BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24516_g1_i2 len=1126 path=[1664:0-208 563:209-251 127:252-306
2907:307-335 1994:336-359 2959:360-423 2070:424-613 2258:614-630
2275:631-674 2318:675-745 446:746-921 3344:922-924 2567:925-1125]

Length=1126
                                                                      Score     E

gb|EPS65223.1|  hypothetical protein M569_09558                         149   3e-38   
ref|XP_009615226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   6e-36   
ref|XP_010265495.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   8e-36   
gb|KCW80704.1|  hypothetical protein EUGRSUZ_C02101                     141   2e-35   
ref|XP_010048457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   8e-35   
ref|XP_009784353.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   1e-34   
gb|KDP33435.1|  hypothetical protein JCGZ_07006                         139   2e-34   
ref|XP_011082708.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   4e-34   
ref|XP_008799982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   2e-33   
ref|XP_010909123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   1e-32   
ref|XP_011034724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   2e-32   
ref|XP_002527970.1|  conserved hypothetical protein                     133   3e-32   Ricinus communis
ref|XP_006368661.1|  hypothetical protein POPTR_0001s07490g             134   3e-32   
ref|XP_008786366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   3e-32   
emb|CAN62804.1|  hypothetical protein VITISV_011795                     133   1e-31   Vitis vinifera
ref|XP_002271150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   2e-31   Vitis vinifera
ref|XP_004136457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   8e-31   
ref|XP_006357108.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   1e-30   
ref|XP_008799981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   1e-30   
ref|XP_006382179.1|  putative surface family protein                    128   3e-30   
ref|XP_009394682.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   3e-30   
ref|XP_008466329.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   3e-30   
gb|KFK38614.1|  hypothetical protein AALP_AA3G137100                    126   5e-30   
ref|XP_004952427.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   8e-30   
gb|KDP41920.1|  hypothetical protein JCGZ_26938                         125   9e-30   
gb|AFK47920.1|  unknown                                                 125   1e-29   
ref|XP_006371803.1|  putative surface family protein                    125   2e-29   
ref|XP_010465042.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   3e-29   
ref|XP_009593249.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   3e-29   
gb|KEH39773.1|  fasciclin domain protein                                124   3e-29   
ref|XP_004244694.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   3e-29   
ref|XP_010324668.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   4e-29   
gb|KEH39771.1|  fasciclin-like arabinogalactan protein                  124   7e-29   
ref|XP_007161299.1|  hypothetical protein PHAVU_001G058300g             123   8e-29   
gb|AFK40899.1|  unknown                                                 123   1e-28   
ref|XP_010499304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_010914304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
ref|XP_011015272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_011045030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_002882785.1|  hypothetical protein ARALYDRAFT_478625             121   3e-28   
gb|KEH39774.1|  fasciclin domain protein                                121   4e-28   
ref|XP_009781936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   4e-28   
ref|XP_009787705.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   5e-28   
ref|XP_010938482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   6e-28   
ref|XP_009612463.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   1e-27   
ref|XP_003545530.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   1e-27   
ref|XP_002512774.1|  Glycoprotein X precursor, putative                 121   1e-27   Ricinus communis
ref|XP_002282846.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   3e-27   Vitis vinifera
ref|XP_006357096.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   3e-27   
ref|XP_010938483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   4e-27   
ref|XP_007011569.1|  Fasciclin-like arabinogalactan protein 17, p...    118   4e-27   
ref|XP_004498590.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   5e-27   
ref|XP_004305606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   5e-27   
ref|XP_009363599.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   5e-27   
ref|XP_006298989.1|  hypothetical protein CARUB_v10015115mg             117   7e-27   
ref|XP_008445580.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   9e-27   
ref|NP_187872.1|  fasciclin-like arabinogalactan protein 14             116   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28554.1|  unknown                                                 116   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486594.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   2e-26   
emb|CAN66163.1|  hypothetical protein VITISV_008126                     117   2e-26   Vitis vinifera
ref|XP_008361057.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
ref|XP_011082038.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
ref|XP_009377364.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   3e-26   
gb|KEH39772.1|  fasciclin domain protein                                115   3e-26   
gb|EYU22059.1|  hypothetical protein MIMGU_mgv1a011491mg                116   3e-26   
ref|NP_001130104.1|  hypothetical protein precursor                     116   5e-26   Zea mays [maize]
ref|XP_004305605.1|  PREDICTED: uncharacterized protein LOC101308896    120   5e-26   
ref|XP_008378295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   5e-26   
ref|XP_002452018.1|  hypothetical protein SORBIDRAFT_04g015850          115   6e-26   Sorghum bicolor [broomcorn]
ref|XP_008781934.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   1e-25   
ref|XP_008219800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-25   
gb|KHN10392.1|  Fasciclin-like arabinogalactan protein 3                115   1e-25   
ref|XP_007224727.1|  hypothetical protein PRUPE_ppa024912mg             114   1e-25   
ref|XP_010486992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-25   
ref|XP_009418876.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   2e-25   
gb|EPS61284.1|  hypothetical protein M569_13515                         112   2e-25   
ref|XP_009338843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   3e-25   
ref|XP_006664971.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   4e-25   
ref|XP_008219801.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-25   
ref|XP_009396684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   6e-25   
ref|XP_009605451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   7e-25   
ref|XP_008777689.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-25   
ref|XP_004138878.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   8e-25   
ref|XP_007221854.1|  hypothetical protein PRUPE_ppa021523mg             112   9e-25   
ref|XP_010034870.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   2e-24   
ref|XP_009402000.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-24   
gb|ABR16344.1|  unknown                                                 112   2e-24   Picea sitchensis
gb|KCW53929.1|  hypothetical protein EUGRSUZ_J03138                     111   3e-24   
gb|KHM99327.1|  Fasciclin-like arabinogalactan protein 3                110   3e-24   
emb|CDY52668.1|  BnaC01g38580D                                          110   3e-24   
ref|XP_008352034.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   4e-24   
ref|XP_010102851.1|  hypothetical protein L484_004423                   110   4e-24   
ref|XP_010669451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   6e-24   
ref|XP_010913663.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   6e-24   
ref|XP_009398985.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   9e-24   
ref|NP_001046792.1|  Os02g0461500                                       108   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511740.1|  conserved hypothetical protein                     110   2e-23   Ricinus communis
ref|XP_010527113.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-23   
gb|KDP28734.1|  hypothetical protein JCGZ_14505                         109   2e-23   
gb|KFK32632.1|  hypothetical protein AALP_AA6G268600                    107   2e-23   
ref|XP_009381782.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   3e-23   
ref|XP_009785088.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   3e-23   
ref|XP_009120424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-23   
emb|CDY42162.1|  BnaC05g40570D                                          105   8e-23   
ref|NP_180021.1|  fasciclin-like arabinogalactan protein 3              105   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24724.1|  unknown                                                 107   2e-22   Picea sitchensis
ref|XP_006296192.1|  hypothetical protein CARUB_v10025354mg             105   2e-22   
ref|XP_004229828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   2e-22   
gb|ABR16637.1|  unknown                                                 106   3e-22   Picea sitchensis
ref|XP_002880584.1|  hypothetical protein ARALYDRAFT_481301             104   3e-22   
emb|CDY50538.1|  BnaA01g30420D                                          104   3e-22   
ref|XP_006845641.1|  hypothetical protein AMTR_s00019p00223190          105   3e-22   
ref|XP_010506492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   4e-22   
ref|XP_010429425.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   4e-22   
emb|CDY00793.1|  BnaC03g37770D                                          103   5e-22   
emb|CDY20316.1|  BnaC04g36400D                                          103   6e-22   
ref|XP_002320736.1|  Fasciclin-like arabinogalactan protein 8 pre...    105   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009417795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   7e-22   
emb|CDY08417.1|  BnaA05g26530D                                          102   7e-22   
ref|XP_010518164.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   1e-21   
gb|EPS66997.1|  hypothetical protein M569_07779                         104   1e-21   
ref|XP_010417204.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
ref|XP_010472452.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-21   
ref|XP_006339448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   1e-21   
gb|EMS62729.1|  hypothetical protein TRIUR3_26693                       102   1e-21   
ref|XP_006404978.1|  hypothetical protein EUTSA_v10000470mg             102   2e-21   
ref|XP_009140554.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-21   
gb|EMT17229.1|  hypothetical protein F775_11240                         102   2e-21   
dbj|BAK06740.1|  predicted protein                                      102   2e-21   
gb|ABV27488.1|  fasciclin-like arabinogalactan protein 17               102   2e-21   Gossypium hirsutum [American cotton]
ref|XP_010508167.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   2e-21   
ref|XP_003526450.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   3e-21   
ref|XP_010092859.1|  hypothetical protein L484_022454                   103   3e-21   
ref|XP_009133982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   3e-21   
ref|XP_006445226.1|  hypothetical protein CICLE_v10020328mg             103   4e-21   
ref|XP_006483738.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   4e-21   
dbj|BAP11159.1|  putative Fasciclin-like Arabinogalactan-protein 10   99.4    4e-21   
ref|XP_006450136.1|  hypothetical protein CICLE_v10010765mg             101   4e-21   
ref|XP_010056276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-21   
gb|KHN16466.1|  Fasciclin-like arabinogalactan protein 14             99.8    4e-21   
ref|XP_011082039.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    100   5e-21   
ref|XP_006491459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   5e-21   
dbj|BAP11158.1|  putative Fasciclin-like Arabinogalactan-protein 10   98.6    7e-21   
ref|NP_566043.1|  FASCICLIN-like arabinogalactan protein 8              102   8e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66074.1|  endosperm-specific protein-like protein                 102   9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   9e-21   
dbj|BAP11161.1|  putative Fasciclin-like Arabinogalactan-protein 10   98.2    1e-20   
gb|EPS62290.1|  fasciclin-like arabinogalactan protein 13               101   1e-20   
ref|XP_008460132.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-20   
ref|XP_006352538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   1e-20   
emb|CDP17792.1|  unnamed protein product                                102   1e-20   
ref|XP_009767783.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   1e-20   
dbj|BAP11162.1|  putative Fasciclin-like Arabinogalactan-protein 10   97.4    2e-20   
ref|XP_002882015.1|  hypothetical protein ARALYDRAFT_483684             100   2e-20   
ref|XP_009615606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   2e-20   
ref|XP_007052018.1|  FASCICLIN-like arabinogalactan protein 8           100   3e-20   
ref|XP_004248342.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   4e-20   
ref|XP_009363600.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    4e-20   
ref|XP_006296250.1|  hypothetical protein CARUB_v10025417mg             100   4e-20   
emb|CDY28643.1|  BnaC09g32320D                                          100   5e-20   
ref|XP_010243936.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    7e-20   
ref|XP_004244059.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    7e-20   
ref|XP_010435371.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    8e-20   
ref|XP_009802278.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    9e-20   
ref|XP_006858016.1|  hypothetical protein AMTR_s00069p00195790        99.4    9e-20   
ref|XP_006415013.1|  hypothetical protein EUTSA_v10025352mg           99.0    1e-19   
ref|XP_009625162.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    1e-19   
emb|CDX76814.1|  BnaC08g34000D                                        97.1    1e-19   
emb|CDY34771.1|  BnaA09g41380D                                        97.1    1e-19   
ref|XP_011095539.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    1e-19   
emb|CAN65447.1|  hypothetical protein VITISV_011425                   98.6    1e-19   Vitis vinifera
ref|XP_009117125.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    1e-19   
ref|XP_004144998.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    1e-19   
emb|CDP12467.1|  unnamed protein product                              96.7    2e-19   
ref|XP_004306902.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    2e-19   
ref|XP_010526275.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    2e-19   
emb|CDX68507.1|  BnaC01g25850D                                        98.2    2e-19   
ref|XP_002270426.2|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    2e-19   Vitis vinifera
gb|AIY35292.1|  fasciclin-like arabinogalactan 12                     98.2    2e-19   
ref|XP_010692313.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.2    2e-19   
ref|XP_009151619.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.2    2e-19   
ref|XP_009104281.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.2    2e-19   
ref|XP_010496525.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.2    2e-19   
ref|XP_003523715.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    3e-19   
ref|XP_009146602.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    3e-19   
dbj|BAJ34929.1|  fasciclin-like arabinogalactan protein               97.8    3e-19   
ref|XP_004144548.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.4    4e-19   
ref|XP_006397729.1|  hypothetical protein EUTSA_v10001463mg           97.4    4e-19   
gb|KFK32403.1|  hypothetical protein AALP_AA6G237100                  97.1    5e-19   
ref|XP_009120095.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.4    5e-19   
ref|XP_008462050.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    5e-19   
ref|XP_010479980.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    5e-19   
ref|XP_010438048.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    6e-19   
ref|XP_007049368.1|  FASCICLIN-like arabinogalactan 2                 96.7    6e-19   
ref|XP_006286070.1|  hypothetical protein CARUB_v10007603mg           96.7    6e-19   
emb|CDX73808.1|  BnaA03g32390D                                        94.4    6e-19   
ref|XP_004305460.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    7e-19   
ref|XP_009135245.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    7e-19   
ref|XP_011097758.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    7e-19   
ref|XP_008232692.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    8e-19   
gb|AGN92424.2|  putative fasciclin-like arabinogalactan protein 4     95.5    8e-19   
gb|ABV27484.1|  fasciclin-like arabinogalactan protein 13             95.9    1e-18   Gossypium hirsutum [American cotton]
ref|XP_010277448.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    1e-18   
gb|EYU33706.1|  hypothetical protein MIMGU_mgv1a007367mg              95.9    1e-18   
ref|XP_008463001.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    1e-18   
gb|EYU32014.1|  hypothetical protein MIMGU_mgv1a007039mg              95.9    1e-18   
ref|XP_007218052.1|  hypothetical protein PRUPE_ppa006158mg           95.9    1e-18   
emb|CDY18927.1|  BnaC04g04230D                                        95.9    2e-18   
ref|XP_006601616.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    2e-18   
gb|KDP29933.1|  hypothetical protein JCGZ_18502                       95.5    2e-18   
ref|XP_010432871.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    2e-18   
ref|XP_002267946.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    2e-18   Vitis vinifera
ref|XP_011090995.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    2e-18   
ref|XP_010447580.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    2e-18   
ref|XP_007024813.1|  FASCICLIN-like arabinogalactan protein 14 pr...  94.0    2e-18   
emb|CBI28444.3|  unnamed protein product                              96.3    2e-18   
ref|XP_006401420.1|  hypothetical protein EUTSA_v10013639mg           95.5    2e-18   
ref|XP_006286247.1|  hypothetical protein CARUB_v10007817mg           93.6    2e-18   
ref|XP_002878353.1|  AT3g60900/T4C21_310                              95.5    2e-18   
ref|XP_002316776.2|  hypothetical protein POPTR_0011s09590g           95.1    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002863317.1|  hypothetical protein ARALYDRAFT_497154           95.1    2e-18   
gb|ABV27482.1|  fasciclin-like arabinogalactan protein 11             95.1    2e-18   Gossypium hirsutum [American cotton]
gb|AIY35291.1|  fasciclin-like arabinogalactan 11                     95.1    2e-18   
gb|KFK37339.1|  hypothetical protein AALP_AA4G243700                  95.1    2e-18   
ref|XP_010689281.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    3e-18   
emb|CDX87001.1|  BnaC03g52710D                                        94.7    3e-18   
dbj|BAE75863.1|  putative fasciclin-like arabinogalactan protein      95.1    3e-18   Salicornia europaea [chicken-claws]
emb|CAN61077.1|  hypothetical protein VITISV_012919                   94.7    3e-18   Vitis vinifera
ref|XP_009379279.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    4e-18   
emb|CDY37904.1|  BnaA06g19130D                                        94.4    4e-18   
ref|XP_006346133.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    5e-18   
ref|XP_009150168.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    5e-18   
ref|XP_008343059.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    6e-18   
ref|XP_008228867.1|  PREDICTED: mucin-17-like                         95.5    6e-18   
emb|CDP13717.1|  unnamed protein product                              94.0    6e-18   
gb|AAK55685.1|AF378882_1  AT3g60900/T4C21_310                         94.0    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191649.1|  fasciclin-like arabinogalactan protein 10           94.0    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010616.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    7e-18   
emb|CDX74743.1|  BnaA05g04890D                                        94.0    7e-18   
gb|KDP39270.1|  hypothetical protein JCGZ_01027                       93.6    7e-18   
ref|XP_009143146.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    8e-18   
gb|AAM65777.1|  putative pollen surface protein                       93.6    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148925.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    8e-18   
gb|AAK20858.1|AF333971_1  fasciclin-like arabinogalactan-protein 2    93.6    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193009.1|  fasciclin-like arabinogalactan protein 2            93.6    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHG09433.1|  Fasciclin-like arabinogalactan protein 1              93.6    1e-17   
