BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24517_g2_i1 len=183 path=[1039:0-155 7134:156-182]

Length=183
                                                                      Score     E

emb|CDP12449.1|  unnamed protein product                                119   2e-29   
gb|AEA86343.1|  brassinosteroid insensitive 1-associated receptor...    110   6e-29   
emb|CDO98556.1|  unnamed protein product                                116   3e-28   
emb|CDP07729.1|  unnamed protein product                                113   2e-27   
ref|XP_006348981.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
ref|XP_009798696.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
ref|XP_006448035.1|  hypothetical protein CICLE_v10014371mg             111   1e-26   
ref|XP_006492302.1|  PREDICTED: G-type lectin S-receptor-like ser...    109   1e-26   
ref|XP_010323667.1|  PREDICTED: G-type lectin S-receptor-like ser...    111   1e-26   
ref|XP_006448036.1|  hypothetical protein CICLE_v10014371mg             111   1e-26   
ref|XP_004243251.1|  PREDICTED: G-type lectin S-receptor-like ser...    111   1e-26   
ref|XP_006348904.1|  PREDICTED: G-type lectin S-receptor-like ser...    111   1e-26   
ref|XP_006492260.1|  PREDICTED: G-type lectin S-receptor-like ser...    111   1e-26   
ref|XP_006492264.1|  PREDICTED: G-type lectin S-receptor-like ser...    111   1e-26   
emb|CDO98553.1|  unnamed protein product                                111   2e-26   
ref|XP_006492266.1|  PREDICTED: G-type lectin S-receptor-like ser...    111   2e-26   
ref|XP_010070466.1|  PREDICTED: G-type lectin S-receptor-like ser...    110   2e-26   
gb|KCW89672.1|  hypothetical protein EUGRSUZ_A01944                     110   2e-26   
ref|XP_006448032.1|  hypothetical protein CICLE_v10017695mg             110   2e-26   
gb|EYU30749.1|  hypothetical protein MIMGU_mgv1a019140mg                110   3e-26   
ref|XP_009763890.1|  PREDICTED: G-type lectin S-receptor-like ser...    110   5e-26   
gb|KDO38706.1|  hypothetical protein CISIN_1g043292mg                   108   5e-26   
ref|XP_010323669.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    109   5e-26   
ref|XP_009605954.1|  PREDICTED: G-type lectin S-receptor-like ser...    109   6e-26   
ref|XP_010070456.1|  PREDICTED: G-type lectin S-receptor-like ser...    109   7e-26   
gb|KCW44834.1|  hypothetical protein EUGRSUZ_L01598                     109   7e-26   
gb|KCW89671.1|  hypothetical protein EUGRSUZ_A01943                     109   7e-26   
ref|XP_010040878.1|  PREDICTED: G-type lectin S-receptor-like ser...    109   8e-26   
ref|XP_006348915.1|  PREDICTED: G-type lectin S-receptor-like ser...    109   8e-26   
emb|CDP15996.1|  unnamed protein product                                107   9e-26   
gb|EYU30750.1|  hypothetical protein MIMGU_mgv1a024561mg                109   1e-25   
ref|XP_009778145.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   1e-25   
ref|XP_006448031.1|  hypothetical protein CICLE_v10014464mg             108   1e-25   
emb|CDP15994.1|  unnamed protein product                                108   1e-25   
ref|XP_009605931.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   1e-25   
ref|XP_002454975.1|  hypothetical protein SORBIDRAFT_03g002425          105   1e-25   Sorghum bicolor [broomcorn]
ref|XP_010039230.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   1e-25   
ref|XP_003632253.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   2e-25   
gb|KCW49738.1|  hypothetical protein EUGRSUZ_K03237                     108   2e-25   
ref|XP_006348913.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   2e-25   
ref|XP_009795619.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   2e-25   
gb|EMT28454.1|  Putative LRR receptor-like serine/threonine-prote...    104   2e-25   
ref|XP_009605940.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   3e-25   
gb|ACI26722.1|  receptor-like kinase                                    107   3e-25   Nicotiana glutinosa
ref|XP_010324078.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   3e-25   
ref|XP_006348903.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   3e-25   
ref|XP_006377090.1|  hypothetical protein POPTR_0012s14130g             106   3e-25   
ref|XP_010039229.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   4e-25   
ref|XP_010657073.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   4e-25   
gb|KCW49725.1|  hypothetical protein EUGRSUZ_K03222                     107   5e-25   
gb|KCW49726.1|  hypothetical protein EUGRSUZ_K03223                     107   5e-25   
ref|XP_003633280.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   5e-25   
ref|XP_006652160.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   6e-25   
gb|KCW49728.1|  hypothetical protein EUGRSUZ_K03225                     106   6e-25   
ref|XP_010657072.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   6e-25   
ref|XP_010657074.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   7e-25   
ref|XP_002277643.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   7e-25   Vitis vinifera
ref|XP_010242119.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   8e-25   
ref|XP_010038719.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   8e-25   
gb|KCW47386.1|  hypothetical protein EUGRSUZ_K01188                     106   8e-25   
ref|XP_010038721.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   9e-25   
gb|KCW89665.1|  hypothetical protein EUGRSUZ_A01935                     103   9e-25   
gb|EEE60706.1|  hypothetical protein OsJ_14199                          106   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010323666.1|  PREDICTED: G-type lectin S-receptor-like ser...    106   9e-25   
ref|XP_002525876.1|  serine-threonine protein kinase, plant-type,...    106   1e-24   Ricinus communis
gb|KCW47378.1|  hypothetical protein EUGRSUZ_K01177                     105   1e-24   
ref|XP_010242180.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   1e-24   
gb|KCW47363.1|  hypothetical protein EUGRSUZ_K01148                     105   1e-24   
dbj|BAJ94427.1|  predicted protein                                      103   1e-24   
gb|KCW47380.1|  hypothetical protein EUGRSUZ_K01180                     105   2e-24   
emb|CDP15997.1|  unnamed protein product                                105   2e-24   
gb|EAY93506.1|  hypothetical protein OsI_15301                          105   2e-24   Oryza sativa Indica Group [Indian rice]
gb|EAZ30147.1|  hypothetical protein OsJ_14201                          105   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KCW47671.1|  hypothetical protein EUGRSUZ_K01410                     105   2e-24   
ref|NP_001052412.2|  Os04g0303500                                       105   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60705.1|  hypothetical protein OsJ_14196                          105   2e-24   Oryza sativa Japonica Group [Japonica rice]
emb|CDP15995.1|  unnamed protein product                                105   2e-24   
emb|CDP15993.1|  unnamed protein product                                105   2e-24   
ref|XP_006348914.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   2e-24   
emb|CAH66217.1|  OSIGBa0157N01.3                                        105   2e-24   Oryza sativa [red rice]
ref|XP_006348984.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   2e-24   
emb|CAE05335.2|  OSJNBa0079M09.4                                        105   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007037704.1|  S-domain-2 5, putative                             105   2e-24   
emb|CAH66083.1|  H0215E01.11                                            105   2e-24   Oryza sativa [red rice]
emb|CAE05332.2|  OSJNBa0079M09.1                                        105   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010323668.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   3e-24   
ref|XP_004243252.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   3e-24   
emb|CBI22039.3|  unnamed protein product                                104   3e-24   
gb|EMT08875.1|  Putative LRR receptor-like serine/threonine-prote...    105   3e-24   
gb|EMT14318.1|  Putative receptor protein kinase ZmPK1                  105   3e-24   
ref|XP_011098378.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   3e-24   
ref|XP_010038718.1|  PREDICTED: G-type lectin S-receptor-like ser...    105   3e-24   
gb|EEE60707.1|  hypothetical protein OsJ_14200                          104   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173852.1|  Os04g0303300                                       104   3e-24   
emb|CAE04684.2|  OSJNBb0018A10.13                                       104   3e-24   Oryza sativa [red rice]
gb|EEC76989.1|  hypothetical protein OsI_15296                          104   3e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009605899.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   3e-24   
gb|KCW47376.1|  hypothetical protein EUGRSUZ_K01175                     104   3e-24   
ref|XP_002525880.1|  serine-threonine protein kinase, plant-type,...    104   4e-24   Ricinus communis
ref|XP_002445840.1|  hypothetical protein SORBIDRAFT_07g026780          104   4e-24   Sorghum bicolor [broomcorn]
ref|XP_004243248.1|  PREDICTED: G-type lectin S-receptor-like ser...    104   5e-24   
gb|EMT26048.1|  Putative receptor protein kinase ZmPK1                  104   5e-24   
gb|EMT26049.1|  Putative receptor protein kinase ZmPK1                  104   5e-24   
gb|KDP39795.1|  hypothetical protein JCGZ_03931                         103   5e-24   
gb|EMT08394.1|  Putative receptor protein kinase ZmPK1                  103   6e-24   
ref|XP_004975239.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   6e-24   
ref|XP_006348912.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   7e-24   
emb|CAH66079.1|  H0215E01.7                                             103   8e-24   Oryza sativa [red rice]
emb|CAE04686.2|  OSJNBb0018A10.15                                       103   8e-24   Oryza sativa [red rice]
ref|XP_006348980.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   8e-24   
gb|EMT18051.1|  Putative serine/threonine-protein kinase                103   8e-24   
gb|EMS64724.1|  G-type lectin S-receptor-like serine/threonine-pr...    103   1e-23   
ref|XP_009593099.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   1e-23   
ref|XP_002457489.1|  hypothetical protein SORBIDRAFT_03g008160          102   1e-23   Sorghum bicolor [broomcorn]
gb|EMT32501.1|  Putative receptor protein kinase ZmPK1                  103   1e-23   
ref|XP_009593100.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   1e-23   
gb|EEC70133.1|  hypothetical protein OsI_00815                          103   1e-23   Oryza sativa Indica Group [Indian rice]
dbj|BAA92954.1|  S-receptor kinase -like                                103   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KCW47382.1|  hypothetical protein EUGRSUZ_K01182                     103   1e-23   
emb|CAH66082.1|  H0215E01.10                                            102   2e-23   Oryza sativa [red rice]
ref|XP_006348905.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   2e-23   
ref|XP_004968009.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   2e-23   
gb|AAR08844.1|  resistance protein candidate                          97.4    2e-23   Vitis amurensis
ref|XP_003578879.1|  PREDICTED: G-type lectin S-receptor-like ser...    102   2e-23   
gb|EMS49522.1|  G-type lectin S-receptor-like serine/threonine-pr...    102   2e-23   
ref|XP_007048759.1|  S-domain-2 5, putative                             102   3e-23   
ref|XP_002445841.1|  hypothetical protein SORBIDRAFT_07g026790          102   3e-23   Sorghum bicolor [broomcorn]
ref|XP_009618783.1|  PREDICTED: G-type lectin S-receptor-like ser...    101   3e-23   
gb|EMT08844.1|  Putative LRR receptor-like serine/threonine-prote...  98.2    4e-23   
gb|AAF43399.1|  serine/threonine protein kinase                       96.3    5e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52420.1|  G-type lectin S-receptor-like serine/threonine-pr...    100   5e-23   
gb|EMT13028.1|  Zeamatin                                                100   5e-23   
ref|XP_008791435.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    101   6e-23   
ref|XP_010038902.1|  PREDICTED: G-type lectin S-receptor-like ser...    101   6e-23   
ref|XP_009405076.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    101   7e-23   
ref|XP_006643673.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   7e-23   
ref|XP_003572973.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   7e-23   
ref|XP_010657163.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   7e-23   
ref|XP_002277928.2|  PREDICTED: G-type lectin S-receptor-like ser...    100   8e-23   Vitis vinifera
ref|XP_010059113.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   9e-23   
ref|XP_009771360.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   9e-23   
ref|XP_002278212.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   9e-23   Vitis vinifera
gb|KCW48103.1|  hypothetical protein EUGRSUZ_K01839                     100   1e-22   
ref|XP_010925665.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   1e-22   
gb|EMT29328.1|  Zeamatin                                              99.4    2e-22   
dbj|BAJ96726.1|  predicted protein                                    99.4    2e-22   
ref|NP_001141480.1|  uncharacterized LOC100273591                     97.1    2e-22   Zea mays [maize]
dbj|BAJ89157.1|  predicted protein                                    99.4    2e-22   
gb|EEC70132.1|  hypothetical protein OsI_00814                        99.8    2e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAD72985.1|  putative S-receptor kinase                           99.8    2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AFW57900.1|  putative D-mannose binding lectin receptor-like p...  99.0    2e-22   
gb|AAR08853.1|  resistance protein candidate                          91.3    3e-22   Vitis amurensis
dbj|BAD45068.1|  putative receptor serine/threonine kinase PR5K       98.6    3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008778569.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.3    3e-22   
ref|XP_007048756.1|  S-domain-2 5, putative                           98.6    3e-22   
gb|EEE53749.1|  hypothetical protein OsJ_00116                        98.6    3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001172138.1|  Os01g0113650                                     98.6    3e-22   
ref|XP_008779505.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.6    4e-22   
gb|AGY30981.1|  receptor-like protein kinase                          96.3    4e-22   
ref|XP_008663082.1|  PREDICTED: G-type lectin S-receptor-like ser...  99.0    4e-22   
ref|XP_004968008.1|  PREDICTED: probable LRR receptor-like serine...  98.6    4e-22   
ref|XP_009605729.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.6    5e-22   
gb|EMT14789.1|  Zeamatin                                              98.2    5e-22   
gb|EAZ01299.1|  hypothetical protein OsI_23331                        98.6    5e-22   Oryza sativa Indica Group [Indian rice]
gb|EEC69811.1|  hypothetical protein OsI_00122                        98.6    6e-22   Oryza sativa Indica Group [Indian rice]
gb|EMT00452.1|  Putative LRR receptor-like serine/threonine-prote...  97.8    6e-22   
gb|KCW47381.1|  hypothetical protein EUGRSUZ_K01181                   97.8    6e-22   
gb|AAF43402.1|  serine/threonine protein kinase                       93.6    6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571152.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.2    6e-22   
ref|XP_003633281.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.2    6e-22   
ref|XP_006657049.1|  PREDICTED: G-type lectin S-receptor-like ser...  98.2    7e-22   
gb|EMS64723.1|  G-type lectin S-receptor-like serine/threonine-pr...  97.8    7e-22   
gb|AFW65500.1|  putative D-mannose binding lectin receptor-like p...  97.4    8e-22   
gb|EMS47949.1|  G-type lectin S-receptor-like serine/threonine-pr...  96.7    8e-22   
emb|CAN67060.1|  hypothetical protein VITISV_036717                   97.8    8e-22   Vitis vinifera
emb|CDM80298.1|  unnamed protein product                              98.2    9e-22   
dbj|BAD45065.1|  putative receptor serine/threonine kinase PR5K       97.4    9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002277429.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.4    1e-21   Vitis vinifera
gb|EMS67568.1|  G-type lectin S-receptor-like serine/threonine-pr...  97.4    1e-21   
dbj|BAK02589.1|  predicted protein                                    97.4    1e-21   
gb|EAZ10278.1|  hypothetical protein OsJ_00113                        95.5    1e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ95826.1|  predicted protein                                    96.3    1e-21   
gb|AEI84329.1|  lectin-domain receptor-like kinase                    97.4    1e-21   
gb|EMT08770.1|  Putative LRR receptor-like serine/threonine-prote...  97.4    1e-21   
gb|EMS67566.1|  Zeamatin                                              96.7    1e-21   
gb|EMT14788.1|  Protein P21                                           97.4    1e-21   
gb|EEC69810.1|  hypothetical protein OsI_00117                        97.4    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_011033510.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.4    2e-21   
dbj|BAK00815.1|  predicted protein                                    96.7    2e-21   
emb|CDM81285.1|  unnamed protein product                              96.7    2e-21   
ref|XP_010316850.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.7    2e-21   
ref|XP_002454976.1|  hypothetical protein SORBIDRAFT_03g002430        97.1    2e-21   Sorghum bicolor [broomcorn]
ref|XP_011010909.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.4    2e-21   
ref|XP_002451837.1|  hypothetical protein SORBIDRAFT_04g008440        97.1    2e-21   Sorghum bicolor [broomcorn]
gb|EMT00453.1|  Putative LRR receptor-like serine/threonine-prote...  95.5    2e-21   
ref|XP_002458028.1|  hypothetical protein SORBIDRAFT_03g025670        96.3    2e-21   Sorghum bicolor [broomcorn]
ref|XP_002445226.1|  hypothetical protein SORBIDRAFT_07g006250        96.7    2e-21   Sorghum bicolor [broomcorn]
ref|XP_011010908.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.1    2e-21   
ref|XP_011010907.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.1    2e-21   
ref|XP_002464192.1|  hypothetical protein SORBIDRAFT_01g013860        96.7    2e-21   Sorghum bicolor [broomcorn]
ref|XP_010102125.1|  G-type lectin S-receptor-like serine/threoni...  96.7    2e-21   
ref|XP_004951359.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.7    3e-21   
ref|XP_002437131.1|  hypothetical protein SORBIDRAFT_10g021740        96.7    3e-21   Sorghum bicolor [broomcorn]
ref|XP_009620921.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.7    3e-21   
gb|EMS57499.1|  G-type lectin S-receptor-like serine/threonine-pr...  95.1    3e-21   
ref|XP_002450278.1|  hypothetical protein SORBIDRAFT_05g003110        95.9    3e-21   Sorghum bicolor [broomcorn]
ref|XP_006358140.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.3    3e-21   
ref|XP_009778430.1|  PREDICTED: G-type lectin S-receptor-like ser...  96.3    3e-21   
gb|AFW65559.1|  D-mannose binding lectin family protein               95.9    3e-21   
ref|NP_001147808.1|  protein kinase/ transmembrane receptor prote...  95.9    3e-21   Zea mays [maize]
gb|EEC76991.1|  hypothetical protein OsI_15300                        93.2    4e-21   Oryza sativa Indica Group [Indian rice]
gb|EMT19168.1|  Putative receptor protein kinase ZmPK1                95.9    5e-21   
dbj|BAJ89300.1|  predicted protein                                    95.5    6e-21   
ref|XP_002305722.2|  hypothetical protein POPTR_0004s06050g           95.5    6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008655752.1|  PREDICTED: G-type lectin S-receptor-like ser...  95.5    7e-21   
ref|XP_008655751.1|  PREDICTED: G-type lectin S-receptor-like ser...  95.5    7e-21   
gb|EMT29879.1|  Putative receptor protein kinase ZmPK1                95.1    8e-21   
ref|XP_006647105.1|  PREDICTED: G-type lectin S-receptor-like ser...  94.7    1e-20   
dbj|BAD27663.1|  putative S-receptor kinase                           94.7    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72793.1|  hypothetical protein OsI_06477                        94.7    1e-20   Oryza sativa Indica Group [Indian rice]
gb|EMS61843.1|  G-type lectin S-receptor-like serine/threonine-pr...  94.7    1e-20   
dbj|BAJ90630.1|  predicted protein                                    94.4    1e-20   
gb|AFW71183.1|  putative D-mannose binding lectin receptor-like p...  94.4    2e-20   
ref|XP_010657065.1|  PREDICTED: G-type lectin S-receptor-like ser...  94.4    2e-20   
emb|CAN67059.1|  hypothetical protein VITISV_036716                   94.4    2e-20   Vitis vinifera
gb|AGY30982.1|  receptor-like protein kinase                          92.8    2e-20   
ref|XP_002277406.2|  PREDICTED: G-type lectin S-receptor-like ser...  94.4    2e-20   Vitis vinifera
gb|EMT13027.1|  Putative LRR receptor-like serine/threonine-prote...  93.6    2e-20   
gb|EMS57498.1|  G-type lectin S-receptor-like serine/threonine-pr...  93.6    2e-20   
gb|EMS52421.1|  G-type lectin S-receptor-like serine/threonine-pr...  93.6    2e-20   
gb|EMS64869.1|  G-type lectin S-receptor-like serine/threonine-pr...  94.0    2e-20   
ref|XP_003575768.1|  PREDICTED: G-type lectin S-receptor-like ser...  94.0    2e-20   
ref|XP_004968870.1|  PREDICTED: G-type lectin S-receptor-like ser...  94.0    2e-20   
gb|AGY30983.1|  receptor-like protein kinase                          92.8    2e-20   
ref|XP_003575454.2|  PREDICTED: G-type lectin S-receptor-like ser...  94.0    2e-20   
ref|XP_006838827.1|  hypothetical protein AMTR_s00002p00263020        93.6    2e-20   
emb|CAH66077.1|  H0215E01.5                                           93.2    3e-20   Oryza sativa [red rice]
