BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24523_g1_i4 len=1091 path=[3434:0-106 5057:107-116 3549:117-179
1259:180-181 520:182-183 5235:184-205 1284:206-335 1414:336-339
5270:340-359 4875:360-376 3746:377-405 3774:406-517 3885:518-661
4029:662-719 4087:720-782 4149:783-856 1753:857-908 4274:909-994
4360:995-1090]

Length=1091
                                                                      Score     E

gb|ELR46445.1|  hypothetical protein M91_13311                        81.3    7e-15   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           75.9    4e-13   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    7e-13   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   74.7    9e-13   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  74.7    1e-12   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   74.3    1e-12   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   74.3    1e-12   
ref|XP_010539605.1|  PREDICTED: putative lipid-binding protein AIR1   74.3    1e-12   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  74.3    2e-12   
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           73.9    2e-12   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           73.6    2e-12   
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       73.6    2e-12   
dbj|BAA11854.1|  extensin like protein                                73.6    3e-12   Populus nigra [black poplar]
ref|XP_009053737.1|  hypothetical protein LOTGIDRAFT_147418           74.7    5e-12   
gb|ETY79774.1|  Rod shape-determining protein MreD                    75.5    6e-12   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  72.0    8e-12   Ricinus communis
ref|XP_006369032.1|  HyPRP family protein                             72.0    9e-12   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           72.0    9e-12   
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   72.0    1e-11   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.6    1e-11   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   71.6    1e-11   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           71.6    1e-11   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.6    1e-11   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  71.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422227.1|  PREDICTED: putative lipid-binding protein AIR1B  70.9    2e-11   
ref|XP_010433300.1|  PREDICTED: putative lipid-binding protein AIR1   70.9    2e-11   
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-11   
ref|XP_010422228.1|  PREDICTED: putative lipid-binding protein AIR1   70.9    2e-11   
ref|XP_010433312.1|  PREDICTED: putative lipid-binding protein AIR1   70.9    2e-11   
ref|XP_010433325.1|  PREDICTED: putative lipid-binding protein AIR1B  70.5    2e-11   
gb|ACV74341.1|  proline-rich protein                                  70.9    2e-11   Jatropha curcas
gb|AAD01800.1|  HyPRP                                                 71.2    3e-11   Fragaria x ananassa
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-11   
ref|XP_010088890.1|  hypothetical protein L484_020878                 70.5    3e-11   
ref|XP_010455703.1|  PREDICTED: putative lipid-binding protein AIR1B  70.1    3e-11   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    70.5    3e-11   
ref|XP_006290090.1|  hypothetical protein CARUB_v10003735mg           69.7    4e-11   
ref|XP_010455705.1|  PREDICTED: pEARLI1-like lipid transfer prote...  70.5    4e-11   
gb|AAX20042.1|  proline-rich protein                                  70.1    5e-11   Capsicum annuum
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           69.7    5e-11   
ref|XP_006368194.1|  HyPRP family protein                             70.1    5e-11   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    5e-11   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.9    6e-11   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.7    6e-11   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           68.9    6e-11   
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     69.7    6e-11   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    69.3    7e-11   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    7e-11   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   69.3    7e-11   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    8e-11   
emb|CDY61290.1|  BnaCnng37610D                                        69.3    8e-11   
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    8e-11   
emb|CDY21275.1|  BnaC03g29590D                                        69.3    8e-11   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    9e-11   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           68.9    9e-11   
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    9e-11   
emb|CDY21277.1|  BnaC03g29610D                                        68.6    9e-11   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   68.9    1e-10   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    1e-10   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-10   
ref|XP_010529481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    1e-10   
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           69.3    1e-10   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           68.6    1e-10   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-10   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-10   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    1e-10   
dbj|BAF46299.1|  extensin like protein                                68.2    2e-10   Ipomoea nil [qian niu]
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           67.4    2e-10   
gb|ABG91752.1|  HyPRP2                                                68.2    2e-10   Gossypium hirsutum [American cotton]
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   67.8    2e-10   
emb|CDX79156.1|  BnaA01g12230D                                        67.8    3e-10   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    3e-10   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   67.8    3e-10   
ref|XP_008238565.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    3e-10   
ref|XP_010431835.1|  PREDICTED: putative lipid-binding protein AIR1   67.0    3e-10   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  67.8    3e-10   
ref|XP_010431799.1|  PREDICTED: putative lipid-binding protein AIR1   67.0    3e-10   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  67.4    3e-10   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    4e-10   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-10   
gb|AFK37038.1|  unknown                                               67.0    4e-10   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  67.4    4e-10   Daucus carota [carrots]
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   67.0    5e-10   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  67.0    5e-10   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  67.4    6e-10   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    6e-10   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   67.0    6e-10   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    6e-10   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  67.0    6e-10   Ricinus communis
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           66.6    6e-10   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    7e-10   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    7e-10   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           66.6    7e-10   
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           66.2    7e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           66.6    7e-10   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   66.2    7e-10   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   65.9    7e-10   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           66.6    7e-10   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  66.6    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    7e-10   
ref|XP_010431811.1|  PREDICTED: putative lipid-binding protein AIR1   65.9    8e-10   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   66.2    9e-10   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    9e-10   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    9e-10   
ref|XP_001619595.1|  hypothetical protein NEMVEDRAFT_v1g224033        69.7    1e-09   Nematostella vectensis
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  66.2    1e-09   
ref|XP_010456925.1|  PREDICTED: putative lipid-binding protein AIR1   65.9    1e-09   
emb|CDX95635.1|  BnaC03g25160D                                        66.2    1e-09   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-09   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           66.2    1e-09   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  65.9    1e-09   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   65.9    1e-09   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
gb|ABP35529.1|  proline-rich protein                                  65.9    1e-09   Ipomoea batatas [batate]
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    65.9    1e-09   Vitis vinifera
ref|XP_009133710.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    65.9    1e-09   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...  65.9    1e-09   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...  65.9    1e-09   
emb|CDX94514.1|  BnaC09g23220D                                        66.2    1e-09   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          65.9    2e-09   
ref|XP_001634551.1|  predicted protein                                69.3    2e-09   Nematostella vectensis
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           65.5    2e-09   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           66.2    2e-09   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    65.5    2e-09   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-09   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   65.5    2e-09   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    2e-09   
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-09   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-09   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    2e-09   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  65.1    2e-09   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           65.1    2e-09   
ref|NP_192992.1|  auxin-Induced in Root cultures 1                    64.7    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-09   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              65.1    2e-09   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.1    2e-09   
gb|AEX33654.1|  lipid transfer protein                                65.1    3e-09   
dbj|BAA05471.1|  tumor-related protein                                63.9    3e-09   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           64.7    3e-09   
ref|XP_009049229.1|  hypothetical protein LOTGIDRAFT_112822           68.2    3e-09   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   65.1    3e-09   
ref|NP_001053512.1|  Os04g0554600                                     64.7    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAM63191.1|  putative cell wall-plasma membrane disconnecting ...  64.3    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        64.3    3e-09   Sorghum bicolor [broomcorn]
ref|XP_008772969.1|  PREDICTED: uncharacterized protein LOC102547221  67.4    4e-09   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    4e-09   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    4e-09   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    4e-09   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    4e-09   
ref|XP_009061086.1|  hypothetical protein LOTGIDRAFT_176866           68.2    4e-09   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        64.3    4e-09   Sorghum bicolor [broomcorn]
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              64.3    4e-09   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    4e-09   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   64.7    4e-09   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    4e-09   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    4e-09   
emb|CDY31240.1|  BnaC08g15350D                                        64.3    4e-09   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           64.7    4e-09   
gb|AIX10944.1|  PRP2-like protein                                     64.7    4e-09   
gb|ACE82175.1|  extensin-like protein                                 64.3    4e-09   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        63.9    5e-09   Sorghum bicolor [broomcorn]
gb|AAC62610.1|  similar to the C-terminus of putative plasma memb...  63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    5e-09   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    5e-09   
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           64.3    5e-09   
emb|CAA81526.1|  14 kDa polypeptide                                   64.3    5e-09   Catharanthus roseus [chatas]
emb|CAA59472.1|  hybrid proline-rich protein                          64.3    5e-09   Catharanthus roseus [chatas]
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        63.9    5e-09   Sorghum bicolor [broomcorn]
ref|XP_010424613.1|  PREDICTED: putative lipid-binding protein AIR1   63.5    6e-09   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               64.3    6e-09   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.9    6e-09   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_004246067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           63.9    6e-09   
gb|ABQ88334.1|  lipid transfer protein                                63.9    6e-09   Capsicum annuum
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    7e-09   
gb|KHG02760.1|  14 kDa proline-rich DC2                               63.9    7e-09   
ref|XP_002271792.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.9    7e-09   Vitis vinifera
ref|XP_010433288.1|  PREDICTED: putative lipid-binding protein AIR1   63.2    7e-09   
emb|CDP09932.1|  unnamed protein product                              63.9    7e-09   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    7e-09   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    7e-09   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    8e-09   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    8e-09   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        63.9    8e-09   Capsicum chinense [bonnet pepper]
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    8e-09   
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    8e-09   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    9e-09   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    9e-09   
gb|EAY95110.1|  hypothetical protein OsI_16927                        63.5    9e-09   Oryza sativa Indica Group [Indian rice]
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       65.1    1e-08   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        63.2    1e-08   Sorghum bicolor [broomcorn]
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|NP_001053511.1|  Os04g0554500                                     63.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      63.2    1e-08   Zea mays [maize]
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    1e-08   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-08   
ref|NP_192985.1|  putative lipid transfer protein                     63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-08   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  62.4    2e-08   
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
gb|AFW63295.1|  cortical cell-delineating protein                     62.8    2e-08   
gb|KDP34267.1|  hypothetical protein JCGZ_12836                       62.0    2e-08   
ref|NP_001152585.1|  LOC100286225 precursor                           62.4    2e-08   Zea mays [maize]
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    63.2    2e-08   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           62.8    2e-08   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.8    2e-08   Vitis vinifera
gb|ACU21436.1|  unknown                                               63.2    2e-08   Glycine max [soybeans]
ref|XP_002304421.2|  hypothetical protein POPTR_0003s11070g           62.4    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-08   
gb|ADU20204.1|  hypothetical protein                                  62.4    2e-08   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        62.4    2e-08   Sorghum bicolor [broomcorn]
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
ref|XP_009137260.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.4    2e-08   
ref|XP_011039660.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
ref|XP_004291445.1|  PREDICTED: uncharacterized protein LOC101307558  62.8    2e-08   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       63.9    2e-08   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        62.4    2e-08   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
ref|XP_009787417.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    2e-08   
gb|AFK47547.1|  unknown                                               62.4    2e-08   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.0    2e-08   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.0    3e-08   Vitis vinifera
ref|XP_003572054.1|  PREDICTED: putative lipid-binding protein AIR1   62.4    3e-08   
emb|CDY64848.1|  BnaC05g49400D                                        62.4    3e-08   
gb|EPS71802.1|  hypothetical protein M569_02964                       62.4    3e-08   
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               62.4    3e-08   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    3e-08   
gb|AAM75351.1|AF520576_1  extensin-like protein                       62.8    3e-08   Glycine max [soybeans]
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       62.0    3e-08   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  62.0    3e-08   
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    3e-08   
ref|XP_010093705.1|  hypothetical protein L484_019046                 61.6    3e-08   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        61.6    3e-08   Sorghum bicolor [broomcorn]
gb|AAC49369.1|  proline-rich 14 kDa protein                           61.6    3e-08   Phaseolus vulgaris [French bean]
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           62.0    3e-08   
gb|ADD11814.1|  hybrid proline-rich protein                           61.6    3e-08   Cajanus cajan
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    4e-08   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    4e-08   
emb|CDP05328.1|  unnamed protein product                              61.6    4e-08   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  62.0    4e-08   
ref|XP_009612116.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    4e-08   
emb|CAI48077.1|  extensin-like protein                                61.6    4e-08   Capsicum chinense [bonnet pepper]
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    4e-08   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              62.0    4e-08   
ref|XP_010422218.1|  PREDICTED: lipid transfer protein EARLI 1-like   61.6    4e-08   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    61.2    4e-08   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           62.0    4e-08   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    4e-08   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    5e-08   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    5e-08   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       61.2    5e-08   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    5e-08   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        62.0    5e-08   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    5e-08   
dbj|BAA13150.1|  NT16 polypeptide                                     62.0    5e-08   Nicotiana tabacum [American tobacco]
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    5e-08   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    5e-08   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    5e-08   
gb|AAC60566.1|  proline-rich SAC51                                    61.6    5e-08   Brassica napus [oilseed rape]
ref|XP_004244453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    5e-08   
ref|XP_006357014.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    5e-08   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   61.6    5e-08   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  61.2    5e-08   
ref|XP_010692176.1|  PREDICTED: putative lipid-binding protein At...  61.2    5e-08   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   61.2    6e-08   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      61.2    6e-08   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    6e-08   
dbj|BAA99575.1|  DC2.15 like protein                                  60.8    6e-08   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    6e-08   
gb|KDP25656.1|  hypothetical protein JCGZ_20812                       60.5    6e-08   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    6e-08   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    7e-08   
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    7e-08   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           60.8    7e-08   
ref|NP_001047650.1|  Os02g0662000                                     60.8    7e-08   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   60.5    7e-08   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.8    7e-08   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           60.8    8e-08   
ref|XP_010276748.1|  PREDICTED: pEARLI1-like lipid transfer prote...  61.6    8e-08   
ref|XP_002511666.1|  14 kDa proline-rich protein DC2.15 precursor...  60.5    8e-08   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    8e-08   
ref|XP_010434049.1|  PREDICTED: putative lipid-binding protein AIR1   60.8    8e-08   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    8e-08   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  60.8    8e-08   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           60.8    8e-08   
gb|AFK37174.1|  unknown                                               60.5    8e-08   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      60.5    8e-08   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.8    8e-08   
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    8e-08   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    9e-08   
ref|XP_007155643.1|  hypothetical protein PHAVU_003G219100g           60.5    9e-08   
ref|NP_192986.1|  Bifunctional inhibitor/lipid-transfer protein/s...  61.2    9e-08   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           60.5    9e-08   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           61.2    9e-08   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    9e-08   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        60.8    9e-08   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    9e-08   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  60.5    9e-08   
ref|XP_003608741.1|  Cortical cell-delineating protein                60.5    1e-07   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              60.1    1e-07   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           60.5    1e-07   
ref|XP_004169260.1|  PREDICTED: putative lipid-binding protein At...  61.2    1e-07   
ref|XP_006288783.1|  hypothetical protein CARUB_v10002104mg           60.8    1e-07   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470        60.5    1e-07   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.5    1e-07   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    1e-07   
emb|CDX98748.1|  BnaA03g45330D                                        60.1    1e-07   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    1e-07   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           60.1    1e-07   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.5    1e-07   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   60.1    1e-07   
ref|NP_001237088.1|  uncharacterized protein LOC100527767 precursor   60.1    1e-07   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    1e-07   
ref|XP_006289908.1|  hypothetical protein CARUB_v10003523mg           59.7    1e-07   
ref|XP_010455697.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.5    1e-07   
emb|CDX90834.1|  BnaA03g25140D                                        60.1    1e-07   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  60.1    1e-07   
ref|XP_008437114.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    1e-07   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    60.1    1e-07   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           60.1    1e-07   
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           60.8    1e-07   
emb|CDX94097.1|  BnaC07g37310D                                        60.1    1e-07   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    59.7    1e-07   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    1e-07   
ref|NP_001241194.1|  uncharacterized protein LOC100777903 precursor   60.1    1e-07   
ref|XP_008437113.1|  PREDICTED: pEARLI1-like lipid transfer prote...  60.1    1e-07   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        60.1    1e-07   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    1e-07   
emb|CDP09930.1|  unnamed protein product                              60.1    1e-07   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              60.1    1e-07   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    1e-07   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   60.5    1e-07   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   60.1    1e-07   
gb|KDP28789.1|  hypothetical protein JCGZ_14560                       59.7    1e-07   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    2e-07   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.1    2e-07   
ref|XP_009804889.1|  PREDICTED: putative lipid-binding protein At...  59.7    2e-07   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   59.7    2e-07   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    59.7    2e-07   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        59.7    2e-07   
emb|CDY20047.1|  BnaA09g02040D                                        59.3    2e-07   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   59.7    2e-07   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  60.1    2e-07   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  62.4    2e-07   
ref|NP_192984.1|  azelaic acid induced 1                              60.1    2e-07   
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    2e-07   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    2e-07   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       59.7    2e-07   
ref|XP_004241782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    2e-07   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    59.3    2e-07   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    2e-07   
ref|XP_009111571.1|  PREDICTED: putative lipid-binding protein AIR1B  58.9    2e-07   
ref|XP_002533291.1|  lipid binding protein, putative                  58.9    2e-07   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    2e-07   
emb|CDY31241.1|  BnaC08g15360D                                        59.3    2e-07   
gb|KGN50238.1|  hypothetical protein Csa_5G161870                     59.3    2e-07   
ref|XP_010439335.1|  PREDICTED: putative lipid-binding protein AIR1   59.3    2e-07   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    2e-07   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   59.7    3e-07   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   59.3    3e-07   
ref|XP_001302837.1|  hypothetical protein                             62.0    3e-07   
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    3e-07   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    3e-07   
gb|KGN50240.1|  hypothetical protein Csa_5G161890                     58.9    3e-07   
ref|XP_008796819.1|  PREDICTED: lipid transfer protein EARLI 1-like   58.9    3e-07   
gb|AFK41425.1|  unknown                                               58.9    3e-07   
ref|XP_004291440.1|  PREDICTED: putative lipid-binding protein At...  59.3    3e-07   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 58.9    3e-07   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.1    3e-07   
ref|XP_008756313.1|  PREDICTED: uncharacterized histidine-rich pr...  61.2    3e-07   
ref|XP_009608848.1|  PREDICTED: putative lipid-binding protein At...  58.9    3e-07   
ref|NP_193977.1|  bifunctional inhibitor/lipid-transfer protein/s...  58.9    3e-07   
ref|XP_010088891.1|  hypothetical protein L484_020879                 58.9    3e-07   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           58.9    3e-07   
ref|XP_010093706.1|  hypothetical protein L484_019047                 58.9    4e-07   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           59.7    4e-07   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       58.9    4e-07   
ref|XP_003609035.1|  Proline-rich protein                             58.5    4e-07   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           58.9    4e-07   
ref|XP_010676152.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    4e-07   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           59.7    4e-07   
ref|XP_003611288.1|  Proline-rich protein                             59.3    4e-07   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    4e-07   
ref|XP_010456905.1|  PREDICTED: putative lipid-binding protein AIR1   58.2    4e-07   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    4e-07   
ref|XP_004165755.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    4e-07   
gb|ACN26094.1|  unknown                                               58.5    4e-07   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    58.5    4e-07   
gb|AES59035.2|  Lipid transfer protein                                58.9    4e-07   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        58.9    4e-07   
gb|AAK30571.1|AF346659_1  extensin-like protein                       58.5    4e-07   
ref|NP_001151721.1|  LOC100285357 precursor                           58.5    4e-07   
gb|ACN54400.1|  hybrid proline-rich protein                           58.5    4e-07   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    5e-07   
ref|XP_004291443.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    5e-07   
emb|CBI31906.3|  unnamed protein product                              58.2    5e-07   
ref|NP_680546.1|  bifunctional inhibitor/lipid-transfer protein/s...  58.2    5e-07   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    5e-07   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  58.2    5e-07   
ref|XP_007155638.1|  hypothetical protein PHAVU_003G218700g           58.9    5e-07   
emb|CDY32208.1|  BnaA03g54590D                                        58.5    5e-07   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    5e-07   
ref|XP_009801239.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    5e-07   
emb|CDY08680.1|  BnaC04g19890D                                        58.2    5e-07   
ref|XP_008448871.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_004165505.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa proli...  58.2    6e-07   
ref|XP_009607067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  58.9    6e-07   
emb|CDX82944.1|  BnaC01g13940D                                        58.2    6e-07   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  58.9    6e-07   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  58.2    6e-07   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  58.2    6e-07   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   58.5    6e-07   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  58.5    6e-07   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_004291441.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    6e-07   
ref|NP_001141168.1|  cortical cell-delineating protein precursor      58.2    6e-07   
ref|XP_008232587.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    6e-07   
ref|XP_004151036.1|  PREDICTED: uncharacterized protein LOC101220...  59.3    6e-07   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    6e-07   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    7e-07   
ref|NP_001152193.1|  cortical cell-delineating protein precursor      58.2    7e-07   
gb|KFK31980.1|  hypothetical protein AALP_AA6G184800                  58.5    7e-07   
ref|XP_006284763.1|  hypothetical protein CARUB_v10006030mg           57.8    7e-07   
gb|ACG24719.1|  cortical cell-delineating protein precursor           58.2    7e-07   
ref|XP_010261664.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    7e-07   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    7e-07   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           57.8    7e-07   
ref|XP_010533776.1|  PREDICTED: lipid transfer protein EARLI 1        57.8    7e-07   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   57.8    8e-07   
ref|XP_004151035.1|  PREDICTED: uncharacterized protein LOC101220...  59.3    8e-07   
gb|KFK30593.1|  hypothetical protein AALP_AA6G001800                  57.8    8e-07   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   58.5    8e-07   
ref|XP_003611290.1|  Proline-rich protein                             58.2    8e-07   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        57.8    8e-07   
ref|XP_006353678.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    8e-07   
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  57.8    9e-07   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    9e-07   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    9e-07   
emb|CDY20048.1|  BnaA09g02030D                                        57.4    9e-07   
ref|XP_010099842.1|  hypothetical protein L484_008499                 57.4    9e-07   
ref|XP_008658410.1|  PREDICTED: ctenidin-1-like                       58.9    1e-06   
ref|XP_007137003.1|  hypothetical protein PHAVU_009G092000g           57.8    1e-06   
ref|XP_004150818.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.4    1e-06   
ref|XP_006289892.1|  hypothetical protein CARUB_v10003507mg           57.8    1e-06   
ref|XP_006290213.1|  hypothetical protein CARUB_v10003904mg           57.0    1e-06   
ref|XP_006396214.1|  hypothetical protein EUTSA_v10029074mg           57.4    1e-06   
gb|ACG33201.1|  cortical cell-delineating protein precursor           57.8    1e-06   
gb|EMS53002.1|  14 kDa proline-rich protein DC2.15                    57.4    1e-06   
gb|ACG32786.1|  cortical cell-delineating protein precursor           57.4    1e-06   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           57.4    1e-06   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  58.5    1e-06   
ref|XP_006413654.1|  hypothetical protein EUTSA_v10027584mg           57.0    1e-06   
gb|KFK31986.1|  hypothetical protein AALP_AA6G185300                  57.0    1e-06   
ref|XP_007155637.1|  hypothetical protein PHAVU_003G218600g           57.4    1e-06   
ref|XP_006289150.1|  hypothetical protein CARUB_v10002588mg           57.8    1e-06   
ref|XP_010696470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.0    1e-06   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           57.4    1e-06   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.4    1e-06   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.0    1e-06   
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.0    1e-06   
gb|AFK47889.1|  unknown                                               56.6    2e-06   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.0    2e-06   
gb|KGN55880.1|  hypothetical protein Csa_3G026160                     59.3    2e-06   
ref|XP_003525814.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    2e-06   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    2e-06   
ref|XP_002602546.1|  hypothetical protein BRAFLDRAFT_159054           57.8    2e-06   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    2e-06   
ref|XP_010041938.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    2e-06   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               56.6    2e-06   
ref|XP_006662037.1|  PREDICTED: cortical cell-delineating protein...  56.6    2e-06   
ref|NP_172673.1|  extensin-like protein                               56.6    2e-06   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    2e-06   
ref|XP_002892674.1|  hypothetical protein ARALYDRAFT_471359           56.6    2e-06   
emb|CDP19512.1|  unnamed protein product                              56.6    2e-06   
gb|KHN04347.1|  14 kDa proline-rich protein DC2.15                    56.6    2e-06   
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    2e-06   