ref|XP_002462113.1|  hypothetical protein SORBIDRAFT_02g019380        93.2    1e-17   Sorghum bicolor [broomcorn]
gb|EYU27439.1|  hypothetical protein MIMGU_mgv1a007268mg              93.2    1e-17   
ref|XP_010542030.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    1e-17   
ref|XP_004956400.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    1e-17   
ref|XP_010525235.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    2e-17   
ref|XP_010497131.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    2e-17   
gb|ABV27483.1|  fasciclin-like arabinogalactan protein 12             92.8    2e-17   Gossypium hirsutum [American cotton]
gb|ADP88924.1|  fasciclin-like AGP                                    92.4    2e-17   
ref|XP_010557720.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    2e-17   
ref|XP_010942271.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    2e-17   
gb|EAZ42295.1|  hypothetical protein OsJ_26868                        92.0    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010928138.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    3e-17   
ref|XP_010252769.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    3e-17   
ref|XP_010485145.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    3e-17   
ref|XP_006603146.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    3e-17   
ref|XP_010063266.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    3e-17   
ref|XP_003581094.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    4e-17   
ref|XP_004291803.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    4e-17   
ref|XP_010675939.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    4e-17   
ref|XP_008788906.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    4e-17   
ref|XP_010102850.1|  hypothetical protein L484_004422                 89.7    4e-17   
ref|XP_006844054.1|  hypothetical protein AMTR_s00006p00245830        91.3    4e-17   
ref|XP_007212310.1|  hypothetical protein PRUPE_ppa006726mg           91.3    5e-17   
ref|XP_004516114.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    5e-17   
ref|XP_011038795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.3    5e-17   
gb|EMS65354.1|  hypothetical protein TRIUR3_14037                     90.9    6e-17   
gb|EMT28749.1|  hypothetical protein F775_29839                       90.5    8e-17   
gb|ABI95418.1|  fasciclin-like protein FLA28                          90.9    8e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010088447.1|  hypothetical protein L484_018219                 90.9    8e-17   
ref|XP_002320524.2|  hypothetical protein POPTR_0014s16610g           90.5    9e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009375067.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    1e-16   
ref|XP_008651121.1|  PREDICTED: uncharacterized protein LOC100274...  90.5    1e-16   
ref|XP_011011127.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.1    1e-16   
ref|XP_010536730.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    1e-16   
ref|XP_008227156.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.1    1e-16   
emb|CBI39739.3|  unnamed protein product                              90.1    1e-16   
gb|KDO38095.1|  hypothetical protein CISIN_1g013841mg                 90.5    1e-16   
ref|XP_010545276.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.1    1e-16   
gb|ABV27481.1|  fasciclin-like arabinogalactan protein 10             90.1    1e-16   
ref|XP_009385381.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.1    2e-16   
ref|XP_006447810.1|  hypothetical protein CICLE_v10015469mg           89.7    2e-16   
ref|NP_001062666.1|  Os09g0248100                                     89.7    2e-16   
ref|XP_006469451.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    2e-16   
emb|CDX67846.1|  BnaA07g18860D                                        89.7    2e-16   
ref|XP_006660446.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    2e-16   
ref|XP_003534603.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    2e-16   
ref|XP_006652672.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.1    2e-16   
ref|NP_194865.1|  FASCICLIN-like arabinogalactan protein 5            87.8    2e-16   
ref|XP_004965683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.8    2e-16   
ref|XP_002522745.1|  conserved hypothetical protein                   89.7    2e-16   
gb|AGV54413.1|  fasciclin-like arabinogalactan protein 1-like pro...  89.7    2e-16   
ref|XP_002298869.2|  hypothetical protein POPTR_0001s37650g           89.7    2e-16   
ref|XP_002866110.1|  hypothetical protein ARALYDRAFT_495659           89.7    2e-16   
ref|XP_007146643.1|  hypothetical protein PHAVU_006G057400g           89.7    2e-16   
ref|NP_001061532.1|  Os08g0321000                                     89.7    2e-16   
ref|XP_007139983.1|  hypothetical protein PHAVU_008G075000g           89.7    2e-16   
ref|NP_200384.1|  fasciclin-like arabinogalactan protein 1            89.7    2e-16   
emb|CDY66159.1|  BnaCnng49680D                                        89.7    2e-16   
gb|EYU43168.1|  hypothetical protein MIMGU_mgv1a011668mg              87.0    3e-16   
ref|XP_007215592.1|  hypothetical protein PRUPE_ppa007675mg           88.6    3e-16   
emb|CDX71771.1|  BnaC08g31030D                                        89.0    4e-16   
ref|XP_007142534.1|  hypothetical protein PHAVU_008G288800g           89.0    4e-16   
ref|XP_008380005.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    4e-16   
ref|XP_009388359.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    4e-16   
ref|XP_002267825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    5e-16   
ref|XP_006474892.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    5e-16   
gb|KDO59100.1|  hypothetical protein CISIN_1g015356mg                 88.6    5e-16   
ref|XP_011100491.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    5e-16   
dbj|BAK00054.1|  predicted protein                                    88.2    6e-16   
ref|XP_003552347.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    6e-16   
ref|XP_009142340.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    7e-16   
ref|XP_008229928.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.8    7e-16   
ref|XP_006452590.1|  hypothetical protein CICLE_v10008218mg           88.6    7e-16   
ref|XP_006402530.1|  hypothetical protein EUTSA_v10005998mg           88.2    7e-16   
emb|CDY36762.1|  BnaA03g11240D                                        84.7    7e-16   
emb|CDY37043.1|  BnaA04g26210D                                        87.8    9e-16   
ref|XP_008803592.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    9e-16   
dbj|BAE71278.1|  putative fasciclin-like arabinogalactan protein ...  87.8    9e-16   
gb|KHG10798.1|  Fasciclin-like arabinogalactan protein 2              87.8    1e-15   
gb|KFK27162.1|  hypothetical protein AALP_AA8G343200                  87.8    1e-15   
ref|XP_004501250.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    1e-15   
ref|XP_004491619.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.8    1e-15   
ref|XP_009351261.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    1e-15   
ref|XP_007020499.1|  Fasciclin-like arabinogalactan protein 1         87.4    1e-15   
gb|EYU42817.1|  hypothetical protein MIMGU_mgv1a007557mg              87.4    1e-15   
emb|CDX86346.1|  BnaA06g30630D                                        87.4    1e-15   
ref|XP_010061458.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    1e-15   
ref|XP_008342240.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    1e-15   
gb|ABI95393.1|  fasciclin-like protein FLA3                           87.4    1e-15   
ref|XP_004303568.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    1e-15   
gb|ACU21313.1|  unknown                                               84.0    2e-15   
ref|XP_003618047.1|  Fasciclin-like arabinogalactan protein           87.0    2e-15   
ref|XP_008797603.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    2e-15   
ref|XP_009418107.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    2e-15   
ref|XP_003519683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    2e-15   
ref|XP_008809683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    2e-15   
ref|XP_003576707.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    2e-15   
ref|XP_009370988.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    2e-15   
ref|NP_001141906.1|  uncharacterized protein LOC100274054 precursor   86.7    3e-15   
ref|XP_006653238.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    3e-15   
ref|XP_008362415.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    3e-15   
dbj|BAJ90388.1|  predicted protein                                    86.3    3e-15   
ref|XP_003545484.2|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    3e-15   
ref|XP_006292436.1|  hypothetical protein CARUB_v10018654mg           86.3    3e-15   
ref|XP_009108932.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    3e-15   
ref|XP_009132640.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    5e-15   
gb|AEI98736.1|  fasciclin-like arabinogalactan 2                      85.9    5e-15   
gb|KEH34088.1|  fasciclin-like arabinogalactan protein                85.9    5e-15   
ref|XP_010512424.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    5e-15   
ref|XP_010469133.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    5e-15   
ref|XP_006352015.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    6e-15   
emb|CDY52341.1|  BnaA09g38900D                                        85.5    6e-15   
ref|NP_001150349.1|  fasciclin-like arabinogalactan protein 8 pre...  83.6    7e-15   
emb|CDY36445.1|  BnaC03g67650D                                        83.6    7e-15   
ref|XP_008649024.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.2    8e-15   
ref|XP_009116767.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    8e-15   
emb|CDY23293.1|  BnaA08g12530D                                        82.8    1e-14   
ref|XP_008342793.1|  PREDICTED: uncharacterized protein LOC103405558  85.1    1e-14   
ref|XP_003532178.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    1e-14   
emb|CDP18905.1|  unnamed protein product                              84.3    1e-14   
ref|XP_010943291.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    1e-14   
ref|XP_009354314.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    1e-14   
ref|XP_009370989.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    1e-14   
ref|XP_004305604.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.4    1e-14   
gb|EPS69372.1|  fasciclin-like arabinogalactan protein 19             83.2    2e-14   
gb|AFK41095.1|  unknown                                               84.3    2e-14   
ref|XP_010545153.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    2e-14   
ref|XP_002867304.1|  hypothetical protein ARALYDRAFT_491605           82.0    2e-14   
ref|XP_009616556.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    2e-14   
ref|XP_009792211.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    3e-14   
ref|XP_004251538.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.2    3e-14   
ref|XP_006659292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.2    3e-14   
ref|XP_007216704.1|  hypothetical protein PRUPE_ppa026501mg           84.0    3e-14   
ref|XP_003580362.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    3e-14   
gb|EMT07250.1|  hypothetical protein F775_26198                       83.2    4e-14   
ref|XP_004492650.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.2    4e-14   
ref|XP_008228897.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    4e-14   
ref|XP_006357643.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    5e-14   
ref|XP_006412600.1|  hypothetical protein EUTSA_v10027390mg           80.9    6e-14   
ref|NP_001053617.1|  Os04g0574200                                     82.4    8e-14   
ref|NP_001149463.1|  fasciclin-like arabinogalactan protein 8 pre...  80.5    8e-14   
gb|EMT13908.1|  hypothetical protein F775_11763                       79.7    9e-14   
emb|CDY20747.1|  BnaA02g08870D                                        82.0    9e-14   
ref|XP_010418601.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    1e-13   
ref|XP_009379991.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    1e-13   
ref|XP_010323900.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    1e-13   
ref|XP_007150828.1|  hypothetical protein PHAVU_005G184100g           81.6    2e-13   
ref|XP_009799147.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    2e-13   
ref|XP_003603528.1|  Fasciclin-like arabinogalactan protein           79.0    2e-13   
emb|CDY13425.1|  BnaA03g51430D                                        79.3    2e-13   
gb|AAA91129.1|  putative surface protein                              79.0    2e-13   
ref|XP_008342795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    3e-13   
ref|XP_009391103.1|  PREDICTED: flocculation protein FLO11-like       80.9    3e-13   
ref|XP_009138006.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.0    3e-13   
ref|XP_010069727.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.1    5e-13   
ref|XP_010919185.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    5e-13   
gb|ABV27490.1|  fasciclin-like arabinogalactan protein 19             79.3    6e-13   
ref|XP_009606546.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    6e-13   
ref|NP_001151356.1|  fasciclin-like arabinogalactan protein 10 pr...  79.3    8e-13   
ref|XP_008780048.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.3    8e-13   
tpg|DAA36388.1|  TPA: fasciclin-like arabinogalactan protein 10       79.3    9e-13   
ref|XP_009126981.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.0    9e-13   
gb|KCW58153.1|  hypothetical protein EUGRSUZ_H00875                   79.0    1e-12   
ref|XP_009354315.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    1e-12   
ref|XP_004973191.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.0    1e-12   
ref|XP_006280472.1|  hypothetical protein CARUB_v10026407mg           78.6    1e-12   
ref|XP_006595480.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    1e-12   
ref|XP_002440657.1|  hypothetical protein SORBIDRAFT_09g004700        78.2    2e-12   
emb|CDX72305.1|  BnaC07g43270D                                        76.6    2e-12   
ref|NP_001147121.1|  rat frizzled homolog1                            77.8    2e-12   
ref|XP_009365292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    2e-12   
gb|ACL36352.1|  fascilin-like arabinogalactan protein                 77.8    2e-12   
gb|ACN30673.1|  unknown                                               77.8    3e-12   
ref|XP_002448368.1|  hypothetical protein SORBIDRAFT_06g026030        77.4    3e-12   
ref|XP_008803297.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    3e-12   
gb|KHN31865.1|  Fasciclin-like arabinogalactan protein 3              75.9    3e-12   
ref|XP_008342794.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    4e-12   
ref|XP_003560388.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    5e-12   
ref|XP_006647825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    6e-12   
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...  77.0    7e-12   
ref|XP_002438784.1|  hypothetical protein SORBIDRAFT_10g026140        74.7    1e-11   
dbj|BAK07804.1|  predicted protein                                    73.9    1e-11   
dbj|BAK07384.1|  predicted protein                                    73.6    2e-11   
gb|ABI95391.1|  fasciclin-like protein FLA1                           75.5    2e-11   
gb|EMT00417.1|  hypothetical protein F775_14876                       73.2    2e-11   
gb|ABI95423.1|  fasciclin-like protein FLA33                          73.2    2e-11   
ref|XP_006657210.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.2    2e-11   
ref|XP_009382277.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.7    2e-11   
gb|EAZ01938.1|  hypothetical protein OsI_23966                        72.8    4e-11   
ref|XP_011085650.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  73.9    4e-11   
emb|CAH66152.1|  OSIGBa0097I11.4                                      72.4    5e-11   
gb|KHN08266.1|  Fasciclin-like arabinogalactan protein 2              69.7    5e-11   
ref|XP_004965239.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.9    5e-11   
gb|EMS55677.1|  hypothetical protein TRIUR3_04850                     72.8    6e-11   
gb|EAY93407.1|  hypothetical protein OsI_15204                        72.0    6e-11   
gb|KHN13519.1|  Fasciclin-like arabinogalactan protein 1              70.1    7e-11   
gb|ABI95395.1|  fasciclin-like protein FLA5                           73.2    7e-11   
emb|CAD40213.2|  OSJNBa0019J05.11                                     71.6    9e-11   
ref|NP_001047988.1|  Os02g0726000                                     71.2    1e-10   
gb|EAY87366.1|  hypothetical protein OsI_08770                        71.2    1e-10   
ref|XP_004976555.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    2e-10   
ref|XP_002436882.1|  hypothetical protein SORBIDRAFT_10g010500        72.4    2e-10   
ref|NP_001131728.1|  endosperm specific protein precursor             72.4    2e-10   
dbj|BAJ90216.1|  predicted protein                                    72.0    2e-10   
gb|EEE60667.1|  hypothetical protein OsJ_14125                        70.1    2e-10   
gb|ABI95392.1|  fasciclin-like protein FLA2                           71.6    3e-10   
ref|NP_001105408.1|  endosperm specific protein1 precursor            71.6    3e-10   
ref|XP_010030210.1|  PREDICTED: uncharacterized protein LOC104420...  72.0    3e-10   
ref|XP_010030212.1|  PREDICTED: uncharacterized protein LOC104420...  72.0    3e-10   
ref|XP_006649316.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.2    3e-10   
ref|XP_007137111.1|  hypothetical protein PHAVU_009G1004000g          68.2    5e-10   
ref|XP_003572987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  70.1    8e-10   
ref|XP_010933921.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.7    1e-09   
gb|EEC74435.1|  hypothetical protein OsI_09823                        66.6    1e-09   
ref|NP_001058255.1|  Os06g0656800                                     68.2    1e-09   
ref|NP_001048836.2|  Os03g0128000                                     66.6    1e-09   
ref|XP_010253181.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.3    1e-09   
gb|EAZ25443.1|  hypothetical protein OsJ_09260                        68.6    2e-09   
gb|AAM19119.1|AC104427_17  Putative endosperm specific protein        67.8    5e-09   
gb|KEH23329.1|  fasciclin-like arabinogalactan protein                66.6    1e-08   
ref|XP_003623747.1|  Fasciclin-like arabinogalactan protein           66.2    1e-08   
ref|XP_010922339.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.2    1e-08   
ref|XP_010104070.1|  hypothetical protein L484_014256                 65.9    2e-08   
ref|XP_010229273.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.9    2e-08   
ref|XP_004953764.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.5    2e-08   
gb|AFW66310.1|  hypothetical protein ZEAMMB73_332533                  64.7    2e-08   
ref|XP_004244698.2|  PREDICTED: skin secretory protein xP2-like       64.3    3e-08   
ref|XP_006607004.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.0    4e-08   
ref|XP_008680887.1|  PREDICTED: fasciclin-like arabinogalactan pr...  64.7    4e-08   
ref|XP_008802746.1|  PREDICTED: fasciclin-like arabinogalactan pr...  64.3    6e-08   
ref|XP_004987197.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.9    8e-08   
ref|XP_002488894.1|  hypothetical protein SORBIDRAFT_2276s002020      62.8    2e-07   
ref|XP_008679063.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.8    2e-07   
ref|XP_010252126.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.8    2e-07   
ref|XP_003571006.2|  PREDICTED: fasciclin-like arabinogalactan pr...  62.0    2e-07   
ref|XP_002452625.1|  hypothetical protein SORBIDRAFT_04g029330        62.0    3e-07   
ref|XP_002458743.1|  hypothetical protein SORBIDRAFT_03g039440        62.0    3e-07   
ref|NP_001169235.1|  uncharacterized protein LOC100383093 precursor   61.2    6e-07   
ref|XP_002991166.1|  hypothetical protein SELMODRAFT_448310           60.5    6e-07   
ref|XP_004954690.1|  PREDICTED: fasciclin-like arabinogalactan pr...  59.3    8e-07   
ref|XP_011089459.1|  PREDICTED: fasciclin-like arabinogalactan pr...  60.8    9e-07   
ref|XP_002970944.1|  hypothetical protein SELMODRAFT_441324           59.7    1e-06   
gb|EMT30625.1|  hypothetical protein F775_08816                       57.4    1e-06   
ref|XP_002283909.1|  PREDICTED: fasciclin-like arabinogalactan pr...  59.7    2e-06   
ref|XP_008223499.1|  PREDICTED: fasciclin-like arabinogalactan pr...  59.7    2e-06   
emb|CAN72469.1|  hypothetical protein VITISV_006797                   59.7    2e-06   
ref|XP_002982557.1|  hypothetical protein SELMODRAFT_58104            57.4    2e-06   
emb|CBI16143.3|  unnamed protein product                              58.9    2e-06   
ref|XP_007208574.1|  hypothetical protein PRUPE_ppa023463mg           58.9    2e-06   
ref|XP_008776771.1|  PREDICTED: fasciclin-like arabinogalactan pr...  59.3    3e-06   
ref|XP_003560811.1|  PREDICTED: fasciclin-like arabinogalactan pr...  58.5    3e-06   
ref|XP_009595320.1|  PREDICTED: fasciclin-like arabinogalactan pr...  58.9    3e-06   
ref|XP_010236293.1|  PREDICTED: fasciclin-like arabinogalactan pr...  56.6    3e-06   
ref|XP_006838924.1|  hypothetical protein AMTR_s00002p00270100        58.9    4e-06   