ref|XP_002987238.1|  hypothetical protein SELMODRAFT_125579           90.9    3e-20   
ref|XP_002976405.1|  hypothetical protein SELMODRAFT_104776           90.9    4e-20   
gb|EEC70837.1|  hypothetical protein OsI_02334                        92.8    4e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_006644290.1|  PREDICTED: G-type lectin S-receptor-like ser...  92.0    5e-20   
gb|EMS63048.1|  G-type lectin S-receptor-like serine/threonine-pr...  92.8    6e-20   
gb|KDP29864.1|  hypothetical protein JCGZ_18439                       92.4    6e-20   
ref|XP_006656152.1|  PREDICTED: G-type lectin S-receptor-like ser...  92.4    7e-20   
ref|XP_002974074.1|  hypothetical protein SELMODRAFT_100787           89.7    9e-20   
ref|NP_001057839.1|  Os06g0551800                                     90.9    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007024191.1|  Serine-threonine protein kinase, plant-type,...  91.7    1e-19   
ref|XP_006468977.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  91.7    1e-19   
ref|XP_006468974.1|  PREDICTED: G-type lectin S-receptor-like ser...  91.3    1e-19   
ref|XP_006469080.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  91.7    1e-19   
ref|XP_006468975.1|  PREDICTED: G-type lectin S-receptor-like ser...  90.9    1e-19   
ref|XP_006446831.1|  hypothetical protein CICLE_v10018366mg           90.9    1e-19   
ref|XP_002968897.1|  hypothetical protein SELMODRAFT_64580            88.6    2e-19   
gb|ADM67544.1|  STK-like protein kinase                               87.0    2e-19   
gb|KDP21143.1|  hypothetical protein JCGZ_21614                       91.3    2e-19   
gb|EAZ37312.1|  hypothetical protein OsJ_21652                        90.9    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980118.1|  hypothetical protein SELMODRAFT_55105            87.8    3e-19   
ref|XP_002962447.1|  hypothetical protein SELMODRAFT_25647            86.3    9e-19   
gb|KCW48954.1|  hypothetical protein EUGRSUZ_K02564                   88.6    1e-18   
ref|XP_011037770.1|  PREDICTED: G-type lectin S-receptor-like ser...  86.3    1e-18   
ref|XP_002989397.1|  hypothetical protein SELMODRAFT_428008           89.0    1e-18   
ref|XP_002304906.2|  hypothetical protein POPTR_0004s01460g           87.8    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002989396.1|  hypothetical protein SELMODRAFT_2406             85.9    1e-18   
ref|XP_011037638.1|  PREDICTED: G-type lectin S-receptor-like ser...  86.7    2e-18   
ref|XP_002277451.2|  PREDICTED: G-type lectin S-receptor-like ser...  88.6    2e-18   Vitis vinifera
ref|XP_004142234.1|  PREDICTED: G-type lectin S-receptor-like ser...  88.2    2e-18   
ref|XP_006376604.1|  hypothetical protein POPTR_0012s00870g           86.3    3e-18   
ref|XP_004168531.1|  PREDICTED: G-type lectin S-receptor-like ser...  87.8    3e-18   
ref|XP_002976189.1|  hypothetical protein SELMODRAFT_17508            84.0    3e-18   
ref|XP_002972761.1|  hypothetical protein SELMODRAFT_17546            84.0    3e-18   
ref|XP_002985870.1|  hypothetical protein SELMODRAFT_24639            84.7    3e-18   
ref|XP_011037637.1|  PREDICTED: G-type lectin S-receptor-like ser...  85.9    4e-18   
ref|XP_011037635.1|  PREDICTED: G-type lectin S-receptor-like ser...  86.3    4e-18   
ref|XP_002968191.1|  hypothetical protein SELMODRAFT_17456            83.2    5e-18   
ref|XP_002304898.2|  hypothetical protein POPTR_0004s01420g           86.7    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011037636.1|  PREDICTED: G-type lectin S-receptor-like ser...  85.9    5e-18   
ref|XP_002976262.1|  hypothetical protein SELMODRAFT_35175            84.3    5e-18   
ref|XP_011037634.1|  PREDICTED: proline-rich receptor-like protei...  86.7    6e-18   
ref|XP_011037633.1|  PREDICTED: G-type lectin S-receptor-like ser...  86.7    6e-18   
ref|XP_002304902.2|  hypothetical protein POPTR_0004s01440g           86.7    6e-18   
ref|XP_011037632.1|  PREDICTED: proline-rich receptor-like protei...  86.7    6e-18   
gb|AEW07694.1|  hypothetical protein 0_9163_01                        82.4    7e-18   
ref|XP_002962445.1|  hypothetical protein SELMODRAFT_64706            84.0    7e-18   
ref|XP_006389620.1|  hypothetical protein POPTR_0021s00700g           84.7    8e-18   
ref|XP_002974256.1|  hypothetical protein SELMODRAFT_17510            82.8    8e-18   
ref|XP_001781944.1|  predicted protein                                84.3    9e-18   
gb|KCW44833.1|  hypothetical protein EUGRSUZ_L01597                   85.5    9e-18   
ref|XP_002984806.1|  hypothetical protein SELMODRAFT_121148           84.3    9e-18   
ref|XP_001764647.1|  predicted protein                                83.6    1e-17   
ref|XP_001766837.1|  predicted protein                                83.6    1e-17   
ref|XP_001767914.1|  predicted protein                                83.6    1e-17   
ref|XP_001775642.1|  predicted protein                                83.6    1e-17   
ref|XP_002319170.1|  hypothetical protein POPTR_0013s05640g           86.3    1e-17   
gb|KDP40161.1|  hypothetical protein JCGZ_02159                       85.9    1e-17   
ref|XP_002522267.1|  serine-threonine protein kinase, plant-type,...  84.0    1e-17   
gb|KCW44223.1|  hypothetical protein EUGRSUZ_L02352                   85.5    2e-17   
ref|XP_011034448.1|  PREDICTED: G-type lectin S-receptor-like ser...  85.9    2e-17   
emb|CAN77456.1|  hypothetical protein VITISV_037411                   85.1    2e-17   
ref|XP_010911694.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.8    2e-17   
ref|XP_002993403.1|  hypothetical protein SELMODRAFT_6355             81.6    2e-17   
emb|CDY13481.1|  BnaA03g51990D                                        85.1    3e-17   
emb|CDX72354.1|  BnaC07g43760D                                        85.1    3e-17   
ref|XP_009138076.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.7    3e-17   
ref|XP_002984332.1|  hypothetical protein SELMODRAFT_17512            80.9    3e-17   
ref|XP_010673327.1|  PREDICTED: probable receptor protein kinase ...  84.7    4e-17   
gb|AFG66055.1|  hypothetical protein 0_9163_01                        80.5    4e-17   
ref|XP_010673819.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.0    4e-17   
gb|AFG66056.1|  hypothetical protein 0_9163_01                        80.5    4e-17   
ref|XP_010928203.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.3    4e-17   
ref|XP_010650034.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.7    4e-17   
ref|XP_002975991.1|  hypothetical protein SELMODRAFT_17519            80.5    5e-17   
ref|XP_009796973.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.3    5e-17   
emb|CDX75235.1|  BnaA01g04670D                                        84.3    6e-17   
ref|XP_006412492.1|  hypothetical protein EUTSA_v10024411mg           84.3    6e-17   
emb|CDY39882.1|  BnaC03g67350D                                        84.3    6e-17   
emb|CAN77457.1|  hypothetical protein VITISV_037412                   84.0    7e-17   
gb|KFK29839.1|  hypothetical protein AALP_AA7G185500                  84.0    7e-17   
ref|XP_008449746.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.0    7e-17   
ref|XP_009391880.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    8e-17   
ref|XP_004162098.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    8e-17   
ref|XP_004142230.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    8e-17   
ref|XP_004162099.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    9e-17   
emb|CAN69991.1|  hypothetical protein VITISV_000931                   83.6    9e-17   
ref|XP_009379485.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    9e-17   
ref|XP_010437925.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    9e-17   
ref|XP_010928252.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  83.6    1e-16   
ref|XP_006282812.1|  hypothetical protein CARUB_v10006528mg           83.6    1e-16   
ref|XP_010437924.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    1e-16   
ref|XP_002282203.3|  PREDICTED: G-type lectin S-receptor-like ser...  83.6    1e-16   
emb|CAN73880.1|  hypothetical protein VITISV_029122                   83.2    1e-16   
ref|XP_010432736.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    1e-16   
emb|CBI26234.3|  unnamed protein product                              83.2    1e-16   
ref|XP_009108882.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    1e-16   
ref|XP_002278198.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    1e-16   
ref|NP_194957.2|  G-type lectin S-receptor-like serine/threonine-...  83.2    1e-16   
emb|CDY23321.1|  BnaA08g12250D                                        83.2    1e-16   
ref|XP_010447409.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    1e-16   
ref|XP_002964086.1|  hypothetical protein SELMODRAFT_81021            83.2    1e-16   
ref|XP_002975434.1|  hypothetical protein SELMODRAFT_103141           83.2    1e-16   
ref|XP_002869284.1|  lectin protein kinase family protein             83.2    1e-16   
ref|XP_002278071.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    1e-16   
gb|KHM99645.1|  G-type lectin S-receptor-like serine/threonine-pr...  82.8    1e-16   
ref|XP_006586060.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.8    1e-16   
ref|XP_006386090.1|  hypothetical protein POPTR_0003s220001g          82.4    1e-16   
ref|XP_010227133.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    1e-16   
emb|CAA16960.1|  S-receptor kinase -like protein                      82.8    2e-16   
ref|XP_006477571.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.8    2e-16   
ref|XP_006844030.1|  hypothetical protein AMTR_s00006p00234620        82.8    2e-16   
ref|XP_006440225.1|  hypothetical protein CICLE_v10018906mg           82.8    2e-16   
ref|XP_002968495.1|  hypothetical protein SELMODRAFT_17523            79.0    2e-16   
ref|XP_006440220.1|  hypothetical protein CICLE_v10018902mg           82.8    2e-16   
ref|XP_006440216.1|  hypothetical protein CICLE_v10018901mg           82.8    2e-16   
ref|XP_009388136.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    2e-16   
gb|KFK29822.1|  hypothetical protein AALP_AA7G183300                  82.8    2e-16   
ref|XP_001773238.1|  predicted protein                                80.1    2e-16   
ref|XP_007048279.1|  Receptor-like protein kinase 1                   82.4    2e-16   
ref|XP_010039226.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.8    2e-16   
gb|KCW49732.1|  hypothetical protein EUGRSUZ_K03230                   82.4    2e-16   
ref|XP_003609255.1|  Avr9/Cf-9 rapidly elicited protein               81.3    2e-16   
ref|XP_010673822.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.4    2e-16   
ref|XP_007034736.1|  Receptor-like protein kinase 1                   82.4    2e-16   
gb|KHN15122.1|  Putative receptor-like protein kinase                 79.7    2e-16   
ref|XP_010673820.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.4    2e-16   
gb|KHN42673.1|  G-type lectin S-receptor-like serine/threonine-pr...  79.0    2e-16   
ref|XP_009407891.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.4    2e-16   
ref|XP_006445958.1|  hypothetical protein CICLE_v10014324mg           82.4    2e-16   
ref|XP_008371662.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.7    3e-16   
ref|XP_002319171.1|  hypothetical protein POPTR_0013s05650g           82.0    3e-16   
ref|XP_007034737.1|  Receptor-like protein kinase 1, putative         82.0    3e-16   
ref|XP_004303307.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_004142231.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_006386087.1|  hypothetical protein POPTR_0003s21980g           78.6    3e-16   
ref|XP_006489370.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_004291455.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_010942056.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_007013350.1|  Receptor protein kinase                          80.9    3e-16   
ref|XP_010927742.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
gb|KDO74635.1|  hypothetical protein CISIN_1g047157mg                 82.0    3e-16   
ref|XP_006494277.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
gb|KCW85883.1|  hypothetical protein EUGRSUZ_B02605                   82.0    3e-16   
ref|XP_008794850.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_010043873.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_010520595.1|  PREDICTED: probable receptor-like protein ki...  80.9    3e-16   
ref|XP_009599702.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    3e-16   
ref|XP_003588769.1|  S-receptor kinase -like protein                  82.0    4e-16   
ref|XP_006388388.1|  hypothetical protein POPTR_0200s00200g           81.6    4e-16   
gb|AFW74873.1|  putative S-locus receptor-like protein kinase fam...  78.2    4e-16   
ref|XP_008782878.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    4e-16   
ref|XP_006376605.1|  hypothetical protein POPTR_0012s00880g           79.7    4e-16   
ref|XP_006359937.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    4e-16   
ref|NP_001182865.1|  uncharacterized protein LOC100501128             78.6    4e-16   
gb|EMT25759.1|  Putative serine/threonine-protein kinase receptor     81.6    5e-16   
gb|KCW44832.1|  hypothetical protein EUGRSUZ_L01596                   81.3    5e-16   
ref|XP_004977987.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    5e-16   
ref|XP_008366187.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    5e-16   
ref|XP_010277462.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    5e-16   
ref|XP_006842056.1|  hypothetical protein AMTR_s00078p00034300        81.6    5e-16   
ref|XP_010249992.1|  PREDICTED: probable receptor-like protein ki...  80.5    5e-16   
ref|XP_006656104.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    5e-16   
ref|XP_008445224.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    5e-16   
ref|XP_002446462.1|  hypothetical protein SORBIDRAFT_06g016370        81.3    5e-16   
ref|XP_006383929.1|  hypothetical protein POPTR_0004s01450g           79.7    5e-16   
ref|XP_009769630.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    6e-16   
ref|XP_010228733.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    6e-16   
ref|XP_009111492.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    6e-16   
emb|CDY07226.1|  BnaCnng02410D                                        81.3    6e-16   
ref|XP_006653154.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    6e-16   
ref|XP_008650227.1|  PREDICTED: G-type lectin S-receptor-like ser...  78.2    6e-16   
gb|KHN42674.1|  G-type lectin S-receptor-like serine/threonine-pr...  81.3    6e-16   
ref|XP_003516654.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    6e-16   
ref|XP_008780533.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.0    6e-16   
ref|XP_009400124.1|  PREDICTED: probable receptor-like protein ki...  80.5    6e-16   
gb|KDP40162.1|  hypothetical protein JCGZ_02160                       81.3    6e-16   
ref|XP_008659521.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    6e-16   
gb|EPS69024.1|  hypothetical protein M569_05744                       78.2    6e-16   
gb|KDO36845.1|  hypothetical protein CISIN_1g041576mg                 80.9    6e-16   
ref|NP_001288447.1|  G-type lectin S-receptor-like serine/threoni...  81.3    7e-16   
ref|XP_010925196.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    7e-16   
ref|XP_011025245.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  81.3    7e-16   
ref|XP_011037768.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.3    7e-16   
emb|CAH66917.1|  H0525E10.1                                           80.9    7e-16   
ref|NP_001052781.1|  Os04g0420400                                     80.9    7e-16   
ref|XP_011025246.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.3    7e-16   
gb|EMT08973.1|  Putative receptor protein kinase ZmPK1                80.9    7e-16   
gb|EMS50642.1|  Putative receptor protein kinase ZmPK1                80.9    7e-16   
ref|XP_010928211.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    7e-16   
gb|EAZ29659.1|  hypothetical protein OsJ_13724                        80.9    7e-16   
gb|KCW49724.1|  hypothetical protein EUGRSUZ_K032211                  77.8    7e-16   
ref|XP_008787374.1|  PREDICTED: probable receptor-like protein ki...  80.1    7e-16   
gb|EYU46320.1|  hypothetical protein MIMGU_mgv1a026830mg              80.9    8e-16   
ref|XP_011025243.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  80.9    8e-16   
gb|EMT33829.1|  Putative LRR receptor-like serine/threonine-prote...  79.0    8e-16   
ref|XP_010275673.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    8e-16   
gb|EEE60992.1|  hypothetical protein OsJ_14790                        80.9    8e-16   
gb|EAY94094.1|  hypothetical protein OsI_15868                        80.9    8e-16   
ref|XP_006376602.1|  hypothetical protein POPTR_0012s00850g           79.0    8e-16   
ref|XP_010911349.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    8e-16   
ref|XP_006388392.1|  hypothetical protein POPTR_0200s00240g           77.8    8e-16   
ref|XP_010312782.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    8e-16   
ref|XP_002516775.1|  serine-threonine protein kinase, plant-type,...  79.3    9e-16   
gb|KHN34903.1|  G-type lectin S-receptor-like serine/threonine-pr...  80.1    9e-16   
ref|XP_003581087.2|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    9e-16   
gb|AEW07680.1|  hypothetical protein 0_8683_01                        76.6    9e-16   
ref|XP_004160765.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  80.5    9e-16   
ref|XP_006663867.1|  PREDICTED: putative receptor protein kinase ...  80.5    9e-16   
ref|XP_002871918.1|  kinase family protein                            79.7    9e-16   
ref|XP_004292984.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    9e-16   
ref|XP_004498744.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_003549780.1|  PREDICTED: probable receptor-like protein ki...  79.7    1e-15   
ref|XP_010265873.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_004138723.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_010227398.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    1e-15   
gb|KFK30619.1|  hypothetical protein AALP_AA6G005100                  80.5    1e-15   
ref|XP_010666218.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_006396235.1|  hypothetical protein EUTSA_v10028429mg           80.5    1e-15   
ref|XP_004303306.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_006386085.1|  hypothetical protein POPTR_0003s21960g           80.5    1e-15   
ref|XP_010027416.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.8    1e-15   
ref|XP_007048804.1|  Receptor-like protein kinase 1, putative         80.5    1e-15   
ref|XP_006389618.1|  hypothetical protein POPTR_0021s00680g           79.0    1e-15   
gb|KDO38717.1|  hypothetical protein CISIN_1g0381681mg                77.4    1e-15   
gb|KCW81393.1|  hypothetical protein EUGRSUZ_C02773                   80.5    1e-15   
ref|XP_004296355.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_010048966.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_004975942.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
gb|AAA33915.1|  protein kinase                                        80.5    1e-15   
gb|ACA05219.1|  pto-like protein                                      77.8    1e-15   
ref|XP_010242295.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
gb|KCW62458.1|  hypothetical protein EUGRSUZ_H05095                   77.8    1e-15   
ref|XP_002278028.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
gb|KCW45166.1|  hypothetical protein EUGRSUZ_L01215                   80.1    1e-15   
ref|NP_001174594.1|  Os06g0142650                                     79.3    1e-15   
gb|EAZ35795.1|  hypothetical protein OsJ_20087                        79.3    1e-15   
gb|EAY99611.1|  hypothetical protein OsI_21589                        79.3    1e-15   
ref|XP_007014864.1|  CCHC-type integrase, putative                    80.5    1e-15   
ref|XP_006388390.1|  hypothetical protein POPTR_0200s00220g           80.1    1e-15   
ref|XP_006361290.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_010047794.1|  PREDICTED: probable receptor-like protein ki...  79.3    1e-15   
gb|KHN22443.1|  G-type lectin S-receptor-like serine/threonine-pr...  78.2    1e-15   
ref|XP_003538753.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
gb|EEE65757.1|  hypothetical protein OsJ_21426                        80.5    1e-15   
ref|XP_008787418.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_010696173.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_010247878.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_002436992.1|  hypothetical protein SORBIDRAFT_10g014200        80.1    1e-15   
dbj|BAJ94511.1|  predicted protein                                    80.1    1e-15   
ref|NP_001057686.1|  Os06g0494100                                     80.1    1e-15   
gb|ACR15163.1|  B-lectin receptor kinase                              80.1    1e-15   
ref|XP_009595215.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_002532358.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  80.1    1e-15   
ref|XP_006450427.1|  hypothetical protein CICLE_v10007503mg           80.1    1e-15   
ref|XP_003581225.2|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|NP_001176815.1|  Os12g0177800                                     77.0    1e-15   
ref|XP_011037898.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_006483369.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
gb|KDO61739.1|  hypothetical protein CISIN_1g036583mg                 80.1    1e-15   
ref|XP_009418234.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    1e-15   
ref|XP_010250137.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    2e-15   
gb|AAF02796.1|AF195115_16  Similar to receptor-like protein kinas...  80.1    2e-15   
dbj|BAD46526.1|  putative receptor-like protein kinase                80.1    2e-15   