>gb|ELR46445.1| hypothetical protein M91_13311, partial [Bos mutus]
Length=158

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 77/148 (52%), Gaps = 4/148 (3%)
 Frame = +2

Query  167  ANPLSHLQAMVNPRSHLREMVNPPFHRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAM  346
            A   +HL++     +HLR       H ++ AK  +HL     + +HL++     +HLR+ 
Sbjct  7    AKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSC  66

Query  347  ANLPSHLQKVTNLPSHLRAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVI  526
            A + +HL+    + +HLR+ A   +HLR+ + +  HL++   +  HLR+ A   +HL+  
Sbjct  67   AKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSC  126

Query  527  A----HLQAVTHLRFHLQALANPLCHLK  598
            A    HL++   +  HL++ A    HL+
Sbjct  127  AKVGTHLRSCAKVGTHLRSCAKVGTHLR  154


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 75/153 (49%), Gaps = 1/153 (1%)
 Frame = +2

Query  71   VANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPFHRQ  250
             A    HL+  + + +HL      +  H    A   +HL++     +HLR       H +
Sbjct  6    CAKVGTHLRSCAKVGTHLRSC-AKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLR  64

Query  251  ATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPSHLR  430
            + AK  +HL     + +HL++     +HLR+ A + +HL+    + +HLR+ A   +HLR
Sbjct  65   SCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLR  124

Query  431  AISNLLFHLQAIVNLPCHLRAIANPPSHLQVIA  529
            + + +  HL++   +  HLR+ A   +HL+  A
Sbjct  125  SCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCA  157


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = +2

Query  245  RQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPSH  424
            ++  AK  +HL     + +HL++     +HLR+ A + +HL+    + +HLR+ A   +H
Sbjct  3    KKRCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTH  62

Query  425  LRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIA----HLQAVTHLRFHLQALANPLCH  592
            LR+ + +  HL++   +  HLR+ A   +HL+  A    HL++   +  HL++ A    H
Sbjct  63   LRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTH  122

Query  593  LKVMLAV  613
            L+    V
Sbjct  123  LRSCAKV  129


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (52%), Gaps = 4/99 (4%)
 Frame = +2

Query  329  SHLRAMANLPSHLQKVTNLPSHLRAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPP  508
            S  +  A + +HL+    + +HLR+ A   +HLR+ + +  HL++   +  HLR+ A   
Sbjct  1    SEKKRCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKVG  60

Query  509  SHLQVIA----HLQAVTHLRFHLQALANPLCHLKVMLAV  613
            +HL+  A    HL++   +  HL++ A    HL+    V
Sbjct  61   THLRSCAKVGTHLRSCAKVGTHLRSCAKVGTHLRSCAKV  99



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 63/93 (68%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CP+D L+LGVCA  +K    +L+I+   P ++PCC+ ++GL + + A CLCTA
Sbjct  45   SHSSTGSCPKDTLKLGVCANVLK---DLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GFKC
Sbjct  102  IKANVLGINLNVPVSLSLLLNVCGKKVPSGFKC  134



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CP+D L+LGVCA     +GS+L +    P ++PCC+ ++GL + + A CLCTA K  
Sbjct  46   GGKCPKDALKLGVCA---GLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKAN  102

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG++ PKGF+C
Sbjct  103  ILGINLNIPVSLSLLLNVCGKKVPKGFQC  131



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K +   L+I+   P ++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSTGSCPRDTLKLGVCANVLKDL---LKIELGTPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GF C
Sbjct  102  LKANVLGINLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K +   L+I+   P ++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSTGSCPRDTLKLGVCANVLKDL---LKIELGTPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GF C
Sbjct  102  LKANVLGINLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K +   L+I+   P ++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSTGSCPRDTLKLGVCANVLKDL---LKIELGTPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GF C
Sbjct  102  LKANVLGINLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K +   L+I+   P ++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSTGSCPRDTLKLGVCANVLKDL---LKIELGTPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GF C
Sbjct  102  LKANVLGINLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010539605.1| PREDICTED: putative lipid-binding protein AIR1 [Tarenaya hassleriana]
Length=140

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +1

Query  610  SGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQ  789
            S G   T+P+N + G+CPRD L+LG+C  A+  +   L    S P++PCC+ ++GL + +
Sbjct  42   SPGSTPTNPTNPSTGSCPRDALKLGICVDALNLLNVTL---GSPPVQPCCSLIQGLVDLE  98

Query  790  TATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             A CLCT  +  +  IN N  + +  LL +C R+AP+GF+C
Sbjct  99   AALCLCTVLRASILGINVNLPINLSLLLNVCSRQAPRGFQC  139



>ref|XP_010422223.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X2 [Camelina 
sativa]
Length=135

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K +   L+I+   P ++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSTGSCPRDTLKLGVCANVLKDL---LKIELGTPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GF C
Sbjct  102  LKANVLGINLNVPISLSLLLNVCGKKFPSGFVC  134



>ref|XP_006289270.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
 gb|EOA22168.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
Length=131

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = +1

Query  607  SSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNS  786
            SS  +P  +PS     TCP+D L+LGVC  A+  +   L    + P++PCC+ + GL + 
Sbjct  32   SSYNKPKPTPSAPAIETCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDL  88

Query  787  QTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            + A CLCTA K  +  IN N  + +  LL +C R+AP+GF+C
Sbjct  89   EAAVCLCTAIKASILGININLPINLSLLLNVCSRKAPRGFQC  130



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 62/93 (67%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CP+D L+LGVCA  +K    +L+I+   P ++PCC+ ++GL + + A CLCTA
Sbjct  45   SHSSTGSCPKDTLKLGVCANVLK---DLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  +++  LL +CG++ P GF C
Sbjct  102  IKANVLGINLNVPISLSLLLNVCGKKVPSGFVC  134



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQID-HSIPIRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CPRD L+LGVCA   K +GS+L I     P++PCC+ L GL + + A CLCTA K  
Sbjct  52   GGKCPRDALKLGVCA---KVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKAN  108

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  L++  LL +C ++ P  F+C
Sbjct  109  ILGINLNVPLSLSLLLNVCSKKVPSDFQC  137



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CP+D L+LGVCA     +GS+L +    P ++PCC+ ++GL + + A CLCTA K  
Sbjct  55   GGKCPKDALKLGVCA---DLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKAN  111

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  L++  LL +CG++ PK F+C
Sbjct  112  ILGINLNIPLSLSLLLNVCGKKVPKDFQC  140



>ref|XP_009053737.1| hypothetical protein LOTGIDRAFT_147418 [Lottia gigantea]
 gb|ESO95574.1| hypothetical protein LOTGIDRAFT_147418 [Lottia gigantea]
Length=240

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/142 (18%), Positives = 74/142 (52%), Gaps = 4/142 (3%)
 Frame = -2

Query  595  EVTKGVGQCLEMEPEVSHCLEVGY----YLEVGRGVGYCPEVAREVDYCLEVEQEVGYCP  428
             +   +  C+ ++ ++ HC+ +GY    ++ +G  + +C  +  ++ +C+ +  ++ +C 
Sbjct  17   SIDYKIFHCVSIDYKIFHCVSIGYKIFHWVSIGYKIFHCVSIGYKIFHCVSIGYKIFHCV  76

Query  427  EVGRGIGHCPEVGREVGYFLEVGWEVGHCPEVG*GVGHCLEVGQEVDHYWEVGRGFGRCL  248
             +   I HC  +G ++ + + +G+++ H   +G  + HC+ +G ++ H   +G     C+
Sbjct  77   SIDYNIFHCVSIGYKIFHCVSIGYKIFHRVSIGYKIFHCVSIGYKIFHCVLIGYKIFHCV  136

Query  247  AVERGVDHFPEVGPGVDHCLEV  182
            ++   + H   +G  + HC+ +
Sbjct  137  SIGYKIFHRVSIGYKIFHCVSI  158


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/133 (18%), Positives = 67/133 (50%), Gaps = 6/133 (5%)
 Frame = -2

Query  580  VGQCLEMEPEVSHCLEVGYYLEVGRGVGYCPEVAREVDYCLEVEQEVGYCPEVGRGIGHC  401
            +  C+ ++ ++ HC+ + Y       + +C  +  ++ + + +  ++ +C  +G  I HC
Sbjct  12   IFHCVSIDYKIFHCVSIDY------KIFHCVSIGYKIFHWVSIGYKIFHCVSIGYKIFHC  65

Query  400  PEVGREVGYFLEVGWEVGHCPEVG*GVGHCLEVGQEVDHYWEVGRGFGRCLAVERGVDHF  221
              +G ++ + + + + + HC  +G  + HC+ +G ++ H   +G     C+++   + H 
Sbjct  66   VSIGYKIFHCVSIDYNIFHCVSIGYKIFHCVSIGYKIFHRVSIGYKIFHCVSIGYKIFHC  125

Query  220  PEVGPGVDHCLEV  182
              +G  + HC+ +
Sbjct  126  VLIGYKIFHCVSI  138


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/177 (16%), Positives = 81/177 (46%), Gaps = 25/177 (14%)
 Frame = -2

Query  595  EVTKGVGQCLEMEPEVSHCLEVGYYL----EVGRGVGYCPEVAREVDYCLEVEQEVGYCP  428
             +   +  C+ +  ++ HC+ +GY +     +G  + +C  +  ++ +C+ +  ++ +C 
Sbjct  77   SIDYNIFHCVSIGYKIFHCVSIGYKIFHRVSIGYKIFHCVSIGYKIFHCVLIGYKIFHCV  136

Query  427  EVGRGIGHCPEVGREVGYFLEVGWEVGHCPEVG*GVGHCLEVGQEVDHYWEVGRGFGRCL  248
             +G  I H   +G ++ + + + +++ HC  +   + HC+ +G ++ H          C+
Sbjct  137  SIGYKIFHRVSIGYKIFHCVSIDYKIFHCVSIDYNIFHCVSIGYKIFH----------CV  186

Query  247  AVERGVDHFPEVGPGVDHCLEVR*GVGRYYLVAEQVVAHYQEVGSEAGHYLEVGQGI  77
            +++  + H   +G  + HC+ +           +  + H   +G +  H + +G  I
Sbjct  187  SIDYNIFHCVSIGYKIFHCVSI-----------DYKIFHCVSIGYKIFHRVSIGYKI  232


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/117 (19%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = -2

Query  580  VGQCLEMEPEVSHCLEVGYYL----EVGRGVGYCPEVAREVDYCLEVEQEVGYCPEVGRG  413
            +  C+ +  ++ HC+ +GY +     +G  + +C  +  ++ +C+ ++  + +C  +G  
Sbjct  122  IFHCVLIGYKIFHCVSIGYKIFHRVSIGYKIFHCVSIDYKIFHCVSIDYNIFHCVSIGYK  181

Query  412  IGHCPEVGREVGYFLEVGWEVGHCPEVG*GVGHCLEVGQEVDHYWEVGRGFGRCLAV  242
            I HC  +   + + + +G+++ HC  +   + HC+ +G ++ H   +G     C+++
Sbjct  182  IFHCVSIDYNIFHCVSIGYKIFHCVSIDYKIFHCVSIGYKIFHRVSIGYKIFHCVSI  238


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/146 (18%), Positives = 72/146 (49%), Gaps = 1/146 (1%)
 Frame = -2

Query  514  VGRGVGYCPEVAREVDYCLEVEQEVGYCPEVGRGIGHCPEVGREVGYFLEVGWEVGHCPE  335
            +G  + +C  +  ++ +C+ ++ ++ +C  +G  I H   +G ++ + + +G+++ HC  
Sbjct  8    IGYKIFHCVSIDYKIFHCVSIDYKIFHCVSIGYKIFHWVSIGYKIFHCVSIGYKIFHCVS  67

Query  334  VG*GVGHCLEVGQEVDHYWEVGRGFGRCLAVERGVDHFPEVGPGVDHCLEVR*GVGRYYL  155
            +G  + HC+ +   + H   +G     C+++   + H   +G  + HC+ +   +    L
Sbjct  68   IGYKIFHCVSIDYNIFHCVSIGYKIFHCVSIGYKIFHRVSIGYKIFHCVSIGYKIFHCVL  127

Query  154  VAEQVVAHYQEVGSEAGHYLEVGQGI  77
            +  + + H   +G +  H + +G  I
Sbjct  128  IGYK-IFHCVSIGYKIFHRVSIGYKI  152



>gb|ETY79774.1| Rod shape-determining protein MreD [Burkholderia caribensis MBA4]
Length=314

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 61/183 (33%), Gaps = 5/183 (3%)
 Frame = -3

Query  603  ITLR*QRGLANAWRWNRR*VTAWRW----AITWRWDGGLAIARRWHGRLTIAWRWNRRLD  436
              LR     A A RW+ R     RW    A   RW    A A RWH R     RW+ R  
Sbjct  113  FGLRWHPRFAFALRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  172

Query  435  IARRWDGGLATARRWDGRLVTFWRWDGRLAIARRWDRGLVIAWRWDRRLTTIGRWDGGLA  256
             A RW    A   RW  R     RW  R A   RW      A RW  R     RW    A
Sbjct  173  FALRWHPRFAFGLRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  232

Query  255  VAWRWNGGLTISRRWDRGLTIAWR*DRGLAVITWWRNRLSPIIRRWDRRLDTIWRWGKGL  76
             A RW+       RW      A R     A    W  R +    RW  R     RW    
Sbjct  233  FALRWHPRFAFGLRWHPRFAFALRWHPRFAFALRWHPRFA-FALRWHPRFAFALRWHPRF  291

Query  75   ATT  67
            A  
Sbjct  292  AFV  294


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 60/182 (33%), Gaps = 5/182 (3%)
 Frame = -3

Query  603  ITLR*QRGLANAWRWNRR*VTAWRW----AITWRWDGGLAIARRWHGRLTIAWRWNRRLD  436
               R     A A RW+ R     RW    A   RW    A   RWH R   A RW+ R  
Sbjct  3    CFFRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFA  62

Query  435  IARRWDGGLATARRWDGRLVTFWRWDGRLAIARRWDRGLVIAWRWDRRLTTIGRWDGGLA  256
             A RW    A A RW  R     RW  R A   RW      A RW  R     RW    A
Sbjct  63   FALRWHPRFAFALRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  122

Query  255  VAWRWNGGLTISRRWDRGLTIAWR*DRGLAVITWWRNRLSPIIRRWDRRLDTIWRWGKGL  76
             A RW+       RW        R     A    W  R +    RW  R     RW    
Sbjct  123  FALRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFA-FGLRWHPRFAFALRWHPRF  181

Query  75   AT  70
            A 
Sbjct  182  AF  183


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 61/183 (33%), Gaps = 5/183 (3%)
 Frame = -3

Query  603  ITLR*QRGLANAWRWNRR*VTAWRW----AITWRWDGGLAIARRWHGRLTIAWRWNRRLD  436
              LR     A   RW+ R   A RW    A   RW    A A RWH R     RW+ R  
Sbjct  33   FALRWHPRFAFGLRWHPRFAFALRWHPRFAFALRWHPRFAFALRWHPRFAFGLRWHPRFA  92

Query  435  IARRWDGGLATARRWDGRLVTFWRWDGRLAIARRWDRGLVIAWRWDRRLTTIGRWDGGLA  256
               RW    A A RW  R     RW  R A A RW        RW  R     RW    A
Sbjct  93   FGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFGLRWHPRFA  152

Query  255  VAWRWNGGLTISRRWDRGLTIAWR*DRGLAVITWWRNRLSPIIRRWDRRLDTIWRWGKGL  76
             A RW+       RW      A R     A    W  R +    RW  R     RW    
Sbjct  153  FALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA-FGLRWHPRFAFGLRWHPRF  211

Query  75   ATT  67
            A  
Sbjct  212  AFA  214


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 59/182 (32%), Gaps = 5/182 (3%)
 Frame = -3

Query  603  ITLR*QRGLANAWRWNRR*VTAWRW----AITWRWDGGLAIARRWHGRLTIAWRWNRRLD  436
              LR     A A RW+ R     RW    A   RW    A A RWH R     RW+ R  
Sbjct  63   FALRWHPRFAFALRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  122

Query  435  IARRWDGGLATARRWDGRLVTFWRWDGRLAIARRWDRGLVIAWRWDRRLTTIGRWDGGLA  256
             A RW    A   RW  R     RW  R A A RW        RW  R     RW    A
Sbjct  123  FALRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFA  182

Query  255  VAWRWNGGLTISRRWDRGLTIAWR*DRGLAVITWWRNRLSPIIRRWDRRLDTIWRWGKGL  76
               RW+       RW        R     A    W  R +    RW  R     RW    
Sbjct  183  FGLRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFA-FGLRWHPRFAFALRWHPRF  241

Query  75   AT  70
            A 
Sbjct  242  AF  243


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 58/164 (35%), Gaps = 4/164 (2%)
 Frame = -3

Query  603  ITLR*QRGLANAWRWNRR*VTAWRW----AITWRWDGGLAIARRWHGRLTIAWRWNRRLD  436
              LR     A   RW+ R   A RW    A   RW    A A RWH R     RW+ R  
Sbjct  133  FGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  192

Query  435  IARRWDGGLATARRWDGRLVTFWRWDGRLAIARRWDRGLVIAWRWDRRLTTIGRWDGGLA  256
               RW    A   RW  R     RW  R A   RW      A RW  R     RW    A
Sbjct  193  FGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  252

Query  255  VAWRWNGGLTISRRWDRGLTIAWR*DRGLAVITWWRNRLSPIIR  124
             A RW+     + RW      A R     A    W  R + +++
Sbjct  253  FALRWHPRFAFALRWHPRFAFALRWHPRFAFALRWHPRFAFVLQ  296


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 60/183 (33%), Gaps = 5/183 (3%)
 Frame = -3

Query  603  ITLR*QRGLANAWRWNRR*VTAWRW----AITWRWDGGLAIARRWHGRLTIAWRWNRRLD  436
              LR     A   RW+ R   A RW    A   RW    A A RWH R     RW+ R  
Sbjct  83   FGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  142

Query  435  IARRWDGGLATARRWDGRLVTFWRWDGRLAIARRWDRGLVIAWRWDRRLTTIGRWDGGLA  256
               RW    A A RW  R     RW  R A A RW        RW  R     RW    A
Sbjct  143  FGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFGLRWHPRFA  202