>gb|EPS65223.1| hypothetical protein M569_09558, partial [Genlisea aurea]
Length=276

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +L++YP+F++FN +LT+ +LA +INSR T+TVLAVDNGG+ +LSG S D +K+V+
Sbjct  23   FNITHILEQYPDFDSFNNFLTQAKLASQINSRQTITVLAVDNGGVSSLSGMSSDAMKNVL  82

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            + H+VLDYYD  K   L  K+  LTTLFQS+G+  G+QGFLN T   G  V  GSAV  A
Sbjct  83   SAHVVLDYYDEAKLHKLSNKSAILTTLFQSSGLGRGQQGFLNVTILSGGKVAFGSAVAGA  142

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  502
            P G+NL+ +V  + Y++S+LQ+SSLIIPPG++S     +PPS++
Sbjct  143  PLGANLVKSVFSQPYNVSVLQVSSLIIPPGIDSATNATSPPSNR  186



>ref|XP_009615226.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
tomentosiformis]
Length=299

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 133/194 (69%), Gaps = 9/194 (5%)
 Frame = -2

Query  1014  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK  835
             ++    AFN+T +L++Y +F+NFN YLT+T +A  INSR T+TVL V+N  +  LSGKS+
Sbjct  16    ILCHAKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQTITVLVVENSNLSPLSGKSQ  75

Query  834   DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMI  655
             DV+ ++M VH++LDYYDV+K   L  KT K  TLFQ+TG A+ +QG+LN TD G  +V +
Sbjct  76    DVLANIMRVHVLLDYYDVQKLQKLPNKTMKAPTLFQTTGQANSDQGYLNVTDLGSGSVAL  135

Query  654   GSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-------SIAPKAAPPSHQQH  496
             GSA K +  GSNL+ ++A + Y+ISILQIS++IIP G++       S   +A  PS   +
Sbjct  136   GSAAKGSTLGSNLVKSIASQPYNISILQISNVIIPLGIDSSTNSPSSSPNRAPSPSTSDN  195

Query  495   --GKSPAAAPSPRK  460
               G SP +APSP K
Sbjct  196   SSGPSPGSAPSPNK  209



>ref|XP_010265495.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nelumbo 
nucifera]
Length=295

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 124/184 (67%), Gaps = 4/184 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L +Y +F+NFN YLT+T+LA  IN R T+TVLAVDNG + +LSGKS D+I
Sbjct  35    STEAFNITRLLSQYSDFSNFNDYLTQTKLADSINRRQTITVLAVDNGAVSSLSGKSPDLI  94

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K V+++H++LDYYD+ K   L  K+T LTTLFQSTG+A  +QGFLN T      V  GSA
Sbjct  95    KKVLSLHVILDYYDIDKIKKLSNKSTILTTLFQSTGVAVNKQGFLNVTRFASGEVRFGSA  154

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI----APKAAPPSHQQHGKSPAA  478
             VK +   + LI  VA + Y++S+LQ+SS+I P G+E I     P     +  +   SPA 
Sbjct  155   VKGSSLDAQLIKKVAAQPYNLSVLQVSSVIYPTGIEDIKFTPTPPPPRANAPRKSLSPAK  214

Query  477   APSP  466
             AP+P
Sbjct  215   APAP  218



>gb|KCW80704.1| hypothetical protein EUGRSUZ_C02101 [Eucalyptus grandis]
Length=286

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 146/248 (59%), Gaps = 10/248 (4%)
 Frame = -2

Query  1038  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
              F A F     +  AFN+T +L +YP+F+ FN +LT+T+L  +IN R T+TVLA+DN  +
Sbjct  9     LFFAVFIFSSSAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQTITVLALDNSAV  68

Query  858   GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             G +SGK  DV+KS+++ H+VLDYYD++K T L KK+T LTTL+QS+G A  +QGFLN T 
Sbjct  69    GDISGKPADVLKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNVTK  128

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQ  499
               G+ ++ GSAVK A   + L+ AVA + Y+IS+LQ+SS II PG+++  P     +   
Sbjct  129   QSGE-IVFGSAVKGASHNAKLVKAVAAQPYNISVLQVSSPIIAPGIDASNPNGTVHNATT  187

Query  498   HGKSPAAAP------SPRKllspsn---spsdspsdspsalspPGVSPSVPETDSPASGP  346
                SPAA P      SP K         S + +      A        S PE D+P S P
Sbjct  188   PSASPAATPKKAPASSPAKSPVADTPDSSEAPAADSPADAPEADAPEASAPEADAPTSSP  247

Query  345   NGEGDSSA  322
                 D+ A
Sbjct  248   PAPSDADA  255



>ref|XP_010048457.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Eucalyptus 
grandis]
Length=345

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 157/276 (57%), Gaps = 20/276 (7%)
 Frame = -2

Query  1038  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
              F A F     +  AFN+T +L +YP+F+ FN +LT+T+L  +IN R T+TVLA+DN  +
Sbjct  68    LFFAVFIFSSSAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQTITVLALDNSAV  127

Query  858   GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             G +SGK  DV+KS+++ H+VLDYYD++K T L KK+T LTTL+QS+G A  +QGFLN T 
Sbjct  128   GDISGKPADVLKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNVTK  187

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQ  499
               G+ ++ GSAVK A   + L+ AVA + Y+IS+LQ+SS II PG+++  P     +   
Sbjct  188   QSGE-IVFGSAVKGASHNAKLVKAVAAQPYNISVLQVSSPIIAPGIDASNPNGTVHNATT  246

Query  498   HGKSPAAAP------SPRKllspsn---spsdspsdspsalspPGVSPSVPETDSPASGP  346
                SPAA P      SP K         S + +      A        S PE D+P S P
Sbjct  247   PSASPAATPKKAPASSPAKSPVADTPDSSEAPAADSPADAPEADAPEASAPEADAPTSSP  306

Query  345   NGEGDSSA------ATTAREACL----GFVMAIISA  268
                 D+ A       +++    L    G VM ++SA
Sbjct  307   PAPSDADADAPAPGKSSSSRVTLPVGAGIVMGLLSA  342



>ref|XP_009784353.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
sylvestris]
Length=300

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  1014  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK  835
             ++    AFN+T +L++Y +F+NFN YLT+T +A  INSR T+TVL V+N  +  LSGKS+
Sbjct  17    ILCYAKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQTITVLVVENSNLSPLSGKSQ  76

Query  834   DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMI  655
             DV+ ++M VH++LDYYDV+K   L  KT K   LFQ+TG A+ +QG+LN TD G  +V +
Sbjct  77    DVLANIMRVHVLLDYYDVQKLQKLPNKTMKAPALFQTTGQANSDQGYLNVTDLGSGSVAL  136

Query  654   GSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE  538
             GSA K A  GSNL+ +VA + Y+ISILQIS+ IIP G++
Sbjct  137   GSAAKGATLGSNLVKSVASQPYNISILQISNAIIPLGID  175



>gb|KDP33435.1| hypothetical protein JCGZ_07006 [Jatropha curcas]
Length=299

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 124/193 (64%), Gaps = 4/193 (2%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
                FL  F++   +  AFN+T +L  YP F+ FN+ L++T LA +INSR T+TVLAV N 
Sbjct  8     FLLFLVLFTVFSSTSMAFNITRLLSNYPEFSTFNRLLSQTGLAQQINSRQTITVLAVANR  67

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              +  LSGK  DV K V+  H++LDYYD  K + L++K+  LTTL+Q+TG+A  +QGFLN 
Sbjct  68    AIRDLSGKPLDVTKRVLGAHVILDYYDETKLSKLQEKSNILTTLYQTTGVAVDQQGFLNV  127

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSH  505
             T T  K +M G A K AP   +L   VA + Y+IS+L++S +I  PG+ES   K+ PP  
Sbjct  128   TRT-PKGIMFGPAAKGAPLTVSLKGVVASQPYNISVLKVSGVIEAPGIES---KSTPPPE  183

Query  504   QQHGKSPAAAPSP  466
               H K+P  AP+P
Sbjct  184   GSHKKAPLPAPTP  196



>ref|XP_011082708.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Sesamum 
indicum]
Length=322

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 119/170 (70%), Gaps = 0/170 (0%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++   L SFS++  S  AFN+T +L +Y +F+ FN +LT T LA EINSR ++TVL V+N
Sbjct  5     VVKISLFSFSLLFHSAVAFNITQVLSQYASFSTFNSFLTLTNLASEINSRQSITVLVVEN  64

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               +  LSGKS DV+K +M+VH++LDY+DV K   L  K+T +TTLFQ+TG+A G+QGF+N
Sbjct  65    NNLSPLSGKSSDVLKKIMSVHVILDYFDVPKLQKLSNKSTIVTTLFQTTGLAKGQQGFVN  124

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE  538
              T     ++  GSAV  +   SNL+ +V  + Y+ S+LQ++++IIP G++
Sbjct  125   VTQLSSDSIAFGSAVPGSTISSNLVKSVVSQPYNFSVLQVTNVIIPEGID  174



>ref|XP_008799982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 121/182 (66%), Gaps = 4/182 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++   L  F +++ S  AFN+T +L+ +P F  F+ YL +T+L  EIN R T+TVL VDN
Sbjct  7     VVILVLFPF-LLLSSTMAFNITMILEPFPEFATFSNYLNQTKLVHEINHRQTITVLVVDN  65

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               M A+S   ++ +K VM VH++LDYYD++K + + +++  LTTLFQ+TG+A+   GFLN
Sbjct  66    SRMSAISSLPEESLKHVMEVHVILDYYDIRKISRIPRRSFLLTTLFQTTGIATNRMGFLN  125

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV---ESIAPKAA  517
              T   G++V+ GSAV+ AP  S LI  +    Y+IS+LQIS  IIPPG+     IAP +A
Sbjct  126   LTHKAGESVVFGSAVRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGIYGAPPIAPVSA  185

Query  516   PP  511
             PP
Sbjct  186   PP  187



>ref|XP_010909123.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=259

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 123/182 (68%), Gaps = 4/182 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L+ Y +++ FN YLT+T+LA EIN R T+T+L VDN  M A+  K  +++
Sbjct  17    SVEAFNITHILESYSSYSTFNNYLTQTKLAEEINHRQTITILVVDNSKMSAVFSKPIEIL  76