>emb|CDP12449.1| unnamed protein product [Coffea canephora]
Length=879

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/60 (88%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAK+ADFGLSKLVEKDQS+V+TKM+GTPGY+APEW+S VITEKVDVYSFGIVMLEI
Sbjct  695  DQNFNAKVADFGLSKLVEKDQSRVITKMRGTPGYLAPEWLSSVITEKVDVYSFGIVMLEI  754



>gb|AEA86343.1| brassinosteroid insensitive 1-associated receptor kinase [Solanum 
nigrum]
Length=121

 Score =   110 bits (274),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LE+
Sbjct  59   DQNFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEV  118



>emb|CDO98556.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAK+ADFGLSKLVEKDQS+V+T+M+GTPGY+APEW+S VITEKVDVYSFGIVM EI
Sbjct  639  DQNFNAKVADFGLSKLVEKDQSRVITRMRGTPGYLAPEWLSSVITEKVDVYSFGIVMSEI  698



>emb|CDP07729.1| unnamed protein product [Coffea canephora]
Length=813

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL++KDQS+VVT+M+GTPGY+APEW+S  +TEKVDVYSFGIVMLEI
Sbjct  628  DENFNAKVADFGLSKLIDKDQSRVVTRMRGTPGYLAPEWLSSTVTEKVDVYSFGIVMLEI  687



>ref|XP_006348981.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=924

 Score =   114 bits (284),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/59 (83%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLE  178
            DQNFNAKI+DFGLSKL+EKD+SKVVT+M+GTPGYIAPEW+S +ITEKVDVY+FGIV+LE
Sbjct  745  DQNFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYIAPEWLSSIITEKVDVYAFGIVLLE  803



>ref|XP_009798696.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana sylvestris]
Length=846

 Score =   112 bits (280),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LE+
Sbjct  667  DQNFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEV  726



>ref|XP_006448035.1| hypothetical protein CICLE_v10014371mg [Citrus clementina]
 gb|ESR61275.1| hypothetical protein CICLE_v10014371mg [Citrus clementina]
Length=718

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT MKGTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  533  DDNFNAKVADFGLSKLIDRDQSQVVTTMKGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  592



>ref|XP_006492302.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like, partial [Citrus sinensis]
Length=485

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT MKGTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  300  DDNFNAKVADFGLSKLIDRDQSQVVTTMKGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  359



>ref|XP_010323667.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Solanum lycopersicum]
Length=799

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ FNAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  619  DQYFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSVITEKVDVYAFGIVLLEI  678



>ref|XP_006448036.1| hypothetical protein CICLE_v10014371mg [Citrus clementina]
 gb|ESR61276.1| hypothetical protein CICLE_v10014371mg [Citrus clementina]
Length=760

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT MKGTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  575  DDNFNAKVADFGLSKLIDRDQSQVVTTMKGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  634



>ref|XP_004243251.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Solanum lycopersicum]
Length=834

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ FNAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  654  DQYFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSVITEKVDVYAFGIVLLEI  713



>ref|XP_006348904.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=825

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LE+
Sbjct  645  DQNFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEV  704