Query  255  VAWRWNGGLTISRRWDRGLTIAWR*DRGLAVITWWRNRLSPIIRRWDRRLDTIWRWGKGL  76
               RW+     + RW        R     A    W  R +    RW  R     RW    
Sbjct  203  FGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFA-FGLRWHPRFAFALRWHPRF  261

Query  75   ATT  67
            A  
Sbjct  262  AFA  264


 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 51/153 (33%), Gaps = 1/153 (1%)
 Frame = -3

Query  525  ITWRWDGGLAIARRWHGRLTIAWRWNRRLDIARRWDGGLATARRWDGRLVTFWRWDGRLA  346
              +RW    A A RWH R     RW+ R   A RW    A   RW  R     RW  R A
Sbjct  3    CFFRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFAFALRWHPRFA  62

Query  345  IARRWDRGLVIAWRWDRRLTTIGRWDGGLAVAWRWNGGLTISRRWDRGLTIAWR*DRGLA  166
             A RW      A RW  R     RW    A   RW+     + RW        R     A
Sbjct  63   FALRWHPRFAFALRWHPRFAFGLRWHPRFAFGLRWHPRFAFALRWHPRFAFGLRWHPRFA  122

Query  165  VITWWRNRLSPIIRRWDRRLDTIWRWGKGLATT  67
                W  R +    RW  R     RW    A  
Sbjct  123  FALRWHPRFA-FGLRWHPRFAFGLRWHPRFAFA  154



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CPRD L+LGVCA     +GS+L ++   P + PCC+ ++GL + + A CLCTA K  +
Sbjct  48   GKCPRDALKLGVCA---NVLGSLLNLNIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANI  104

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +CG++ P GF+C
Sbjct  105  LGINLNIPLSLSLLLNVCGKKTPSGFQC  132



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CP+D L+LGVCA     +GS+L +    P + PCC+ ++GL + + A CLCTA K  
Sbjct  46   GGKCPKDALKLGVCA---DLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKAN  102

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG++ PK F+C
Sbjct  103  ILGINLNIPVSLSLLLNVCGKKVPKDFQC  131



>ref|XP_006289684.1| hypothetical protein CARUB_v10003241mg [Capsella rubella]
 ref|XP_006289723.1| hypothetical protein CARUB_v10003290mg [Capsella rubella]
 gb|EOA22582.1| hypothetical protein CARUB_v10003241mg [Capsella rubella]
 gb|EOA22621.1| hypothetical protein CARUB_v10003290mg [Capsella rubella]
Length=140

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCPRD L+LGVCA  +K +   L++ +  P++PCC+ ++GL + + A CLCTA K+ + 
Sbjct  56   GTCPRDALQLGVCANVLKLVD--LKLGNP-PVKPCCSLIQGLADLEAAVCLCTALKVNIL  112

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +C R+APK F+C
Sbjct  113  GINLNLPIDLSVLLNVCSRKAPKNFQC  139



>ref|XP_010448889.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +1

Query  592  PQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLR  771
            P+        P T+P++   GTCP+D L+LGVC  A+  +  +     + P+ PCC+ ++
Sbjct  33   PRKHNKHKPSPPTAPTST--GTCPKDALKLGVCVNALNLLNDVTL--GTPPVTPCCSLIQ  88

Query  772  GLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            GL + + A CLCTA K  V  IN N  + +  LL +C R+AP+GF+C
Sbjct  89   GLVDLEAAVCLCTALKASVLGINLNLPINLSLLLNVCSRKAPRGFQC  135



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K    +L+I+   P ++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSTGSCPRDTLKLGVCANLLK---DLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  I  N  +++  LL +CGR+ P GF C
Sbjct  102  LKANVIGIKLNVPVSLSLLLNVCGRKVPSGFVC  134



>ref|XP_010422226.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 62/103 (60%), Gaps = 5/103 (5%)
 Frame = +1

Query  607  SSGGQPSTSPSNNNG-GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTN  783
            SS  +P  +PS+     TCP+D L+LGVC  A+  +   L    + P++PCC+ + GL +
Sbjct  31   SSSNKPKPTPSSAPAIETCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVD  87

Query  784  SQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + A CLCTA K  +  IN N  + +  LL +C R+AP+GF+C
Sbjct  88   LEAAVCLCTALKASILGININLPINLSLLLNVCSRKAPRGFQC  130



>ref|XP_002867769.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44028.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
Length=133

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +1

Query  619  QPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTAT  798
            +PS +P++   GTCP+D L+LGVC  A+  +  +     + P+ PCC+ ++GL + + A 
Sbjct  40   KPSPTPTS---GTCPKDALKLGVCVNALNLLNDVTL--GTPPVTPCCSLIKGLVDLEAAV  94

Query  799  CLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CLCTA K  V  IN N  + +  LL +C R+AP GF+C
Sbjct  95   CLCTALKASVLGINLNLPIDLSLLLNVCSRKAPHGFQC  132



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSI-PIRPCCNCLRGLTNSQTATCLCTA  813
            S+++ G+CPRD L+LGVCA  +K    +L+I+    P++PCC+ L GL + + A CLCTA
Sbjct  45   SHSSSGSCPRDTLKLGVCANVLK---DLLKIELGKPPVKPCCSLLNGLVDLEAAACLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  I  N  +++  LL +CG++ P GF C
Sbjct  102  LKANVLGIKLNVPVSLSLLLNVCGKKVPSGFVC  134



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G+CP+D L+LGVCA  +K    +L+I    P ++PCC+ L GL + + A CLCTA K  V
Sbjct  44   GSCPKDTLKLGVCANVLK---DLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKV  100

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +CG++ P GF C
Sbjct  101  LGINLNVPVSLSLLLNVCGKKVPSGFVC  128



>ref|XP_010422227.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TS +  + G+CP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLC
Sbjct  21   TSATTPSTGSCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAACLC  77

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            T  K+ +  IN N  + +  LL +CGR+AP  F+C
Sbjct  78   TLLKVNILGINLNLPINLSVLLNVCGRKAPTNFQC  112



>ref|XP_010433300.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=113

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  29   GSCPRDSLQLGVCANVLKLVDLTLG---NPPVKPCCSLIQGLADLEAAVCLCTLLKVNIL  85

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  F C
Sbjct  86   EININLPIDLSVLLNICGRKAPTNFHC  112



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +1

Query  610  SGGQPST--SPSNNNG-GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGL  777
            S G PST  +PS  +G  TCPRD L+LG+CA     + ++L +    P ++PCC  ++GL
Sbjct  64   SPGTPSTPGTPSTPSGTATCPRDALKLGICA---NVLNNLLNVTIGTPPVQPCCTLIQGL  120

Query  778  TNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + + A CLCTA +  +  IN N  +A+  LL  CG + P+GF+C
Sbjct  121  ADLEAAVCLCTAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  165



>ref|XP_010422228.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
 ref|XP_010422229.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCPRD L+LGVCA  +K +   L    + P++PCC  ++GL + + A CLCT  K+ + 
Sbjct  47   GTCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCTLIQGLADLEAAVCLCTLLKVNIL  103

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  F+C
Sbjct  104  GINLNLPIDLSVLLNVCGRKAPTNFQC  130



>ref|XP_010433312.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCPRD L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  47   GTCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTLLKVNIL  103

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  F+C
Sbjct  104  GININLPIDLSILLNVCGRKAPTNFQC  130



>ref|XP_010433325.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TS +  + G+CP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLC
Sbjct  21   TSATTPSTGSCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAACLC  77

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            T  K+ +  IN N  + +  LL +CGR+AP  F+C
Sbjct  78   TLLKVNILGININLPVNLSVLLNVCGRKAPTNFQC  112



>gb|ACV74341.1| proline-rich protein [Jatropha curcas]
Length=138

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQID-HSIPIRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CPRD L+LGVCA   K +GS+L I     P++PCC+ L GL + + A CLCTA K  
Sbjct  52   GGKCPRDALKLGVCA---KVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKAN  108

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  I  N  L++  LL +C ++ P  F+C
Sbjct  109  ILGITLNVPLSLSLLLNVCSKKVPFDFQC  137



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +1

Query  610  SGGQPST--SPSNNNG-GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGL  777
            S G PST  +PS  +G  TCPRD L+LG+CA     + ++L +    P ++PCC  ++GL
Sbjct  54   SPGTPSTPGTPSTPSGTATCPRDALKLGICA---NVLNNLLNVTIGTPPVQPCCTLIQGL  110

Query  778  TNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + + A CLCTA +  +  IN N  +A+  LL  CG + P+GF+C
Sbjct  111  ADLEAAVCLCTAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  155



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP+D L+LGVCA     +GS+L +   + P++PCC+ ++GL + ++A CLCTA K  +
Sbjct  52   GKCPKDALKLGVCA---DLLGSLLNVTVGNPPVKPCCSVIQGLLDLESAVCLCTAIKANI  108

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +CG++ PK F+C
Sbjct  109  LGINLNIPLSLSLLLNVCGKKVPKDFQC  136



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCP+D L+ GVCA  +  +  +  I  + P+ PCC+ L+GL + + A CLCTA K  V 
Sbjct  50   ATCPKDTLKFGVCADLLNGLEHV--IVGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVL  107

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL  CG++APKGF+C
Sbjct  108  GINLNIPVSLSLLLNYCGKKAPKGFQC  134



>ref|XP_010455703.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TS +  + G+CP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLC
Sbjct  21   TSATTPSTGSCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAACLC  77

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            T  K+ +  IN N  + +  LL +CGR+AP  F+C
Sbjct  78   TLLKVNLLGINLNLPINLSVLLNVCGRKAPTNFQC  112



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQID-HSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP+D L+LGVCA     +GS+L +   S P++PCC+ ++GL + + A CLCTA K  +
Sbjct  55   GRCPKDALKLGVCA---DLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANI  111

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  L+ +CG++ PK F+C
Sbjct  112  LGINLNIPLSLSLLVNVCGKKVPKDFQC  139



>ref|XP_006290090.1| hypothetical protein CARUB_v10003735mg [Capsella rubella]
 gb|EOA22988.1| hypothetical protein CARUB_v10003735mg [Capsella rubella]
Length=113

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TS +  +  TCPRD L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLC
Sbjct  21   TSAATPSRQTCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLC  77

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            T  K+ +  IN N  + +  LL +C R+APK F+C
Sbjct  78   TMLKVNLLGINLNLPIDLSVLLNVCSRKAPKNFQC  112



>ref|XP_010455705.1| PREDICTED: pEARLI1-like lipid transfer protein 3 [Camelina sativa]
Length=161

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  77   GACPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAVCLCTLLKVNIL  133

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  FKC
Sbjct  134  GINLNLPIDLSVLLNVCGRKAPTNFKC  160



>gb|AAX20042.1| proline-rich protein [Capsicum annuum]
Length=136

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P+ PCC+ L GL N++ A CLCTA K  +  
Sbjct  53   TCPIDTLKLGVCA---DVLGLVNAVIGSPPVTPCCSLLSGLANAEAALCLCTAIKANILG  109

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL +C + AP GF+C
Sbjct  110  INLNVPVSLSLLLNVCSKEAPAGFQC  135



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            +CPRD L+LGVCA  +K    +L+ID   P ++PCC+ L+GL + + A CLCTA K  V 
Sbjct  51   SCPRDTLKLGVCANVLK---DLLKIDVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVL  107

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             I  N  +++  LL +CGR+ P GF C
Sbjct  108  GIKLNVPISLSLLLNVCGRKTPSGFIC  134



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQID-HSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP+D L+LGVCA     +GS+L +   S P++PCC+ ++GL + + A CLCTA K  +
Sbjct  55   GKCPKDALKLGVCA---DLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANI  111

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  L+ +CG++ PK F+C
Sbjct  112  LGINLNIPISLSLLINVCGKKVPKDFQC  139



>ref|XP_004165754.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50241.1| HyPRP2 [Cucumis sativus]
Length=140

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CPRD L+LGVCA   K +G +L I    P + PCC+ + GL + + A CLCTA K  +
Sbjct  56   GKCPRDTLKLGVCA---KLLGGLLDITIGKPPVTPCCSLIEGLADLEAAVCLCTAIKADI  112

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +C +  PKGF+C
Sbjct  113  LGINLNVPLSLSLLLNVCQKNVPKGFQC  140



>ref|XP_009598876.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Nicotiana 
tomentosiformis]
Length=93

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQID-HSIPIRPCCNCLRGLTNSQTATCLCTA  813
            S N  G CP++ L+LGVCA     +G++L +   +IP +PCC  ++GL + + A CLCTA
Sbjct  3    SPNYKGKCPKNTLKLGVCA---NVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTA  59

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  L++  LL +CG++ P GF C
Sbjct  60   IKANVLGINLNVPLSLSLLLNVCGKKVPSGFIC  92



>ref|XP_010539616.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=142

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCPRD L+LGVC  A+  +   L    S P++PCC+ ++GL + + A CLCTA K  +  
Sbjct  59   TCPRDSLKLGVCVNALNLLNVTL---GSPPVKPCCSLIQGLADLEAAVCLCTALKASILG  115

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL +C R+AP+GF+C
Sbjct  116  INLNVPINLTLLLNVCSRKAPRGFQC  141



>ref|XP_006286641.1| hypothetical protein CARUB_v10002511mg [Capsella rubella]
 gb|EOA19539.1| hypothetical protein CARUB_v10002511mg [Capsella rubella]
Length=110

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 12/91 (13%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQI-DHSI---PIRPCCNCLRGLTNSQTATCLCTASK  819
            GTCPRD L++GVC        S+L I D ++   P++PCC+ ++GL + + A CLCTA K
Sbjct  26   GTCPRDALKIGVCV-------SVLNIVDLTLGNPPVQPCCSLIQGLADLEAAVCLCTALK  78

Query  820  LIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              V  IN N  + +  LL +CGR+AP  F+C
Sbjct  79   ASVLGINLNLPINLSVLLNVCGRKAPTNFQC  109



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +1

Query  622  PST-SPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTA  795
            PST  P+ + GG CPRD L+LG+CA     +G +L +    P ++PCC+ ++GL + + A
Sbjct  44   PSTPCPTPSGGGKCPRDALKLGICA---DLLGGLLNVTVGKPPVQPCCSLIQGLADLEAA  100

Query  796  TCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             CLCTA K  +  IN N  +++  LL +C +  P GF+C
Sbjct  101  VCLCTAIKANILGINLNIPVSLSLLLNVCSKNVPSGFQC  139



>ref|XP_010258987.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Nelumbo nucifera]
Length=135

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TSP     GTCPRD L+LGVCA  +K +   +    + P  PCC+ ++ L + + A CLC
Sbjct  43   TSPIPAAKGTCPRDALKLGVCANVLKLVSVSV---GTPPYLPCCSLIKDLADLEAAACLC  99

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            TA K  V  IN N  +++  +L  CG++ P GFKC
Sbjct  100  TAIKAKVLGINLNVPVSLSLILNNCGKKVPTGFKC  134



>ref|XP_010055513.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=132

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (59%), Gaps = 3/95 (3%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            T+P +  G +CPRD L+LGVCA  +   G +  I  + P  PCC+ L GL + + A CLC
Sbjct  39   TNPFSPRGSSCPRDALKLGVCAKVLD--GPVNAIIGTPPDMPCCSVLEGLLDLEAAVCLC  96

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            TA K  +  IN N  +++  L+  CG+  P GF+C
Sbjct  97   TAIKANILGINLNIPISLSLLINTCGKNVPSGFQC  131



>ref|XP_009114615.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=129

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +1

Query  610  SGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQ  789
            S  +P   P+     TCP+D ++LGVC  A+  + + L    + P++PCC+ + GL + +
Sbjct  31   SSYKPKPGPTTPAIETCPKDTVKLGVCVNALNLLNATL---GAPPVKPCCSLIDGLVDLE  87

Query  790  TATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             A CLCTA K  +  IN N  + +  LL +C R+AP+GF+C
Sbjct  88   AAVCLCTALKASILGININLPINLSLLLNVCNRKAPRGFQC  128



>ref|XP_004245750.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = +1

Query  619  QPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTA  795
            +P+ SPS N+   CPRD L+LGVCA     +  +L +    P ++PCC+ L  L + + A
Sbjct  35   KPTPSPSPNSQTKCPRDALKLGVCA---NVLNGLLNVTLGTPPVKPCCSLLGNLVDLEAA  91

Query  796  TCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             CLCTA K  +  IN +  +++  LL +C + APKGF C
Sbjct  92   VCLCTALKANILGINLDIPISLSLLLNVCTKEAPKGFIC  130



>emb|CDY61290.1| BnaCnng37610D [Brassica napus]
Length=135

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G+CPR  L+LGVCA  +K    +L+I+  S P++PCC+ L+GL + + A CLCTA K  V
Sbjct  50   GSCPRKTLKLGVCANVLK---DLLKIELGSPPVKPCCSLLKGLVDIEAAACLCTALKANV  106

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              I  N  +++  LL  CGR+ P+GF C
Sbjct  107  LGIKLNVPVSLSLLLNACGRKTPRGFIC  134



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 10/105 (10%)
 Frame = +1

Query  616  GQPST----SPSNNNG-GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGL  777
            G PST    +PS  +G  TCPRD L+LG+CA     + ++L +    P ++PCC  ++GL
Sbjct  50   GTPSTPSPGTPSTPSGTATCPRDALKLGICA---NVLNNLLNVTIGTPPVQPCCTLIQGL  106

Query  778  TNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + + A CLCTA +  +  IN N  +A+  LL  CG + P+GF+C
Sbjct  107  ADLEAAVCLCTAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  151



>emb|CDY21275.1| BnaC03g29590D [Brassica napus]
Length=135

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G+CPR  L+LGVCA  +K    +L+I+  S P++PCC+ L+GL + + A CLCTA K  V
Sbjct  50   GSCPRKTLKLGVCANVLK---DLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANV  106

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              I  N  +++  LL  CGR+ P+GF C
Sbjct  107  LGIKLNVPVSLSLLLNACGRKTPRGFIC  134



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            G +CPRD L+LGVCA     +  +L I    P + PCC+ ++GL + + A CLCTA K  
Sbjct  49   GTSCPRDTLKLGVCA---NVLNGLLNISVGKPPVEPCCSLIQGLADIEAAVCLCTALKAN  105

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG + PKGF+C
Sbjct  106  ILGINLNIPISLSLLLNVCGNKVPKGFQC  134



>ref|XP_002874779.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51038.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKL-I  825
            G+CPRD L+LGVCA  +K    +L+I    P ++PCC+ L+GL + + A CLCTA K  +
Sbjct  44   GSCPRDTLKLGVCANVLK---DLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANV  100

Query  826  VRRINNADLAIYTLLKLCGRRAPKGFKC  909
            +    N  +++  LL +CGR+ P GF C
Sbjct  101  LGNKLNVPVSLSLLLNVCGRKVPSGFVC  128



>ref|XP_009134277.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
 emb|CDX90838.1| BnaA03g25180D [Brassica napus]
Length=113

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TS +  N G+CPRD L+LGVCA  +K +   L    + P++PCC+ + GL + + A CLC
Sbjct  21   TSATCYNTGSCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIAGLADLEAAVCLC  77

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            T  K  +  I  N  + +  LL +C R+APK F+C
Sbjct  78   TVLKANILGIKLNLPINLSVLLNVCSRKAPKNFQC  112



>emb|CDY21277.1| BnaC03g29610D [Brassica napus]
Length=113

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            TS +  N G+CPRD L+LGVCA  +K +   L    + P++PCC+ + GL + + A CLC
Sbjct  21   TSATCYNTGSCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIAGLADLEAAVCLC  77

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            T  K  +  I  N  + +  LL +C R+APK F+C
Sbjct  78   TVLKANILGIKLNLPINLSVLLNVCSRKAPKNFQC  112



>ref|NP_001275620.1| uncharacterized protein LOC102590907 precursor [Solanum tuberosum]
 gb|AFW90552.1| 14 kDa proline-rich protein [Solanum tuberosum]
Length=133

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  I  S P+ PCC+ L GL N++ A CLCTA K  +  
Sbjct  50   TCPIDTLKLGVCA---DVLGLVNVIVGSPPVTPCCSLLSGLANAEAAICLCTALKANILG  106

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL +C + AP GF+C
Sbjct  107  INLNLPISLSLLLNVCSKEAPAGFQC  132



>ref|XP_004152410.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=140

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CPRD L+LGVCA   K +G +L I    P + PCC+ + GL + + A CLCTA K  +
Sbjct  56   GKCPRDTLKLGVCA---KLLGGLLDITIGKPPVTPCCSLIDGLADLEAAVCLCTAIKADI  112

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +C +  PKGF+C
Sbjct  113  LGINLNVPLSLSLLLNVCQKNVPKGFQC  140



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCP D L+LGVCA     +G +  +  S P+ PCC+ L GL N + A CLCTA K  + 
Sbjct  44   ATCPIDTLKLGVCA---DVLGLVNAVIGSPPVTPCCSLLSGLANVEAALCLCTAIKANIL  100

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C + AP GF+C
Sbjct  101  GINLNVPISLSLLLNVCSKEAPSGFQC  127