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K++MA+HI+LDYYD  K + +  K+  LTTLFQ++G+A+ + GFLN T+     V+ GSA
Sbjct  77    KNIMAIHIILDYYDTNKLSHIPHKSALLTTLFQTSGIANNKLGFLNVTNMPNDDVVFGSA  136

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGK---SPAAA  475
                AP  S     V  + Y+ISIL+IS LI+PPG+ES A +A+PP+ Q+  K   S A A
Sbjct  137   TPEAPLSSTFTKMVVTKPYNISILEISDLILPPGIES-AKQASPPATQEKAKPTNSTAHA  195

Query  474   PS  469
             P+
Sbjct  196   PA  197



>ref|XP_011034724.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Populus 
euphratica]
Length=314

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 127/195 (65%), Gaps = 0/195 (0%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F    S  ++  +  A N+T +L +YP+F+ F+ YLT+T+LAGEINSR T+TVL V+NG
Sbjct  8     LFALCFSSFLLFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENG  67

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              M  LSGK    IK+V++ H++LDYYDV K   L+KKT  LTTLFQS+G A G+QGFLN 
Sbjct  68    NMSPLSGKPNGEIKNVLSEHVILDYYDVAKLQKLQKKTAMLTTLFQSSGQAKGQQGFLNV  127

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSH  505
             T  G  +V  GSAV  +   SNL+ +V+ + Y+IS+LQ+S++I+P G  +     +P   
Sbjct  128   TVLGSNSVAFGSAVPGSSLSSNLVKSVSSQPYNISVLQVSNIIVPAGTGNTNSSTSPVPV  187

Query  504   QQHGKSPAAAPSPRK  460
                  SP  A SP K
Sbjct  188   GPPKTSPTPASSPNK  202



>ref|XP_002527970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34382.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
               FLA F I   +  AFN+T +L  YP+F+ FN  LT+T LA +INSR T+TVLAV NG 
Sbjct  8     LLFLALFCIFSSTSTAFNITRILSNYPDFSTFNSLLTQTGLAQQINSRQTITVLAVSNGA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G +SGK  D++K +++ H++LDYYD KK   ++K+++ LTTL+Q+TG A+ +QGFLN T
Sbjct  68    IGGVSGKPVDIVKRILSAHVILDYYDQKKLENIKKQSSILTTLYQTTGSANDQQGFLNVT  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI  532
              T    ++ GSAVK AP   +L  +VA + Y+IS+LQ+  +I  PG+E++
Sbjct  128   KTPNG-IVFGSAVKGAPLTVSLEGSVASQPYNISVLQVGGVIEAPGIENM  176



>ref|XP_006368661.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
 gb|ERP65230.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
Length=310

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 104/153 (68%), Gaps = 0/153 (0%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F    S  ++  +  A N+T +L +YP+F+ F+ YLT+T+LAGEINSR T+TVL V+NG
Sbjct  8     LFALCFSSFLLFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENG  67

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              M  LSGK    IK+V++ H++LDYYDV K   L+ KT  LTTLFQS+G A G+QGFLN 
Sbjct  68    NMSPLSGKPNGEIKNVLSGHVILDYYDVAKLQKLQNKTAMLTTLFQSSGQAKGQQGFLNV  127

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             T  G  +V  GSAV  +   SNL+ +V+ + Y+
Sbjct  128   TVLGSNSVAFGSAVPGSSLSSNLVKSVSSQPYN  160



>ref|XP_008786366.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=277

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 142/259 (55%), Gaps = 17/259 (7%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L+ +P F  F+ YL +T+L  EIN R T+TVL VDN  M A+S   ++ +
Sbjct  19    SAVAFNITAILEPFPEFATFSNYLNQTKLVHEINHRQTITVLVVDNSRMSAISSLPEESL  78

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K VM VH++LDYYD++K   + +K+  LTTLFQ+TG+A+   GFLN T   G++V+ GSA
Sbjct  79    KHVMGVHVILDYYDIRKINNIPRKSFILTTLFQTTGIATNRMGFLNVTHKAGESVVFGSA  138

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAA-APS  469
             V+ AP  S LI  V    Y+IS+L IS  IIPPG++  AP  AP S       P+A  P 
Sbjct  139   VRGAPHTSTLIKKVVAMPYNISVLHISEPIIPPGIDG-APHIAPISSLPKETEPSAETPE  197

Query  468   PRKllspsnspsdspsdspsalspPGVSPSVPETDSPASGPNGEGDS---------SAAT  316
                  + S       + + +           PE D PAS    EG S         SA+T
Sbjct  198   VEDAPTESPEEDIVDAPANAPGESADTPADSPEADEPASD-ASEGPSISRKKVFHASAST  256

Query  315   TARE-----ACLGFVMAII  274
             + R      A LG VM I+
Sbjct  257   SLRSRLSIGAILGLVMWIV  275



>emb|CAN62804.1| hypothetical protein VITISV_011795 [Vitis vinifera]
Length=365

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L +Y +F+ FN YLT+T+LA +IN R ++T+LAVDNGG+  LSGK KDVIK V
Sbjct  25   AFNITQLLAQYSDFSTFNGYLTDTQLAADINKRQSITILAVDNGGLSPLSGKPKDVIKKV  84

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++H+VLDY+DV K   L   T  L TLFQ++G ++G+QGFLN T      V+ GSAV  
Sbjct  85   VSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSAVHG  144

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVE  538
               G+NL+ ++A + Y+IS+LQIS++IIP G++
Sbjct  145  TTLGANLVKSIASQPYNISVLQISTVIIPSGLD  177



>ref|XP_002271150.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=312

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L ++ +F+ FN YLT+T+LA +IN R ++T+LAVDNGG+  LSGK KDVIK V
Sbjct  25   AFNITQLLAQFSDFSTFNGYLTDTQLAADINKRQSITILAVDNGGLSPLSGKPKDVIKKV  84

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++H+VLDY+DV K   L   T  L TLFQ++G ++G+QGFLN T      V+ GSAV  
Sbjct  85   VSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSAVHG  144

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVE  538
               G+NL+ ++A + Y+IS+LQIS++IIP G++
Sbjct  145  TTLGANLVKSIASQPYNISVLQISTVIIPSGLD  177



>ref|XP_004136457.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 ref|XP_004162501.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 gb|KGN60156.1| hypothetical protein Csa_3G881690 [Cucumis sativus]
Length=280

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 113/165 (68%), Gaps = 2/165 (1%)
 Frame = -2

Query  1023  FSIMVWSCG-AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             F+ +++S   AFN+T +L ++P+F NFN  LT+T+LA +INSR T+T+LAVDNG +  +S
Sbjct  12    FNFLLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINSRKTITILAVDNGAISGIS  71

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkf-ttlekkttklttlFQSTGMASGEQGFLNATDTGG  670
             GK  DV+K +++VH++LDYYDV+K        TT LTTL+Q++G A+ EQGFL  T    
Sbjct  72    GKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGTATNEQGFLKVTLINE  131

Query  669   KTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES  535
               V   SAVK A   S L+ +V  + Y+I +LQI+S I  PG+++
Sbjct  132   GEVAFKSAVKGATADSKLVKSVVSQPYNIVVLQITSPIQVPGIDT  176



>ref|XP_006357108.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Solanum 
tuberosum]
Length=328

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 124/192 (65%), Gaps = 17/192 (9%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            +FN+T++L+ Y +++NFN YLT+T +A  INSR T+TVL V+N  +  L G S+DVI ++
Sbjct  22   SFNITSLLNHYSSYSNFNNYLTQTGVAAAINSRQTITVLVVENNNLSPLKGMSQDVIANI  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            M VH++LDYYDV K   L  KT K  TLFQ+TG A+ +QGFLN TD G  ++ +GSA K 
Sbjct  82   MRVHVLLDYYDVPKMQMLPNKTMKTPTLFQTTGYANNDQGFLNMTDLGTGSISLGSAAKG  141

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVES--------------IAPKAAP---PS  508
               GS L+ ++A + Y+ISILQIS++IIP G++S                  +AP   P+
Sbjct  142  ETLGSKLVKSIASQPYNISILQISNVIIPSGIDSSTQASPPPSSPHAPAPISSAPTYSPA  201

Query  507  HQQHGKSPAAAP  472
            +  HG S A AP
Sbjct  202  YSPHGSSAAPAP  213



>ref|XP_008799981.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L+ +P F  F+ YL++T+L  EIN R T+TVL VDN  M A+S   ++ +
Sbjct  20    SAMAFNITMILEPFPEFATFSNYLSQTKLVHEINHRQTITVLVVDNSRMSAISSLPEESL  79

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K VM VH++LDYYD+ K +++ +K   LTTLFQ+TG+A+   GFLN +   GK+V+ GSA
Sbjct  80    KHVMEVHVILDYYDITKISSIPRKNFLLTTLFQTTGIATSRIGFLNLSHKAGKSVVFGSA  139

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             V+ AP  S LI  +    Y+IS+LQIS  IIPPG+
Sbjct  140   VRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGI  174



>ref|XP_006382179.1| putative surface family protein [Populus trichocarpa]
 gb|ERP59976.1| putative surface family protein [Populus trichocarpa]
Length=302

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 131/214 (61%), Gaps = 25/214 (12%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
               F+A F  ++ +  AFN T +L +YP F NFN  L+++ LA E+NSR T+TVL +DNG 
Sbjct  8     LLFIA-FLCLISTSTAFNSTKILAQYPEFANFNDLLSQSGLAQEMNSRQTITVLVLDNGS  66

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +  LSG+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G+A   QGFLN +
Sbjct  67    IDGLSGRPLDIAKRILSAHVILDYYDQIKLSKLQKASTIVTTLYQASGVADNRQGFLNIS  126

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIA---------  529
              T  + +  GSA+K AP  ++L+ ++  + Y+IS+LQ+S  I  PG+E++A         
Sbjct  127   RT-AEGIKFGSAMKGAPLVASLVKSIYSQPYNISVLQVSEPIETPGIENMAPPPPPGTAA  185

Query  528   --------------PKAAPPSHQQHGKSPAAAPS  469
                           P AAPP+ +   KSPA +PS
Sbjct  186   VPKKAPAPAPSTKTPPAAPPTAKTPAKSPAKSPS  219



>ref|XP_009394682.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+TT+L K+P+F+ F+  LT T+LA +INSR T+TVLAV+NG + + SG+  DV+K +++
Sbjct  20   NITTILAKFPDFSTFSDLLTRTQLASDINSRKTITVLAVNNGAISSASGQPTDVLKKILS  79

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
            +H+VLDYYD  KF  L  ++  LTTLFQS+G+ASG  GFLN TD     V  GSAV  + 
Sbjct  80   LHVVLDYYDGDKFHKLRNRSAILTTLFQSSGVASGRSGFLNVTDMDNGQVSFGSAVPGSS  139

Query  630  QGSNLISAVAHEGYDisilqissliIPPGV-ESIAPKAAPPSHQQHGKSPAAAPS  469
              +N ++ +A + Y+IS+++ISS+I+PPG+ +  APKA+P        S +AAPS
Sbjct  140  LDANFVTVLATQPYNISVVEISSVIVPPGLSDGAAPKASP------ATSKSAAPS  188



>ref|XP_008466329.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=278

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  1023  FSIMVWSCG-AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             F+ +++S   AFN+T +L ++P+F NFN  LT+T+LA +IN+R T+T+LAVDNG +  +S
Sbjct  12    FNFLLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINNRKTITILAVDNGAISGIS  71

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkf-ttlekkttklttlFQSTGMASGEQGFLNATDTGG  670
             GK  DV+K +++VH++LDYYDV+K        TT LTTL+Q++G A+ +QGFL  T    
Sbjct  72    GKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGAATNQQGFLKVTLINE  131

Query  669   KTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES  535
               V   SAVK A   S L+ +VA + Y+IS+LQI+S I  PG+++
Sbjct  132   GEVAFESAVKGATADSKLVKSVASQPYNISVLQITSPIQVPGIDA  176



>gb|KFK38614.1| hypothetical protein AALP_AA3G137100 [Arabis alpina]
Length=256

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             +IFFF +SF  +  S  +FN+T +LD++ +F+ FN  LT+T+LA  INSR T+TVLAV N
Sbjct  9     LIFFFASSF--LYTSSNSFNITNILDQHHDFSTFNDLLTQTQLASAINSRQTITVLAVSN  66

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
             G + +LS K K ++K+++++HIVLDYYD KK   L KK+  LTTLFQS+G+A G+QGFLN
Sbjct  67    GALSSLSDKPKAMLKNILSLHIVLDYYDEKKLKNLNKKSVILTTLFQSSGLARGQQGFLN  126

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAV  604
             AT T    V  GSAV  +P  + L  +V
Sbjct  127   ATVTKDGDVSFGSAVPGSPLNAQLEESV  154



>ref|XP_004952427.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Setaria 
italica]
Length=295

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 119/198 (60%), Gaps = 7/198 (4%)
 Frame = -2

Query  1035  FLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMG  856
              L   + +     AFN+T +L ++P+F  FN  L++ +LA +IN R T+TVLAVDNG  G
Sbjct  10    LLLVLAGLTSPAAAFNITRLLGEFPDFTTFNNLLSQAKLADDINRRQTITVLAVDNGAAG  69

Query  855   ALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDT  676
              +S    DV + V+++H+VLDYYD  K   ++  TT LTT+FQS+G A+   GFLN T  
Sbjct  70    GISSLPSDVQRKVLSMHVVLDYYDTAKLGAIKNHTTLLTTMFQSSGQATDRMGFLNFTKR  129

Query  675   GGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ--  502
                T++ GSA   AP+ S ++ +VA   Y+IS+LQ+S+ I+PPGV   A   APP H+  
Sbjct  130   SDGTMVFGSAEPGAPKNSQMVKSVASRPYNISVLQVSAPIVPPGVGGSADAGAPPPHKAT  189

Query  501   -----QHGKSPAAAPSPR  463
                     K    APSP+
Sbjct  190   ALAPAPAAKGKKGAPSPK  207



>gb|KDP41920.1| hypothetical protein JCGZ_26938 [Jatropha curcas]
Length=228

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = -2

Query  978  MLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMAVHIV  799
            ML++Y ++  FN  L++TR+A  INSR T+TVLAVDNG +GAL+G S DV K ++ +H+V
Sbjct  1    MLNQYSDYGTFNDLLSKTRIAEAINSRRTITVLAVDNGNLGALTGYSTDVQKHILDLHVV  60

Query  798  LDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAPQGSN  619
            LDYYD  K   ++KK+  LTTL+QSTG A G+QGFLN T+ GG ++  GSAVK +   +N
Sbjct  61   LDYYDETKLKNIKKKSALLTTLYQSTGSARGQQGFLNVTNDGG-SIRFGSAVKGSGLNAN  119

Query  618  LISAVAHEGYDisilqissliIPPGVES--IAPKAAPPSHQQHGKSPAAAPSPR  463
            L+ +V  + Y+IS+LQ+S++IIP G+++    P A  PS  +  +  A  P+P 
Sbjct  120  LVGSVTSQPYNISVLQVSNIIIPQGLDTSNTPPPAKTPSPSEAPEPSAETPTPE  173