>ref|XP_006492260.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X1 [Citrus sinensis]
 ref|XP_006492261.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X2 [Citrus sinensis]
Length=845

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT MKGTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  660  DDNFNAKVADFGLSKLIDRDQSQVVTTMKGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  719



>ref|XP_006492264.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Citrus sinensis]
Length=845

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT MKGTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  660  DDNFNAKVADFGLSKLIDRDQSQVVTTMKGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  719



>emb|CDO98553.1| unnamed protein product [Coffea canephora]
Length=821

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NF AK+ADFGLSKL+EKDQS+VVT+M+GTPGY+APEW+S  ITEKVDVYSFGIV+LEI
Sbjct  636  DKNFRAKVADFGLSKLIEKDQSRVVTRMRGTPGYLAPEWLSSTITEKVDVYSFGIVILEI  695



>ref|XP_006492266.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X1 [Citrus sinensis]
 ref|XP_006492267.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X2 [Citrus sinensis]
 ref|XP_006492268.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X3 [Citrus sinensis]
Length=845

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  660  DDNFNAKVADFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  719



>ref|XP_010070466.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=826

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK+ADFGLSKL+EKDQS+V+T M+GTPGY+APEW+S VITEKVDVYSFGIVMLEI
Sbjct  650  DEHFNAKLADFGLSKLIEKDQSQVMTTMRGTPGYLAPEWLSSVITEKVDVYSFGIVMLEI  709



>gb|KCW89672.1| hypothetical protein EUGRSUZ_A01944 [Eucalyptus grandis]
Length=773

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK+ADFGLSKL+EKDQS+V+T M+GTPGY+APEW+S VITEKVDVYSFGIVMLEI
Sbjct  597  DEHFNAKLADFGLSKLIEKDQSQVMTTMRGTPGYLAPEWLSSVITEKVDVYSFGIVMLEI  656



>ref|XP_006448032.1| hypothetical protein CICLE_v10017695mg [Citrus clementina]
 gb|ESR61272.1| hypothetical protein CICLE_v10017695mg [Citrus clementina]
Length=803

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  618  DDNFNAKVADFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  677



>gb|EYU30749.1| hypothetical protein MIMGU_mgv1a019140mg [Erythranthe guttata]
Length=841

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  660  DENFNAKLADFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEI  719



>ref|XP_009763890.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana sylvestris]
Length=845

 Score =   110 bits (274),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAKI+DFGLSKL+EKD+S VVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LE+
Sbjct  666  DQNFNAKISDFGLSKLIEKDKSNVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEV  725



>gb|KDO38706.1| hypothetical protein CISIN_1g043292mg [Citrus sinensis]
Length=558

 Score =   108 bits (271),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT M+GTPGY+APEW+S +ITEKVD+YSFG+VMLEI
Sbjct  373  DGNFNAKVADFGLSKLIDQDQSQVVTTMRGTPGYLAPEWLSSIITEKVDIYSFGVVMLEI  432



>ref|XP_010323669.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase SD2-5 [Solanum lycopersicum]
Length=824

 Score =   109 bits (273),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LE+
Sbjct  648  DENFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEV  707



>ref|XP_009605954.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=836

 Score =   109 bits (273),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ+ NAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+S +ITEKVDVY+FGIV+LEI
Sbjct  656  DQHLNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSIITEKVDVYAFGIVLLEI  715



>ref|XP_010070456.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=685

 Score =   109 bits (272),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK+ADFGLSKL++KDQS V+T M+GTPGY+APEW+S VITEKVDVYSFGIVMLE+
Sbjct  509  DEHFNAKLADFGLSKLIDKDQSHVMTTMRGTPGYLAPEWLSSVITEKVDVYSFGIVMLEV  568



>gb|KCW44834.1| hypothetical protein EUGRSUZ_L01598 [Eucalyptus grandis]
Length=811

 Score =   109 bits (272),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL++KDQS++VT M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  627  DENFNAKVADFGLSKLIDKDQSQIVTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  686



>gb|KCW89671.1| hypothetical protein EUGRSUZ_A01943, partial [Eucalyptus grandis]
Length=725

 Score =   109 bits (272),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK+ADFGLSKL++KDQS V+T M+GTPGY+APEW+S VITEKVDVYSFGIVMLE+
Sbjct  549  DEHFNAKLADFGLSKLIDKDQSHVMTTMRGTPGYLAPEWLSSVITEKVDVYSFGIVMLEV  608



>ref|XP_010040878.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=836

 Score =   109 bits (272),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL++KDQS++VT M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  652  DENFNAKVADFGLSKLIDKDQSQIVTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  711



>ref|XP_006348915.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=840

 Score =   109 bits (272),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ FNAKI+DFGLSKL+EKD SKVVT+M+GTPGY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  660  DQYFNAKISDFGLSKLIEKDISKVVTRMRGTPGYLAPEWLSSVITEKVDVYAFGIVLLEI  719



>emb|CDP15996.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAK++DFGLSKL+EKDQS+VVT+M+GTPGY+APEW+   ITEKVDVYSFG+V++EI
Sbjct  157  DQNFNAKVSDFGLSKLLEKDQSRVVTRMRGTPGYLAPEWLHSGITEKVDVYSFGVVIMEI  216



>gb|EYU30750.1| hypothetical protein MIMGU_mgv1a024561mg [Erythranthe guttata]
Length=874

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQS+V+T M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  691  DENFNAKLADFGLSKLIDRDQSQVMTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEI  750



>ref|XP_009778145.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana sylvestris]
Length=828

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ+ NAKI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+S +ITEKVDVY+FGIV+LE+
Sbjct  648  DQHLNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSIITEKVDVYAFGIVLLEL  707



>ref|XP_006448031.1| hypothetical protein CICLE_v10014464mg [Citrus clementina]
 gb|ESR61271.1| hypothetical protein CICLE_v10014464mg [Citrus clementina]
Length=697

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVD+YSFG+VMLEI
Sbjct  446  DDNFNAKVADFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSSVITEKVDIYSFGVVMLEI  505



>emb|CDP15994.1| unnamed protein product [Coffea canephora]
Length=816

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAK++DFGLSKL+EKDQS+VVT+M+GTPGY+APEW+   ITEKVDVYSFG+V++EI
Sbjct  632  DQNFNAKVSDFGLSKLLEKDQSRVVTRMRGTPGYLAPEWLHSGITEKVDVYSFGVVIMEI  691



>ref|XP_009605931.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=829

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ FNAKI+DFGLSKL+EKD+SKV+T+M+GTPGY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  649  DQYFNAKISDFGLSKLIEKDKSKVLTRMRGTPGYLAPEWLSSVITEKVDVYAFGIVLLEI  708



>ref|XP_002454975.1| hypothetical protein SORBIDRAFT_03g002425 [Sorghum bicolor]
 gb|EES00095.1| hypothetical protein SORBIDRAFT_03g002425 [Sorghum bicolor]
Length=320

 Score =   105 bits (262),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+E+DQS V+T+M+GTPGY+APEW++  ITEKVDVYSFGIV++EI
Sbjct  174  DDNFNAKVADFGLSKLIERDQSSVITRMRGTPGYMAPEWLTSKITEKVDVYSFGIVLMEI  233



>ref|XP_010039230.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=804

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL++KDQS+++T M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  624  DENFNAKVADFGLSKLIDKDQSQIITTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  683



>ref|XP_003632253.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=832

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK++DFGLSKL++KDQS+VVT+M+GTPGY+APEW++ +ITEKVDVYSFG+V+LEI
Sbjct  649  DEDFNAKVSDFGLSKLIDKDQSQVVTRMRGTPGYLAPEWLTSIITEKVDVYSFGVVVLEI  708



>gb|KCW49738.1| hypothetical protein EUGRSUZ_K03237 [Eucalyptus grandis]
Length=863

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL++KDQS+++T M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  679  DENFNAKVADFGLSKLIDKDQSQIITTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  738



>ref|XP_006348913.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=842

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKI+DFGLSKL++KD+SKVVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LE+
Sbjct  663  DKNFNAKISDFGLSKLIDKDESKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEL  722



>ref|XP_009795619.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana sylvestris]
Length=823

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAKI+DFGLSKL+EK++SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LE+
Sbjct  644  DQNFNAKISDFGLSKLIEKNKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEL  703



>gb|EMT28454.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=309

 Score =   104 bits (260),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  147  DENFNAKVADFGLSKLIDRDQSKVMTMMRGTPGYLAPEWLTSHITEKVDVYSFGVVILEI  206



>ref|XP_009605940.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=826

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQNFNAKI+DFGLSKL+EK++SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LE+
Sbjct  646  DQNFNAKISDFGLSKLIEKNKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEL  705



>gb|ACI26722.1| receptor-like kinase [Nicotiana glutinosa]
Length=832

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ+ N KI+DFGLSKL+EKD+SKVVT+M+GTPGY+APEW+S +ITEKVDVY+FGIV+LEI
Sbjct  652  DQHLNVKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSIITEKVDVYAFGIVLLEI  711



>ref|XP_010324078.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5, partial [Solanum lycopersicum]
Length=827

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/59 (78%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  5    QNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            +NFNAKI+DFGLSKL++KD+SKVVT+M+GTPGY+APEW+  VITEKVDVY+FGIV+LEI
Sbjct  649  KNFNAKISDFGLSKLIDKDESKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEI  707



>ref|XP_006348903.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=841

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ FNAKI+DFGLSKL+EKD+SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  661  DQYFNAKISDFGLSKLIEKDKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEI  720



>ref|XP_006377090.1| hypothetical protein POPTR_0012s14130g [Populus trichocarpa]
 gb|ERP54887.1| hypothetical protein POPTR_0012s14130g [Populus trichocarpa]
Length=602

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAKI+DFGLSKLV+KDQSK+VT M+GTPGY+APEW+S VITEK D+YSFG+V+LE+
Sbjct  428  DDNFNAKISDFGLSKLVDKDQSKIVTIMRGTPGYLAPEWLSSVITEKADIYSFGVVVLEM  487



>ref|XP_010039229.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
 gb|KCW49737.1| hypothetical protein EUGRSUZ_K03236 [Eucalyptus grandis]
Length=803

 Score =   107 bits (267),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+V+T M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  619  DGNFNAKVADFGLSKLIDRDQSQVITTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  678



>ref|XP_010657073.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Vitis vinifera]
Length=790

 Score =   107 bits (267),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK++DFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  604  DEHFNAKVSDFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEI  663



>gb|KCW49725.1| hypothetical protein EUGRSUZ_K03222 [Eucalyptus grandis]
Length=827

 Score =   107 bits (266),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL++KDQS++VT M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  656  DETFNAKVADFGLSKLIDKDQSQIVTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  715



>gb|KCW49726.1| hypothetical protein EUGRSUZ_K03223 [Eucalyptus grandis]
Length=760

 Score =   107 bits (266),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL++KDQS+V T M+GTPGY+APEW+S+ ITEKVDVYSFG+V+LEI
Sbjct  576  DGNFNAKVADFGLSKLIDKDQSQVFTTMRGTPGYLAPEWLSVAITEKVDVYSFGVVILEI  635



>ref|XP_003633280.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Vitis vinifera]
Length=848

 Score =   107 bits (266),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK++DFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  662  DEHFNAKVSDFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEI  721



>ref|XP_006652160.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Oryza brachyantha]
Length=840

 Score =   107 bits (266),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVD+YSFGIV++EI
Sbjct  658  DENFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGIVVMEI  717



>gb|KCW49728.1| hypothetical protein EUGRSUZ_K03225 [Eucalyptus grandis]
Length=823

 Score =   106 bits (265),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+V+T M+GTPGY+APEW S VITEKVDVYSFG+V+LEI
Sbjct  639  DGNFNAKVADFGLSKLIDRDQSQVITTMRGTPGYLAPEWRSAVITEKVDVYSFGVVILEI  698



>ref|XP_010657072.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=809

 Score =   106 bits (265),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++ NAK++DFGLSKL++KDQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  630  DEHLNAKVSDFGLSKLIDKDQSQVVTTMRGTPGYLAPEWLSSVITEKVDVYSFGVVLLEI  689



>ref|XP_010657074.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=840

 Score =   106 bits (265),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++ NAK++DFGLSKL++KDQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  661  DEHLNAKVSDFGLSKLIDKDQSQVVTTMRGTPGYLAPEWLSSVITEKVDVYSFGVVLLEI  720



>ref|XP_002277643.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=846

 Score =   106 bits (265),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++ NAK++DFGLSKL++KDQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  667  DEHLNAKVSDFGLSKLIDKDQSQVVTTMRGTPGYLAPEWLSSVITEKVDVYSFGVVLLEI  726



>ref|XP_010242119.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nelumbo nucifera]
Length=855

 Score =   106 bits (265),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGLSKL+++DQS+VVT M+GTPGY+APEW+S +ITEKVDVYSFG+V++EI
Sbjct  673  DDNFNAKVSDFGLSKLIDRDQSEVVTTMRGTPGYLAPEWLSSMITEKVDVYSFGVVVMEI  732



>ref|XP_010038719.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
 gb|KCW47377.1| hypothetical protein EUGRSUZ_K01176 [Eucalyptus grandis]
Length=838

 Score =   106 bits (265),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++D+S+VVT M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  654  DDNFNAKVADFGLSKLIDRDKSQVVTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVVLEI  713



>gb|KCW47386.1| hypothetical protein EUGRSUZ_K01188 [Eucalyptus grandis]
Length=820

 Score =   106 bits (264),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKIADFGLSKL+++D+++VVT M+GTPGY+APEW ++VITEKVDVYSFG+V+LEI
Sbjct  639  DENFNAKIADFGLSKLIDRDKNQVVTSMRGTPGYMAPEWWNIVITEKVDVYSFGVVILEI  698



>ref|XP_010038721.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=905

 Score =   106 bits (265),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF AK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  721  DGNFTAKVADFGLSKLIDRDQSKVVTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  780



>gb|KCW89665.1| hypothetical protein EUGRSUZ_A01935 [Eucalyptus grandis]
Length=330

 Score =   103 bits (256),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK+ADF LSKL+ KDQS V+  M+GTPGY+APEW+S VITEKVDVYSFGIVMLE+
Sbjct  244  DEHFNAKLADFWLSKLINKDQSHVMMSMRGTPGYLAPEWLSYVITEKVDVYSFGIVMLEV  303



>gb|EEE60706.1| hypothetical protein OsJ_14199 [Oryza sativa Japonica Group]
Length=835

 Score =   106 bits (264),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  656  DENFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVLMEI  715



>ref|XP_010323666.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Solanum lycopersicum]
Length=835

 Score =   106 bits (264),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ FNAKI+DFGLSKL++KD+SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  656  DQYFNAKISDFGLSKLIDKDKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEI  715