>ref|XP_010529481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Tarenaya 
hassleriana]
Length=152

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            GGTCPRD L++GVC  A+  I   +    S P++PCC+ ++GL + + A CLCTA +  +
Sbjct  67   GGTCPRDALKIGVCVDALNLINVTI---GSPPVQPCCSLIQGLVDLEAALCLCTALRATI  123

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              +  N  + +  LL +C R+ P+GF+C
Sbjct  124  LGLTINLPINLSLLLNVCSRQTPRGFQC  151



>ref|XP_006396746.1| hypothetical protein EUTSA_v10029045mg [Eutrema salsugineum]
 gb|ESQ38199.1| hypothetical protein EUTSA_v10029045mg [Eutrema salsugineum]
Length=147

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +1

Query  646  NGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLI  825
            N G+CPRD L++G+CA  +K +   L    + P++PCC  + GL + + A CLCTA K  
Sbjct  61   NTGSCPRDALKIGLCANVLKLVDLTLG---NPPVKPCCTLIEGLADLEAAVCLCTALKAN  117

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +C R APK F+C
Sbjct  118  ILGINLNLPISLSVLLNVCSREAPKDFQC  146



>ref|XP_006289359.1| hypothetical protein CARUB_v10002845mg [Capsella rubella]
 gb|EOA22257.1| hypothetical protein CARUB_v10002845mg [Capsella rubella]
Length=113

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +1

Query  625  STSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCL  804
            +T+PS     TCP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CL
Sbjct  23   ATTPSRR---TCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCL  76

Query  805  CTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CT  K  V  IN N  + +  LL +C R+APK F+C
Sbjct  77   CTVLKANVLGINLNLPIDLSVLLNVCSRKAPKNFQC  112



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            G +CPRD L+LGVCA     +  +L I    P + PCC+ ++GL + + A CLCTA K  
Sbjct  51   GTSCPRDTLKLGVCA---NVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKAN  107

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG + PKGF+C
Sbjct  108  ILGINLNIPISLSLLLNVCGNKVPKGFQC  136



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            G +CPRD L+LGVCA     +  +L I    P + PCC+ ++GL + + A CLCTA K  
Sbjct  53   GTSCPRDTLKLGVCA---NVLNGLLNISVGKPPVEPCCSLIQGLADLEAAVCLCTALKAN  109

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG + PKGF+C
Sbjct  110  ILGINLNIPVSLSLLLNVCGNKVPKGFQC  138



>ref|XP_009623719.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=135

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTA  813
            S N  G CP++ L+LGVCA     +G++L +   +IP +PCC  ++GL + + A CLCTA
Sbjct  45   SPNYKGKCPKNTLKLGVCA---NVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTA  101

Query  814  SKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             K  V  IN N  L++  LL +CG++ P GF C
Sbjct  102  IKANVLGINLNVPLSLSLLLNVCGKKVPSGFIC  134



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +1

Query  646  NGGTCPRDRLELGVCALAVKKIGSIL-QIDHSIPIRPCCNCLRGLTNSQTATCLCTASKL  822
            N G CP+D L+LGVCA     +G++L  +  + P +PCC+ + GL + + A CLCTA K 
Sbjct  46   NKGKCPKDALKLGVCA---NVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKA  102

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +  IN N  L++  LL +CG++ P GF+C
Sbjct  103  NILGINLNVPLSLSLLLNVCGKKVPSGFQC  132



>ref|XP_006290087.1| hypothetical protein CARUB_v10003726mg [Capsella rubella]
 gb|EOA22985.1| hypothetical protein CARUB_v10003726mg [Capsella rubella]
Length=113

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 7/96 (7%)
 Frame = +1

Query  625  STSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCL  804
            +T+PS     TCP+D L+LGVCA  +K +   L++ +  P++PCC+ ++GL + + A CL
Sbjct  23   ATTPSRR---TCPKDSLKLGVCANVLKLVD--LKLGNP-PVKPCCSLIQGLADLEAAVCL  76

Query  805  CTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CT  K  V  IN N  + +  LL +C R+APK F+C
Sbjct  77   CTVLKANVLGINLNLPIDLSVLLNVCSRKAPKNFQC  112



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CPRD L+LGVCA     +G +L +    P ++PCC+ ++GL + + A CLCTA K  +
Sbjct  52   GKCPRDALKLGVCA---DLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANI  108

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +C ++ P GF+C
Sbjct  109  LGINLNVPLSLSLLLNVCSKKVPSGFQC  136



>ref|XP_009135928.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=133

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP+D L+LGVC  A+  +  +     + P+ PCC+ ++GL + + A CLCTA K  V 
Sbjct  48   GTCPKDTLKLGVCVNALNLLNDVTL--GTPPVTPCCSLIKGLVDLEAAVCLCTALKASVL  105

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +C R++P GF+C
Sbjct  106  GINLNLPINLSLLLNVCKRKSPPGFQC  132



>emb|CDX79156.1| BnaA01g12230D [Brassica napus]
Length=135

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP+D L+LGVC  A+  +        + P+ PCC+ ++GL + + A CLCTA K  V 
Sbjct  48   GTCPKDTLKLGVCVNALNLLNDDGPALGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVL  107

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +C R++P GF+C
Sbjct  108  GININLPINLSLLLNVCKRKSPPGFQC  134



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = +1

Query  616  GQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQT  792
            G PST PS     TCPRD L+LG+CA     + ++L +    P ++PCC  ++GL + + 
Sbjct  50   GTPST-PSGT--ATCPRDALKLGICA---NVLNNLLNVTIGTPPVQPCCTLIQGLADLEA  103

Query  793  ATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            A CLCTA +  +  IN N  +A+  LL  CG + P+GF+C
Sbjct  104  AVCLCTAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  143



>ref|XP_010433333.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP+D L+LGVC  A+  +   L    + P++PCC+ + GL + + A CLCTA K  +  
Sbjct  48   TCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKASILG  104

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL +C R+AP+GF+C
Sbjct  105  ININLPINLSLLLNVCSRKAPRGFQC  130



>ref|XP_008238565.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=120

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 8/102 (8%)
 Frame = +1

Query  610  SGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNS  786
            +   PS +P   N   CPRD L+LGVCA     +  ++ ++   +P+RPCC  L GL + 
Sbjct  23   NANNPSPAP---NRIACPRDALKLGVCA---NVLSGLVNVNVGQVPVRPCCTILLGLVDL  76

Query  787  QTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            + A CLCT+ K  +  IN N  +A+  LL  CG + P GF+C
Sbjct  77   EAAVCLCTSIKARILGINLNIPVALSLLLSACGDKLPDGFQC  118



>ref|XP_010431835.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  23   AACPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAACLCTLLKVNIL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  F+C
Sbjct  80   GINVNLPIDLSVLLNICGRKAPTNFQC  106



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 5/97 (5%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            PST P      +CPRD L+LGVCA  +  +  I  +  + P  PCC  ++GL + + A C
Sbjct  46   PSTRPPA--AASCPRDTLKLGVCANVLNDL--IHLVVGTPPKTPCCPLIQGLADLEAAVC  101

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            LCTA K  +  IN N  +++  LL  CG+  PKGF+C
Sbjct  102  LCTAIKANILGINLNVPVSLSLLLNYCGKNVPKGFQC  138



>ref|XP_010431799.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
 ref|XP_010431824.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  23   AACPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAACLCTLLKVNIL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  F+C
Sbjct  80   GINLNLPIDLSVLLNICGRKAPTNFQC  106



>gb|KFK28807.1| hypothetical protein AALP_AA7G051200 [Arabis alpina]
Length=133

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP D ++LGVC  A+  +  +     + P+ PCC+ ++GL + + A CLCTA K  V 
Sbjct  48   GTCPLDTIKLGVCVNALNLLNDVTL--GTPPVTPCCSLIKGLVDLEAAVCLCTALKASVL  105

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +C R+AP+GF+C
Sbjct  106  GINLNLPINLSLLLNVCSRKAPRGFQC  132



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLI  825
            G  CPRD L+LGVCA     +  +L I   + P++PCC+ ++GL + + A CLCTA +  
Sbjct  59   GTRCPRDTLKLGVCA---NVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRAN  115

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  L++  LL +CG + PKGF+C
Sbjct  116  ILGINLNIPLSLSLLLNVCGNKVPKGFQC  144



>ref|XP_011081224.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=135

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 60/108 (56%), Gaps = 6/108 (6%)
 Frame = +1

Query  589  SPQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCL  768
            SP S  S    P+ SP+    G CPRD L+LGVCA  +   G+I  I  + P  PCC+ L
Sbjct  32   SPVSKPSPSTNPNPSPAK---GHCPRDALKLGVCAKLLG--GNIGTIVGNPPNTPCCSIL  86

Query  769  RGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             GL + + A CLCTA K  V  IN N  +A+  L+  CG+  PK F C
Sbjct  87   GGLLDLEAAVCLCTALKANVLGININIPIALSLLINTCGKTLPKDFIC  134



>gb|AFK37038.1| unknown [Lotus japonicus]
Length=132

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 4/97 (4%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            PST P +    +CPRD ++LGVCA  +  I   +Q+    P  PCC+ L GL + + A C
Sbjct  38   PSTKPPSTKQPSCPRDTIKLGVCADVLGLIN--VQLGKP-PKTPCCSLLEGLVDLEAAVC  94

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            LCTA K  V  IN N  + +  +L  CG+  PKGF C
Sbjct  95   LCTALKANVLGINLNLPINLSLILNYCGKGVPKGFVC  131



>sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor 
[Daucus carota]
 emb|CAA33476.1| unnamed protein product [Daucus carota]
Length=137

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 13/93 (14%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSI-----PIRPCCNCLRGLTNSQTATCLCTA  813
             G CPRD L+LGVCA        +L + H++     P  PCC+ L GL N + A CLCTA
Sbjct  51   AGKCPRDALKLGVCA-------DVLNLVHNVVIGSPPTLPCCSLLEGLVNLEAAVCLCTA  103

Query  814  SKL-IVRRINNADLAIYTLLKLCGRRAPKGFKC  909
             K  I+ +  N  +A+  +L  CG++ P GF+C
Sbjct  104  IKANILGKNLNLPIALSLVLNNCGKQVPNGFEC  136



>ref|XP_009134275.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
 emb|CDX90835.1| BnaA03g25150D [Brassica napus]
Length=133

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G+CPR  L+LGVCA  +K    +L+I+   P ++PCC+ L GL + + A CLCTA K  V
Sbjct  48   GSCPRKTLKLGVCANVLK---DLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANV  104

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              I  N  +++  LL  CGR+ P+GF C
Sbjct  105  LGIKLNVPVSLSLLLNACGRKTPRGFIC  132



>ref|XP_006600137.1| PREDICTED: uncharacterized protein LOC100500016 isoform X1 [Glycine 
max]
 gb|KHN09802.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=137

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  + + L      P+ PCC+ L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNATL---GQPPVTPCCSLLDGLVDLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+AP+ F+C
Sbjct  109  GINLNLPISLSLLLNVCSRKAPRDFQC  135



>ref|XP_010676148.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=161

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = +1

Query  607  SSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIR-PCCNCLRGLTN  783
            S+GG PST  S++  G CP D L+ GVCA     +  +L ++   P + PCC  + GL +
Sbjct  63   STGGTPSTGGSSS--GACPIDALKFGVCA---NVLTDLLNLNLGTPPKTPCCPLIAGLVD  117

Query  784  SQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             + A CLCTA K  +  IN N  L++  L+  CG + P+GF+C 
Sbjct  118  LEAAVCLCTAIKANILGINLNIPLSLSLLVNYCGTKVPRGFQCA  161



>ref|XP_003549906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN09800.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  + + L      P+ PCC  L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNATL---GQPPVTPCCTLLDGLVDLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+AP+ F+C
Sbjct  109  GINLNLPISLSLLLNVCSRKAPRDFQC  135



>ref|NP_001235642.1| uncharacterized protein LOC100500016 precursor [Glycine max]
 gb|ACU14605.1| unknown [Glycine max]
Length=137

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  + + L      P+ PCC+ L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNATL---GQPPVTPCCSLLDGLADLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+AP+ F+C
Sbjct  109  GINLNLPISLSLLLNVCSRKAPRDFQC  135



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCPRD L+LGVCA  +  +  +  +  + P  PCC+ ++GL + + A CLCTA K  +  
Sbjct  50   TCPRDTLKLGVCANVLNDLVHL--VVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL  CG++ P GF+C
Sbjct  108  INLNVPVSLSLLLNFCGKKVPSGFQC  133



>ref|XP_002529775.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF32589.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CPRD L+LGVCA     +GS+L I    P + PCC+ ++GL + + A CLCTA K  +
Sbjct  54   GKCPRDALKLGVCA---DVLGSLLNITIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANI  110

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +C ++ P  F+C
Sbjct  111  LGINLNIPLSLSLLLNVCSKKTPSDFQC  138



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            G +CPRD L+LGVCA     +  +L +    P ++PCC  ++GL + + A CLCTA K  
Sbjct  46   GASCPRDALKLGVCA---NVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKAN  102

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  L++  LL +C +  P+GF+C
Sbjct  103  ILGINLNIPLSLSLLLNVCSKSVPRGFQC  131



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIR-PCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP+D L+LGVCA     +G +L I    P + PCC  + GL + + A CLCTA K  +
Sbjct  42   GYCPKDTLKLGVCA---DLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANI  98

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +C ++ PKGF C
Sbjct  99   LGINLNVPLSLSLLLNVCSKKVPKGFVC  126



>ref|XP_004298650.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 3/98 (3%)
 Frame = +1

Query  619  QPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTAT  798
            +P T+P      +CPRD L+LGVCA  +   G++  +  S P  PCC  L GL + + A 
Sbjct  39   KPITNPIPGAAKSCPRDTLKLGVCAKLLN--GAVGAVVGSPPDTPCCAVLEGLVDLEVAV  96

Query  799  CLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CLCTA K  +  IN N  +++  LL  C ++ P GF+C
Sbjct  97   CLCTAIKANILGINLNIPVSLSLLLDGCAKKFPSGFQC  134



>ref|XP_006396747.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
 gb|ESQ38200.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
Length=129

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP+D L+LGVC  A+  +   L    + P++PCC+ + GL + + A CLCTA K  +  
Sbjct  46   TCPKDALKLGVCVNALNLLNVTL---GAPPVQPCCSLIDGLVDLEAAVCLCTALKASILG  102

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL +C R+AP+GF+C
Sbjct  103  ININLPINLSLLLNVCSRKAPRGFQC  128



>ref|XP_002324869.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
 gb|ABK95939.1| unknown [Populus trichocarpa]
 gb|EEF03434.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
Length=121

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 53/98 (54%), Gaps = 7/98 (7%)
 Frame = +1

Query  619  QPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTAT  798
            QP T P+     TCPRD L+LG CA     +G +  +  S P   CC  L GL + + A 
Sbjct  29   QPKTPPTEP---TCPRDTLKLGACA---DILGLVNVVVGSPPYSKCCPLLEGLADLEVAL  82

Query  799  CLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CLCTA K  V  IN N  +A+  L+  CG+  P GFKC
Sbjct  83   CLCTAIKASVLGINLNVPVALSVLVSACGKSIPPGFKC  120



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKL-I  825
            G+CPRD L+LGVCA  +K    +L+I    P ++PCC+ L+GL + + A CLCTA K  +
Sbjct  44   GSCPRDTLKLGVCANVLK---DLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANV  100

Query  826  VRRINNADLAIYTLLKLCGRRAPKGFKC  909
            +    N  +++  LL +CGR+ P  F C
Sbjct  101  LGTKLNVPVSLSLLLNVCGRKVPSKFVC  128



>ref|XP_010456924.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CP+D L+LGVCA  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  23   AACPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTLLKVNIL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CG++AP  F+C
Sbjct  80   GINLNLPIDLSVLLNICGKKAPTNFQC  106



>ref|XP_010422379.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
              CP+D L+LGVCA  +K       +D S+   P++PCC+ ++GL + + A CLCT  K+
Sbjct  23   AACPKDSLQLGVCANVLK------LVDLSLGNPPVKPCCSLIQGLADLEAAVCLCTLLKV  76

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +  IN N  + +  LL +CG++AP  F+C
Sbjct  77   NILGINLNLPIDLSVLLNICGKKAPTNFQC  106



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCPRD L+LGVCA  +  +  +  +  + P  PCC+ ++GL + + A CLCTA K  +  
Sbjct  47   TCPRDTLKLGVCANVLNDLVHL--VVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILG  104

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL  CG++ P GF+C
Sbjct  105  INLNVPVSLSLLLNFCGKKVPSGFQC  130



>ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana]
 gb|AAB82643.1| expressed protein [Arabidopsis thaliana]
 gb|AAM62919.1| unknown [Arabidopsis thaliana]
 gb|AAV84511.1| At2g45180 [Arabidopsis thaliana]
 dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|ABI93898.1| At2g45180 [Arabidopsis thaliana]
 gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=134

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P  PCC  L+GL N + A CLCTA K  V  
Sbjct  51   TCPTDTLKLGVCA---DLLGLVNVVVGSPPKTPCCTLLQGLANLEAAVCLCTALKANVLG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL  CG++ P GF+C
Sbjct  108  INLNVPIDLTLLLNYCGKKVPHGFQC  133



>ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 56/97 (58%), Gaps = 7/97 (7%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            PS SPS    G CP + L+LGVCA  +K +  I+ I    P +PCC  L GL + + A C
Sbjct  35   PSPSPSK---GRCPMNTLKLGVCADVLKAL--IVNIGKP-PKKPCCTLLEGLVDLEAAVC  88

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            LCTA K  +  I  N  + +  LL  CG++ PKGF+C
Sbjct  89   LCTALKANILGIKLNIPVDLSLLLNYCGKKVPKGFQC  125



>ref|XP_010431811.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CP+D L+LGVC+  +K +   L    + P++PCC+ ++GL + + A CLCT  K+ + 
Sbjct  23   AACPKDSLQLGVCSNVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAACLCTLLKVNIL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  LL +CGR+AP  F+C
Sbjct  80   GINVNLPIDLSVLLNICGRKAPTNFQC  106



>ref|XP_009134276.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=127

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP+D ++LGVC  A+  +   L    + P++PCC+ + GL + + A CLCTA K  +  
Sbjct  44   TCPKDTVKLGVCVNALNLLNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKASILG  100

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL +C R+AP+GF+C
Sbjct  101  ININLPINLSLLLNVCSRKAPRGFQC  126



>ref|XP_010518131.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=134

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P  PCC+ L+GL N + A CLCTA K  V  
Sbjct  51   TCPTDTLKLGVCA---DLLGLVNVLIGSPPKTPCCSLLQGLANLEAAVCLCTAIKANVVG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL  CG++ P GF+C
Sbjct  108  INLNVPIDLSLLLNYCGKKLPYGFQC  133



>ref|XP_009801825.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CP D L+LGVCA     +G +  +  S P+ PCC+ L GL N + A CLC+A K  + 
Sbjct  49   AICPIDTLKLGVCA---DVLGLVNAVIGSPPVAPCCSLLSGLANVEAALCLCSAIKANIL  105

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C + AP GF+C
Sbjct  106  GINLNVPISLSLLLNVCSKEAPSGFQC  132



>ref|XP_001619595.1| hypothetical protein NEMVEDRAFT_v1g224033 [Nematostella vectensis]
 gb|EDO27495.1| predicted protein [Nematostella vectensis]
Length=404

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 95/196 (48%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  14   LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  72

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  73   ALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  132

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN  + L+ +A+    L+ V +  + L+ +AN + 
Sbjct  133  ALRTVANEMYALRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMY  192

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  193  ALR----TVANEMNAL  204


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 95/196 (48%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  84   LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  142

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A     L  V N ++ L+ + N +  LR +AN    L+ V N    LR VAN  +
Sbjct  143  ALRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMN  202

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN    L+ +A+    L+ V +  + L+ +AN + 
Sbjct  203  ALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  262

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  263  ALR----TVANEMYAL  274


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 95/196 (48%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  214  LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  272

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  273  ALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  332

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN  + L+ +A+    L+ V +  + L+ +AN + 
Sbjct  333  ALRTVANEMYALRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMY  392

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  393  ALR----TVANEMYAL  404


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 94/196 (48%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + +   + + AN +  L+ + N    LR + N  +
Sbjct  134  LRTVANEMYALRTVANEMYALRTVANEMNALRTV-ANEMYALRTVANEMYALRTVANEMY  192

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  193  ALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  252

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN  + L+ +A+    L+ V +  + L+ +AN + 
Sbjct  253  ALRTVANEMYALRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMY  312

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  313  ALR----TVANEMYAL  324


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 77/161 (48%), Gaps = 8/161 (5%)
 Frame = +2

Query  167  ANPLSHLQAMVNPRSHLREMVNPPFHRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAM  346
            AN +  L+ + N    LR + N  +  +  A     L  V N +  L+ + N +  LR +
Sbjct  8    ANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTV  67

Query  347  ANLPSHLQKVTNLPSHLRAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVI  526
            AN    L+ V N  + LR VAN    LR ++N ++ L+ + N    LR +AN    L+ +
Sbjct  68   ANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTV  127