>gb|AFK47920.1| unknown [Medicago truncatula]
Length=287

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 122/212 (58%), Gaps = 20/212 (9%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET+L G+IN R T+TV A+DNG 
Sbjct  8     FLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDNGA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M ++S K  + I+++MA H++LDYYD  K      K   LTTL+QS+G+A  +QG+L   
Sbjct  68    MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMHKREPLTTLYQSSGIAVDQQGYLKVN  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI---------A  529
              T    + IGSAV  AP    L+  V  + Y+I+I+Q++  I+ PG+E+          A
Sbjct  128   RTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPIMFPGLETQTLGAPSNGSA  187

Query  528   PKA-----------APPSHQQHGKSPAAAPSP  466
             P A           APP+  ++  +P+AA  P
Sbjct  188   PAAETNVDVSSVFKAPPAKAKNASAPSAAEEP  219



>ref|XP_006371803.1| putative surface family protein [Populus trichocarpa]
 gb|ERP49600.1| putative surface family protein [Populus trichocarpa]
Length=271

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 139/237 (59%), Gaps = 30/237 (13%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
               F+A   ++  +  AFN+T +L +YP F +FN  LT++ LA E++SR T+TVLA+DN  
Sbjct  8     LLFIAILCLISSTSTAFNITKILAQYPEFVSFNDLLTQSGLAKEMSSRETITVLALDNSS  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G LSG+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G A   QGFLN +
Sbjct  68    IGGLSGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNIS  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  502
              T  + +  GSAVK AP  ++L+  V  + Y+IS+LQ+S  I  PG+E++AP   P +  
Sbjct  128   RT-AEGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIENMAPPPPPAAVP  186

Query  501   QH-----GKSPAAAPSPRKllspsnspsdspsdspsalspPGVSPSVPETDSPASGP  346
             +       KSP+ AP+P K                       V PS P T+SP  GP
Sbjct  187   KKAPAPTAKSPSKAPAPSK-----------------------VEPSTP-TESPTEGP  219



>ref|XP_010465042.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=254

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             + FFF+++F  +  S  +FN+T +L+++ +F+ FN+ LTET+LA  INSR T+TVL V N
Sbjct  7     LFFFFVSTF--LYTSSNSFNITNILNEHDDFSTFNKLLTETQLASTINSRQTITVLVVSN  64

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
             GG+ +LSG+  ++IK ++++HI+LDYYD KK   L KK+  LTTLFQS+G A G+QGFLN
Sbjct  65    GGLSSLSGQPINLIKKILSLHIILDYYDEKKLKNLNKKSVLLTTLFQSSGQARGQQGFLN  124

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVA  601
             AT T    V+ GSAV      + L+ +VA
Sbjct  125   ATVTKDGDVLFGSAVPGPDVNAELLDSVA  153



>ref|XP_009593249.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=272

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             I   L  F ++  S  AFN+T +L ++ +++ FN  L+++ LA EIN R T+T+LAV NG
Sbjct  5     IVALLCYFLLLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRATITILAVPNG  64

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              +G L+ KS DV+KSV++ ++VLDYYD+ K   L+ KT KLTT++Q +G A  +QGFLN 
Sbjct  65    AIGDLTSKSDDVLKSVLSTYVVLDYYDIPKLKNLKDKTAKLTTMYQQSGKAGYDQGFLNV  124

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  511
             T   G  V  GSAVK A + S L  +V ++ Y+ISIL IS  I+ PG++ ++AP +APP
Sbjct  125   TAKDGSFVF-GSAVKGAQRDSRLEKSVMNQPYNISILGISQPIVTPGLDGTLAPVSAPP  182



>gb|KEH39773.1| fasciclin domain protein [Medicago truncatula]
Length=287

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 107/169 (63%), Gaps = 0/169 (0%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET+L G+IN R T+TV A+DNG 
Sbjct  8     FLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDNGA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M ++S K  + I+++MA H++LDYYD  K     +K   L TL+QS+G+A  +QG+L   
Sbjct  68    MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMRKRELLITLYQSSGIAVDQQGYLKVN  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES  535
              T    + IGSAV  AP    L+  V  + Y+I+I+Q++  I+ PG+E+
Sbjct  128   RTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPILYPGLET  176



>ref|XP_004244694.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Solanum 
lycopersicum]
Length=251

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 121/189 (64%), Gaps = 18/189 (10%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F FL++      S  AFNVT +L +YP++ NFN  +++T LA EIN++ T+T+LA+ NG 
Sbjct  12    FLFLSA-----SSASAFNVTKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIPNGA  66

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G L+ K  DV+K ++  H+VLDYYD  K   L+ KT+KLTT+FQ +G AS +QGFLN T
Sbjct  67    IGDLTSKPNDVVKKILTTHVVLDYYDTMKLQKLKDKTSKLTTMFQESGKASNDQGFLNVT  126

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI----------  532
                  T + GSAVK+A + S L  +V ++ Y+ISIL IS  I+ PG++S           
Sbjct  127   -AKDNTFVFGSAVKDAQRDSRLEKSVMNQPYNISILGISQPIVTPGIDSPLSPSSAPSPK  185

Query  531   --APKAAPP  511
                PK++PP
Sbjct  186   ANTPKSSPP  194



>ref|XP_010324668.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Solanum 
lycopersicum]
Length=265

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -2

Query  1035  FLASFSIMVWSCG-AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
              L SF I+  S   AFN+T +L +Y +++ FN+ L+++ LA +INSRGT+T+LAV NG +
Sbjct  8     LLCSFLILFASSASAFNITKILGQYSDYSTFNELLSKSGLASDINSRGTITLLAVPNGAV  67

Query  858   GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             G L+ KS DV+K V+A H+VLDYYD  K   ++ KT K+TT+FQ +G A+ +QGFLN T 
Sbjct  68    GDLTSKSDDVLKRVLATHVVLDYYDPMKLQKMKDKTAKMTTMFQQSGKAAYDQGFLNVTA  127

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  511
               G  V  GSAV  A + S L  +V ++ Y+ISIL IS  I+ PG++ ++AP +APP
Sbjct  128   KDGSFVF-GSAVVGAQRDSKLEKSVMNQPYNISILGISQPIVTPGLDGTMAPISAPP  183



>gb|KEH39771.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=287

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 107/169 (63%), Gaps = 0/169 (0%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET+L G+IN R T+TV A+DNG 
Sbjct  8     FLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDNGA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M ++S K  + I+++MA H++LDYYD  K      K   LTTL+QS+G+A  +QG+L   
Sbjct  68    MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMHKREPLTTLYQSSGIAVDQQGYLKVN  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES  535
              T    + IGSAV  AP    L+  V  + Y+I+I+Q++  I+ PG+E+
Sbjct  128   RTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPILFPGLET  176



>ref|XP_007161299.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
 gb|ESW33293.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
Length=282

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 128/203 (63%), Gaps = 16/203 (8%)
 Frame = -2

Query  1035  FLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMG  856
             FL +FS  V+    F++T ML+K P  ++FN+Y+TE +LA +INSR T+TVLAV N  + 
Sbjct  13    FLLAFSSAVY---GFDITKMLEKEPELSSFNKYITEAKLADQINSRNTITVLAVGNDAIS  69

Query  855   ALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDT  676
             +++GKS ++IK++++ H++LDYYD KK    +  T +LTTLFQS+G A  EQGF+  +  
Sbjct  70    SIAGKSPELIKAIISTHVILDYYDEKKLVEAQASTPQLTTLFQSSGNAVKEQGFVKVSLI  129

Query  675   GGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIA------PKAAP  514
             G   +   S    +   S L+  +A E Y+ISILQ++  IIPPG++S         KA+P
Sbjct  130   GEGEIAFSSV--GSSDYSELVKPIASEPYNISILQVTKPIIPPGLDSQTAQSPQQAKASP  187

Query  513   PSHQQHGKSP-----AAAPSPRK  460
             P+  +  K+P     A APSP K
Sbjct  188   PTSSKTAKAPAPSKTAKAPSPAK  210



>gb|AFK40899.1| unknown [Lotus japonicus]
Length=285

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 112/177 (63%), Gaps = 3/177 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AF++T +L +YP F+ F++YLTET+L  +INSR T+TVLAVDN  + A+SGKS D IK+V
Sbjct  23   AFDITKILSQYPEFSTFSKYLTETKLTEQINSRNTITVLAVDNSAISAISGKSADAIKAV  82

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            ++ HIVLD++D KK         +LTTL+Q++G+A  +QGFL     G   V  GSAV  
Sbjct  83   VSTHIVLDFFDEKKLMEALGSKQQLTTLYQASGLAVNQQGFLKVALIGEGEVAFGSAVNG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVESIAPK---AAPPSHQQHGKSPAAA  475
            A   + L+  V  + Y+IS+LQ+S  I+ PG +  +P    A  P   Q  K+P  A
Sbjct  143  AATDAELVKTVTSQPYNISVLQVSKPIVFPGADKASPSQGAAKAPVPAQGAKAPVPA  199



>ref|XP_010499304.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=250

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             + FFF+++F  +  S  +FN+T +L+++ +F+ FN+ L+ET+LA  INSR T+TVL V N
Sbjct  7     LFFFFVSTF--LYTSSNSFNITNILNEHDDFSTFNKLLSETQLASTINSRQTITVLVVSN  64

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
             G + +LSG+  ++IK ++++HI+LDYYD KK   L KK+  LTTLFQS+G A G+QGFLN
Sbjct  65    GALSSLSGQPANLIKKILSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLN  124

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVA  601
             AT T    V+ GSAV      + L+ +VA
Sbjct  125   ATVTKDGNVLFGSAVPGPDLNAELLDSVA  153



>ref|XP_010914304.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=282

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A+NVT +L+ + +F  FN YLT T+LA EIN R T+TVL VDN  M ALS    + +K V
Sbjct  21   AYNVTQILEPFSDFATFNNYLTRTKLADEINRRQTITVLVVDNSKMSALSSLDVETLKHV  80

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            MAVH++LDYYD  K + +   +  LTTLFQ+TG+A    GFLN T    + ++ GSA + 
Sbjct  81   MAVHVILDYYDENKLSHISNNSALLTTLFQTTGIAKNNLGFLNVTRKPNEAMLFGSAFQK  140

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV-------ESIAPKAAPPSH--QQHGKSP  484
            AP  S     +    Y+ISILQIS  I+PPG+        S+APK AP      +  KS 
Sbjct  141  APLSSTFSKVIITMPYNISILQISDPIVPPGIGGAKKTSSSMAPKNAPALAPVAKPAKST  200

Query  483  AAAPSP  466
            A AP+P
Sbjct  201  ANAPAP  206



>ref|XP_011015272.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Populus 
euphratica]
Length=271

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 138/237 (58%), Gaps = 30/237 (13%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
               F+A   ++  +  AFN+T +L +YP F  FN  LT++ LA E++SR T+TVLA+DN  
Sbjct  8     LLFIAILCLISSTSTAFNITKILGQYPEFVGFNDLLTQSGLAKEMSSRETITVLALDNSS  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G L+G+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G A   QGFLN +
Sbjct  68    IGGLNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNIS  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  502
              T  + +  GSAVK AP  ++L+  V  + Y+IS+LQ+S  I  PG+E++AP   P +  
Sbjct  128   RT-AEGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIENMAPPPPPAAVP  186

Query  501   QH-----GKSPAAAPSPRKllspsnspsdspsdspsalspPGVSPSVPETDSPASGP  346
             +       KSP+ AP+P K                       V PS P T+SP  GP
Sbjct  187   KKAPAPTAKSPSKAPAPSK-----------------------VEPSTP-TESPTEGP  219



>ref|XP_011045030.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X1 
[Populus euphratica]
 ref|XP_011045031.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X2 
[Populus euphratica]
Length=271

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 138/237 (58%), Gaps = 30/237 (13%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
               F+A   ++  +  AFN+T +L +YP F  FN  LT++ LA E++SR T+TVLA+DN  
Sbjct  8     LLFIAILCLISSTSTAFNITKILAQYPEFVGFNDLLTQSGLAKEMSSRETITVLALDNSS  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G L+G+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G A   QGFLN +
Sbjct  68    IGGLNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNIS  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  502
              T  + +  GSAVK AP  ++L+  V  + Y+IS+LQ+S  I  PG+E++AP   P +  
Sbjct  128   RT-AEGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIENMAPPPPPAAVP  186

Query  501   QH-----GKSPAAAPSPRKllspsnspsdspsdspsalspPGVSPSVPETDSPASGP  346
             +       KSP+ AP+P K                       V PS P T+SP  GP
Sbjct  187   KKAPAPTAKSPSKAPAPSK-----------------------VEPSTP-TESPTEGP  219



>ref|XP_002882785.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59044.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             IFFF AS + +  S  +FN+T +L+++ +F+ FNQ L+ET+LA  IN R T+TVL V NG
Sbjct  7     IFFFFAS-TFLYSSSNSFNITNILNEHDDFSTFNQLLSETQLASTINKRQTITVLVVSNG  65

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              + ++SG+   VIK ++++HIVLDYYD KK   L KK+  LTTLFQS+G+A G+QGFLNA
Sbjct  66    ALSSISGQPTAVIKKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGLARGQQGFLNA  125

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVA  601
             T T    V  GSAV  +   + L   VA
Sbjct  126   TVTKDGDVAFGSAVPGSSLDAQLQDTVA  153



>gb|KEH39774.1| fasciclin domain protein [Medicago truncatula]
Length=268

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 118/189 (62%), Gaps = 1/189 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
                LA F  +  S  A ++T +L + P+F  FN+ LTET+L  +INSR T+TVLAV +G 
Sbjct  8     LLCLALFLAVSSSIHALDITKLLGQNPDFAAFNKQLTETKLVDQINSRNTITVLAVSDGA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M A+SGKS   IK++M+ H+VLDY+D KK +        LTTLFQ++G A  +QGFL   
Sbjct  68    MSAISGKSPQAIKAIMSTHVVLDYFDEKKLSEAVGSGILLTTLFQASGQAKNQQGFLKVK  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  502
               G   +  GSAV  AP    L+  V  + Y+ISILQ++  II PGV+S++  A+ P+  
Sbjct  128   LIGEGEMDFGSAVSGAPIDVALVKTVVKQPYNISILQVAKPIIFPGVDSVS-TASAPTAA  186

Query  501   QHGKSPAAA  475
             ++  SP+AA
Sbjct  187   KNASSPSAA  195



>ref|XP_009781936.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=273

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 120/179 (67%), Gaps = 2/179 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             I   L  F ++  S  AFN+T +L ++ +++ FN  L+++ LA EIN R T+T+LAV NG
Sbjct  5     IVTLLCYFLLLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRTTITILAVPNG  64

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              +G L+ KS DV+ SV++ ++VLDYYD+ K  +L+ KT K+TT++Q +G A  +QGFLN 
Sbjct  65    AIGDLTSKSDDVLNSVLSTYVVLDYYDIPKLKSLKDKTAKMTTMYQQSGKARFDQGFLNM  124

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  511
             T   G  V  GSAVK+A + S L  +V ++ Y+IS+L IS   + PG++ ++AP + PP
Sbjct  125   TAKDGSFVF-GSAVKDAQRDSRLEKSVMNQPYNISVLGISQPFVTPGLDGTLAPVSTPP  182