>ref|XP_002525876.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF36480.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=870

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAKI DFGLSKL+ +DQSKVVT M+GTPGY+APEW+S VITEKVD+YSFGIV+LE+
Sbjct  672  DNQFNAKICDFGLSKLIHRDQSKVVTTMRGTPGYLAPEWLSSVITEKVDIYSFGIVVLEM  731



>gb|KCW47378.1| hypothetical protein EUGRSUZ_K01177 [Eucalyptus grandis]
Length=638

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQS+VVT M+GTPGY+APEW+S  ITEKVDVYS+G+V+LEI
Sbjct  454  DGNFNAKVADFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSAAITEKVDVYSYGVVILEI  513



>ref|XP_010242180.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nelumbo nucifera]
Length=817

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL++++QS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V++EI
Sbjct  643  DENFNAKVSDFGLSKLIDRNQSQVVTTMRGTPGYLAPEWLSSVITEKVDVYSFGVVVMEI  702



>gb|KCW47363.1| hypothetical protein EUGRSUZ_K01148 [Eucalyptus grandis]
Length=589

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQS+ +T M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  501  DENFNAKVADFGLSKLLDRDQSQAMTTMRGTPGYLAPEWLSATITEKVDVYSFGVVVLEI  560



>dbj|BAJ94427.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   103 bits (256),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++E+
Sbjct  197  DENFNAKVADFGLSKLIDRDQSKVMTMMRGTPGYLAPEWLTSQITEKVDVYSFGVVVMEV  256



>gb|KCW47380.1| hypothetical protein EUGRSUZ_K01180, partial [Eucalyptus grandis]
Length=824

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF AK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  640  DGNFTAKVADFGLSKLIDRDQSKVVTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVILEI  699



>emb|CDP15997.1| unnamed protein product [Coffea canephora]
Length=836

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSKL+++DQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  656  DDKFNAKLSDFGLSKLIDRDQSQVVTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEI  715



>gb|EAY93506.1| hypothetical protein OsI_15301 [Oryza sativa Indica Group]
Length=863

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  683  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  742



>gb|EAZ30147.1| hypothetical protein OsJ_14201 [Oryza sativa Japonica Group]
Length=863

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  683  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  742



>gb|KCW47671.1| hypothetical protein EUGRSUZ_K01410 [Eucalyptus grandis]
Length=729

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKIADFGLSK++++DQS++VT M+GTPGY+APEW+   ITEKVDVYSFG+V+LEI
Sbjct  555  DENFNAKIADFGLSKIIDRDQSQIVTTMRGTPGYMAPEWLHATITEKVDVYSFGVVILEI  614



>ref|NP_001052412.2| Os04g0303500 [Oryza sativa Japonica Group]
 dbj|BAF14326.2| Os04g0303500 [Oryza sativa Japonica Group]
Length=900

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  683  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  742



>gb|EEE60705.1| hypothetical protein OsJ_14196 [Oryza sativa Japonica Group]
Length=723

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  561  DENFNAKLADFGLSKLMDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLMEI  620



>emb|CDP15995.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 58/61 (95%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWM-SLVITEKVDVYSFGIVMLE  178
            DQNFNAK++DFGLSKL+EKDQS+VVT+M+GTPGY+APEW+ S  +TEKVDVYSFG+V++E
Sbjct  634  DQNFNAKVSDFGLSKLLEKDQSRVVTRMRGTPGYLAPEWLHSAGMTEKVDVYSFGVVIME  693

Query  179  I  181
            I
Sbjct  694  I  694



>emb|CDP15993.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 58/61 (95%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWM-SLVITEKVDVYSFGIVMLE  178
            DQNFNAK++DFGLSKL+EKDQS+VVT+M+GTPGY+APEW+ S  +TEKVDVYSFG+V++E
Sbjct  648  DQNFNAKVSDFGLSKLLEKDQSRVVTRMRGTPGYLAPEWLHSAGMTEKVDVYSFGVVIME  707

Query  179  I  181
            I
Sbjct  708  I  708



>ref|XP_006348914.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=832

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ  NAKI+DFGLSKL+EKD+SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  653  DQYLNAKISDFGLSKLIEKDKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEI  712



>emb|CAH66217.1| OSIGBa0157N01.3 [Oryza sativa Indica Group]
Length=838

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  658  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  717



>ref|XP_006348984.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=846

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ  NAKI+DFGLSKL+EKD+SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  667  DQYLNAKISDFGLSKLIEKDKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEI  726



>emb|CAE05335.2| OSJNBa0079M09.4 [Oryza sativa Japonica Group]
Length=838

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  658  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  717



>ref|XP_007037704.1| S-domain-2 5, putative [Theobroma cacao]
 gb|EOY22205.1| S-domain-2 5, putative [Theobroma cacao]
Length=761

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL+ +DQS+V+T M+GTPGY+APEW+S VITEK DVYSFGIV+LEI
Sbjct  586  DENFNAKVSDFGLSKLIGRDQSQVITTMRGTPGYMAPEWLSSVITEKADVYSFGIVVLEI  645



>emb|CAH66083.1| H0215E01.11 [Oryza sativa Indica Group]
 emb|CAH66215.1| OSIGBa0157N01.1 [Oryza sativa Indica Group]
Length=822

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  642  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  701



>emb|CAE05332.2| OSJNBa0079M09.1 [Oryza sativa Japonica Group]
Length=822

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  642  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  701



>ref|XP_010323668.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Solanum lycopersicum]
Length=803

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ  NAKI+DFGLSKL+EKD+SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  623  DQYLNAKISDFGLSKLIEKDKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEI  682



>ref|XP_004243252.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Solanum lycopersicum]
Length=838

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ  NAKI+DFGLSKL+EKD+SKVVT+M+GT GY+APEW+S VITEKVDVY+FGIV+LEI
Sbjct  658  DQYLNAKISDFGLSKLIEKDKSKVVTRMRGTRGYLAPEWLSSVITEKVDVYAFGIVLLEI  717



>emb|CBI22039.3| unnamed protein product [Vitis vinifera]
Length=713

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++ NAK++DFGLSKL++KDQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  432  DEHLNAKVSDFGLSKLIDKDQSQVVTTMRGTPGYLAPEWLSSVITEKVDVYSFGVVLLEI  491



>gb|EMT08875.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=838

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++E+
Sbjct  659  DENFNAKVADFGLSKLIDRDQSKVMTMMRGTPGYMAPEWLTSQITEKVDVYSFGVVVMEL  718



>gb|EMT14318.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=848

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++E+
Sbjct  669  DENFNAKVADFGLSKLIDRDQSKVMTMMRGTPGYMAPEWLTSQITEKVDVYSFGVVVMEL  728



>ref|XP_011098378.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Sesamum indicum]
Length=821

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+N+NAKIADFGL+KL+ +DQS VVT M+GTPGY+APEW++ VITEKVDVYSFG+V+LEI
Sbjct  641  DENYNAKIADFGLAKLIGRDQSAVVTTMRGTPGYLAPEWINGVITEKVDVYSFGVVLLEI  700



>ref|XP_010038718.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=845

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++D+S+V+T M+GTPGY+APEW+S  ITEKVDVYSFG+V+LE+
Sbjct  661  DENFNAKVADFGLSKLIDRDKSQVMTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVVLEV  720



>gb|EEE60707.1| hypothetical protein OsJ_14200 [Oryza sativa Japonica Group]
Length=773

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  593  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  652



>ref|NP_001173852.1| Os04g0303300 [Oryza sativa Japonica Group]
 dbj|BAH92580.1| Os04g0303300 [Oryza sativa Japonica Group]
Length=733

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V+LEI
Sbjct  553  DEKFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLLEI  612



>emb|CAE04684.2| OSJNBb0018A10.13 [Oryza sativa Japonica Group]
Length=716

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  554  DENFNAKLADFGLSKLMDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLMEI  613



>gb|EEC76989.1| hypothetical protein OsI_15296 [Oryza sativa Indica Group]
Length=831

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  669  DENFNAKLADFGLSKLMDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLMEI  728



>ref|XP_009605899.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
 ref|XP_009605907.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
 ref|XP_009605916.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
 ref|XP_009605922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=530

 Score =   103 bits (257),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNA+ +DFGLSKLV KD+SK+VT M+GTPGY+APEW++ VITEKVDVYSFG+V+LEI
Sbjct  351  DHNFNARASDFGLSKLVGKDESKIVTTMRGTPGYLAPEWLNSVITEKVDVYSFGVVILEI  410



>gb|KCW47376.1| hypothetical protein EUGRSUZ_K01175 [Eucalyptus grandis]
Length=770

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++D+S+V+T M+GTPGY+APEW+S  ITEKVDVYSFG+V+LE+
Sbjct  586  DENFNAKVADFGLSKLIDRDKSQVMTTMRGTPGYLAPEWLSAAITEKVDVYSFGVVVLEV  645



>ref|XP_002525880.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF36484.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=837

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ F+AKI+DFGLSKL+++DQSKVVT M+GTPGY+APEW+S +ITEK D+YSFG+VMLE+
Sbjct  662  DQKFSAKISDFGLSKLMDRDQSKVVTAMRGTPGYLAPEWLSSIITEKADIYSFGVVMLEM  721



>ref|XP_002445840.1| hypothetical protein SORBIDRAFT_07g026780 [Sorghum bicolor]
 gb|EES15335.1| hypothetical protein SORBIDRAFT_07g026780 [Sorghum bicolor]
Length=847

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVD+YSFG+V++E+
Sbjct  668  DDNFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVVMEV  727



>ref|XP_004243248.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Solanum lycopersicum]
Length=834

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ +NAK+ADFGLSKL++++QS+V+T+M+GTPGY+APEW+S VITEKVDVYSFGIV+LEI
Sbjct  656  DEKYNAKLADFGLSKLIDRNQSQVMTQMRGTPGYLAPEWLSGVITEKVDVYSFGIVILEI  715



>gb|EMT26048.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=805

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGL KL+ +DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  642  DENFNAKVADFGLCKLINRDQSKVVTVMRGTPGYLAPEWLTSRITEKVDVYSFGVVIMEI  701



>gb|EMT26049.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=957

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGL KL+ +DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  492  DDNFNAKVADFGLCKLINRDQSKVVTMMRGTPGYLAPEWLTSRITEKVDVYSFGVVLMEI  551



>gb|KDP39795.1| hypothetical protein JCGZ_03931 [Jatropha curcas]
Length=782

 Score =   103 bits (258),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D   NAKI+DFGLSKL+++DQSKVVT M+GTPGY+APEW+S VITEKVD+YSFG+V+LEI
Sbjct  607  DDKINAKISDFGLSKLIDRDQSKVVTTMRGTPGYLAPEWLSSVITEKVDIYSFGVVVLEI  666



>gb|EMT08394.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=830

 Score =   103 bits (258),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGL KL+ +DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  657  DDNFNAKVADFGLCKLINRDQSKVVTMMRGTPGYLAPEWLTSSITEKVDVYSFGVVIMEI  716



>ref|XP_004975239.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Setaria italica]
Length=848

 Score =   103 bits (258),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVD+YSFG+V++E+
Sbjct  669  DENFNAKLADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVVMEV  728



>ref|XP_006348912.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=704

 Score =   103 bits (257),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N NAK++DFGLSKLV KD+SK+VT M+GTPGY+APEW+  VITEKVDVYSFG+V+LEI
Sbjct  520  DHNLNAKVSDFGLSKLVGKDESKIVTTMRGTPGYLAPEWLHEVITEKVDVYSFGVVILEI  579



>emb|CAH66079.1| H0215E01.7 [Oryza sativa Indica Group]
Length=864

 Score =   103 bits (258),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++D SKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  685  DENFNAKLADFGLSKLIDRDHSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLMEI  744



>emb|CAE04686.2| OSJNBb0018A10.15 [Oryza sativa Japonica Group]
 gb|EAZ30143.1| hypothetical protein OsJ_14197 [Oryza sativa Japonica Group]
Length=864

 Score =   103 bits (258),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+ADFGLSKL+++D SKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  685  DENFNAKLADFGLSKLIDRDHSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLMEI  744



>ref|XP_006348980.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=515

 Score =   102 bits (254),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            DQ  NAKI+DFGLSKL+EKD+SKVVT+M+GT GY+APEW+S VI EKVDVY+FGIV+LEI
Sbjct  335  DQYLNAKISDFGLSKLIEKDKSKVVTRMRGTRGYLAPEWLSSVIIEKVDVYAFGIVLLEI  394



>gb|EMT18051.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=763

 Score =   103 bits (257),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK+ADFGLSKL+++D+S+VVT+M+GTPGY+APEW++  ITEKVDVYSFGIV++EI
Sbjct  627  DDKFNAKVADFGLSKLIDRDESRVVTRMRGTPGYMAPEWLTSKITEKVDVYSFGIVVIEI  686



>gb|EMS64724.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=831

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGL KL+ +DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  658  DDNFNAKVADFGLCKLINRDQSKVVTVMRGTPGYLAPEWLTSRITEKVDVYSFGVVVMEI  717



>ref|XP_009593099.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGLSKLV K++SK+VT M+GTPGY+APEW++ VITEKVDVYSFG+V+LEI
Sbjct  654  DHDFNAKVSDFGLSKLVGKNESKIVTTMRGTPGYLAPEWLNSVITEKVDVYSFGVVILEI  713



>ref|XP_002457489.1| hypothetical protein SORBIDRAFT_03g008160 [Sorghum bicolor]
 gb|EES02609.1| hypothetical protein SORBIDRAFT_03g008160 [Sorghum bicolor]
Length=640

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++EI
Sbjct  461  DENFNAKLSDFGLSKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEI  520



>gb|EMT32501.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=1097

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK+ADFGL KL+++DQSKVVT M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  924  DESFNAKVADFGLCKLIDRDQSKVVTMMRGTPGYLAPEWLTSRITEKVDVYSFGVVIMEI  983



>ref|XP_009593100.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Nicotiana tomentosiformis]
Length=740

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGLSKLV K++SK+VT M+GTPGY+APEW++ VITEKVDVYSFG+V+LEI
Sbjct  556  DHDFNAKVSDFGLSKLVGKNESKIVTTMRGTPGYLAPEWLNSVITEKVDVYSFGVVILEI  615



>gb|EEC70133.1| hypothetical protein OsI_00815 [Oryza sativa Indica Group]
Length=845

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK+ADFGLSKL+E++ SKVVT+MKGTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  666  DDSFNAKVADFGLSKLIEREISKVVTRMKGTPGYMAPEWLTSQITEKVDVYSFGVVVMEI  725



>dbj|BAA92954.1| S-receptor kinase -like [Oryza sativa Japonica Group]
 gb|EAZ10953.1| hypothetical protein OsJ_00796 [Oryza sativa Japonica Group]
Length=845