Query  527  AH----LQAVTHLRFHLQALANPLCHLKVMLAVVANPLPHL  637
            A+    L+ V +  + L+ +AN +  L+     VAN +  L
Sbjct  128  ANEMYALRTVANEMYALRTVANEMYALR----TVANEMNAL  164


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 74/155 (48%), Gaps = 8/155 (5%)
 Frame = +2

Query  185  LQAMVNPRSHLREMVNPPFHRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSH  364
            L+ + N    LR + N  +  +  A     L  V N +  L+ + N +  LR +AN    
Sbjct  4    LRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYA  63

Query  365  LQKVTNLPSHLRAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----  532
            L+ V N    LR VAN  + LR ++N ++ L+ + N    LR +AN    L+ +A+    
Sbjct  64   LRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYA  123

Query  533  LQAVTHLRFHLQALANPLCHLKVMLAVVANPLPHL  637
            L+ V +  + L+ +AN +  L+     VAN +  L
Sbjct  124  LRTVANEMYALRTVANEMYALR----TVANEMYAL  154



>gb|KFK31985.1| hypothetical protein AALP_AA6G185200 [Arabis alpina]
Length=133

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP+D + LGVCA  +K    +L+I    P ++PCC+ + GL + + A CLCTA K  V
Sbjct  48   GKCPKDTIRLGVCANVLK---DLLKIKLGTPPVKPCCSLIDGLVDLEAAACLCTALKANV  104

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              I  N  +++  LL +CG++ P GFKC
Sbjct  105  LGIKLNIPISLNLLLNVCGKKVPSGFKC  132



>ref|XP_010456925.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CPRD L+LGVCA  +K +   L    + P+ PCC+ ++GL + + A CLCT  K+ V 
Sbjct  23   AACPRDSLQLGVCANVLKLVDITL---GNPPVTPCCSLIQGLADLEAAACLCTLVKVNVL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  LL +CGR  P  F+CV
Sbjct  80   GINLNLPIDLSVLLNVCGRTPPTNFQCV  107



>emb|CDX95635.1| BnaC03g25160D [Brassica napus]
Length=131

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 56/108 (52%), Gaps = 10/108 (9%)
 Frame = +1

Query  589  SPQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCL  768
            +P++  S    P   P      TCP D L+LGVCA     +G I  +  S P  PCC  L
Sbjct  32   TPKTPKSPKKIPPVKP------TCPTDTLKLGVCA---DLLGLINVLVGSPPKTPCCALL  82

Query  769  RGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             GL N + A CLCTA K  V  IN N  + +  LL  CG++ P GF+C
Sbjct  83   NGLANVEAAVCLCTALKANVLGINLNVPVDLSLLLNYCGKKLPYGFQC  130



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLI  825
            G  CPRD L+LGVCA     +  +L I   + P++PCC+ ++GL + + A CLCTA +  
Sbjct  67   GTRCPRDTLKLGVCA---NVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRAN  123

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  L++  LL +CG + P+GF+C
Sbjct  124  ILGINLNIPLSLSLLLNVCGNKVPRGFQC  152



>ref|XP_006286053.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
 gb|EOA18951.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
Length=137

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
             GTCP+D L+LGVC  A+  +  +     + P+ PCC+ + GL + + A CLCTA K  V
Sbjct  51   AGTCPKDALKLGVCVNALNLLKDVTL--GTPPVTPCCSLIEGLVDLEAAVCLCTALKASV  108

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN    + +  LL +C R+AP+GF+C
Sbjct  109  LGINLYLPINLSLLLNVCSRKAPRGFQC  136



>gb|KFK37310.1| hypothetical protein AALP_AA4G240600 [Arabis alpina]
Length=132

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P  PCC  L+GL N + A CLCTA K  V  
Sbjct  50   TCPTDTLKLGVCA---DLLGLVNVVVGSPPKTPCCTLLKGLANLEAAVCLCTALKANVLG  106

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            +N N  + +  LL  CG++ P GF+C
Sbjct  107  LNLNVPIDLSLLLNYCGKKLPYGFQC  132



>ref|XP_004976455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=123

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +1

Query  595  QSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRG  774
             +    G  PS++P++   G CPRD L+LGVCA  +  I + + +    P  PCC  L G
Sbjct  20   MASACGGHCPSSTPASF--GKCPRDALKLGVCANVLGLIKAKVGVP---PTEPCCPLLEG  74

Query  775  LTNSQTATCLCTASKLIVRRINN---ADLAIYTLLKLCGRRAPKGFKCV  912
            L + + A CLCTA K  +  IN     D+++  +L  CG+  P GFKC+
Sbjct  75   LVDLEAAVCLCTAIKGNILGINLNLPIDVSLSLILNHCGKTVPTGFKCL  123



>ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP+D L+LGVC  A+  +   L    + P++PCC+ + GL + + A CLCTA K  +  
Sbjct  48   TCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKASILG  104

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL +C R+ P+GF+C
Sbjct  105  ININLPINLSLLLNVCSRKPPRGFQC  130



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = +1

Query  631  SPSNNNG-----GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTA  795
            +PS+ +G       CP+D L+LGVCA  +  +  +  +  + P  PCC  + GL + + A
Sbjct  36   TPSHGHGHKHSKAKCPKDTLKLGVCANLLNDL--VHLVVGTPPKTPCCTLIEGLADLEAA  93

Query  796  TCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             CLCTA K  V  IN N  +++  LL  CG++AP GF+C
Sbjct  94   VCLCTAIKANVLGINLNVPVSLSLLLNYCGKKAPSGFQC  132



>ref|XP_010506455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Camelina sativa]
 ref|XP_010506456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Camelina sativa]
Length=131

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P  PCC+ L+GL N + A CLCTA K  V  
Sbjct  48   TCPTDTLKLGVCA---DLLGLVNVLVGSPPKTPCCSLLQGLANLEAAVCLCTALKANVLG  104

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL  CG++ P GF+C
Sbjct  105  INLNVPIDLSLLLNYCGKKLPYGFQC  130



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSIL-QIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP+D L+LGVCA     +G++L  +  + P +PCC+ + GL + + A CLCTA K  V
Sbjct  47   GKCPKDALKLGVCA---NVLGNLLGLVVGNPPKKPCCSFIEGLVDLEAAVCLCTAIKANV  103

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++   L +CG++ P GF+C
Sbjct  104  LGINLNVPLSLSLFLNVCGKKVPFGFQC  131



>ref|XP_002271593.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80709.1| hypothetical protein VITISV_033376 [Vitis vinifera]
 emb|CBI31903.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +   G++  +  + P+ PCC+ L GL + + A CLCTA K  + 
Sbjct  47   GSCPRDALKLGVCAKLLN--GTVGAVVGTPPVTPCCSLLEGLLDLEVAACLCTAIKANIL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             I+ +  +++  L+ +CG++ PK F+C
Sbjct  105  GIHLDIPVSLSLLVNICGKKLPKDFQC  131



>ref|XP_009133710.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDX83396.1| BnaA03g21100D [Brassica napus]
Length=131

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 56/108 (52%), Gaps = 10/108 (9%)
 Frame = +1

Query  589  SPQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCL  768
            +P++  S    P   P      TCP D L+LGVCA     +G +  +  S P  PCC  L
Sbjct  32   TPKTPKSPKKDPPVKP------TCPTDTLKLGVCA---DLLGLVNVLVGSPPKTPCCALL  82

Query  769  RGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             GL N + A CLCTA K  V  IN N  + +  LL  CG++ P GF+C
Sbjct  83   NGLANVEAAVCLCTALKANVLGINLNVPVDLSLLLNYCGKKLPYGFQC  130



>ref|XP_009591583.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Nicotiana tomentosiformis]
Length=135

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CP D L+LGVCA     +  +L +    P ++PCC+ +  L + + A CLCTA K  
Sbjct  49   GGKCPTDALKLGVCA---NVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKAN  105

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +C ++APKGF C
Sbjct  106  ILGINLNLPISLNLLLNVCSKKAPKGFTC  134



>ref|XP_009782252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CP D L+LGVCA     +  +L +    P ++PCC+ +  L + + A CLCTA K  
Sbjct  47   GGKCPTDALKLGVCA---NVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKAN  103

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +C ++APKGF C
Sbjct  104  ILSINLNLPISLNLLLNVCSKKAPKGFTC  132



>ref|XP_011081227.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Sesamum indicum]
Length=139

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIR-PCCNCLRGLTNSQTATCLCTASKLIV  828
             TCPRD L+LGVCA     +G ++ +    P + PCC  + GL + + A CLCTA K  V
Sbjct  54   ATCPRDALKLGVCA---NLLGGLIDLTIGTPPKTPCCTLIEGLADVEAAVCLCTAIKANV  110

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +C ++ P GF+C
Sbjct  111  LGINLNVPLSLSLLLNVCSKKVPPGFQC  138



>emb|CDX94514.1| BnaC09g23220D [Brassica napus]
Length=169

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 6/100 (6%)
 Frame = +1

Query  619  QPSTSPSN-NNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQT  792
            +P T PSN  + G CP D L+LGVC      +  +L I    P  +PCC+ ++GL + + 
Sbjct  72   RPVTPPSNPGSSGNCPIDVLKLGVCG---NVLSGLLNIQLGQPSAQPCCSLVQGLVDVEA  128

Query  793  ATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            A CLCTA K+ V  IN N  +++  LL  C ++ P GF+C
Sbjct  129  AICLCTALKVNVLGINLNVPISLSVLLNKCNKKVPSGFEC  168



>ref|XP_010508203.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=131

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 57/108 (53%), Gaps = 10/108 (9%)
 Frame = +1

Query  589  SPQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCL  768
            +P++  S    P   P      TCP D  +LGVCA     +G +  +  S P  PCC+ L
Sbjct  32   TPKTPKSPKKDPPVKP------TCPTDTFKLGVCA---DLLGLVNVLVGSPPKTPCCSLL  82

Query  769  RGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +GL N + A CLCTA K  V  IN N  + +  LL  CG++ P GF+C
Sbjct  83   QGLANLEAAVCLCTALKANVLGINLNVPINLSLLLNYCGKKLPYGFQC  130



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LGVCA     +G++L +   + P +PCC+ + GL + + A CLCTA K  +
Sbjct  52   GKCPIDTLKLGVCA---NVLGNLLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANI  108

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +CG++AP GF+C
Sbjct  109  LGINLNVPLSLSLLLNVCGKKAPSGFQC  136



>ref|XP_001634551.1| predicted protein [Nematostella vectensis]
 gb|EDO42488.1| predicted protein [Nematostella vectensis]
Length=601

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 96/196 (49%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++  + L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  124  LRTVANEMYALRTVANEMNALRTVANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  182

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A     L  V N +  ++ + N +  LR +AN  + L+ V N    LR VAN  +
Sbjct  183  ALRTVANEMYALRTVANEMYAIRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMN  242

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN    L+ +A+    L+ V +  + L+ +AN + 
Sbjct  243  ALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  302

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  303  ALR----TVANEMYAL  314


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 94/196 (48%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  244  LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  302

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A     L  V N +  L+ + N +  LR +AN  + L+ V N    LR VAN   
Sbjct  303  ALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMNALRTVANKMYALRTVANEMY  362

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN    L+ +A+    L+ V +  + L+ +AN + 
Sbjct  363  ALRTVANEMYALRTVANEMYSLRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  422

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  423  ALR----TVANEMYAL  434


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 98/196 (50%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N  + LR +VN  +
Sbjct  394  LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMNALRTVVNEMY  452

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A     L  V N +  L+ + N ++ LR + N  + L+ V N  + LR VAN  +
Sbjct  453  ALRTVANEMYALRTVANEMYALRTVANEMNALRTVVNEMNALRTVVNEMNALRTVANEMN  512

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N +  L+ +VN    LR +AN    L+ +A+    L+ V +  + L+ +AN + 
Sbjct  513  ALRTVANEMNALRTVVNEMNALRTVANEMYSLRTVANEMNALRTVANEMYALRTVANEMY  572

Query  590  HLKVMLAVVANPLPHL  637
             ++     VAN +  L
Sbjct  573  AIR----TVANEMNAL  584


 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 94/196 (48%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N  + LR + N  +
Sbjct  294  LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMNALRTVANKMY  352

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A     L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  353  ALRTVANEMYALRTVANEMYALRTVANEMYSLRTVANEMYALRTVANEMYALRTVANEMY  412

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN  + L+ + +    L+ V +  + L+ +AN + 
Sbjct  413  ALRTVANEMYALRTVANEMYALRTVANEMNALRTVVNEMYALRTVANEMYALRTVANEMY  472

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  473  ALR----TVANEMNAL  484


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 91/192 (47%), Gaps = 11/192 (6%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N  + LR + N  +
Sbjct  174  LRTVANEMYALRTVANEMYALRTVANEMYAIRTV-ANEMYALRTVANEMNALRTVANEMY  232

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  233  ALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  292

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAHLQAVTHLRFHLQALANPLCHLKV  601
             LR ++N ++ L+ + N    LR +AN    L+ +A+        + L+ +AN +  L+ 
Sbjct  293  ALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEM------YALRTVANEMNALR-  345

Query  602  MLAVVANPLPHL  637
                VAN +  L
Sbjct  346  ---TVANKMYAL  354


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 92/196 (47%), Gaps = 19/196 (10%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V           + ++  + + AN +  L+ + N    LR + N  +
Sbjct  4    LRTVANEMYALRTV----------ANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  52

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N ++ L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  53   ALRTVANEMNALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  112

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR ++N ++ L+ + N    LR +AN  + L+ +A+    L+ V +  + L+ +AN + 
Sbjct  113  ALRTVANEMYALRTVANEMYALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMY  172

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  173  ALR----TVANEMYAL  184


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 91/192 (47%), Gaps = 11/192 (6%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++    L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  74   LRTVANEMYALRTVANEMYALRTVANEMYALRTV-ANEMYALRTVANEMYALRTVANEMY  132

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN   
Sbjct  133  ALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMY  192

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAHLQAVTHLRFHLQALANPLCHLKV  601
             LR ++N ++ ++ + N    LR +AN  + L+ +A+        + L+ +AN +  L+ 
Sbjct  193  ALRTVANEMYAIRTVANEMYALRTVANEMNALRTVANEM------YALRTVANEMNALR-  245

Query  602  MLAVVANPLPHL  637
                VAN +  L
Sbjct  246  ---TVANEMYAL  254


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 82/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  V N +  L+ V++    L  + + ++  + + AN ++ L+ +VN  + LR +VN   
Sbjct  444  LRTVVNEMYALRTVANEMYALRTVANEMYALRTV-ANEMNALRTVVNEMNALRTVVNEMN  502

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A   + L  V N ++ L+ + N ++ LR +AN    L+ V N  + LR VAN   
Sbjct  503  ALRTVANEMNALRTVANEMNALRTVVNEMNALRTVANEMYSLRTVANEMNALRTVANEMY  562

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH  532
             LR ++N ++ ++ + N    LR +AN  + L+ +A+
Sbjct  563  ALRTVANEMYAIRTVANEMNALRTVANEMNALRTVAN  599


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 92/196 (47%), Gaps = 9/196 (5%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L  VAN +  L+ V++  + L  + + ++  + + AN +  L+ + N    LR + N  +
Sbjct  324  LRTVANEMYALRTVANEMNALRTVANKMYALRTV-ANEMYALRTVANEMYALRTVANEMY  382

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
              +  A     L  V N +  L+ + N +  LR +AN    L+ V N    LR VAN  +
Sbjct  383  SLRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMN  442

Query  422  HLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH----LQAVTHLRFHLQALANPLC  589
             LR + N ++ L+ + N    LR +AN    L+ +A+    L+ V +    L+ + N + 
Sbjct  443  ALRTVVNEMYALRTVANEMYALRTVANEMYALRTVANEMNALRTVVNEMNALRTVVNEMN  502

Query  590  HLKVMLAVVANPLPHL  637
             L+     VAN +  L
Sbjct  503  ALR----TVANEMNAL  514


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 77/158 (49%), Gaps = 8/158 (5%)
 Frame = +2

Query  176  LSHLQAMVNPRSHLREMVNPPFHRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANL  355
            ++ L+ + N    LR + N  +  +  A     L  V N +  L+ + N +  LR +AN 
Sbjct  1    MNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANE  60

Query  356  PSHLQKVTNLPSHLRAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAH-  532
             + L+ V N  + LR VAN    LR ++N ++ L+ + N    LR +AN    L+ +A+ 
Sbjct  61   MNALRTVANEMNALRTVANEMYALRTVANEMYALRTVANEMYALRTVANEMYALRTVANE  120

Query  533  ---LQAVTHLRFHLQALANPLCHLKVMLAVVANPLPHL  637
               L+ V +  + L+ +AN +  L+     VAN +  L
Sbjct  121  MYALRTVANEMYALRTVANEMNALR----TVANEMYAL  154



>ref|XP_006397698.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum]
 gb|ESQ39151.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum]
Length=134

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P  PCC  L+GL N + A CLCTA K  V  
Sbjct  51   TCPTDTLKLGVCA---DLLGLVNVVAGSPPKTPCCALLKGLANLEAAVCLCTALKANVLG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL  CG++ P GF+C
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQC  133



>ref|XP_002874775.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51034.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
Length=168

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 6/100 (6%)
 Frame = +1

Query  619  QPSTSPSN-NNGGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQT  792
            +P T PS   + G CP D L+LGVCA     + S+L I    P  +PCC+ ++GL +   
Sbjct  71   RPVTPPSTPGSSGNCPIDALKLGVCA---NVLSSLLNIQLGQPSAQPCCSLIQGLVDLDA  127

Query  793  ATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            A CLCTA +  V  IN N  +++  LL +C R+ P GF+C
Sbjct  128  AICLCTALRANVLGINLNVPISLSVLLNVCNRKVPSGFQC  167



>gb|KHN04346.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  + + L      P+ PCC  L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNATL---GQPPVTPCCTLLDGLVDLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+ P+ F+C
Sbjct  109  GINLNLPISLSLLLNVCSRKVPRNFQC  135



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            CPRD L+LGVCA     +G++L +    P + PCC+ L GL + + A CLCTA K  +  
Sbjct  52   CPRDALKLGVCA---DVLGNLLNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILG  108

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL +C ++ P GFKC
Sbjct  109  INLNIPISLSLLLNVCSKQVPPGFKC  134



>ref|NP_001238293.1| uncharacterized protein LOC100527330 precursor [Glycine max]
 gb|ACU16403.1| unknown [Glycine max]
Length=136

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  + + L      P+ PCC  L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNATL---GQPPVTPCCTLLDGLVDLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+ P+ F+C
Sbjct  109  GINLNLPISLSLLLNVCSRKVPRNFQC  135



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCPRD ++LGVCA  +K +  +  +  + P  PCC+ + GL + + A CLCTA K  V 
Sbjct  46   ATCPRDTIKLGVCANVLKNLLHL--VVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVL  103

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +N N  +++  LL  CG++ P GF+C
Sbjct  104  GLNLNVPVSLSLLLNYCGKKVPSGFQC  130



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 57/106 (54%), Gaps = 6/106 (6%)
 Frame = +1

Query  595  QSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRG  774
            Q   +S   P+ +PS     TCPRD L+LG CA     +  ++ +    P  PCC+ + G
Sbjct  39   QPKHASPALPNPNPSK--PATCPRDTLKLGACA---DVLNGLVHLVVGPPKFPCCSLIEG  93

Query  775  LTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            L +   A CLCTA K  V  IN N  +++  LL  CG++ P G++C
Sbjct  94   LVDLDAAVCLCTAIKANVMGINLNIPISLSLLLNYCGKQVPTGYEC  139



>ref|XP_008437101.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 9/90 (10%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
            G CPRD L+LGVCA   K +G +  +D +I   P+ PCC+ + GL + + A CLCTA K 
Sbjct  56   GKCPRDTLKLGVCA---KLLGGL--VDVTIGKPPVTPCCSLIEGLADLEAAVCLCTAIKA  110

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +  +N N  +++  LL +C +  PKGF+C
Sbjct  111  NLLGLNLNIPVSLSLLLNVCQKNVPKGFQC  140



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            +CPRD L+LGVCA  +  + +I  +  + P  PCC+ L GL + + A CLCTA K  V  
Sbjct  50   SCPRDALKLGVCADLLNGLVNI--VVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL  CG+  P GF+C
Sbjct  108  INLNVPVSLSLLLNYCGKDVPYGFQC  133



>ref|XP_010676151.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=131

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            TCP D L+LGVCA     +G++L +    P ++PCC+ ++GL + + A CLCT  +  V 
Sbjct  46   TCPIDTLKLGVCA---NLLGNLLHLQIGTPPVQPCCSLIQGLVDLEAAVCLCTVIRANVL  102

Query  832  RINNADLAI--YTLLKLCGRRAPKGFKC  909
             + N +L +    LL +CGR+ P+GF C
Sbjct  103  DLINLNLPVNLSLLLNVCGRQVPRGFVC  130



>ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
 gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
Length=134

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P  PCC+ L+GL N + A CLCTA K  V  
Sbjct  51   TCPTDTLKLGVCA---DLLGLVNVLIGSPPKTPCCSLLQGLANLEAAVCLCTALKANVLG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL  CG++ P GF+C
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQC  133