>ref|XP_009787705.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=267

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -2

Query  1035  FLASFSIMV-WSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
              L +F ++   S  AFN+T +L +Y +++ FN+ L+++ LA EIN R T+T+LAV NG +
Sbjct  8     ILCTFLLLAATSASAFNITKILSQYSDYSTFNELLSKSGLAAEINKRATITILAVPNGAI  67

Query  858   GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             G L+ KS DV+K  ++ +++LDYYD+ K  ++++KT K+T ++Q +G A+ +QGFLN T 
Sbjct  68    GDLTSKSDDVLKRELSTYVILDYYDIPKLRSMKEKTAKMTNMYQQSGKAAYDQGFLNVTA  127

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  511
               G  V  GSAVK A + S L  +V ++ Y+ISIL IS  ++ PG++ ++AP +APP
Sbjct  128   KDGSFVF-GSAVKGAQRDSRLEKSVMNQPYNISILGISQPMVTPGLDGTLAPVSAPP  183



>ref|XP_010938482.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=257

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 110/173 (64%), Gaps = 1/173 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AF +T +L  +  F  F+ YL +T+L  EIN R T+T+L VDN  M A+S   ++ +K V
Sbjct  2    AFKITAILKPFSEFATFSNYLNQTKLVHEINHRQTITILVVDNSKMSAISSLPEESLKHV  61

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            M VH++LDYYD++K + +  K+  LTTLFQ+TG+A+   GFLN T    ++V+ GSAV  
Sbjct  62   MEVHVILDYYDIRKISHIPSKSFLLTTLFQTTGVATKRMGFLNVTRKADESVVFGSAVLG  121

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAA  478
            AP  S LI  V    Y+IS+LQ+S  IIPPG++  AP  AP S+      P+A
Sbjct  122  APHTSTLIKNVMTMPYNISVLQVSEPIIPPGIDG-APPMAPISNPSEMIDPSA  173



>ref|XP_009612463.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=276

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -2

Query  1035  FLASFSIMV-WSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
              L +F ++   S  AFN+T +L +Y +++ FN+ L+++ LA EIN R T+TVLAV NG +
Sbjct  8     LLCTFLLLAATSASAFNITKILSQYSDYSTFNELLSKSGLATEINKRATITVLAVPNGAI  67

Query  858   GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             G L+ KS DV+K  ++ H+VLDYYD  K   +++KT KLT ++Q +G A+ +QGFLN T 
Sbjct  68    GDLTSKSDDVLKRDLSTHVVLDYYDPMKLRNMKEKTAKLTNMYQQSGKAAYDQGFLNVTA  127

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  511
               G  V  GSAVK A + S L  +V ++ Y+ISIL IS  I  PG++ ++AP +APP
Sbjct  128   KDGSFV-FGSAVKGAQRDSRLEKSVMNQPYNISILGISQPIFTPGLDGTLAPVSAPP  183



>ref|XP_003545530.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Glycine 
max]
Length=306

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AF++T +L +YP F+ FN+YLTET+LA EINSR T+TVLAV++  M +++ KS + IK++
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNTITVLAVEDSAMNSIAAKSPEAIKAI  82

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            ++ H++LD++D KK    +  + +LTTLFQ++G+A  +QGFL     G   +  GSAV  
Sbjct  83   ISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFGSAVSG  142

Query  636  AP-QGSNLISAVAHEGYDisilqissliIPPGVESIAP  526
            AP   + L+  V  E Y+ISILQ++  I+ PGV+S  P
Sbjct  143  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQTP  180



>ref|XP_002512774.1| Glycoprotein X precursor, putative [Ricinus communis]
 gb|EEF49277.1| Glycoprotein X precursor, putative [Ricinus communis]
Length=339

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             SF I+  +  AFN+T +L  + +F+NFN  LT+T+LA  INSR T+T+LAVDNG +  +S
Sbjct  17    SFFILFSTVSAFNITKILSDHSDFSNFNDLLTKTQLAATINSRQTITILAVDNGNISPIS  76

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGK  667
             G+S D+ K ++++H++LDYYD  K   L  KT  LTTL+QS+G A G++GFLNAT    +
Sbjct  77    GQSVDMQKKILSMHVILDYYDDAKLQKLPNKTELLTTLYQSSGQAKGQEGFLNATLVNNQ  136

Query  666   TVMIGSAVKNAPQGSNLISAVAHEGYD  586
              V +GSAV  +   + L+ AV  + Y+
Sbjct  137   -VTLGSAVPGSGLNAKLVKAVVTQPYN  162



>ref|XP_002282846.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=305

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L ++P+F+ FN YL++T ++  IN R T+TVLAV+NG +  ++GKS D IK++
Sbjct  27   AFNITRLLGQFPDFSTFNSYLSQTNISIGINRRQTITVLAVENGAIAPITGKSMDDIKNI  86

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            + +H++LDYYDV K   L  KT  LTTLFQ+TG A+G+QGFLN T+     V+ GSAV  
Sbjct  87   LRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGSAVAG  146

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            +   + L+  VA + ++IS+LQIS+ I+ PG+
Sbjct  147  SGLQAKLVKTVASQPFNISVLQISTPILAPGI  178



>ref|XP_006357096.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Solanum 
tuberosum]
Length=262

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 114/172 (66%), Gaps = 13/172 (8%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T +L +YP++ NFN  +++T LA EIN++ T+T+LA+ NG +G L+ KS DV+K ++ 
Sbjct  24   NITKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIPNGAIGDLTSKSNDVVKKILT  83

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
             H+VLDYYD  K   L+ KTTKLTT+FQ +G AS +QGFLN T     T + GSAVK+A 
Sbjct  84   THVVLDYYDTMKLQKLKDKTTKLTTMFQESGKASNDQGFLNVT-AKDNTFVFGSAVKDAQ  142

Query  630  QGSNLISAVAHEGYDisilqissliIPPGVESI------------APKAAPP  511
            + S L  +V ++ Y+ISIL IS  I+ PG++S              PK++PP
Sbjct  143  RDSRLEKSVMNQPYNISILGISQPIVTPGIDSPLAPSSAPPPKANTPKSSPP  194



>ref|XP_010938483.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=277

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 103/160 (64%), Gaps = 0/160 (0%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L+ +  F  F+ YL +T+L  EIN R T+T+L +DN  M A+S   ++ +
Sbjct  19    SAMAFNITAILEPFSKFTTFSNYLNQTKLVHEINHRRTITILVIDNSRMSAISSLPEESL  78

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K VM VH++LDYYD++K + + +K+  LT LFQ+T +A+   GFLN T    ++ + GSA
Sbjct  79    KHVMEVHVILDYYDIRKISHIPRKSFLLTILFQTTDVATKRMGFLNVTRMADESEVFGSA  138

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAP  526
             +  AP  S LI  V    Y+IS+LQ+S  IIPPG++   P
Sbjct  139   ILRAPHTSTLIKKVMTMPYNISVLQVSEPIIPPGIDGALP  178



>ref|XP_007011569.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
 gb|EOY29188.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
Length=277

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 113/167 (68%), Gaps = 3/167 (2%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F FL + S    +  AFNVT +L +YP++ +FN  L++T+LA EI+ R T+T+LA+DN 
Sbjct  10    VFAFLLALS---TTSTAFNVTKVLGQYPDYGSFNDLLSQTKLAEEISHRQTITILALDNA  66

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              + +++ +  D +K ++  H+VLDY+D  K   L KK+  LTTL+Q+TG+A G+QGFLN 
Sbjct  67    SISSIASRPSDEVKKILMNHVVLDYFDTFKIQKLGKKSVILTTLYQTTGLAQGQQGFLNI  126

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPG  544
             T  G   V+ GSAVK AP  S L+ +V  + +++S+L +S+ I+ PG
Sbjct  127   TKLGPGEVVFGSAVKGAPLVSKLLGSVVSQPFNLSVLHVSTPIVAPG  173



>ref|XP_004498590.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cicer 
arietinum]
Length=316

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 118/182 (65%), Gaps = 5/182 (3%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AF++T +L + P+F  FN+YLTET+LA  INSR T+T+LAV + G+ +LSGKS+  I
Sbjct  20    SIHAFDITKLLGQNPDFATFNKYLTETKLAEPINSRNTITILAVSDAGLSSLSGKSQQFI  79

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K+ ++ H++LD++D KK    +     LTTL+QS+G+A  +QGF+     G   +  GSA
Sbjct  80    KASLSTHVILDFFDEKKLMEAQGSGQLLTTLYQSSGLAMNQQGFIKVALIGEGEIAFGSA  139

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAPSP  466
             V  AP   +L+  V  + Y+ISILQ++ LI+ PG++     A  P+   + ++PAAA +P
Sbjct  140   VNGAPLDVSLVKTVVSQPYNISILQVTKLIVVPGLD-----AQTPASSGNAQAPAAAKTP  194

Query  465   RK  460
              +
Sbjct  195   AE  196



>ref|XP_004305606.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=282

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 144/275 (52%), Gaps = 12/275 (4%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +FF L S  + + SC AFN+T +L+K  +F+ FN+YL+ T+LA EIN + T+TVLA++N 
Sbjct  10    MFFVLLSM-LSIRSCSAFNITKLLNKESDFSTFNKYLSATKLADEINKQSTITVLALNND  68

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlF--QSTGMASGEQGFL  691
              MG +S  +   +KSVM+VHI+LDY+D +K   L K  +        QS+G A  +QGF+
Sbjct  69    AMGGISSDNSFPLKSVMSVHIILDYFDKEKLAKLAKNNSSTKLTTLFQSSGEAKDQQGFV  128

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAP  514
                   G+ +  GSA K A   S L+ +V  + Y+IS+L++SS+I  P +  S AP+ AP
Sbjct  129   RVEVVDGE-IFFGSASKGAQMNSKLVRSVTAQPYNISVLEVSSIIRVPNINASPAPEKAP  187

Query  513   -------PSHQQHGKSPAAAPSPRKllspsnspsdspsdspsalspPGVSPSVPETDSPA  355
                    PS +   +SP+   +        +        + S    PG    V   DSP+
Sbjct  188   APKKGKSPSLKDEAESPSEDTAESPAGDEKDEAPSPSKATDSTPPKPGYEDDVITADSPS  247

Query  354   SGPNGEGDSSAATTAREACLGFVMAIISANLFFFF  250
             S P     S A  T  E     V   +++ L  FF
Sbjct  248   STPTAWDYSDARATDAEMGFRVVTMGLASVLVAFF  282



>ref|XP_009363599.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=262

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 6/151 (4%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             +F ++  S  AF++  +L+K  +F++F  YL ET+L  EIN R T+TVLAVDNGG+ ++S
Sbjct  13    AFFLVFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKRSTITVLAVDNGGISSIS  72

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkft--tlekkttklttlFQSTGMASGEQGFLN--ATD  679
             GKS+DVIK +++ H+VLDYYD KK T      K + LTT+ QSTG A  +QGF+N    D
Sbjct  73    GKSQDVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFINLGKID  132

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
              GG  +  GSAVK +   + L+ +V  + ++
Sbjct  133   EGG--LAFGSAVKGSKLNAKLVKSVVSQPFN  161



>ref|XP_006298989.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
 gb|EOA31887.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
Length=252

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  +FN+T +L+++ +F+ FN  L+ET+LA  IN R T+TVL V NG + +LSG+  DVI
Sbjct  21    SSNSFNITNILNEHDDFSTFNNLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTDVI  80

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K ++++HIVLDYYD KK   L KK+  LTTLFQS+G A G+QGFLNAT      V  GSA
Sbjct  81    KKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGQAKGQQGFLNATVMTNGDVAFGSA  140

Query  645   VKNAPQGSNLISAVA  601
             V  + + S L+ +VA
Sbjct  141   VPGSDRNSQLLDSVA  155



>ref|XP_008445580.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=296

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 113/195 (58%), Gaps = 20/195 (10%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T +L+++P F  FN  LT+TRL  +IN+R T+TVLA++N  +GA+SG S DVIK +++
Sbjct  34   NITRLLNRFPEFGAFNDLLTKTRLFEQINTRQTITVLALNNATVGAISGNSLDVIKQILS  93

Query  810  VHIVLDYYDVkkfttlekkttklttlF-QSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
             H++LDYYDV K   L      + T   QSTG A  +QGFL         V  GSA K A
Sbjct  94   AHVILDYYDVAKMRKLSADKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSASKKA  153

Query  633  PQGSNLISAVAHEGYDisilqissliIPPG------------------VESIAPKA-APP  511
            P  + L+  VA + Y+IS+LQIS+ I+ PG                  VE+ AP+A AP 
Sbjct  154  PLSAKLVKPVASQPYNISVLQISAPIVIPGIGVYNLPPPAPEAPLVAPVEAPAPEADAPG  213

Query  510  SHQQHGKSPAAAPSP  466
              +    SP+ APSP
Sbjct  214  PAEDEADSPSDAPSP  228



>ref|NP_187872.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
 sp|Q9LTW9.1|FLA14_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51033.1|AC069474_32 hypothetical protein; 8734-7967 [Arabidopsis thaliana]
 dbj|BAB02409.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65936.1| fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
 gb|AEE75229.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
Length=255

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  +FN+T +L+++ +F+NFNQ L+ET+LA  IN R T+TVL V NG + +LSG+   VI
Sbjct  20    SSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTSVI  79

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K ++++HIVLDYYD KK   L KKT  LTTLFQS+G+A G+QGFLNAT      V  GSA
Sbjct  80    KKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSA  139

Query  645   VKNAPQGSNLISAVA  601
             V  +   + L   VA
Sbjct  140   VPGSSLDAQLQDTVA  154



>gb|ABK28554.1| unknown [Arabidopsis thaliana]
Length=256

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  +FN+T +L+++ +F+NFNQ L+ET+LA  IN R T+TVL V NG + +LSG+   VI
Sbjct  20    SSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTSVI  79

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K ++++HIVLDYYD KK   L KKT  LTTLFQS+G+A G+QGFLNAT      V  GSA
Sbjct  80    KKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSA  139

Query  645   VKNAPQGSNLISAVA  601
             V  +   + L   VA
Sbjct  140   VPGSSLDAQLQDTVA  154



>ref|XP_004486594.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cicer 
arietinum]
Length=344

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 112/169 (66%), Gaps = 4/169 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++  F+    ++  S   F+VT ML +YP ++ ++ YLT+T+LA EIN++ T+TVL VDN
Sbjct  10    MVLIFVVVVMLLPISITCFDVTKMLSQYPAYSTYSNYLTQTQLATEINAKPTITVLVVDN  69

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              GM  +SGK  DVIK V++VH++LDY+DV+KF  L  KT  ++T+F+S GM    + F+ 
Sbjct  70    SGMAPISGKPMDVIKKVLSVHVILDYFDVQKFQHLGNKTITVSTMFESKGM----ERFIK  125

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD     V   SA    P G+NLI A+  + Y+IS++QIS++IIPP +
Sbjct  126   ITDLNTGAVTFTSAADPNPTGANLIKAIVAQPYNISLVQISTVIIPPSL  174



>emb|CAN66163.1| hypothetical protein VITISV_008126 [Vitis vinifera]
Length=305

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L ++P+F+ FN YL++T ++  IN R T+TVLAV+NG +  ++ KS D IK++
Sbjct  27   AFNITRLLGQFPDFSTFNSYLSQTNISIGINKRQTITVLAVENGAIAPITXKSLDDIKNI  86