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK+ADFGLSKL+E++ SKVVT+MKGTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  666  DDSFNAKVADFGLSKLIEREISKVVTRMKGTPGYMAPEWLTSQITEKVDVYSFGVVVMEI  725



>gb|KCW47382.1| hypothetical protein EUGRSUZ_K01182 [Eucalyptus grandis]
Length=818

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKLV ++QS+V+T M+GTPGY+A EW+S VITEKVDVYSFG+V+LEI
Sbjct  658  DGNFNAKVADFGLSKLVNRNQSQVITTMRGTPGYLALEWLSAVITEKVDVYSFGVVILEI  717



>emb|CAH66082.1| H0215E01.10 [Oryza sativa Indica Group]
Length=835

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK+A FGLSKL+++DQSKVVT M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  656  DENFNAKLAYFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVLMEI  715



>ref|XP_006348905.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=581

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N NAK++DFGLSKLV KD+S +VT M+GTPGY+APEW+  VITEKVDVYSFG+V+LEI
Sbjct  397  DHNLNAKVSDFGLSKLVGKDESNIVTAMRGTPGYLAPEWLHEVITEKVDVYSFGVVILEI  456



>ref|XP_004968009.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Setaria italica]
Length=661

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  482  DENFNAKLSDFGLSKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  541



>gb|AAR08844.1| resistance protein candidate [Vitis amurensis]
Length=181

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGI  166
            D++ NAK++DFGLSKL++KDQS+VVT M+GTPGY+APEW+S VITEKVDVYSFG+
Sbjct  127  DEHLNAKVSDFGLSKLIDKDQSQVVTTMRGTPGYLAPEWLSSVITEKVDVYSFGV  181



>ref|XP_003578879.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Brachypodium distachyon]
Length=846

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NF+AK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++E+
Sbjct  667  DENFHAKVADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVVMEV  726



>gb|EMS49522.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=830

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++E+
Sbjct  651  DEKFNAKVADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVVMEL  710



>ref|XP_007048759.1| S-domain-2 5, putative [Theobroma cacao]
 gb|EOX92916.1| S-domain-2 5, putative [Theobroma cacao]
Length=815

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNA++ADFGLSK++ +DQ K  T M+GTPGY+APEW S VITEKVDVYSFGIV+LEI
Sbjct  637  DENFNAQLADFGLSKVIARDQDKAFTTMRGTPGYMAPEWSSAVITEKVDVYSFGIVVLEI  696



>ref|XP_002445841.1| hypothetical protein SORBIDRAFT_07g026790 [Sorghum bicolor]
 gb|EES15336.1| hypothetical protein SORBIDRAFT_07g026790 [Sorghum bicolor]
Length=789

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSK +++DQSKVVT M+GTPGY+APEW++  ITEKVD+YSFG+V++E+
Sbjct  614  DDNFNAKLADFGLSKHIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVVMEV  673



>ref|XP_009618783.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
 ref|XP_009618784.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=770

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ +NAK++DFGLSKL+++ QSKVVT M+GTPGY+APEW+S VITEKVDVYS+G+V+LEI
Sbjct  594  DEKYNAKLSDFGLSKLIDRTQSKVVTTMRGTPGYLAPEWLSAVITEKVDVYSYGVVVLEI  653



>gb|EMT08844.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=259

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNA++ADFGLSKL+++++S+VVT+M+GTPGY+APEW++  ITEKVDVYSFG V++ I
Sbjct  79   DDNFNAEVADFGLSKLIDREESRVVTRMRGTPGYMAPEWLTPKITEKVDVYSFGTVVMAI  138



>gb|AAF43399.1| serine/threonine protein kinase [Oryza sativa Japonica Group]
Length=175

 Score = 96.3 bits (238),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGI  166
            D NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYS+GI
Sbjct  121  DDNFNAKLADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSYGI  175



>gb|EMS52420.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=604

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKI+DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  425  DENFNAKISDFGLCKLIDRDTSEVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  484



>gb|EMT13028.1| Zeamatin [Aegilops tauschii]
Length=636

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKI+DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  457  DENFNAKISDFGLCKLIDRDMSEVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  516



>ref|XP_008791435.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase SD2-5 [Phoenix dactylifera]
Length=849

 Score =   101 bits (251),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL+KL+++DQS V+T+M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  670  DDNFNAKVSDFGLAKLIDRDQSYVMTRMRGTPGYLAPEWLTSRITEKVDIYSFGVVVMEI  729



>ref|XP_010038902.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=811

 Score =   101 bits (251),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLE  178
            D+NFNAK+ADFGLSKL+++DQS+++T ++GTPGY+APEW+   ITEKVDVYSFG+V+LE
Sbjct  627  DENFNAKVADFGLSKLIDRDQSQILTTIRGTPGYLAPEWLHTSITEKVDVYSFGVVILE  685



>ref|XP_009405076.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103988248 
[Musa acuminata subsp. malaccensis]
Length=1449

 Score =   101 bits (252),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2     DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
             D  FNAK++DFGLSKL+++DQ +V+T+M+GTPGY+APEW++ +ITEKVD+YSFG+V++EI
Sbjct  1274  DDRFNAKVSDFGLSKLIDRDQEQVMTRMRGTPGYLAPEWLTSIITEKVDIYSFGVVIIEI  1333


 Score =   101 bits (251),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAK++DFGLSKL+++DQ +V+T+M+GTPGY+APEW++ VITEKVD+YSFG++++EI
Sbjct  665  DEKFNAKVSDFGLSKLIDRDQEEVMTRMRGTPGYLAPEWLTSVITEKVDIYSFGVMIVEI  724



>ref|XP_006643673.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Oryza brachyantha]
Length=653

 Score =   100 bits (249),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAKI+DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++EI
Sbjct  475  DDNFNAKISDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSHITEKADVYSFGIVVMEI  534



>ref|XP_003572973.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Brachypodium distachyon]
Length=809

 Score =   100 bits (250),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGL KL+ +DQSK++T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  636  DDNFNAKVADFGLCKLINRDQSKIMTVMRGTPGYLAPEWLTSRITEKVDVYSFGVVVMEI  695



>ref|XP_010657163.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At5g24080 [Vitis vinifera]
Length=796

 Score =   100 bits (250),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK++DFGLSKL+++DQS+VVT ++GTPGY+APEW+   ITEKVDVYSFGIV LEI
Sbjct  612  DESFNAKVSDFGLSKLMDRDQSQVVTTLRGTPGYMAPEWLISAITEKVDVYSFGIVTLEI  671



>ref|XP_002277928.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=868

 Score =   100 bits (250),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL+++DQS+VVT ++GT GY+APEW S  ITEKVDVYSFG+V LEI
Sbjct  684  DENFNAKVSDFGLSKLIDRDQSQVVTTLRGTLGYLAPEWFSSAITEKVDVYSFGVVTLEI  743



>ref|XP_010059113.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Eucalyptus grandis]
Length=981

 Score =   100 bits (250),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ADFGLSKL++KDQS VVT ++GTPGY+APEW    ITEKV+VYSFG+V+LEI
Sbjct  797  DGNFNAKVADFGLSKLIDKDQSHVVTTIRGTPGYLAPEWQGTTITEKVNVYSFGVVILEI  856



>ref|XP_009771360.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5, partial [Nicotiana sylvestris]
Length=636

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ ++AK++DFGLSKL+++ QSKVVT M+GTPGY+APEW+S VITEKVDVYSFG+V+LEI
Sbjct  460  DEKYDAKLSDFGLSKLIDRTQSKVVTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEI  519



>ref|XP_002278212.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=864

 Score =   100 bits (250),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D++FNAK++DFGLSKL+++DQS+VVT ++GTPGY+APEW+   ITEKVDVYSFGIV LEI
Sbjct  680  DESFNAKVSDFGLSKLMDRDQSQVVTTLRGTPGYMAPEWLISAITEKVDVYSFGIVTLEI  739



>gb|KCW48103.1| hypothetical protein EUGRSUZ_K01839 [Eucalyptus grandis]
Length=864

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLE  178
            D+NFNAK+ADFGLSKL+++DQS+++T ++GTPGY+APEW+   ITEKVDVYSFG+V+LE
Sbjct  680  DENFNAKVADFGLSKLIDRDQSQILTTIRGTPGYLAPEWLHTSITEKVDVYSFGVVILE  738



>ref|XP_010925665.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105048149 
[Elaeis guineensis]
Length=1771

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL+K++++DQS V+T+M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  678  DDNFNAKVSDFGLAKMIDRDQSHVMTRMRGTPGYLAPEWLTSRITEKVDIYSFGVVVMEI  737


 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2     DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
             D NFNAK++DFGL+K++++DQS V+T+M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  1592  DDNFNAKVSDFGLAKMIDRDQSHVMTRMRGTPGYLAPEWLTSRITEKVDIYSFGVVVMEI  1651



>gb|EMT29328.1| Zeamatin [Aegilops tauschii]
Length=629

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFGIV++EI
Sbjct  450  DDNFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADVYSFGIVVIEI  509



>dbj|BAJ96726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=627

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N+NAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  448  DDNYNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKVDVYSFGVVVMEI  507



>ref|NP_001141480.1| uncharacterized LOC100273591 [Zea mays]
 gb|ACF86456.1| unknown [Zea mays]
 gb|AFW65501.1| putative D-mannose binding lectin receptor-like protein kinase 
family protein [Zea mays]
Length=346

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF+AK++DFGL KL+++D+S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  166  DDNFDAKLSDFGLCKLIDRDKSQVVTRMRGTPGYLAPEWLTSHITEKADVYSFGVVVMEI  225



>dbj|BAJ89157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=634

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N+NAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  455  DDNYNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKVDVYSFGVVVMEI  514



>gb|EEC70132.1| hypothetical protein OsI_00814 [Oryza sativa Indica Group]
Length=779

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ DFGLS+L+ +DQS V T+M+GTPGY++PEW++  ITEKVDVYS+G+VM+EI
Sbjct  621  DDNFNAKVCDFGLSRLIHRDQSHVTTRMRGTPGYLSPEWLTSHITEKVDVYSYGVVMIEI  680



>dbj|BAD72985.1| putative S-receptor kinase [Oryza sativa Japonica Group]
Length=779

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK+ DFGLS+L+ +DQS V T+M+GTPGY++PEW++  ITEKVDVYS+G+VM+EI
Sbjct  621  DDNFNAKVCDFGLSRLIHRDQSHVTTRMRGTPGYLSPEWLTSHITEKVDVYSYGVVMIEI  680



>gb|AFW57900.1| putative D-mannose binding lectin receptor-like protein kinase 
family protein [Zea mays]
Length=581

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++++DQSKVVT+M+GT GY+APEW+   ITEK DVYSFGIVM+E+
Sbjct  396  DSKFNAKLSDFGLSKMIDRDQSKVVTRMRGTRGYLAPEWLGSTITEKADVYSFGIVMVEM  455



>gb|AAR08853.1| resistance protein candidate [Vitis amurensis]
Length=62

 Score = 91.3 bits (225),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGI  166
            D++FNAK++DFGLSKL+++DQS+VVT ++GTPGY+APEW+   ITEKVDVYSFG+
Sbjct  8    DESFNAKVSDFGLSKLMDRDQSQVVTTLRGTPGYMAPEWLISAITEKVDVYSFGV  62



>dbj|BAD45068.1| putative receptor serine/threonine kinase PR5K [Oryza sativa 
Japonica Group]
 dbj|BAD45146.1| putative receptor serine/threonine kinase PR5K [Oryza sativa 
Japonica Group]
Length=601

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++E+
Sbjct  423  DDNFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEM  482



>ref|XP_008778569.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Phoenix dactylifera]
Length=300

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  8    NFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            NFNAK++DFGL+KL+++DQS V+T+M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  123  NFNAKVSDFGLAKLIDRDQSYVMTRMRGTPGYLAPEWLTSRITEKVDIYSFGVVVMEI  180



>ref|XP_007048756.1| S-domain-2 5, putative [Theobroma cacao]
 gb|EOX92913.1| S-domain-2 5, putative [Theobroma cacao]
Length=607

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNA++ADFGLSK++ +DQ K  T M+GTPGY+AP W S VITEKVDVYSFGIV+LEI
Sbjct  429  DENFNAQLADFGLSKVLARDQDKAFTTMRGTPGYMAPGWSSAVITEKVDVYSFGIVVLEI  488



>gb|EEE53749.1| hypothetical protein OsJ_00116 [Oryza sativa Japonica Group]
Length=656

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++E+
Sbjct  478  DDNFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEM  537



>ref|NP_001172138.1| Os01g0113650 [Oryza sativa Japonica Group]
 dbj|BAH90868.1| Os01g0113650 [Oryza sativa Japonica Group]
Length=674

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++E+
Sbjct  478  DDNFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEM  537



>ref|XP_008779505.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5, partial [Phoenix dactylifera]
Length=629

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL+KL+++DQS V+T+M+GTPGY+APEW++  ITEKVD+YS G+V++EI
Sbjct  450  DDNFNAKVSDFGLAKLIDRDQSYVITRMRGTPGYLAPEWLTSRITEKVDIYSSGVVVMEI  509



>gb|AGY30981.1| receptor-like protein kinase [Triticum aestivum]
Length=380

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+V T+M+GTPGY+APEW++  ITEKVDVYSFG+V++E+
Sbjct  296  DDDFNAKLSDFGLCKLIDRDMSQVFTRMRGTPGYLAPEWLTSQITEKVDVYSFGVVVMEV  355



>ref|XP_008663082.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Zea mays]
Length=817

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++++DQSKVVT+M+GT GY+APEW+   ITEK DVYSFGIVM+E+
Sbjct  632  DSKFNAKLSDFGLSKMIDRDQSKVVTRMRGTRGYLAPEWLGSTITEKADVYSFGIVMVEM  691



>ref|XP_004968008.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Setaria italica]
Length=666

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK D+YSFG+V++E+
Sbjct  487  DENFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADIYSFGVVVMEM  546



>ref|XP_009605729.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=827

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+  NAK++DFGLSKL++++QS+V+T M+GTPGY+APEW+S  ITEKVDVYSFGIV+LEI
Sbjct  649  DEKHNAKLSDFGLSKLIDRNQSQVMTTMRGTPGYLAPEWLSGAITEKVDVYSFGIVILEI  708



>gb|EMT14789.1| Zeamatin [Aegilops tauschii]
Length=643

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK D+YSFG+V++EI
Sbjct  464  DDNFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSHITEKADIYSFGVVVMEI  523



>gb|EAZ01299.1| hypothetical protein OsI_23331 [Oryza sativa Indica Group]
Length=845