>ref|NP_192992.1| auxin-Induced in Root cultures 1 [Arabidopsis thaliana]
 sp|Q9S7I2.1|AIR1_ARATH RecName: Full=Putative lipid-binding protein AIR1; AltName: Full=Auxin-induced 
in root cultures protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95273.1|AF410287_1 AT4g12550/T1P17_140 [Arabidopsis thaliana]
 gb|AAD12258.1| putative cell wall-plasma membrane disconnecting CLCT protein 
[Arabidopsis thaliana]
 emb|CAB41725.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
 emb|CAB78298.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
 gb|AAM10352.1| AT4g12550/T1P17_140 [Arabidopsis thaliana]
 gb|AEE83146.1| auxin-Induced in Root cultures 1 [Arabidopsis thaliana]
Length=111

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP++ +E+G C   +  +   L    + P++PCC+ ++GL + + A CLCTA K  + 
Sbjct  26   GTCPKNSIEIGTCVTVLNLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTAVKASIL  82

Query  832  RINNADLAI--YTLLKLCGRRAPKGFKC  909
             I N +L I    LL +C R APK F+C
Sbjct  83   GIVNINLPINLSVLLNVCSRNAPKSFQC  110



>ref|XP_004516838.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=166

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            TCPRD L+LGVCA     +  +L +     P+ PCC+ L+GL + + A CLCTA K  + 
Sbjct  82   TCPRDALKLGVCA---NVLNGLLNVTLGQPPVTPCCSLLQGLVDLEAAVCLCTALKANIL  138

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+AP+ F+C
Sbjct  139  GINLNLPISLSLLLNVCSRQAPRDFQC  165



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCP+D L+LGVCA  +  +  +  +  S P  PCC+ + GL + + A CLCTA K  V 
Sbjct  47   ATCPKDTLKLGVCANLLNDLVHL--VVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL  CG++ P GF+C
Sbjct  105  GINLNVPVSLSLLLNYCGKKVPSGFQC  131



>ref|XP_010539640.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=133

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LG+C   +K +   LQ+    P++PCC+ + GL + + A CLCT  K  V 
Sbjct  48   GKCPRDTLKLGICLNVLKGLVD-LQLGQP-PVKPCCSLIEGLADLEAAACLCTVLKANVL  105

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +  N  +++  LL +C R+AP GFKC
Sbjct  106  GLKLNVPVSLSLLLNVCKRKAPSGFKC  132



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CP+D L+LGVCA  +  +  +  +  + P  PCC  L+GL + + A CLCTA K  V 
Sbjct  49   GKCPKDTLKLGVCANLLNDLVHL--VVGAPPKTPCCTLLKGLADLEAALCLCTAIKANVL  106

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL  CG++ P GF+C
Sbjct  107  GINLNVPVSLSLLLNYCGKKVPTGFQC  133



>dbj|BAA05471.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=87

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  I  S P  PCC+ + GL + + A CLCTA +  V 
Sbjct  3    GRCPRDALKLGVCANLVG--GLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVL  60

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  61   GINLNVPLSLSLVLNNCGRNPPTGFTC  87



>ref|XP_002880164.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56423.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA   + +G +  +  S P  PCC  L+GL N + A CLCTA K  V  
Sbjct  51   TCPTDTLKLGVCA---ELLGLVNLVVGSPPKTPCCTLLQGLANLEAAVCLCTALKANVLG  107

Query  835  IN-NADLAIYTLLKLCGRRAPKGFK  906
            IN N  + +  LL  CG++ P GF+
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQ  132



>ref|XP_009049229.1| hypothetical protein LOTGIDRAFT_112822 [Lottia gigantea]
 gb|ESP00038.1| hypothetical protein LOTGIDRAFT_112822 [Lottia gigantea]
Length=451

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 94/198 (47%), Gaps = 15/198 (8%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L + +  LPHL+I S    HL I    L  H  I +  LSHL+      SHLR  +N  +
Sbjct  61   LRIYSRYLPHLRIYSRYLPHLRIYSRYL-SHMRIYSRYLSHLRICSCYLSHLR--INSRY  117

Query  242  --HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANP  415
              H +  ++  SHL I    LSHL   T  LSHLR  +   SHL   +   SHLR  +  
Sbjct  118  LSHLRIYSRYLSHLRIYSCYLSHLLINTCYLSHLRIYSCYLSHLIIYSCYLSHLRIYSCY  177

Query  416  PSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAHLQAVTHLRFHLQALANPLCHL  595
             SHLR  S  L HL+       +LR  +   S+L++ +  + ++HLR + + L+      
Sbjct  178  LSHLRIYSCYLSHLRIYSCYLSYLRIYSRYLSNLRINS--RYLSHLRIYSRYLS------  229

Query  596  KVMLAVVANPLPHLLITT  649
               L + +  L H+ I +
Sbjct  230  --YLIIYSRYLSHMRINS  245



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCPRD ++LGVCA  +K +  +  +  + P  PCC+ + GL + + A CLCTA K  V 
Sbjct  62   ATCPRDTIKLGVCANVLKNLLHL--VVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVL  119

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +N N  +++  LL  CG++ P GF+C
Sbjct  120  GLNLNVPVSLSLLLNYCGKKVPSGFQC  146



>ref|NP_001053512.1| Os04g0554600 [Oryza sativa Japonica Group]
 emb|CAD41235.2| OSJNBa0010H02.23 [Oryza sativa Japonica Group]
 dbj|BAF15426.1| Os04g0554600 [Oryza sativa Japonica Group]
 gb|EAZ31583.1| hypothetical protein OsJ_15725 [Oryza sativa Japonica Group]
Length=131

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  + 
Sbjct  47   GKCPRDALKLGVCANVLGLIKAKVGVP---PAEPCCPLLEGLVDLEAAVCLCTAIKGNIL  103

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+R P GFKC 
Sbjct  104  GINLNLPVDLSLILNYCGKRVPTGFKCF  131



>gb|AAM63191.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
Length=111

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP++ +E+G C   +  +   L    + P++PCC+ ++GL + + A CLCTA K  + 
Sbjct  26   GTCPKNSIEIGTCVTVLNLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTALKASIL  82

Query  832  RINNADLAI--YTLLKLCGRRAPKGFKC  909
             I N +L I    LL +C R APK F+C
Sbjct  83   GIVNINLPINLSVLLNVCSRNAPKSFQC  110



>ref|XP_002454527.1| hypothetical protein SORBIDRAFT_04g032680 [Sorghum bicolor]
 gb|EES07503.1| hypothetical protein SORBIDRAFT_04g032680 [Sorghum bicolor]
Length=119

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  + 
Sbjct  36   GKCPRDALKLGVCANVLGLIKAKVAVP---PAEPCCPLLEGLVDLEAAVCLCTAIKGNIL  92

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  +L  CG+  P GFKC
Sbjct  93   GINLNLPIDLSLILNYCGKTVPTGFKC  119



>ref|XP_008772969.1| PREDICTED: uncharacterized protein LOC102547221 [Rattus norvegicus]
 ref|XP_008772971.1| PREDICTED: uncharacterized protein LOC102547221 [Rattus norvegicus]
 ref|XP_008758404.1| PREDICTED: uncharacterized protein LOC102547221 [Rattus norvegicus]
 ref|XP_008758405.1| PREDICTED: uncharacterized protein LOC102547221 [Rattus norvegicus]
Length=339

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 64/147 (44%), Gaps = 1/147 (1%)
 Frame = -3

Query  528  AITWRWDGGLAIARRWHGRLTIAWRWNRRLDIARRWDGGLATARRWDGRLVTFWRWDGRL  349
             +++RWD    ++ RW     ++ RW+    ++ RWD     + RWD       RWD   
Sbjct  4    GVSYRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDT  63

Query  348  AIARRWDRGLVIAWRWDRRLTTIGRWDGGLAVAWRWNGGLTISRRWDRGLTIAWR*DRGL  169
             ++ RWD    ++ RWD       RWD    V+ RW+    +S RWD    ++ R D   
Sbjct  64   GVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDT  123

Query  168  AVITWWRNRLSPIIRRWDRRLDTIWRW  88
             V   W +  + +  RWD       RW
Sbjct  124  GVSHRW-DMDTGVSHRWDMDTGVSHRW  149


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 69/167 (41%), Gaps = 1/167 (1%)
 Frame = -3

Query  528  AITWRWDGGLAIARRWHGRLTIAWRWNRRLDIARRWDGGLATARRWDGRLVTFWRWDGRL  349
             ++ RWD    ++ RW     ++ RW+    ++ RWD     + RWD       RWD   
Sbjct  44   GVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDT  103

Query  348  AIARRWDRGLVIAWRWDRRLTTIGRWDGGLAVAWRWNGGLTISRRWDRGLTIAWR*DRGL  169
             ++ RWD    ++ RWD       RWD    V+ RW+    +S RWD    ++ R D   
Sbjct  104  GVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDTDT  163

Query  168  AVITWWRNRLSPIIRRWDRRLDTIWRWGKGLATTGSRGLDTTAFISW  28
             V   W +  + +  RWD       RW      +    +DT    SW
Sbjct  164  GVSHRW-DTDTGVSHRWDTDTGVSHRWDMDTGVSHRWDMDTAVSRSW  209


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 54/123 (44%), Gaps = 2/123 (2%)
 Frame = -3

Query  528  AITWRWDGGLAIARRWHGRLTIAWRWNRRLDIARRWDGGLATARRWDGRLVTFWRWDGRL  349
             ++ RWD    ++ RW     ++ RW+    ++ RWD     + RWD       RWD   
Sbjct  114  GVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDMDTGVSHRWDTDTGVSHRWDTDT  173

Query  348  AIARRWDRGLVIAWRWDRRLTTIGRWDGGLAV--AWRWNGGLTISRRWDRGLTIAWR*DR  175
             ++ RWD    ++ RWD       RWD   AV  +W  + G++       G++  W  D 
Sbjct  174  GVSHRWDTDTGVSHRWDMDTGVSHRWDMDTAVSRSWDTDTGMSHKSYMLTGVSHIWDVDT  233

Query  174  GLA  166
            G+ 
Sbjct  234  GVP  236



>ref|XP_009333632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            PS SP      +CPRD L+LGVCA  +   G++  +  + P  PCC  L GL + + A C
Sbjct  46   PSASPK-----SCPRDSLKLGVCAKLLN--GAVGAVVGNPPDHPCCALLEGLVDLEVAVC  98

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            LCTA K  +  IN N  +A+  ++  C +  P+GFKC
Sbjct  99   LCTAIKANILGINLNIPIALSLVIDGCAKNVPEGFKC  135



>ref|XP_009798258.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=135

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            GG CP D L+LGVCA     +  +L +    P ++PCC+ +  L + + A CLCTA K  
Sbjct  49   GGKCPTDALKLGVCA---NVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKAK  105

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  +N N  +++  LL +C ++APKGF C
Sbjct  106  ILGVNLNLPISLNLLLNVCSKKAPKGFTC  134



>ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=128

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CP + L+LGVCA  +K +  +++I    P +PCC  L GL + + A CLCTA K  + 
Sbjct  44   GNCPMNTLKLGVCADVLKAL--VVKIGKP-PKKPCCTLLEGLVDLEAAVCLCTALKANIL  100

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             I  N  + +  LL  CG++APKGF+C
Sbjct  101  GIKLNIPIDLSLLLNYCGKKAPKGFQC  127



>ref|XP_003549907.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=138

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G +CPRD L+LGVCA  +K + ++       P+ PCC  L GL + + A CLCTA K  V
Sbjct  52   GASCPRDALKLGVCANVLKGLLNVTL--GQPPVTPCCTLLDGLVDLEAAVCLCTALKANV  109

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C R+ P+ F+C
Sbjct  110  LGINLNLPISLSLLLNVCSRQVPRDFQC  137



>ref|XP_009061086.1| hypothetical protein LOTGIDRAFT_176866, partial [Lottia gigantea]
 gb|ESO88226.1| hypothetical protein LOTGIDRAFT_176866, partial [Lottia gigantea]
Length=670

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 91/194 (47%), Gaps = 15/194 (8%)
 Frame = +2

Query  80   PLPHLQIVSSLRSHLLIMGDNL--FRHQVITANPLSHLQAMVNPRSHLREMVNPPFHRQA  253
             L HL+I SS  SHL I    L   R   I +  LSH++      SHLR       H + 
Sbjct  2    YLSHLRIYSSYLSHLRIYSRYLPLLR---IYSCYLSHMRIYSRYLSHLRIYSCYLSHLRI  58

Query  254  TAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPSHLRA  433
             ++  SHL I    LSHL+  +  LSHLR  +   SHL+  +    HLR  +    HLR 
Sbjct  59   NSRYLSHLIIYSRYLSHLRIYSCYLSHLRINSCYLSHLRIYSRYLPHLRIYSRYLPHLRI  118

Query  434  ISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAHLQAVTHLRFHLQALANPLCHLKVMLAV  613
             S  L H++       HLR  +   SHL++ +  + ++HLR + + L++        L +
Sbjct  119  YSRYLSHMRIYSRYLSHLRICSCYLSHLRINS--RYLSHLRIYSRYLSH--------LRI  168

Query  614  VANPLPHLLITTVE  655
             +  L HLLI T  
Sbjct  169  YSCYLSHLLINTCY  182


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 86/187 (46%), Gaps = 5/187 (3%)
 Frame = +2

Query  56   PLLPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNP  235
            PLL + +  L H++I S   SHL I    L  H  I +  LSHL       SHLR     
Sbjct  24   PLLRIYSCYLSHMRIYSRYLSHLRIYSCYL-SHLRINSRYLSHLIIYSRYLSHLRIYSCY  82

Query  236  PFHRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANP  415
              H +  +   SHL I    L HL+  +  L HLR  +   SH++  +   SHLR  +  
Sbjct  83   LSHLRINSCYLSHLRIYSRYLPHLRIYSRYLPHLRIYSRYLSHMRIYSRYLSHLRICSCY  142

Query  416  PSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQV----IAHLQAVTHLRFHLQALANP  583
             SHLR  S  L HL+       HLR  +   SHL +    ++HL+  +    HL+  +  
Sbjct  143  LSHLRINSRYLSHLRIYSRYLSHLRIYSCYLSHLLINTCYLSHLKIYSCYLSHLRIYSRY  202

Query  584  LCHLKVM  604
            L HL++ 
Sbjct  203  LSHLRIY  209


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 97/212 (46%), Gaps = 15/212 (7%)
 Frame = +2

Query  44   VVSKPL--LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHL  217
            + S+ L  L + +  L H++I S   SHL I    L  H  I +  LSHL+      SHL
Sbjct  108  IYSRYLPHLRIYSRYLSHMRIYSRYLSHLRICSCYL-SHLRINSRYLSHLRIYSRYLSHL  166

Query  218  REMVNPPFHRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHL  397
            R       H        SHL I    LSHL+  +  LSHLR  +   SH +  +   SH 
Sbjct  167  RIYSCYLSHLLINTCYLSHLKIYSCYLSHLRIYSRYLSHLRIYSCYLSHQRIYSCYKSHQ  226

Query  398  RAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQVIAHLQAVTHLRFHLQALA  577
            R  +   S+LR  S  L HL+       HLR  +   SHL++ +  + +++LR +   L+
Sbjct  227  RIYSCYLSYLRINSRCLSHLRIYSRYLSHLRIYSCYLSHLRINS--RYLSYLRIYSCYLS  284

Query  578  NPLCHLKV---MLA---VVANPLPHLLITTVE  655
                HL++    L+   + +  L HL+I +  
Sbjct  285  ----HLRINSCYLSHQRIYSCYLSHLIIYSCY  312


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 104/219 (47%), Gaps = 27/219 (12%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L + +  L +L+I S   SHL I    L  HQ I +  LSHL       SHLR       
Sbjct  266  LRINSRYLSYLRIYSCYLSHLRINSCYL-SHQRIYSCYLSHLIIYSCYLSHLRIYSRYLS  324

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKVTNLPSHLRAVANPPS  421
            H++  +   SHL I    LS+L+  +  LS+L   +   SHL+  +   SHLR  +   S
Sbjct  325  HQRIYSCYLSHLRIYSCYLSYLRIYSRYLSYLIIYSRYLSHLRIYSCYLSHLRINSRYLS  384

Query  422  HLRAISNLLFHLQAIVNLPCHL---RAIANPPSHLQV----IAHLQ----AVTHLRFHLQ  568
            +LR  S  L HL+  +N  C+L   R  +   SHL++    +++L+     +++LR + +
Sbjct  385  YLRIYSCYLSHLR--IN-SCYLSHQRIYSCYLSHLRIYSCYLSYLRIYSCYLSYLRIYSR  441

Query  569  ALAN------PLCHLKV------MLAVVANPLPHLLITT  649
             L+N       L HL++       L + +  L H+ I +
Sbjct  442  YLSNLRINSRYLSHLRIYSRYLSYLIIYSRYLSHMRINS  480


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 97/228 (43%), Gaps = 31/228 (14%)
 Frame = +2

Query  62   LPVVANPLPHLQIVSSLRSHLLIMGDNLFRHQVITANPLSHLQAMVNPRSHLREMVNPPF  241
            L + +  L HL+I S   SHL I    L  H  I +  L HL+       HLR       
Sbjct  66   LIIYSRYLSHLRIYSCYLSHLRINSCYL-SHLRIYSRYLPHLRIYSRYLPHLRIYSRYLS  124

Query  242  HRQATAKPPSHLPIVVNLLSHLQAMTNPLSHLRAMANLPSHLQKV----------TNLPS  391
            H +  ++  SHL I    LSHL+  +  LSHLR  +   SHL+            T   S
Sbjct  125  HMRIYSRYLSHLRICSCYLSHLRINSRYLSHLRIYSRYLSHLRIYSCYLSHLLINTCYLS  184

Query  392  HLRAVANPPSHLRAISNLLFHLQAIVNLPCHLRAIANPPSHLQV----IAHL----QAVT  547
            HL+  +   SHLR  S  L HL+       H R  +   SH ++    +++L    + ++
Sbjct  185  HLKIYSCYLSHLRIYSRYLSHLRIYSCYLSHQRIYSCYKSHQRIYSCYLSYLRINSRCLS  244

Query  548  HLRF------HLQALANPLCHLKV------MLAVVANPLPHLLITTVE  655
            HLR       HL+  +  L HL++       L + +  L HL I +  
Sbjct  245  HLRIYSRYLSHLRIYSCYLSHLRINSRYLSYLRIYSCYLSHLRINSCY  292



>ref|XP_002454523.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 ref|XP_002454526.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
 gb|EES07499.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 gb|EES07502.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
Length=122

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  V 
Sbjct  39   GSCPRDALKLGVCANVLGLIKAQVGVP---PAEPCCPLLAGLVDLEAAVCLCTAIKANVL  95

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L +  +L  CG+  P GF C
Sbjct  96   GINLNVPLDLSLILNYCGKTVPTGFMC  122



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCP+D L+LGVCA  +  +  +  +  S P  PCC+ + GL + + A CLCTA K  V 
Sbjct  47   ATCPKDTLKLGVCANLLNDLVHL--VVGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL  CG++ P GF+C
Sbjct  105  GINLNVPVSLSLLLNYCGKKVPSGFQC  131



>ref|XP_009148613.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
 emb|CDY53347.1| BnaA06g38220D [Brassica napus]
Length=137

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
            G CP+D L+LGVCA  +  +     +D ++   P+ PCC+ ++GL + + A CLCTA K 
Sbjct  53   GKCPKDTLQLGVCANVLNGL-----LDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKA  107

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             V  IN N  +++  LL +C ++ P GF+C
Sbjct  108  NVLGINLNLPISLSLLLNVCSKQVPPGFQC  137



>ref|NP_001237154.1| uncharacterized protein LOC100500124 precursor [Glycine max]
 gb|ACU15034.1| unknown [Glycine max]
Length=136

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  +   L      P+ PCC  L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNVTL---GQPPVTPCCTLLDGLVDLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+ P+ F+C
Sbjct  109  GINLNLPISLSLLLDVCSRKVPRDFQC  135



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LGVCA     +G++L +   + P +PCC+ + GL + + A CLCTA K  +
Sbjct  52   GKCPIDTLKLGVCA---NVLGNVLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANI  108

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL  CG++AP GF+C
Sbjct  109  LGINLNVPLSLSLLLNACGKKAPSGFQC  136



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            PS SP      +CPRD L+LGVCA  +   G++  +  + P  PCC  L GL + + A C
Sbjct  46   PSASPK-----SCPRDSLKLGVCAKLLN--GAVGAVVGNPPDHPCCALLEGLVDLEVAVC  98

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            LCTA K  +  IN N  +A+  ++  C +  P+GFKC
Sbjct  99   LCTAIKANILGINLNIPIALSLVIDGCAKNVPEGFKC  135



>emb|CDY31240.1| BnaC08g15350D [Brassica napus]
Length=137

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 9/90 (10%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
            G CP+D L+LGVCA  +  +     +D ++   P++PCC+ ++GL + + A CLCTA K 
Sbjct  53   GKCPKDTLKLGVCANVLNGL-----LDLTLGKPPVKPCCSLIQGLADVEAAVCLCTALKA  107