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            + +H++LDYYDV K   L  KT  LTTLFQ+TG A+G+QGFLN T+     V+ GSAV  
Sbjct  87   LRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGSAVAG  146

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            +   + L+  VA + ++IS+LQIS+ I+ PG+
Sbjct  147  SGLQAKLVKTVASQPFNISVLQISTPILAPGI  178



>ref|XP_008361057.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=262

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             +F ++  S  AF++  +L+K  +F++F  YL ET+L  EIN R T+TVLAVDNGG+ ++S
Sbjct  13    AFFLVFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKRSTITVLAVDNGGISSIS  72

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkft--tlekkttklttlFQSTGMASGEQGFLN--ATD  679
             GKS+DVIK +++ H+VLDYYD KK T      K + LTT+ QSTG A  +QGF+N    D
Sbjct  73    GKSQDVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFINLGKID  132

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
              GG  +  GSAVK +   +  + +V  + ++
Sbjct  133   EGG--LAFGSAVKGSKLNAKFVKSVVSQPFN  161



>ref|XP_011082038.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Sesamum 
indicum]
Length=255

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 130/242 (54%), Gaps = 32/242 (13%)
 Frame = -2

Query  1038  FFLASFSIMVWSC--GAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
               L S  +++ S    AFNVT +L+KYP++  FN  L++T +A EIN R T+T+LA+ NG
Sbjct  8     LILVSAVLLLSSATTSAFNVTLILEKYPDYTEFNNLLSKTGVADEINRRNTITILALSNG  67

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
               G +S K +DV K +++ H+VLDYYDV K          LTTL Q+ G A  +QGFLN 
Sbjct  68    RFGDISSKKEDVQKRIISTHVVLDYYDVAKLKQYNTSKGPLTTLCQTYGQAKQQQGFLNV  127

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPPS  508
                    V + SAVK A   S + S+VA + Y+ISIL ISS II PG++ +++P +A   
Sbjct  128   V-VKDSEVFLSSAVKGASMDSKVESSVASQPYNISILSISSPIIAPGIDGALSPASA---  183

Query  507   HQQHGKSPAAAPSPRKllspsnspsdspsdspsalspPGVSPSVPETDSPASGPNGEGDS  328
              Q +  +PA +  P                              P+ +  A+GP GEG S
Sbjct  184   KQPNAAAPAGSEGPAVAEG-------------------------PKQEEAAAGPEGEGTS  218

Query  327   SA  322
             +A
Sbjct  219   AA  220



>ref|XP_009377364.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Pyrus x 
bretschneideri]
Length=283

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 100/154 (65%), Gaps = 4/154 (3%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
                LA F ++  S  AF++  +L+K    ++F  YL ET+L  EIN R T+TVLAVDNGG
Sbjct  9     ILCLALF-LVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRSTITVLAVDNGG  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttl--ekkttklttlFQSTGMASGEQGFLN  688
             M ++SGKS+DVIK +++ H+VLDY+D KK T+L    K + LTT+ QS+G A  +QGF+ 
Sbjct  68    MSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGFII  127

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
                + G+ +  GSAVK A   + L+ AV  + Y+
Sbjct  128   VGKSDGE-IAFGSAVKGAKLNAKLVKAVVSQPYN  160



>gb|KEH39772.1| fasciclin domain protein [Medicago truncatula]
Length=227

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 107/192 (56%), Gaps = 8/192 (4%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET+L G+IN R T+TV  +DNG 
Sbjct  8     FLCLALFLTVSTSIQAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTLTVFTLDNGA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M ++S K  + I+++MA H++LDYYD  K     +K   L TL+QS+G+A  +QG+L   
Sbjct  68    MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMRKRELLITLYQSSGIAVDQQGYLKVN  127

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  502
              T    + IGSAV   P  +   +A A    +  I ++S    P    S +P  AP    
Sbjct  128   RTSDGDLAIGSAVSAPPAKAK--NASAPSAAEEPITEVSDSPSPSDEPSESPVEAP----  181

Query  501   QHGKSPAAAPSP  466
                KSP+ AP P
Sbjct  182   --AKSPSLAPGP  191



>gb|EYU22059.1| hypothetical protein MIMGU_mgv1a011491mg [Erythranthe guttata]
Length=280

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 110/178 (62%), Gaps = 1/178 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
              F +++  ++  +  A N+T +LD+YP F  +N  LT T LA +IN R T+T+LA+ N  
Sbjct  9     LFVISAVLLLSATTSAHNITLILDQYPEFTTYNSLLTATDLATKINRRKTLTILALTNDR  68

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G L+GKS DV   +++ HIVLDY+D+ K    +   + +TTL+QSTG A   QGFLN  
Sbjct  69    IGDLAGKSVDVQTRILSTHIVLDYFDMLKLYKFKNTKSVVTTLYQSTGTADDMQGFLNVI  128

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  511
              +    +  GSA+  AP  + +  +VA + Y+IS+L IS +I+ PG++ S  P  APP
Sbjct  129   HSTDGNIYFGSAMNGAPLDAKVEGSVAKQPYNISVLSISHVIVAPGIDGSFKPVTAPP  186



>ref|NP_001130104.1| hypothetical protein precursor [Zea mays]
 gb|ACF78231.1| unknown [Zea mays]
 gb|AFW70826.1| hypothetical protein ZEAMMB73_792931 [Zea mays]
Length=296

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 116/198 (59%), Gaps = 6/198 (3%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +   LA FS       AFN+T +L ++ +F  FN  L++T+LA +IN R T+TVLAVDNG
Sbjct  10    LVLILACFS---SPAAAFNITRLLGQFSDFTTFNNLLSQTKLAEDINRRQTITVLAVDNG  66

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
               G +S    DV + V+++H+VLDYYD  K   ++  +  LTT+FQS+G A+   GFLN 
Sbjct  67    AAGGISSLPSDVQRKVLSMHVVLDYYDTAKLEAIKNHSALLTTMFQSSGQATDRMGFLNF  126

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPK---AAP  514
             T      ++ GSA   A   S+++ +V    Y+IS+LQ+S+ I+PPGV   A      AP
Sbjct  127   TKRSDGVMVFGSAQPGAQMTSHMVKSVTSRPYNISVLQVSAPIVPPGVGGSADSGKGGAP  186

Query  513   PSHQQHGKSPAAAPSPRK  460
             P H+    +P  A   +K
Sbjct  187   PPHKATAPAPGPATKGKK  204



>ref|XP_004305605.1| PREDICTED: uncharacterized protein LOC101308896 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   120 bits (300),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 119/189 (63%), Gaps = 8/189 (4%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             + FFL    + + SC AFN+T +L+K  +F+ FNQ+L++T+LA +IN R T+TVLAVDN 
Sbjct  10    VSFFLVMMLLSISSCSAFNITKLLEKEDDFSTFNQHLSDTKLADQINKRSTITVLAVDNS  69

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlF--QSTGMASGEQGFL  691
              +G L   S  V+K++M+VH++LDYYD +K T L K     T     Q++G+A  EQGF+
Sbjct  70    AIGGLGDDS--VVKAIMSVHVILDYYDKEKLTKLAKNNKSATLTTLYQTSGLAKNEQGFV  127

Query  690   N-ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
               ATD  G  +  GSA K +   S L+ +V  + Y+IS+LQ+SS+I  P + +  +P+ A
Sbjct  128   RIATDDDG--ITFGSASKGSQMNSKLVKSVTSQPYNISVLQVSSIIEVPNINADPSPEKA  185

Query  516   PPSHQQHGK  490
             P    +  K
Sbjct  186   PAPKSRKAK  194



>ref|XP_008378295.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Malus domestica]
Length=283

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +   LA F ++  S  AF++  +L+K    ++F  YL ET+L  EIN R T+TVLAVDNG
Sbjct  8     VILCLALF-LVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRSTITVLAVDNG  66

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttl--ekkttklttlFQSTGMASGEQGFL  691
             GM ++SGKS+DVIK +++ H+VLDY+D KK T+L    K + LTT+ QS+G A  +QGF+
Sbjct  67    GMSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGFI  126

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
                 + G+ +  GSAVK     + L+ AV  + Y+
Sbjct  127   IVGKSDGE-IAFGSAVKGGKLNAKLVKAVVSQPYN  160



>ref|XP_002452018.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
 gb|EES04994.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
Length=296

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 118/193 (61%), Gaps = 18/193 (9%)
 Frame = -2

Query  1002  CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  823
               AFN+T +L ++ +F  FN  L++T+LA +IN R T+TVLAVDNG  G +S    DV +
Sbjct  21    AAAFNITRLLGEFSDFTTFNNLLSQTKLAEDINRRQTITVLAVDNGAAGGISSLPSDVQR  80

Query  822   SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
              V+++H+VLDYYD  K   ++  +  LTT+FQS+G A+   GFLN T      ++ GSA 
Sbjct  81    KVLSMHVVLDYYDTAKLGAIKNHSALLTTMFQSSGKATDRMGFLNFTKRSDGVMLFGSAQ  140

Query  642   KNAPQGSNLISAVAHEGYDisilqissliIPPGV-------ESIAP--------KAAPPS  508
               A   S+++ +VA   Y+IS+LQ+S  I+PPGV       E+ AP        +AAPP+
Sbjct  141   PGAQMTSHMVKSVASRPYNISVLQVSDPIVPPGVGGSADSGEATAPAPATKGKKEAAPPN  200

Query  507   HQQHGKSPAAAPS  469
              ++   +PA APS
Sbjct  201   DKE---APAPAPS  210



>ref|XP_008781934.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=308

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 103/152 (68%), Gaps = 0/152 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L ++ +F+N N  LT T+LA EINSR TVTVLAV+N  + ++S    DV+K V
Sbjct  22   AFNITQILGQFSDFSNLNNLLTRTQLASEINSRQTVTVLAVNNAALSSVSNLPTDVLKKV  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +A+H+VLDY+D  K T L  ++  L TLFQ++G+A+G+ GFLN TD G   + +GSA   
Sbjct  82   LALHVVLDYFDRDKITRLSNRSAILATLFQASGLATGQNGFLNVTDMGNGQIALGSAAPG  141

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            +   +  +  +    Y+IS+L+IS +I PPG+
Sbjct  142  SNLDARFVGVLVTHPYNISVLKISGVITPPGL  173



>ref|XP_008219800.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=285

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 4/159 (3%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L+K  +F+NFN  L++T+LA EIN R T+T+LAVDNGG G LSG+S D+ 
Sbjct  26    SVSAFNITKILEKQSDFSNFNNLLSQTKLADEINRRSTITILAVDNGGAGGLSGQSSDMA  85

Query  825   KSVMAVHIVLDYYDVkkftt--lekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
             K +++VH+VLDYYD  K        K+  LTTLFQSTG A  EQGF+  +   G+ +  G
Sbjct  86    KKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQ-ISFG  144

Query  651   SAVKNAPQGS-NLISAVAHEGYDisilqissliIPPGVE  538
             SA K     S N + +V  + Y+IS+LQ+ S+I  P +E
Sbjct  145   SAAKGGNGNSVNFVKSVVSQPYNISVLQVGSIINVPDIE  183



>gb|KHN10392.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=305

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AF++T +L +YP F+ FN+YLTET+LA EINSR T+TVLAV++  M +++ KS + IK++
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNTITVLAVEDSAMNSIAAKSPEAIKAI  82

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            ++ H++LD++D KK    +  + +LTTLFQ++G+A  +QGFL     G   +  G AV  
Sbjct  83   ISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFG-AVSG  141

Query  636  AP-QGSNLISAVAHEGYDisilqissliIPPGVESIAP  526
            AP   + L+  V  E Y+ISILQ++  I+ PGV+S  P
Sbjct  142  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQTP  179



>ref|XP_007224727.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
 gb|EMJ25926.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
Length=268

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = -2

Query  1023  FSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG  844
             F +   S  AF++T +L+K   F+NFN YL ET+L  +INSR T+TVLAV NG + +L+G
Sbjct  15    FIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSRSTITVLAVGNGAISSLAG  74

Query  843   KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlF--QSTGMASGEQGFLNATDTGG  670
             KS+DV+K +++ H++LDYYD +K T L K +   T     QS+G A  +QGF+NA     
Sbjct  75    KSQDVVKKILSAHVILDYYDEQKLTKLAKSSKATTLTTMFQSSGQAQNQQGFINAGIVNE  134

Query  669   KTVMIGSAVKNAPQGSNLISAVAHEGYD  586
               +  GSA K +   + L+ +V  + ++
Sbjct  135   GELAFGSAAKGSKLNAKLVKSVVSQPFN  162



>ref|XP_010486992.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=255

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            +FN+T +L+++ +F+ FN+ L+ET+LA  INSR T+TVL V NG + +LSG+  ++IK +
Sbjct  23   SFNITNILNEHDDFSTFNKLLSETQLASTINSRQTITVLVVSNGAISSLSGQPTNLIKKI  82

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++HI+LDYYD KK   L KK+  LTTLFQS+G A G+QGFLNAT T    V+ GSAV  
Sbjct  83   LSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLNATVTKDGNVLFGSAVPG  142

Query  636  APQGSNLISAVA  601
                + L+ +VA
Sbjct  143  PDLNAELLDSVA  154



>ref|XP_009418876.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 103/155 (66%), Gaps = 0/155 (0%)
 Frame = -2

Query  1002  CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  823
               + N+T +L ++ +F+ FN  LT+T+L  +INSR T+TVLAVDNG   ++S +  D +K
Sbjct  19    AASHNITRILAQFDDFSTFNSLLTQTQLVSDINSRRTITVLAVDNGAASSVSSRPTDELK  78

Query  822   SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
              +++VH+VLDYYD  K   L   T  LTTLFQ+TG+ASG  GFLN T+ G   +  GSAV
Sbjct  79    KILSVHVVLDYYDDAKLHKLPNHTAILTTLFQATGLASGRNGFLNVTNMGNGQIAFGSAV  138

Query  642   KNAPQGSNLISAVAHEGYDisilqissliIPPGVE  538
               +   +N +  VA   Y+IS++QISS+I+PP + 
Sbjct  139   PGSSLVANFVKVVATRPYNISVIQISSVIVPPNIS  173



>gb|EPS61284.1| hypothetical protein M569_13515, partial [Genlisea aurea]
Length=220

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 0/183 (0%)
 Frame = -2

Query  1017  IMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS  838
             I   S   FN+T +L +YP F+NF+  LT T+LA EIN R T+TVLAV N  +G ++GK 
Sbjct  3     ISAISVSGFNITVLLGRYPEFSNFSDLLTRTQLAEEINHRSTITVLAVTNDKLGGVAGKP  62

Query  837   KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVM  658
              DV K +++ H++LDY+DV K   L+   T++TTL+Q++G+A+  QGFL+       +V+
Sbjct  63    LDVAKRILSNHVILDYFDVLKLNKLKNTRTEVTTLYQASGVANDAQGFLDIVHKLDGSVV  122

Query  657   IGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAA  478
              GSAV+ +     L  +VA + Y+IS+L +S +II PG++    KA   +      SP A
Sbjct  123   FGSAVRGSGLDCKLEGSVASQPYNISVLAVSQVIIAPGMDGTYSKAPASAPPPKANSPTA  182