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAKI+DFG++KLV+KD+S+V+T+M+GTPGY+APEW++  ITEK DVYSFG+ +LEI
Sbjct  667  DDQFNAKISDFGVAKLVDKDKSRVMTRMRGTPGYLAPEWLTSTITEKADVYSFGVAVLEI  726



>gb|EEC69811.1| hypothetical protein OsI_00122 [Oryza sativa Indica Group]
Length=1067

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++E+
Sbjct  889  DDNFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEM  948



>gb|EMT00452.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=639

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAKI+DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  460  DDDFNAKISDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSHITEKADVYSFGVVVMEI  519



>gb|KCW47381.1| hypothetical protein EUGRSUZ_K01181 [Eucalyptus grandis]
Length=571

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 1/60 (2%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAKIADFGLSKL+++DQS+V+T M+G PGY+APEW+S+ ITEKVDVYS G+V+LEI
Sbjct  477  DGNFNAKIADFGLSKLIDRDQSQVITTMRGIPGYLAPEWLSVAITEKVDVYS-GLVILEI  535



>gb|AAF43402.1| serine/threonine protein kinase [Oryza sativa Japonica Group]
Length=176

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGI  166
            D NFNAK+ DFGLS+L+ +DQS V T+M+GTPGY++PEW++  ITEKVD+YS+GI
Sbjct  122  DDNFNAKVCDFGLSRLIHRDQSHVTTRMRGTPGYLSPEWLTSHITEKVDIYSYGI  176



>ref|XP_003571152.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Brachypodium distachyon]
Length=888

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAKI+DFGL+KL+++DQS V+TK++GT GY+APEW++  ITEK D+YSFG+V+LEI
Sbjct  717  DENFNAKISDFGLAKLIDRDQSHVMTKVRGTRGYLAPEWLTSTITEKADIYSFGVVVLEI  776



>ref|XP_003633281.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Vitis vinifera]
Length=791

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL+++DQS+VVT ++GT GY+APEW S  ITEK DVYSFG+V LEI
Sbjct  657  DKNFNAKVSDFGLSKLMDRDQSQVVTTLRGTLGYLAPEWFSSAITEKADVYSFGVVTLEI  716



>ref|XP_006657049.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Oryza brachyantha]
Length=833

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGL+KLV++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  655  DDQFNAKLSDFGLAKLVDRDKSRVMTRMRGTPGYLAPEWLTSTITEKADVYSFGVVVMEV  714



>gb|EMS64723.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=735

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F+AK+ADFGL KL+ +DQSKV+T M+GTPGY+APEW++  ITEKVDVYSFG+V++EI
Sbjct  619  DGKFSAKVADFGLCKLINRDQSKVMTMMRGTPGYLAPEWLTSRITEKVDVYSFGVVLMEI  678



>gb|AFW65500.1| putative D-mannose binding lectin receptor-like protein kinase 
family protein [Zea mays]
Length=653

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF+AK++DFGL KL+++D+S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  473  DDNFDAKLSDFGLCKLIDRDKSQVVTRMRGTPGYLAPEWLTSHITEKADVYSFGVVVMEI  532



>gb|EMS47949.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=504

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N+NAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  333  DDNYNAKLSDFGLCKLIDRDISQVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  392



>emb|CAN67060.1| hypothetical protein VITISV_036717 [Vitis vinifera]
Length=689

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL++KD+S+V+  M+GTPGY+APEW    IT KVD+YSFGIV+LEI
Sbjct  513  DENFNAKVSDFGLSKLIDKDESQVLITMRGTPGYLAPEWRESRITVKVDIYSFGIVLLEI  572



>emb|CDM80298.1| unnamed protein product [Triticum aestivum]
Length=1164

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2     DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
             D +FNAKI+DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  985   DHDFNAKISDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSHITEKADVYSFGVVVMEI  1044


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL K++++D S+V T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  339  DDDFNAKLSDFGLCKIIDRDMSQVFTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  398



>dbj|BAD45065.1| putative receptor serine/threonine kinase PR5K [Oryza sativa 
Japonica Group]
 dbj|BAD45143.1| putative receptor serine/threonine kinase PR5K [Oryza sativa 
Japonica Group]
Length=652

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++EI
Sbjct  474  DDKFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEI  533



>ref|XP_002277429.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At5g24080 [Vitis vinifera]
Length=717

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLSKL++KD+S+V+  M+GTPGY+APEW    IT KVD+YSFGIV+LEI
Sbjct  541  DENFNAKVSDFGLSKLIDKDESQVLITMRGTPGYLAPEWRESRITVKVDIYSFGIVLLEI  600



>gb|EMS67568.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=636

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  457  DDDFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  516



>dbj|BAK02589.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=641

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  462  DDDFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  521



>gb|EAZ10278.1| hypothetical protein OsJ_00113 [Oryza sativa Japonica Group]
Length=436

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++EI
Sbjct  258  DDKFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEI  317



>dbj|BAJ95826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVTKM+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  305  DDDFNAKLSDFGLCKLIDRDMSQVVTKMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  364



>gb|AEI84329.1| lectin-domain receptor-like kinase [Nicotiana attenuata]
Length=830

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+  NAK++DFGL+KL++++QS+V+T M+GTPGY+APEW+S  ITEKVDVYSFGIV+LEI
Sbjct  652  DEKHNAKLSDFGLAKLIDRNQSQVMTMMRGTPGYLAPEWLSGAITEKVDVYSFGIVILEI  711



>gb|EMT08770.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=825

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF+AK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK D+YSFGIV++EI
Sbjct  302  DDNFDAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADIYSFGIVVMEI  361



>gb|EMS67566.1| Zeamatin [Triticum urartu]
Length=596

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK D+YSFG+V++EI
Sbjct  434  DDDFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADIYSFGVVVMEI  493



>gb|EMT14788.1| Protein P21 [Aegilops tauschii]
Length=818

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  639  DDDFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEI  698



>gb|EEC69810.1| hypothetical protein OsI_00117 [Oryza sativa Indica Group]
Length=1003

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGL KL+++D+S+V+T+M+GTPGY+APEW++  ITEK DVYSFGIV++EI
Sbjct  825  DDKFNAKLSDFGLCKLIDRDKSQVITRMRGTPGYLAPEWLTSQITEKADVYSFGIVVMEI  884



>ref|XP_011033510.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Populus euphratica]
Length=917

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N +AKI+DFGLSKL++KDQS+VVT M+GTPGY+APE  S VITEK DVYSFGIV++E+
Sbjct  738  DANLHAKISDFGLSKLIDKDQSQVVTTMRGTPGYLAPELFSSVITEKADVYSFGIVVMEV  797



>dbj|BAK00815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=639

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK D+YSFG+V++EI
Sbjct  460  DDDFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADIYSFGVVVMEI  519



>emb|CDM81285.1| unnamed protein product [Triticum aestivum]
Length=642

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+VVT+M+GTPGY+APEW++  ITEK D+YSFG+V++EI
Sbjct  463  DDDFNAKLSDFGLCKLIDRDMSQVVTRMRGTPGYLAPEWLTSQITEKADIYSFGVVVMEI  522



>ref|XP_010316850.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Solanum lycopersicum]
Length=594

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+N  AK++DFGL+KLV+KDQS +VT+++GTPGY+APEW S  ITEK DVYSFGIV +EI
Sbjct  416  DENLCAKVSDFGLAKLVDKDQSHIVTRIRGTPGYLAPEWCSAFITEKADVYSFGIVAIEI  475



>ref|XP_002454976.1| hypothetical protein SORBIDRAFT_03g002430 [Sorghum bicolor]
 gb|EES00096.1| hypothetical protein SORBIDRAFT_03g002430 [Sorghum bicolor]
Length=867

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N +AK++DFGLSK++++D+S+V+T+M+GTPGY+APEW++  ITEKVD+YSFG+V++EI
Sbjct  688  DDNLSAKLSDFGLSKMIDRDKSQVITRMRGTPGYLAPEWLTSQITEKVDIYSFGVVVMEI  747



>ref|XP_011010909.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X3 [Populus euphratica]
Length=917

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N +AKI+DFGLSKL++KDQS+VVT M+GTPGY+APE  S VITEK DVYSFGIV++E+
Sbjct  738  DANLHAKISDFGLSKLIDKDQSQVVTTMRGTPGYLAPELFSSVITEKADVYSFGIVVMEV  797



>ref|XP_002451837.1| hypothetical protein SORBIDRAFT_04g008440 [Sorghum bicolor]
 gb|EES04813.1| hypothetical protein SORBIDRAFT_04g008440 [Sorghum bicolor]
Length=870

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAKI+DFGL+KL+++DQS V+TK++GT GY+APEW+S  ITEK D+YSFG+V+LEI
Sbjct  669  DEKFNAKISDFGLAKLIDRDQSHVMTKIRGTRGYLAPEWLSSTITEKADIYSFGVVVLEI  728



>gb|EMT00453.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=478

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D S+V T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  299  DDNFNAKLSDFGLCKLIDRDMSQVFTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  358



>ref|XP_002458028.1| hypothetical protein SORBIDRAFT_03g025670 [Sorghum bicolor]
 gb|EES03148.1| hypothetical protein SORBIDRAFT_03g025670 [Sorghum bicolor]
Length=603

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+V+T+M+GTPGY+APEW++  ITEK D+YSFGIV++EI
Sbjct  424  DDSFNAKLSDFGLCKLIDRDTSQVITRMRGTPGYLAPEWLTSQITEKADIYSFGIVVMEI  483



>ref|XP_002445226.1| hypothetical protein SORBIDRAFT_07g006250 [Sorghum bicolor]
 gb|EES14721.1| hypothetical protein SORBIDRAFT_07g006250 [Sorghum bicolor]
Length=721

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++ +DQSKV+T+M+GT GY+APEW+   ITEK D+YSFGIVM+EI
Sbjct  542  DDEFNAKLSDFGLSKMINRDQSKVMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVMIEI  601



>ref|XP_011010908.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Populus euphratica]
Length=928

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N +AKI+DFGLSKL++KDQS+VVT M+GTPGY+APE  S VITEK DVYSFGIV++E+
Sbjct  749  DANLHAKISDFGLSKLIDKDQSQVVTTMRGTPGYLAPELFSSVITEKADVYSFGIVVMEV  808



>ref|XP_011010907.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Populus euphratica]
Length=937

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N +AKI+DFGLSKL++KDQS+VVT M+GTPGY+APE  S VITEK DVYSFGIV++E+
Sbjct  758  DANLHAKISDFGLSKLIDKDQSQVVTTMRGTPGYLAPELFSSVITEKADVYSFGIVVMEV  817



>ref|XP_002464192.1| hypothetical protein SORBIDRAFT_01g013860 [Sorghum bicolor]
 gb|EER91190.1| hypothetical protein SORBIDRAFT_01g013860 [Sorghum bicolor]
Length=801

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++ +DQSKV+T+M+GT GY+APEW+   ITEK D+YSFGIVM+EI
Sbjct  622  DDRFNAKVSDFGLSKMINRDQSKVMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVMIEI  681



>ref|XP_010102125.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Morus notabilis]
 gb|EXB92375.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Morus notabilis]
Length=787

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLS L+++D+S+V+T ++GTPGY+APEW  L +T KVDVYSFGIV+LEI
Sbjct  608  DENFNAKVSDFGLSTLIDRDESQVLTTLRGTPGYLAPEWKELRVTVKVDVYSFGIVLLEI  667



>ref|XP_004951359.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Setaria italica]
Length=840

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAKI+DFGL+KL+++DQS V+TK++GT GY+APEW+S  ITEK D+YSFG+V+LEI
Sbjct  669  DEKFNAKISDFGLAKLIDRDQSHVMTKIRGTRGYLAPEWLSSTITEKADIYSFGVVVLEI  728



>ref|XP_002437131.1| hypothetical protein SORBIDRAFT_10g021740 [Sorghum bicolor]
 gb|EER88498.1| hypothetical protein SORBIDRAFT_10g021740 [Sorghum bicolor]
Length=840

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ F AK++DFGL+KL++++QS V+T+++GTPGY+APEW++ +ITEKVDVYSFGIV++EI
Sbjct  661  DEMFAAKVSDFGLAKLIDREQSTVMTRLRGTPGYLAPEWLTSIITEKVDVYSFGIVIMEI  720



>ref|XP_009620921.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana tomentosiformis]
Length=834

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F AK++DFGL+KLV+KDQS++VT+++GTPGY+APEW S  ITEK DVYSFG+V +EI
Sbjct  656  DDKFCAKVSDFGLAKLVDKDQSRIVTRIRGTPGYLAPEWFSAFITEKADVYSFGVVAMEI  715



>gb|EMS57499.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=473

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL+++D S+V T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  294  DDNFNAKLSDFGLCKLIDRDMSQVFTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  353



>ref|XP_002450278.1| hypothetical protein SORBIDRAFT_05g003110 [Sorghum bicolor]
 gb|EES09266.1| hypothetical protein SORBIDRAFT_05g003110 [Sorghum bicolor]
Length=672

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++ +DQSKV+T+M+GT GY+APEW+   ITEK D+YSFGIVM+EI
Sbjct  493  DNKFNAKLSDFGLSKMINRDQSKVMTRMRGTRGYLAPEWLGSTITEKADIYSFGIVMIEI  552



>ref|XP_006358140.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Solanum tuberosum]
Length=833

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+N  AK++DFGL+KLV+KDQS +VT+++GTPGY+APEW S  ITEK DVYSFGIV +EI
Sbjct  655  DENLCAKVSDFGLAKLVDKDQSHIVTRIRGTPGYLAPEWCSAFITEKADVYSFGIVAMEI  714



>ref|XP_009778430.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Nicotiana sylvestris]
Length=834

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F AK++DFGL+KLV+KDQS++VT+++GTPGY+APEW S  ITEK DVYSFG+V +EI
Sbjct  656  DDKFCAKVSDFGLAKLVDKDQSRIVTRIRGTPGYLAPEWFSAFITEKADVYSFGVVAMEI  715



>gb|AFW65559.1| D-mannose binding lectin family protein [Zea mays]
Length=645

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF+AK++DFGL KL+++++S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  465  DDNFDAKLSDFGLCKLIDREKSQVVTRMRGTPGYLAPEWLTSHITEKADVYSFGVVVMEI  524



>ref|NP_001147808.1| protein kinase/ transmembrane receptor protein serine/threonine 
kinase precursor [Zea mays]
 gb|ACG28760.1| protein kinase/ transmembrane receptor protein serine/threonine 
kinase [Zea mays]
Length=648

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF+AK++DFGL KL+++++S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++EI
Sbjct  468  DDNFDAKLSDFGLCKLIDREKSQVVTRMRGTPGYLAPEWLTSHITEKADVYSFGVVVMEI  527