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             V  IN N  +++  LL +C ++ P GF+C
Sbjct  108  NVLGINLNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_006391856.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
 gb|ESQ29142.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
Length=147

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            CPRD L+LGVCA     +  +L I    P + PCCN ++GL + + A CLCTA K  +  
Sbjct  65   CPRDALKLGVCA---NVLNGLLNITLGKPPVEPCCNLIKGLADLEAAACLCTALKGNILG  121

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  L++  LL +C ++ P GF+C
Sbjct  122  INLNIPLSLSLLLNVCSKKVPPGFQC  147



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA  +  IG  +    S P +PCC+ L GL + + A CLCTA K  +  
Sbjct  64   TCPGDALKLGVCADLLGLIGISI---GSPPTKPCCSLLEGLADLEAAVCLCTAIKANILG  120

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  +L  CG+  PKGF+C
Sbjct  121  INLNVPISLSLILNNCGKSVPKGFQC  146



>gb|ACE82175.1| extensin-like protein [Glycine max]
 gb|KHN04348.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  +   L      P+ PCC  L GL + + A CLCTA K  + 
Sbjct  52   GSCPRDALKLGVCANVLNLVNVTL---GQPPVTPCCTLLDGLVDLEAAVCLCTALKANIL  108

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+ P+ F+C
Sbjct  109  GINLNLPISLSLLLNVCSRKVPRDFQC  135



>ref|XP_002454525.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
 gb|EES07501.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
Length=122

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  V 
Sbjct  39   GSCPRDALKLGVCANVLGLIKAQVGVP---PAEPCCPLLAGLVDLEAAVCLCTAIKANVL  95

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L +  +L  CG+  P GF C
Sbjct  96   GINLNVPLDLSLILNYCGKTVPTGFMC  122



>gb|AAC62610.1| similar to the C-terminus of putative plasma membrane-cell wall 
linker proteins [Arabidopsis thaliana]
Length=108

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP++ +E+G C   +  +   L    + P++PCC+ ++GL + + A CLCTA K  + 
Sbjct  23   GTCPKNSIEIGTCVTVLNLVDLTL---GNPPVKPCCSLIQGLADLEAAACLCTALKASIL  79

Query  832  RINNADLAI--YTLLKLCGRRAPKGFKC  909
             I N +L I    LL +C R APK F+C
Sbjct  80   GIVNINLPINLSVLLNVCSRNAPKSFQC  107



>ref|XP_004976456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=129

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + Q A CLCTA K  + 
Sbjct  45   GKCPRDALKLGVCANVLGLIKAKIGVP---PTEPCCPLLEGLVDLQAAVCLCTAIKGNIL  101

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+  P GFKC+
Sbjct  102  GINLNLPIDVSLILNHCGKTVPTGFKCL  129



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            PS SP      +CPRD L+LGVCA  +   G++  +  + P  PCC  L GL + + A C
Sbjct  46   PSASPK-----SCPRDSLKLGVCAKLLN--GAVGAVVGNPPDHPCCALLEGLVDLEVAVC  98

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            LCTA K  +  IN N  +A+  ++  C +  P+GFKC
Sbjct  99   LCTAIKANILGINLNIPIALSLVIDGCAKNVPEGFKC  135



>ref|XP_007155641.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
 gb|ESW27635.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
Length=133

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +   G +       P+ PCC  L GL + + A CLCTA K  + 
Sbjct  48   GSCPRDALKLGVCANVLN--GLVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANIL  105

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R+AP+ F+C
Sbjct  106  GINLNLPISLSLLLNVCSRQAPRDFQC  132



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCPRD L+LGVCA  +   G I  +  + P  PCC+ + GL + + A CLCTA K  V 
Sbjct  53   ATCPRDALKLGVCADLLG--GLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVL  110

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C ++ P+GF C
Sbjct  111  GINLNVPVSLTLLLNVCSKKVPEGFIC  137



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCPRD L+LGVCA  +   G I  +  + P  PCC+ + GL + + A CLCTA K  V 
Sbjct  53   ATCPRDALKLGVCADLLG--GLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVL  110

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C ++ P+GF C
Sbjct  111  GINLNVPVSLSLLLNVCSKKVPEGFIC  137



>ref|XP_002446913.1| hypothetical protein SORBIDRAFT_06g024770 [Sorghum bicolor]
 gb|EES11241.1| hypothetical protein SORBIDRAFT_06g024770 [Sorghum bicolor]
Length=130

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L+GL N + A CLCTA K  + 
Sbjct  46   GKCPRDALKLGVCANLLGLIKAKVGVP---PTEPCCPLLKGLVNLEAAVCLCTAIKGSIL  102

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+  P GFKC+
Sbjct  103  GINLNLPVDLSLILNHCGKTVPTGFKCL  130



>ref|XP_010424613.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CPRD L+LGVCA  +K +   L    + P+ PCC+ ++GL + + A CLCT  K+ V 
Sbjct  23   AACPRDSLQLGVCANVLKLVDITL---GNPPVTPCCSLIQGLADLEAAVCLCTLVKVNVL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN    + +  LL +CGR  P  F+CV
Sbjct  80   GINLKLPIDLSVLLNVCGRTPPTNFQCV  107



>ref|XP_003608743.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90940.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK42391.1| unknown [Medicago truncatula]
Length=143

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            GTCPRD L+LGVCA     +  +L +    P + PCC+ L GL + + A CLCTA K  +
Sbjct  58   GTCPRDALKLGVCA---NVLSGLLNLTLGKPPVTPCCSLLNGLVDLEAAACLCTALKANI  114

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C R+ P  F+C
Sbjct  115  LGINLNLPISLSLLLNVCSRKVPHDFQC  142



>ref|XP_009110671.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDY21033.1| BnaA08g24920D [Brassica napus]
Length=137

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
            G CP+D L+LGVCA  +  +     +D ++   P+ PCC+ ++GL + + A CLCTA K 
Sbjct  53   GKCPKDTLKLGVCANVLSGL-----LDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKA  107

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             V  IN N  +++  LL +C ++ P GF+C
Sbjct  108  NVLGINLNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_009333674.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 8/103 (8%)
 Frame = +1

Query  619  QPSTSPSNN-----NGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTN  783
            QP T+P  N        +CPRD L+LGVCA  +   G +  +  + P  PCC  L GL +
Sbjct  35   QPITNPKPNPIPSAASKSCPRDSLKLGVCAKLLN--GVVGAVVGNPPDHPCCALLEGLVD  92

Query  784  SQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + A CLCTA K  +  IN N  +A+  ++  C +  P GFKC
Sbjct  93   LEVAVCLCTAIKANILGINLNIPIALSLVIDGCAKNVPAGFKC  135



>ref|XP_004246067.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA     +G +  +  S P+ PCC  L GL N++ A CLCTA K  +  
Sbjct  48   TCPIDTLKLGVCA---DVLGLVNVVVGSPPVTPCCTLLSGLANAEAALCLCTALKANILG  104

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL +C + AP GF+C
Sbjct  105  INLNLPISLSLLLNVCSKEAPAGFQC  130



>ref|XP_010264241.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=134

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCPRD L+LGVCA  +  +  +     + P  PCC+ ++GL N + A CLCTA K  + 
Sbjct  50   GTCPRDALKLGVCANVLNLVNVV---VGTPPYLPCCSLIQGLANLEAAVCLCTAIKANIL  106

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CG++ P GF+C
Sbjct  107  GINLNIPLSLSLVLNNCGKKFPTGFQC  133



>ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
 gb|EMJ10944.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
Length=144

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            G  CPRD L+LGVCA     +  +L I    P + PCC+ ++GL + + A CLCTA K  
Sbjct  58   GTRCPRDTLKLGVCA---NVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKAN  114

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG + PK F+C
Sbjct  115  ILGINLNIPISLSLLLNVCGNKVPKDFQC  143



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LG+CA     +G++L +   + P +PCC+ ++GL + + A CLCTA K  +
Sbjct  56   GKCPVDALKLGICA---NVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANI  112

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +CG++ P GF+C
Sbjct  113  LGINLNVPISLSLLLNVCGKKVPSGFQC  140



>ref|XP_008238564.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=147

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLI  825
            G  CPRD L+LGVCA     +  +L I    P + PCC+ ++GL + + A CLCTA K  
Sbjct  61   GTKCPRDTLKLGVCA---NVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKAN  117

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +  IN N  +++  LL +CG + PK F+C
Sbjct  118  ILGINLNIPISLSLLLNVCGNKVPKDFQC  146



>ref|XP_008663526.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Zea mays]
 gb|AFW59244.1| hypothetical protein ZEAMMB73_930140 [Zea mays]
Length=128

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L+GL + + A CLCTA K  V 
Sbjct  44   GKCPRDALKLGVCANVLGLIKAKVGVP---PTEPCCPLLKGLVDLEAAVCLCTAIKGEVL  100

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             I  N  + +  +L  CG+R P GFKC+
Sbjct  101  GIKLNLPVDLSLILNHCGKRVPTGFKCL  128



>gb|KHG02760.1| 14 kDa proline-rich DC2 [Gossypium arboreum]
Length=132

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  +   +    S P+ PCC+ L GL + + A CLCTA +  + 
Sbjct  49   GRCPRDALKLGVCANVLNLVNVTV---GSPPVMPCCSLLNGLVDLEAAACLCTAIRANIL  105

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R  P GF+C
Sbjct  106  GINLNIPVSLSLLLNVCSRNVPTGFQC  132



>ref|XP_002271792.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80710.1| hypothetical protein VITISV_033377 [Vitis vinifera]
Length=135

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = +1

Query  592  PQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLR  771
            P+S  +    PS SP+     TCP+D L+LGVC   +  +  ++  +   P  PCC+ ++
Sbjct  33   PKSKTNPRPTPSPSPAR---ATCPKDTLKLGVCVDLLGGLLGVVVGNP--PKTPCCSLIQ  87

Query  772  GLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            GL + + A CLCTA K  V  IN N  L++  LL +C ++ P GF+C
Sbjct  88   GLADLEAAVCLCTAIKANVLGINLNIPLSLSLLLNVCSKKVPSGFQC  134



>ref|XP_010433288.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
              CPRD L+LGVCA  +K +   L    + P+ PCC+ ++G+ + + A CLCT  K  V 
Sbjct  23   AACPRDSLQLGVCANVLKLVDLTL---GNPPVTPCCSLIQGVADLEAAACLCTLVKANVL  79

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  LL +C R AP  F+CV
Sbjct  80   GINLNLPIDLTVLLNVCSRTAPTNFQCV  107



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            +CPRD L+LGVCA  +  IG  +    S P  PCC+ L+GL + + A CLCTA K  +  
Sbjct  64   SCPRDALKLGVCANLLNIIGISI---GSPPTEPCCSLLQGLADLEAALCLCTAIKANILG  120

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  +L  CG++ P GF+C
Sbjct  121  INLNVPVSLSVILNDCGKKVPNGFQC  146



>ref|XP_008392579.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (55%), Gaps = 10/104 (10%)
 Frame = +1

Query  619  QPSTSPSNN-----NGGTCPRDRLELGVCA-LAVKKIGSILQIDHSIPIRPCCNCLRGLT  780
            QP T+P  N        +CPRD L+LGVCA L  + +G+++    + P  PCC  L GL 
Sbjct  35   QPMTNPKPNPIPSAAPKSCPRDSLKLGVCAKLLNRAVGAVVG---NPPDHPCCALLEGLV  91

Query  781  NSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              + A CLCTA K  +  IN N  +A+  ++  C +  P GFKC
Sbjct  92   ELEVAVCLCTAIKANILGINLNIPIALSLIIDGCAKNVPSGFKC  135



>ref|XP_004516836.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=157

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G+CP D L+LGVCA     +  +L I    P + PCC+ L GLT+ Q A CLCTA K  +
Sbjct  72   GSCPSDTLKLGVCA---NVLNGLLNIKLGQPPVAPCCSLLEGLTDLQAAACLCTALKANI  128

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C ++ P+ F+C
Sbjct  129  LGINLNLPISLSLLLNVCSKKVPRDFQC  156



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSIL-QIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LGVCA     +G++L  +  + P +PCC  ++G+ + + A CLCTA K  +
Sbjct  47   GKCPIDTLKLGVCA---NVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANI  103

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +CG++ P GF+C
Sbjct  104  LGINLNVPLSLSLLLNVCGKKVPSGFQC  131



>ref|XP_009333598.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 8/103 (8%)
 Frame = +1

Query  619  QPSTSPSNN-----NGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTN  783
            QP T+P  N        +CPRD L+LGVCA  +   G +  +  + P  PCC  L GL +
Sbjct  35   QPITNPKPNPIPSAASKSCPRDSLKLGVCAKLLN--GVVGAVVGNPPDHPCCALLEGLVD  92

Query  784  SQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + A CLCTA K  +  IN N  +A+  ++  C +  P GFKC
Sbjct  93   LEVAVCLCTAIKANILGINLNIPIALSLVIDGCAKNVPAGFKC  135



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LG+CA     +G++L +   + P +PCC+ ++GL + + A CLCTA K  +
Sbjct  56   GKCPIDALKLGICA---NVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANI  112

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +CG++ P GF+C
Sbjct  113  LGINLNVPISLSLLLNVCGKKVPSGFQC  140



>ref|XP_010264240.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=132

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +   G++     + P  PCC  L GL + + A CLCTA K  + 
Sbjct  47   GSCPRDALKLGVCAKLLN--GAVGAEVGNPPDHPCCTLLEGLVDLEVAACLCTAIKANIL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  L+  CG++ P GF+C
Sbjct  105  GINLNIPVSLSLLVNTCGKKLPSGFQC  131



>ref|XP_004516837.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=135

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATC  801
            P+TSPS     +CPRD L+LGVCA  +   G I  +  S P  PCC+ L GL + + A C
Sbjct  43   PNTSPSTK---SCPRDALQLGVCANLLN--GPIGAVIGSPPEHPCCSVLEGLLDLEVAVC  97

Query  802  LCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKCV  912
            LCTA K  +  IN N  +++  +L  C +  P  ++C+
Sbjct  98   LCTAIKANILGININIPISLSLILNACEKTPPSNYQCI  135



>ref|XP_009783170.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=126

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +1

Query  607  SSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTN  783
            S   +P+ +PS + G  CP D L+LGVCA     +  +L +   + P++PCC+ L  L +
Sbjct  27   SPKAKPTPTPSPSEG-KCPTDALKLGVCA---NVLNGLLNVTLGTPPVKPCCSLLGNLVD  82

Query  784  SQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + A CLCTA K  +  IN N  +++  LL +C +  PKGF C
Sbjct  83   LEAAVCLCTALKANILGINLNIPISLSLLLNVCSKDIPKGFTC  125



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             +CP+D L+LGVC   +  + +I  +  + P  PCC+ + GLT+ + A CLCTA K  V 
Sbjct  57   ASCPKDTLKLGVCGDLLNDLVTI--VVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVL  114

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN +  +++  LL  CG+  PKGF+C
Sbjct  115  GINLDVPVSLSLLLNYCGKSVPKGFQC  141



>gb|EAY95110.1| hypothetical protein OsI_16927 [Oryza sativa Indica Group]
Length=131

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA +  + 
Sbjct  47   GKCPRDALKLGVCANVLGLIKAKVGVP---PAEPCCPLLEGLVDLEAAVCLCTAIRGNIL  103

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+R P GFKC 
Sbjct  104  GINLNLPVDLSLILNYCGKRVPTGFKCF  131



>gb|KDP25651.1| hypothetical protein JCGZ_20807 [Jatropha curcas]
Length=244

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = +1

Query  589  SPQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCL  768
            SP++       P+ SPS    G CPRD L+LGVC   +K + S+     + P  PCC+ L
Sbjct  141  SPRNPSPKPNNPTPSPSQ---GACPRDTLKLGVCVDLLKDLLSV--TIGTPPKTPCCSLL  195

Query  769  RGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              L + + A CLCT  K  +  IN N  + +  LL  CG++ P+GF+C
Sbjct  196  GDLVDLEAAVCLCTTIKASLLGINLNLPIDLSLLLNYCGKKVPQGFQC  243



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            +CPRD LELGVCA  ++ + + LQ+ +  P +PCC+ L  L + + A CLCTA K  +  
Sbjct  52   SCPRDALELGVCANVLQGLIN-LQLGNP-PKKPCCSLLEDLVDLEAAVCLCTAIKANILG  109

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  + +  LL  CG++ P G+ C
Sbjct  110  INLNVPVDLSLLLNYCGKKVPAGYAC  135



>ref|XP_002454524.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
 gb|EES07500.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G+CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  V 
Sbjct  48   GSCPRDALKLGVCANVLGLIKAQVGVP---PAEPCCPLLAGLVDLEAAVCLCTAIKANVL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L +  +L  CG+  P GF C
Sbjct  105  GINLNVPLDLSLILNYCGKTVPTGFMC  131



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSIL-QIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LGVCA     +G++L  +  + P +PCC  ++G+ + + A CLCTA K  +
Sbjct  45   GKCPIDTLKLGVCA---NVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANI  101

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  L++  LL +CG++ P GF+C
Sbjct  102  LGINLNVPLSLSLLLNVCGKQVPSGFQC  129



>ref|XP_006652622.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Oryza brachyantha]
Length=124

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA +  V 
Sbjct  40   GRCPRDALKLGVCANVLGLIKAKVGVP---PAEPCCPLLDGLVDLEAAACLCTAIRGNVL  96

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+R P GFKC+
Sbjct  97   GINLNLPVDLSLILNYCGKRVPTGFKCL  124



>ref|NP_001053511.1| Os04g0554500 [Oryza sativa Japonica Group]
 emb|CAE01698.2| OSJNBa0010H02.22 [Oryza sativa Japonica Group]
 gb|AAR30140.1| lipid transfer protein-like protein [Oryza sativa Japonica Group]
 dbj|BAF15425.1| Os04g0554500 [Oryza sativa Japonica Group]
 gb|EAY95109.1| hypothetical protein OsI_16926 [Oryza sativa Indica Group]
Length=130

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA +  + 
Sbjct  47   GKCPRDALKLGVCANVLGLIKAKVGVP---PAEPCCPLLEGLVDLEAAVCLCTAIRGNIL  103

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  +L  CG+R P GFKC
Sbjct  104  GINLNLPVDLSLILNYCGKRVPTGFKC  130



>ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +1

Query  625  STSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCL  804
            S +P   +   CP+D L+LG CA     +  ++ +    P  PCC+ ++GL +   A CL
Sbjct  45   SPAPPKPSKAVCPKDTLKLGACA---DVLNGLVHLVVGPPKFPCCSLIQGLVDLDAAVCL  101

Query  805  CTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CTA K  V  IN N  +++  LL  CG++ P G++C
Sbjct  102  CTAIKANVLGINLNVPVSLSLLLNYCGKKVPSGYEC  137



>ref|XP_009783445.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  +  S P  PCC+ + GL + + A CLCTA +  V 
Sbjct  74   GRCPRDALKLGVCANLVG--GLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVL  131

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  132  GINLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|NP_001152584.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48357.1| cortical cell-delineating protein precursor [Zea mays]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  + 
Sbjct  48   GRCPRDALKLGVCANVLGLIKAKVGVP---PAEPCCPLLEGLVDLEAAVCLCTAIKGQIL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  +L  CGR  P GFKC
Sbjct  105  GINLNLPIDLSLILNYCGRTVPTGFKC  131



>ref|XP_009619252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAA95941.1| glycine-rich protein [Nicotiana tabacum]
Length=158

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  I  S P  PCC+ + GL + + A CLCTA +  V 
Sbjct  74   GRCPRDALKLGVCANLVG--GLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVL  131

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  132  GINLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_008238566.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=136

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = +1

Query  619  QPSTSPSNN-----NGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTN  783
            QP T+P  N        +CPRD L+LGVCA  +K  G++  I  + P  PCC  L GL +
Sbjct  35   QPITAPKTNPIPSVATKSCPRDALKLGVCANLLK--GAVGAIIGNPPDTPCCALLEGLLD  92

Query  784  SQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             + A CLCTA K  +  IN N  +A+  ++  C +  P GF+C
Sbjct  93   LEVAVCLCTAIKANILGINLNIPIALSLVIDGCAKTFPPGFQC  135



>ref|XP_009619251.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=158

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  I  S P  PCC+ + GL + + A CLCTA +  V 
Sbjct  74   GRCPRDALKLGVCANLVG--GLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVL  131

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  132  GINLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|NP_192985.1| putative lipid transfer protein [Arabidopsis thaliana]
 sp|Q39176.1|ERLI1_ARATH RecName: Full=Lipid transfer protein EARLI 1; AltName: Full=Protein 
EARLY ARABIDOPSIS ALUMINUM INDUCED 1; Short=pEARLI1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL06564.1|AF412111_1 AT4g12480/T1P17_70 [Arabidopsis thaliana]
 gb|AAC37471.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB41718.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB78291.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AAM91484.1| AT4g12480/T1P17_70 [Arabidopsis thaliana]
 dbj|BAF02055.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AEE83138.1| putative lipid transfer protein [Arabidopsis thaliana]
Length=168