>gb|EEC76991.1| hypothetical protein OsI_15300 [Oryza sativa Indica Group]
Length=328

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  5    QNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            +    ++ADFGLSKL+++DQSKVVT M+GTPGY+APEW++  +TEKVDVYSFG+V+LEI
Sbjct  149  REIQCQLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQVTEKVDVYSFGVVLLEI  207



>gb|EMT19168.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=832

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAKI+DFGL+KL+++DQS+V+TK++GT GY+APEW++  ITEK D+YSFG+V+LEI
Sbjct  663  DDKFNAKISDFGLAKLIDRDQSQVMTKVRGTRGYLAPEWLTSTITEKADIYSFGVVVLEI  722



>dbj|BAJ89300.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=838

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ F AK++DFGL+KL++++QS V+T+++GTPGY+APEW++ VI EKVDVYSFGIV+ EI
Sbjct  658  DEQFTAKVSDFGLAKLIDREQSSVMTRLRGTPGYLAPEWLTSVINEKVDVYSFGIVITEI  717



>ref|XP_002305722.2| hypothetical protein POPTR_0004s06050g [Populus trichocarpa]
 gb|EEE86233.2| hypothetical protein POPTR_0004s06050g [Populus trichocarpa]
Length=1034

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D N +AKI+DFGLSKL+++DQS+VVT M+GTPGY+APE  S VITEK DVYSFGIV++E+
Sbjct  855  DANLHAKISDFGLSKLIDRDQSQVVTTMRGTPGYLAPELFSSVITEKADVYSFGIVVMEV  914



>ref|XP_008655752.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Zea mays]
Length=885

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F AKI+DFGLSK++ +D+S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  704  DDGFGAKISDFGLSKMIGRDESRVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  763



>ref|XP_008655751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Zea mays]
Length=905

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F AKI+DFGLSK++ +D+S+VVT+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  724  DDGFGAKISDFGLSKMIGRDESRVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  783



>gb|EMT29879.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=841

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ F AK++DFGL+KL++++Q  V+T+++GTPGY+APEW++ VI EKVDVYSFGIV++EI
Sbjct  661  DEQFTAKVSDFGLAKLIDREQGSVMTRLRGTPGYLAPEWLTSVINEKVDVYSFGIVIMEI  720



>ref|XP_006647105.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Oryza brachyantha]
Length=834

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAKI+DFGL+KL+++D+S V+TK++GT GY+APEW+S  ITEK D+YSFG+V+LEI
Sbjct  663  DDKFNAKISDFGLAKLIDRDESHVMTKIRGTRGYLAPEWLSSTITEKADIYSFGVVVLEI  722



>dbj|BAD27663.1| putative S-receptor kinase [Oryza sativa Japonica Group]
 gb|EEE56621.1| hypothetical protein OsJ_06004 [Oryza sativa Japonica Group]
Length=836

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAKI+DFGL+KL+++D+S V+TK++GT GY+APEW+S  ITEK D+YSFG+V+LEI
Sbjct  664  DDKFNAKISDFGLAKLIDRDESHVMTKIRGTRGYLAPEWLSSTITEKADIYSFGVVVLEI  723



>gb|EEC72793.1| hypothetical protein OsI_06477 [Oryza sativa Indica Group]
Length=836

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAKI+DFGL+KL+++D+S V+TK++GT GY+APEW+S  ITEK D+YSFG+V+LEI
Sbjct  664  DDKFNAKISDFGLAKLIDRDESHVMTKIRGTRGYLAPEWLSSTITEKADIYSFGVVVLEI  723



>gb|EMS61843.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=893

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSKL+ +D SK++T+M+GT GY+APEW+   ITEKVD+YSFGIV++EI
Sbjct  621  DDRFNAKVSDFGLSKLISRDDSKIMTRMRGTRGYLAPEWLGSKITEKVDIYSFGIVIVEI  680



>dbj|BAJ90630.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=830

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++ +DQSK++T+M+GT GY+APEW+   ITEK D+YSFGIV++EI
Sbjct  651  DDRFNAKLSDFGLSKMINRDQSKIMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVVMEI  710



>gb|AFW71183.1| putative D-mannose binding lectin receptor-like protein kinase 
family protein [Zea mays]
Length=825

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F+AKI+DFGL+KL+++DQS V+TK++GT GY+APEW+S  ITEK D+YSFG+V+LEI
Sbjct  681  DDRFDAKISDFGLAKLIDRDQSHVMTKIRGTRGYLAPEWLSSTITEKADIYSFGVVVLEI  740



>ref|XP_010657065.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X2 [Vitis vinifera]
Length=834

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLS+L+ +D+S+V T M+GTPGY+APEW    +T KVD+YSFGIV+LEI
Sbjct  659  DENFNAKVSDFGLSELIGRDESQVFTTMRGTPGYLAPEWSQPKVTVKVDIYSFGIVLLEI  718



>emb|CAN67059.1| hypothetical protein VITISV_036716 [Vitis vinifera]
Length=842

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLS+L+ +D+S+V T M+GTPGY+APEW    +T KVD+YSFGIV+LEI
Sbjct  667  DENFNAKVSDFGLSELIGRDESQVFTTMRGTPGYLAPEWSQPKVTVKVDIYSFGIVLLEI  726



>gb|AGY30982.1| receptor-like protein kinase [Triticum aestivum]
Length=473

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NFNAK++DFGL KL++ D S+V T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  294  DDNFNAKLSDFGLCKLIDWDMSQVFTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  353



>ref|XP_002277406.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 isoform X1 [Vitis vinifera]
Length=849

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGLS+L+ +D+S+V T M+GTPGY+APEW    +T KVD+YSFGIV+LEI
Sbjct  674  DENFNAKVSDFGLSELIGRDESQVFTTMRGTPGYLAPEWSQPKVTVKVDIYSFGIVLLEI  733



>gb|EMT13027.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=566

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+ +D+S+V+T+M+GT GY+APEW+++ I+EK DVYSFGIV++EI
Sbjct  387  DDDFNAKLSDFGLCKLINRDKSQVITRMRGTRGYLAPEWLTMQISEKADVYSFGIVIMEI  446



>gb|EMS57498.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=615

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+++D S+V T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  484  DDDFNAKLSDFGLCKLIDRDMSQVFTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  543



>gb|EMS52421.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=566

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL KL+ +D+S+V+T+M+GT GY+APEW+++ I+EK DVYSFGIV++EI
Sbjct  387  DDDFNAKLSDFGLCKLINRDKSQVITRMRGTRGYLAPEWLTMQISEKADVYSFGIVIMEI  446



>gb|EMS64869.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=747

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++ +DQSK++T+M+GT GY+APEW+   ITEK D+YSFGIV++EI
Sbjct  568  DDRFNAKLSDFGLSKMINRDQSKIMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVVVEI  627



>ref|XP_003575768.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Brachypodium distachyon]
Length=794

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK++ +DQSK++T+M+GT GY+APEW+   ITEK D+YSFGIV++EI
Sbjct  615  DDRFNAKLSDFGLSKMINRDQSKIMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVVVEI  674



>ref|XP_004968870.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Setaria italica]
Length=812

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F+AK++DFGLSK++ +DQSK++T+M+GT GY+APEW+   ITEK D+YSFGIVM+EI
Sbjct  633  DDKFHAKLSDFGLSKMITRDQSKIMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVMIEI  692



>gb|AGY30983.1| receptor-like protein kinase [Triticum aestivum]
Length=518

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL K++++D S+V T+M+GTPGY+APEW++  ITEK DVYSFG+V++E+
Sbjct  339  DDDFNAKLSDFGLCKIIDRDMSQVFTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEV  398



>ref|XP_003575454.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5 [Brachypodium distachyon]
Length=830

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F AK++DFGLSKL+ +D+SKV+T+M+GT GY+APEW+   ITEKVD+YSFGIV++EI
Sbjct  651  DDKFQAKVSDFGLSKLISRDESKVMTRMRGTRGYLAPEWLGSKITEKVDIYSFGIVIVEI  710



>ref|XP_006838827.1| hypothetical protein AMTR_s00002p00263020 [Amborella trichopoda]
 gb|ERN01396.1| hypothetical protein AMTR_s00002p00263020 [Amborella trichopoda]
Length=830

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ FNAKI+DFGLSKL+ +DQS+VVT ++GT GY+APEW +  ITEK DVYSFGIV++EI
Sbjct  659  DEYFNAKISDFGLSKLIARDQSQVVTTLRGTIGYLAPEWRTSKITEKADVYSFGIVIMEI  718



>emb|CAH66077.1| H0215E01.5 [Oryza sativa Indica Group]
Length=720

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVM  172
            D NFNAK+ADFGLSKL+++DQSKV+T M+GTPGY+APEW++  ITEKVDVYS  + +
Sbjct  662  DDNFNAKLADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSLALFL  718



>ref|XP_002987238.1| hypothetical protein SELMODRAFT_125579, partial [Selaginella 
moellendorffii]
 gb|EFJ11814.1| hypothetical protein SELMODRAFT_125579, partial [Selaginella 
moellendorffii]
Length=356

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSL-VITEKVDVYSFGIVMLE  178
            D NF AK+ADFGLSKL+++D+SKV+T M+GTPGY+APEWM    +T K DVYSFG+V+LE
Sbjct  148  DNNFVAKVADFGLSKLIDRDKSKVITNMRGTPGYLAPEWMHQSSVTTKADVYSFGMVLLE  207

Query  179  I  181
            +
Sbjct  208  L  208



>ref|XP_002976405.1| hypothetical protein SELMODRAFT_104776, partial [Selaginella 
moellendorffii]
 gb|EFJ22665.1| hypothetical protein SELMODRAFT_104776, partial [Selaginella 
moellendorffii]
Length=356

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSL-VITEKVDVYSFGIVMLE  178
            D NF AK+ADFGLSKL+++D+SKV+T M+GTPGY+APEWM    +T K DVYSFG+V+LE
Sbjct  148  DNNFVAKVADFGLSKLIDRDKSKVITNMRGTPGYLAPEWMHQSSVTTKADVYSFGMVLLE  207

Query  179  I  181
            +
Sbjct  208  L  208



>gb|EEC70837.1| hypothetical protein OsI_02334 [Oryza sativa Indica Group]
Length=686

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  F+AK++DFGLSKL+ +DQSK++T+M+GT GY+APEW+   ITEK D YSFGIVM+EI
Sbjct  505  DDKFHAKLSDFGLSKLINRDQSKIMTRMRGTRGYLAPEWLGSKITEKADTYSFGIVMIEI  564



>ref|XP_006644290.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Oryza brachyantha]
Length=542

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D  FNAK++DFGLSK + +DQSK++T+M+GT GY+APEW+   ITEK D YSFGIVM EI
Sbjct  363  DDKFNAKLSDFGLSKQINRDQSKIMTRMRGTRGYLAPEWLGSRITEKADTYSFGIVMTEI  422



>gb|EMS63048.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD2-5 [Triticum urartu]
Length=815

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ F AK++DFGL+KL++++Q  V+T+++ TPGY+APEW++ VI EKVDVYSFGIV++EI
Sbjct  635  DEQFTAKVSDFGLAKLIDREQGSVMTRLRSTPGYLAPEWLTSVINEKVDVYSFGIVIMEI  694



>gb|KDP29864.1| hypothetical protein JCGZ_18439 [Jatropha curcas]
Length=844

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D NF+AK++DFGL++L++++Q++V+T+++GT GY+APEW+S  ITEKVDVYSFGIV+LEI
Sbjct  664  DGNFDAKLSDFGLARLIDRNQNQVITQIRGTRGYMAPEWLSRKITEKVDVYSFGIVILEI  723



>ref|XP_006656152.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like [Oryza brachyantha]
Length=844

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ F AKI+DFGL+KL++ +QS V+T+++GT GY+APEW++ VITEKVDVYSFG+V++EI
Sbjct  664  DEMFTAKISDFGLAKLIDHEQSSVMTRLRGTLGYLAPEWLTSVITEKVDVYSFGVVIMEI  723



>ref|XP_002974074.1| hypothetical protein SELMODRAFT_100787 [Selaginella moellendorffii]
 gb|EFJ25029.1| hypothetical protein SELMODRAFT_100787 [Selaginella moellendorffii]
Length=372

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 2/62 (3%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSL--VITEKVDVYSFGIVML  175
            D+NF+ K+ DFGLSKLV++D+++VVT M+GTPGY+APEW++    ++ KVDVYSFGIV+L
Sbjct  163  DENFSPKVTDFGLSKLVDRDKARVVTNMRGTPGYLAPEWLNFNAPVSTKVDVYSFGIVLL  222

Query  176  EI  181
            E+
Sbjct  223  EL  224



>ref|NP_001057839.1| Os06g0551800 [Oryza sativa Japonica Group]
 dbj|BAD53718.1| putative S-domain receptor-like protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAF19753.1| Os06g0551800 [Oryza sativa Japonica Group]
Length=517

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+ F AKI+DFGL+KL++++QS V+T+++G  GY+APEW++ VITEKVDVYSFG+V++EI
Sbjct  408  DEVFTAKISDFGLAKLIDREQSSVMTRLRGRLGYLAPEWLTSVITEKVDVYSFGVVIMEI  467



>ref|XP_007024191.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY26813.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=822

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D +FNAK++DFGL++ ++++QS V+T+M+GT GY+APEW+S  ITEKVDVYSFG+V+LEI
Sbjct  579  DGSFNAKLSDFGLARPIDRNQSHVITQMRGTRGYLAPEWLSRRITEKVDVYSFGVVILEI  638



>ref|XP_006468977.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
Length=833

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGL++L+E+D+S V   M+GTPGYIAPEW    I+ KVD+YSFGIV+LE+
Sbjct  655  DENFNAKVSDFGLAQLIERDESLVQATMRGTPGYIAPEWRKSKISVKVDIYSFGIVLLEV  714



>ref|XP_006468974.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-5-like isoform X1 [Citrus sinensis]
Length=594

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGL++L+E+D+S V   M+GTPGYIAPEW    I+ KVD+YSFGIV+LE+
Sbjct  416  DENFNAKVSDFGLAQLIERDESLVQATMRGTPGYIAPEWRKSKISVKVDIYSFGIVLLEV  475



>ref|XP_006469080.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Citrus sinensis]
Length=726

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    DQNFNAKIADFGLSKLVEKDQSKVVTKMKGTPGYIAPEWMSLVITEKVDVYSFGIVMLEI  181
            D+NFNAK++DFGL++L+E+D+S V   M+GTPGYIAPEW    I+ KVD+YSFGIV+LE+
Sbjct  548  DENFNAKVSDFGLAQLIERDESLVQATMRGTPGYIAPEWRKSKISVKVDIYSFGIVLLEV  607



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506872938168