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L LGVCA     + S+L I    P  +PCC+ ++GL +   A CLCTA +  V
Sbjct  83   GNCPIDALRLGVCA---NVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANV  139

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C R+ P GF+C
Sbjct  140  LGINLNVPISLSVLLNVCNRKVPSGFQC  167



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 54/88 (61%), Gaps = 9/88 (10%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            CP+D L+LGVCA  +  +     +D ++   P+ PCC+ ++GL N + A CLCTA K  V
Sbjct  60   CPKDTLKLGVCANVLNGL-----LDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANV  114

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C ++ P GF+C
Sbjct  115  LGINLNLPISLSLLLNVCSKQLPSGFQC  142



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            +CPRD L+LGVCA  +  +  +  +  + P  PCC+ + GL + + A CLCTA K  +  
Sbjct  53   SCPRDTLKLGVCANLLNDLVHL--VVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILG  110

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            I+ N  +++  LL  CG++ P GF+C
Sbjct  111  IHLNVPVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=152

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCPRD L+LGVCA  + +   +  +  + P  PCC+ L GL + + A CLCTA K  V 
Sbjct  67   ATCPRDALKLGVCANLLGRAAGV--VVGNPPTTPCCSLLAGLVDLEAAVCLCTAIKANVL  124

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL  CGR  P GF C
Sbjct  125  GINLNIPVSLSLLLNACGRTPPTGFTC  151



>ref|XP_008646032.1| PREDICTED: cortical cell-delineating protein-like [Zea mays]
 gb|AFW72681.1| cortical cell-delineating protein [Zea mays]
Length=126

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA     +G I     + P  PCC  L GL + + A CLCTA K  + 
Sbjct  43   GRCPRDALKLGVCA---NVLGLIKAKVGAPPAEPCCPLLEGLVDLEAAACLCTAIKGNIL  99

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  +L  CGR  P GFKC
Sbjct  100  GINLNLPVDLSLILNYCGRTVPTGFKC  126



>ref|XP_009346906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Pyrus x bretschneideri]
Length=140

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 6/102 (6%)
 Frame = +1

Query  607  SSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNS  786
            +S   P+  PS     TCP D L+LGVCA     +  ++ +    P  PCC+ + GL + 
Sbjct  43   ASPALPNPKPSKR--ATCPIDTLKLGVCA---DVLNGLVHLVVGPPKFPCCSLIEGLVDL  97

Query  787  QTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              A CLCTA K  V  I+ N  +++  LL  CG++AP G++C
Sbjct  98   DAAVCLCTAIKANVLGIHLNVPVSLSLLLNYCGKQAPTGYEC  139



>gb|AFW63295.1| cortical cell-delineating protein [Zea mays]
Length=131

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  + 
Sbjct  48   GRCPRDALKLGVCANVLGLIKAKVGVP---PAEPCCPLLEGLVDLEAAVCLCTAIKGQIL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  +L  CGR  P GFKC
Sbjct  105  GINLNLPIDLSLILNYCGRTVPTGFKC  131



>gb|KDP34267.1| hypothetical protein JCGZ_12836 [Jatropha curcas]
Length=108

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 8/87 (9%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCP D L+L +CA     +  I+QI    P +PCC+ L  L   + A CLCTA K+ V 
Sbjct  28   GTCPVDALKLKLCA----NVWGIIQIP---PNQPCCSLLGNLVALEAAACLCTAIKVNVF  80

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             +N N  L +   L  CG++ PKGFKC
Sbjct  81   ALNLNVPLDLSLYLNNCGKKVPKGFKC  107



>ref|NP_001152585.1| LOC100286225 precursor [Zea mays]
 gb|ACG48364.1| cortical cell-delineating protein precursor [Zea mays]
Length=125

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA     +G I     + P  PCC  L GL + + A CLCTA K  + 
Sbjct  42   GRCPRDALKLGVCA---NVLGLIKAKVGAPPAEPCCPLLEGLVDLEAAACLCTAIKGNIL  98

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  + +  +L  CGR  P GFKC
Sbjct  99   GINLNLPVDLSLILNYCGRTVPXGFKC  125



>gb|KHN04345.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=166

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
             +CPRD L+LGVCA     +  +L +     P+ PCC+ L GL + + A CLCTA K  +
Sbjct  81   ASCPRDALKLGVCA---NVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANI  137

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C R AP+ F+C
Sbjct  138  LGINLNLPISLSLLLNVCSRNAPRDFQC  165



>ref|XP_006304906.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
 gb|EOA37804.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
Length=138

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 54/88 (61%), Gaps = 9/88 (10%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            CP+D L+LGVCA  +  +     +D ++   P+ PCC+ ++GL + + A CLCTA K  V
Sbjct  56   CPKDTLKLGVCANVLNGL-----LDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANV  110

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C ++ P GF+C
Sbjct  111  LGINLNVPISLSLLLNVCSKQLPSGFQC  138



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
             TCP+D L+LGVCA  +   G I  +  + P  PCC+ ++GL + + A CLCTA K  V 
Sbjct  50   ATCPKDTLKLGVCANLLG--GLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVL  107

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  LL +C ++ P GF+C
Sbjct  108  GINLNIPLSLSLLLNVCSKKVPPGFQC  134



>gb|ACU21436.1| unknown [Glycine max]
Length=172

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
             +CPRD L+LGVCA     +  +L +     P+ PCC+ L GL + + A CLCTA K  +
Sbjct  87   ASCPRDALKLGVCA---NVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANI  143

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C R AP+ F+C
Sbjct  144  LGINLNLPISLSLLLNVCSRNAPRDFQC  171



>ref|XP_002304421.2| hypothetical protein POPTR_0003s11070g, partial [Populus trichocarpa]
 gb|EEE79400.2| hypothetical protein POPTR_0003s11070g, partial [Populus trichocarpa]
Length=120

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRRI  837
            CP+D L+LGVCA     +GS+L         PCC+ ++GL + + A CLCTA K  +  I
Sbjct  46   CPKDALKLGVCA---DLLGSLL--------NPCCSVIQGLLDLEAAVCLCTAIKANILGI  94

Query  838  N-NADLAIYTLLKLCGRRAPKGFKC  909
            N N  L++  LL +CG++ PK F+C
Sbjct  95   NLNIPLSLSLLLNVCGKKVPKDFQC  119



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = +1

Query  586  LSPQSDVSSGGQPSTS---PSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPC  756
             S  +  +S G+P      P   +  TCPRD L+LG+CA  ++ + ++     + P +PC
Sbjct  19   FSHLATAASNGKPPEHRPRPLPRHQLTCPRDALKLGICANVLRGLLNV--TLGTPPKQPC  76

Query  757  CNCLRGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            C+ L GL + + A CLCTA K  V  +  N  +++  L+  CG++ PKGF C
Sbjct  77   CSLLEGLVDLEAAVCLCTALKGNVLGLKLNIPVSLSLLINYCGKKVPKGFLC  128



>ref|NP_176440.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAD43608.1|AC005698_7 T3P18.7 [Arabidopsis thaliana]
 gb|AAQ65111.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD95067.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD93991.1| similar to 14KD proline-rich protein DC2.15 precursor [Arabidopsis 
thaliana]
 dbj|BAD94286.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAF01655.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 dbj|BAF02193.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 gb|AEE33973.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=149

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            CPRD L+LGVCA     +  +L +    P + PCC  ++GL + + A CLCTA K  +  
Sbjct  67   CPRDALKLGVCA---NVLNGLLNVTLGKPPVEPCCTLIQGLADLEAAACLCTALKANILG  123

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  L++  LL +C ++ P+GF+C
Sbjct  124  INLNIPLSLSLLLNVCSKKVPRGFQC  149



>ref|XP_003525810.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=172

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
             +CPRD L+LGVCA     +  +L +     P+ PCC+ L GL + + A CLCTA K  +
Sbjct  87   ASCPRDALKLGVCA---NVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANI  143

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C R AP+ F+C
Sbjct  144  LGINLNLPISLSLLLNVCSRNAPRDFQC  171



>gb|ADU20204.1| hypothetical protein [Manihot esculenta]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G CP D L+LGVCA   K +G +L +    P + PCC+ ++GL + + A CLCTA K IV
Sbjct  46   GKCPNDALKLGVCA---KVLGDLLNVTIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKAIV  102

Query  829  RRIN-NADLAIYTLLKLCGRR  888
              IN N  +++  LL +CG++
Sbjct  103  LGINLNIPVSLSLLLNVCGKK  123



>ref|XP_002446915.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
 gb|EES11243.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
Length=132

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  + 
Sbjct  48   GKCPRDALKLGVCANVLGLIKAKVGVP---PTEPCCPLLEGLVDLEAALCLCTAIKGNIL  104

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+  P GFKC+
Sbjct  105  GINLNLPIDLSLILNHCGKSVPTGFKCL  132



>ref|XP_009795761.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Nicotiana sylvestris]
Length=146

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  +  + P  PCC+ + GL + + A CLCTA +  V 
Sbjct  62   GRCPRDALKLGVCASLVG--GLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVL  119

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  120  GINLNVPLSLSLVLNNCGRNPPNGFTC  146



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
            G  CPRD L+LG+CA  ++ + ++     + P +PCC+ L GL + + A CLCTA K  V
Sbjct  57   GAKCPRDALKLGICANVLRGLLNV--TLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNV  114

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              +  N  +++  L+  CG++ PKGF C
Sbjct  115  LGLKLNIPVSLSLLINYCGKKVPKGFLC  142



>ref|XP_009796138.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
 ref|XP_009796140.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=152

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  +  S P  PCC+ + GL + + A CLCTA +  V 
Sbjct  68   GRCPRDALKLGVCANLVG--GLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVL  125

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  126  GINLNVPLSLSLVLNNCGRNPPTGFTC  152



>ref|XP_009137260.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 4/86 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            GTCPRD L+LGVCA  V  +G+++  D     RPCC+ + GLTN Q A CLC   + +  
Sbjct  34   GTCPRDPLQLGVCA-NVLGLGNVIAGDTRA--RPCCSAITGLTNVQVADCLCFVFRPL-P  89

Query  832  RINNADLAIYTLLKLCGRRAPKGFKC  909
             +   D A+ T+   C    P GF+C
Sbjct  90   LVYGIDKAVRTIFFACNMVFPIGFQC  115



>ref|XP_011039660.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 4/109 (4%)
 Frame = +1

Query  586  LSPQSDVSSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNC  765
            LS  S       P   PS     TCP+D L+LGVCA     +G +  +  + P   CC+ 
Sbjct  18   LSTFSSACDPCHPKPKPSPPTAPTCPKDTLKLGVCA---DLLGPVNVVAGTPPRSKCCSL  74

Query  766  LRGLTNSQTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            L GL + + A CLCTA K  V   N N  +A+  ++  CG+  P GF+C
Sbjct  75   LEGLADMEVALCLCTAIKANVLGTNLNVPVALSAIVSACGKSIPPGFQC  123



>ref|XP_009346905.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Pyrus x bretschneideri]
Length=142

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 6/102 (6%)
 Frame = +1

Query  607  SSGGQPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNS  786
            +S   P+  PS     TCP D L+LGVCA     +  ++ +    P  PCC+ + GL + 
Sbjct  45   ASPALPNPKPSKR--ATCPIDTLKLGVCA---DVLNGLVHLVVGPPKFPCCSLIEGLVDL  99

Query  787  QTATCLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              A CLCTA K  V  I+ N  +++  LL  CG++AP G++C
Sbjct  100  DAAVCLCTAIKANVLGIHLNVPVSLSLLLNYCGKQAPTGYEC  141



>ref|XP_004291445.1| PREDICTED: uncharacterized protein LOC101307558 [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSI-LQIDHSIPIRPCCNCLRGLTNSQTAT  798
            P T        TCPRD L+LGVCA     +G + LQI   +   PCC  L GL +S+ A 
Sbjct  80   PITPAPTPTWETCPRDTLKLGVCA---NLLGLVNLQIGSPV-TSPCCALLEGLADSEAAI  135

Query  799  CLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CLCTA K  V  IN +  +A+  L+  C +  P GF+C
Sbjct  136  CLCTALKANVLGINLDIPVALSLLVSACQKTVPPGFQC  173



>gb|KDP25648.1| hypothetical protein JCGZ_20804 [Jatropha curcas]
Length=251

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +1

Query  619  QPSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTAT  798
             P+ SPS+   G CPRD L+LGVC   +K + S+     + P  PCC+ L  L + + A 
Sbjct  158  NPTPSPSH---GACPRDTLKLGVCVDLLKDLLSV--TIGTPPKTPCCSLLGDLVDLEAAV  212

Query  799  CLCTASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            CLCT  K  +  IN N  + +  LL  CG++ P+GF+C
Sbjct  213  CLCTTIKASLLGINLNLPIDLSLLLNYCGKKVPQGFQC  250



>ref|XP_009113072.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY19562.1| BnaC09g13410D [Brassica napus]
 emb|CDY12952.1| BnaA09g13220D [Brassica napus]
Length=147

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSIP-IRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            CPRD L+LGVCA     +  +L I    P ++PCC  ++GL + + A CLCTA K  +  
Sbjct  65   CPRDALKLGVCA---NVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANILG  121

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL +C ++ P GF+C
Sbjct  122  INLNIPISLSLLLNVCSKKVPPGFQC  147



>ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=133

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +1

Query  658  CPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRRI  837
            CP+D L+LGVCA  +  +   LQI  S P  PCC+ L+GLT+ + A CLCTA K  V  I
Sbjct  51   CPKDTLKLGVCADLLGLVN--LQIG-SPPTTPCCSLLKGLTDLEAALCLCTALKANVLGI  107

Query  838  N-NADLAIYTLLKLCGRRAPKGFKC  909
            N N  +++  L+  C +  P GF+C
Sbjct  108  NLNVPISLSVLVSACQKSVPSGFQC  132



>ref|XP_009787417.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=138

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVRR  834
            TCP D L+LGVCA  +  +  +     S P++PCC+ + GL + + A CLCTA K  V  
Sbjct  54   TCPIDTLKLGVCANVLGLVNVV---VGSPPVKPCCSLISGLADVEAALCLCTAIKANVLG  110

Query  835  IN-NADLAIYTLLKLCGRRAPKGFKC  909
            IN N  +++  LL +C ++ P GF+C
Sbjct  111  INLNVPVSLSLLLNVCSKKVPSGFQC  136



>ref|XP_004976454.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  +  I + + +    P  PCC  L GL + + A CLCTA K  + 
Sbjct  43   GRCPRDALKLGVCANVLGLIKAKVGVP---PTEPCCPLLEGLVDLEAAVCLCTAIKGNIL  99

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKCV  912
             IN N  + +  +L  CG+  P GFKC+
Sbjct  100  GINLNLPIDVSLILNHCGKTVPTGFKCL  127



>gb|AFK47547.1| unknown [Lotus japonicus]
Length=139

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +1

Query  628  TSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLC  807
            T P +    +CPRD ++LGVCA  +  I   +Q+    P  PCC+ L+GL + + A CLC
Sbjct  47   TKPPSTKQPSCPRDTIKLGVCADVLGLIN--VQLGKP-PKTPCCSLLQGLADLEAAVCLC  103

Query  808  TASKLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            TA +  V  IN N  + +  +L  CG+  PKGF C
Sbjct  104  TALRANVLGINLNIPINLSLILNYCGKGVPKGFVC  138



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = +1

Query  649  GGTCPRDRLELGVCALAVKKIGSILQIDHSIPIR-PCCNCLRGLTNSQTATCLCTASKLI  825
              TCPRD L+LGVCA     +  +L +    P + PCC+ + GL + + A CLCTA K  
Sbjct  47   AATCPRDTLKLGVCA---NLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKAN  103

Query  826  VRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            +   N N  +++  LL  CG+  PKGF+C
Sbjct  104  ILGNNLNIPISLSLLLNYCGQGVPKGFQC  132



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = +1

Query  637  SNNNGGTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTAS  816
            +N N G+CP D L+LGVCA  +   G +  +  + P  PCC  L GL + + A CLCTA 
Sbjct  43   ANPNSGSCPIDALKLGVCANVLS--GLVGVVIGTPPDTPCCALLDGLLDLEAAICLCTAI  100

Query  817  KLIVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
            K  +  IN +  L++  L+  CG+  PK F+C
Sbjct  101  KANILGINLDIHLSLSLLINTCGKTLPKDFQC  132



>ref|XP_003572054.1| PREDICTED: putative lipid-binding protein AIR1 [Brachypodium 
distachyon]
Length=158

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 13/107 (12%)
 Frame = +1

Query  622  PSTSPSNNNGGTCPRDRLELGVCALAVKKIGSILQIDH--------SIPIRPCCNCLRGL  777
            P+  PS   GG CP + L+LGVCA  +  + S+L  D         S   +PCC  + GL
Sbjct  44   PAAVPSGGRGGKCPVNALKLGVCADVLGGLASLLVGDSPAAAASSGSGKKKPCCELVAGL  103

Query  778  TNSQTATCLCTASKLIVRRINNADLAIYTLLKL---CGRRAPKGFKC  909
             +   A CLCTA K   R +   +L +   L+L   CG++ P GF+C
Sbjct  104  ADVDAAVCLCTAVK--ARVLGVVELYLPVQLRLVNQCGKKIPDGFRC  148



>emb|CDY64848.1| BnaC05g49400D [Brassica napus]
Length=137

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 9/90 (10%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
            G CP+D L+LGVCA  +  +     +D ++   P+ PCC+ ++GL + + A CLCTA K 
Sbjct  53   GKCPKDTLQLGVCANVLNGL-----LDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKA  107

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             V  IN N  +++  LL +C ++ P  F+C
Sbjct  108  NVLGINLNLPISLSLLLNVCSKQVPPSFQC  137



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIR-PCCNCLRGLTNSQTATCLCTASKLIV  828
             TCP D L+LGVCA     +G +L +    P + PCC+ ++GL + + A CLCTA K  +
Sbjct  61   ATCPIDTLKLGVCA---NLLGDLLGVVIGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADI  117

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C ++ P GF C
Sbjct  118  LGINLNIPVSLSVLLNVCSKKVPPGFIC  145



>ref|XP_003608748.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90945.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK34609.1| unknown [Medicago truncatula]
Length=169

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIV  828
             +CPRD L+LGVCA     +  +L +     P+ PCC  L GL + + A CLCTA K  +
Sbjct  84   ASCPRDALKLGVCA---NVLNGLLNVTLGQPPVTPCCTLLNGLVDLEAAVCLCTALKANI  140

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  +++  LL +C ++AP+ F+C
Sbjct  141  LGINLNLPISLSLLLNVCSKQAPRDFQC  168



>ref|XP_009782706.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            G CPRD L+LGVCA  V   G +  +  + P  PCC+ + GL + + A CLCTA +  V 
Sbjct  74   GRCPRDALKLGVCANLVG--GLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVL  131

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  L++  +L  CGR  P GF C
Sbjct  132  GINLNVPLSLSLVLNNCGRNPPTGFTC  158



>gb|AAM75351.1|AF520576_1 extensin-like protein [Glycine max]
Length=179

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +1

Query  655  TCPRDRLELGVCALAVKKIGSILQIDH-SIPIRPCCNCLRGLTNSQTATCLCTASKLIVR  831
            +CPRD L+LGVCA     +  +L +     P+ PCC+ L GL + + A CLCTA K  + 
Sbjct  95   SCPRDALKLGVCA---NVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANIL  151

Query  832  RIN-NADLAIYTLLKLCGRRAPKGFKC  909
             IN N  +++  LL +C R AP+ F+C
Sbjct  152  GINLNLPISLSLLLNVCSRNAPRDFQC  178



>gb|KDP25650.1| hypothetical protein JCGZ_20806 [Jatropha curcas]
Length=130

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSIPIR-PCCNCLRGLTNSQTATCLCTASKLIV  828
            G CPRD L+LGVCA  +K    +L +    P + PCC+ L  L + + A CLCT  K  +
Sbjct  45   GACPRDTLKLGVCADVLK---GLLNVTVGTPPKTPCCSLLGDLVDLEAAVCLCTTIKASL  101

Query  829  RRIN-NADLAIYTLLKLCGRRAPKGFKC  909
              IN N  + +  LL  CG++ P+GFKC
Sbjct  102  LGINLNLPIDLSLLLNYCGKKVPEGFKC  129



>gb|KFK43474.1| hypothetical protein AALP_AA1G129700 [Arabis alpina]
Length=140

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 9/90 (10%)
 Frame = +1

Query  652  GTCPRDRLELGVCALAVKKIGSILQIDHSI---PIRPCCNCLRGLTNSQTATCLCTASKL  822
            G CP+D L+LGVCA  +  +     +D ++   P+ PCC+ ++GL + + A CLCTA K 
Sbjct  56   GKCPKDTLKLGVCANVLNGL-----LDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKA  110

Query  823  IVRRIN-NADLAIYTLLKLCGRRAPKGFKC  909
             V  IN N  +++  LL +C ++ P  F+C
Sbjct  111  NVLGINLNLPISLSLLLNVCSKKVPSDFQC  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592