Query  477   APS  469
              PS
Sbjct  183   VPS  185



>ref|XP_009338843.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=267

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 112/183 (61%), Gaps = 15/183 (8%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T +L+K  +F+NFN  L+ET+LA EIN R T+T+LAVDNG  G LSGKS D+ K +++
Sbjct  21   NITKLLEKQSDFSNFNNLLSETKLADEINRRSTITILAVDNGAAGGLSGKSSDLTKKILS  80

Query  810  VHIVLDYYDVkkftt--lekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVK-  640
            VH+VLDYYD  K        K+  LTTLFQSTG A  EQGF+  +      V  GSA K 
Sbjct  81   VHVVLDYYDTDKLKKIFKSNKSATLTTLFQSTGEARKEQGFITVS-VKDNQVSFGSAAKG  139

Query  639  -NAPQGSNLISAVAHEGYDisilqissliIPPGVES--IAPKAAPPSHQQHGKSPAAAPS  469
             N     +L+ +V  + Y+IS+LQ+ S+I  P +E+   AP  +P S        A APS
Sbjct  140  NNGDNHVSLVKSVISQPYNISVLQVGSIINVPDIENSGSAPAHSPKS--------AKAPS  191

Query  468  PRK  460
            P K
Sbjct  192  PSK  194



>ref|XP_006664971.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Oryza 
brachyantha]
Length=305

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 4/180 (2%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +L +  +F+ FN  L + +LA EIN R T+TVLAVDNG  G +S    DV + V+
Sbjct  26   FNITRILGELSDFSTFNNLLMQKKLADEINRRQTITVLAVDNGAAGGISSLPSDVQRKVL  85

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            +VH+VLDYYD KK   ++  +T+LTTLFQS+G A+   GFLN T     T++ GSA   A
Sbjct  86   SVHVVLDYYDTKKLNAMKNHSTRLTTLFQSSGQATNHMGFLNCTKHSDGTMVFGSAEPGA  145

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGVESI----APKAAPPSHQQHGKSPAAAPSP  466
            P  S L+  +A   Y+IS+LQ+SS I+PP + +     +   AP       K+P +AP+P
Sbjct  146  PVTSQLVKLIASRPYNISVLQVSSAIVPPSIGTTNANNSKADAPLPALTKAKTPISAPAP  205



>ref|XP_008219801.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=271

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = -2

Query  1023  FSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG  844
             F +   S  AF++T +L+K   F+NFN YL ET+L  +INSR T+TVLAV NG + +L+G
Sbjct  15    FIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSRSTITVLAVGNGAISSLAG  74

Query  843   KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlF--QSTGMASGEQGFLNATDTGG  670
             KS+DV+K +++ H++LDYYD +K T L K +   T     QS+G A  +QGF+NA     
Sbjct  75    KSQDVVKKILSAHVILDYYDEQKLTKLAKSSKVTTLTTMFQSSGQAQNQQGFINAGVINE  134

Query  669   KTVMIGSAVKNAPQGSNLISAVAHEGYD  586
               +  GSA K +   + L+ +V  + ++
Sbjct  135   GELAFGSAAKGSILNAKLVKSVVSQPFN  162



>ref|XP_009396684.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 113/175 (65%), Gaps = 6/175 (3%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T ML + P+F+ FN  LT+T LA +INSR T+T+LAV NG + ++S +  D IK +++
Sbjct  26   NITKMLAQLPDFSTFNDLLTQTHLAADINSRSTITILAVSNGAVSSVSDEPIDTIKKILS  85

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
            +H++LDYYD  K   +   T  LTTLFQ++G A+G+ GFLN T+     +  GSAV  + 
Sbjct  86   LHVILDYYDDNKIHKISNHTAILTTLFQASGGAAGQNGFLNVTNMENGQIAFGSAVAGSS  145

Query  630  QGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAPSP  466
              +N +  +A + Y+IS+LQISS+I+PP +   A      S  Q  K PA++P+P
Sbjct  146  LTANFVKVLATQPYNISVLQISSVIVPPSLSGGA------SSNQSTKPPASSPTP  194



>ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
tomentosiformis]
Length=422

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 4/170 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             I  F L S +I   S  A N+T +L K+P ++ FN YLT+T+LA EINSR T+TVLA+ N
Sbjct  6     IFLFTLMSITI---SIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRQTITVLALTN  62

Query  867   GGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
             G M  + GK    VIK+V+++HI+LDY+D  K   +   TT  TTL+Q+TG A+G  G +
Sbjct  63    GAMSDVVGKHPLSVIKNVLSLHILLDYFDSTKLHKISDGTTLSTTLYQTTGNANGNLGSV  122

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             N TD  G  V  GSAV ++P  S    +V    Y+IS+L+ISS II PG+
Sbjct  123   NITDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGI  172



>ref|XP_008777689.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=272

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 116/197 (59%), Gaps = 20/197 (10%)
 Frame = -2

Query  1002  CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  823
              GA+N+T +L+ Y +F+ FN YLT+T+LA EIN   T+TVL VDN  M  +     +++K
Sbjct  20    VGAYNITQILEPYSSFSIFNNYLTQTKLADEINRHQTITVLVVDNSKMSVIFSYLNEILK  79

Query  822   SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
               MA+H++LDYYD+ K + +  K+T LTTLF ++G+A+ + G LN T+     V+ GSA 
Sbjct  80    HTMAIHVILDYYDINKLSHILHKSTLLTTLFLTSGIANNKLGILNVTNMPNDIVIFGSAT  139

Query  642   KNAPQGSNLISAVAHEGYDisilqissliIPPGVE---------------SIAPKAAPPS  508
               A   S  I  V  + Y+IS+LQ+S+LII PG+E               ++AP A P +
Sbjct  140   PEATLSSTFIKVVITKPYNISVLQMSNLIILPGIEGAKQASPLATLKKALALAPMAKPTN  199

Query  507   HQQHG-----KSPAAAP  472
                H      KSPA+ P
Sbjct  200   STSHAPTTIEKSPASTP  216



>ref|XP_004138878.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 ref|XP_004160862.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 gb|KGN62878.1| hypothetical protein Csa_2G379090 [Cucumis sativus]
Length=300

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T +L+++P+F  FN+ LT+T L  +INSR T+TVLA+ N  +GA++G S DVIK +++
Sbjct  35   NITRLLNRFPDFGAFNELLTKTHLYEQINSRQTITVLALSNATVGAIAGNSLDVIKQILS  94

Query  810  VHIVLDYYDVkkfttlekkttklttlF-QSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
             H++LDYYDV+K   L      + T   QSTG A  +QGFL         V  GSA K A
Sbjct  95   AHVILDYYDVEKMRKLSTDKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSAAKKA  154

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGV  541
            P  + L+  VA + Y+IS+LQ+S+ I+ PG+
Sbjct  155  PLSAKLMKTVASQPYNISLLQVSAPIVIPGI  185



>ref|XP_007221854.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
 gb|EMJ23053.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
Length=285

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 89/142 (63%), Gaps = 2/142 (1%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  AFN+T +L+K  +F+NFN  L++T+LA EIN R T+T+LAVDNGG G LSG+S D+ 
Sbjct  26    SVSAFNITKLLEKQSDFSNFNNLLSQTKLADEINRRSTITILAVDNGGAGGLSGESSDMA  85

Query  825   KSVMAVHIVLDYYDVkkftt--lekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
             K +++VH+VLDYYD  K        K+  LTTLFQSTG A  EQGF+  +   G+     
Sbjct  86    KKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQISFES  145

Query  651   SAVKNAPQGSNLISAVAHEGYD  586
             +A        N + +V  + Y+
Sbjct  146   AAKGGNGNSVNFVKSVVSQPYN  167



>ref|XP_010034870.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Eucalyptus 
grandis]
Length=345

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L KYP F+ FN  LT +++A  IN+R ++TVLAVDN GM ALSG   + +K +
Sbjct  22   AFNITNILSKYPEFSTFNNDLTLSQVASAINARQSITVLAVDNSGMSALSGNPAETVKDI  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++ +VLDYYD +K   L  KT  LTTL Q++G A G QGFLN T +    +  GSAV+ 
Sbjct  82   LSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSAVQG  141

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            +   +NL+ +V  + ++IS+LQISS I+PP +
Sbjct  142  SSVHANLVKSVTSQPFNISVLQISSAIVPPNI  173



>ref|XP_009402000.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 111/169 (66%), Gaps = 2/169 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             F     + +++ S    A ++  +L  +  F+ F +YLT+T++A EIN R T+TVLAVDN
Sbjct  8     FLVFLPYLLLISSSAVAALDIVGILQPFDEFSTFTKYLTQTKVADEINRRQTITVLAVDN  67

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               + ALS  S D +K+V++VH++LDYYD  K   + KKT  LTTLFQ++G+A+   GFLN
Sbjct  68    SAISALSSLSADTLKNVISVHVILDYYDPYKLDKVPKKTALLTTLFQASGLAANNMGFLN  127

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              T+  G+ +M GSA   AP  SNL   VA   Y++S+LQ+S+ I+PPG+
Sbjct  128   YTELPGEQMMFGSAAPGAPLNSNLQKVVAARPYNVSVLQVSTAIMPPGI  176



>gb|ABR16344.1| unknown [Picea sitchensis]
Length=387

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 3/152 (2%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F  L SF   +    AFN+T +LD YP+++ FN  LT T+LA EINSR T+TVL V+NG 
Sbjct  6     FVLLLSF---LCCANAFNITKILDAYPDYSIFNDDLTRTKLADEINSRKTITVLVVNNGA  62

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M +LSG     +K  +++H+VLD++D +K   +   TT  TTL+Q+TG A+G  GF+N T
Sbjct  63    MASLSGLDLASVKRALSLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINIT  122

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             D  G  V  G + + A   S  + +V  +G++
Sbjct  123   DLKGGKVGFGLSGRGAKLDSTYVKSVKQDGFN  154



>gb|KCW53929.1| hypothetical protein EUGRSUZ_J03138 [Eucalyptus grandis]
Length=309

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L KYP F+ FN  LT +++A  IN+R ++TVLAVDN GM ALSG   + +K +
Sbjct  22   AFNITNILSKYPEFSTFNNDLTLSQVASAINARQSITVLAVDNSGMSALSGNPAETVKDI  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++ +VLDYYD +K   L  KT  LTTL Q++G A G QGFLN T +    +  GSAV+ 
Sbjct  82   LSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSAVQG  141

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            +   +NL+ +V  + ++IS+LQISS I+PP +
Sbjct  142  SSVHANLVKSVTSQPFNISVLQISSAIVPPNI  173



>gb|KHM99327.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=303

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 106/158 (67%), Gaps = 8/158 (5%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AF++T +L +YP F+ FN+YLTET+LA +INSR T+TVLAV++  M +++ KS + IK++
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADQINSRNTITVLAVEDSAMHSIAAKSPEAIKAI  82

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H++LD++D KK    +  + +LTTLFQ++G+A  +QGFL       K  ++G     
Sbjct  83   IGTHVILDFFDEKKLMEAQASSQQLTTLFQASGLAVNQQGFL-------KVALVGEGEIA  135

Query  636  AP-QGSNLISAVAHEGYDisilqissliIPPGVESIAP  526
            AP   + L+  V  E Y+ISILQ++  I+ PGV+S  P
Sbjct  136  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQTP  173



>emb|CDY52668.1| BnaC01g38580D [Brassica napus]
Length=262

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 110/191 (58%), Gaps = 13/191 (7%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +FFF ++F     +  AFN+T +L+    F+ FN  L++T LA  INSR T+TVLA+ N 
Sbjct  13    LFFFASTF----LNAHAFNITRILNLNNEFSTFNNLLSQTGLASTINSRQTITVLALSND  68

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              M   S +S +  K  +++HIVLDYYD+KK  +L KK+  LTTLFQS+G A G+QGF+NA
Sbjct  69    AMSLFSDQSTEDNKKSLSLHIVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINA  128

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSH  505
             T      VM GSAV+ +   S LI +VA   Y+IS+L          + S  P   P   
Sbjct  129   TVMNNGDVMFGSAVRGSLLDSKLIDSVATHPYNISVL---------HISSYIPIMNPEGP  179

Query  504   QQHGKSPAAAP  472
               HG S    P
Sbjct  180   SDHGSSSTPLP  190



>ref|XP_008352034.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
 ref|XP_008361056.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=291

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 113/184 (61%), Gaps = 16/184 (9%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T +L+K  +F+NFN  L+ET+LA EIN R T+T+LAVDNGG+G LSG+S D+ K +++
Sbjct  25   NITKILEKQSDFSNFNSLLSETKLANEINKRKTITILAVDNGGVGGLSGQSSDLTKKILS  84

Query  810  VHIVLDYYDVkkftt--lekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            VH++LDYYD  K        K+  LTT+FQSTG A  +QGF+  +      +   SA K 
Sbjct  85   VHVILDYYDSDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVS-VKDNHISFASAYKG  143

Query  636  APQGS---NLISAVAHEGYDisilqissliIPPGVESI--APKAAPPSHQQHGKSPAAAP  472
               G    NL+ +V  + Y+IS+LQ+ S+I  P +E+   AP  +P S        A AP
Sbjct  144  NNNGGNHVNLVKSVVSQPYNISVLQVGSIIDVPDIENTDSAPAQSPKS--------AKAP  195

Query  471  SPRK  460
            SP K
Sbjct  196  SPSK  199



>ref|XP_010102851.1| hypothetical protein L484_004423 [Morus notabilis]
 gb|EXB94232.1| hypothetical protein L484_004423 [Morus notabilis]
Length=300

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 103/176 (59%), Gaps = 8/176 (5%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L ++P F  FN +L++T+LA EIN R T+TVL VDN    +LSGK  DV+K +
Sbjct  24   AFNITKILSQHPEFATFNGFLSQTKLADEINRRQTITVLVVDNAAASSLSGKPLDVVKKI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQ-GFLNATDTGGKTVMIGSAVK  640
            ++VH++LDYYDV+K T L              G  + +Q GF+N +      +  GS+ K
Sbjct  84   LSVHVILDYYDVEKLTKLGISNKTSALTTLLAGAGAADQRGFINVSLVNEGEIAFGSSAK  143

Query  639  NAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAP  472
                 S L+ +VA   ++IS+LQI++ +  PG+ES  P   PP        P+AAP
Sbjct  144  GGALNSKLVESVAAHPFNISVLQITAPVQVPGIES-TPVGTPPPK------PSAAP  192



>ref|XP_010669451.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 114/205 (56%), Gaps = 15/205 (7%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             II  F         S  AFN+T  L+++  F+ +N  LT++ +A  IN +GTVTVL VDN
Sbjct  8     IILIFTTILCTTTTSISAFNITYFLEQHSEFSTYNNLLTQSGVAAAINKQGTVTVLVVDN  67

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               +G ++G  +  +  ++A H++LDYYD  K   L  K+ K T LFQ TG  +GEQG LN
Sbjct  68    SAVGPITGVPQSKLSFILATHVILDYYDATKLDNLNGKSVKATNLFQQTGKTNGEQGLLN  127

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPK-----  523
              T++ G  V+  S+ K APQ S ++  V+ + + IS++QIS  I+ PG++          
Sbjct  128   ITNSDG-NVIFASSAKGAPQDSKMVKVVSSQPFHISVIQISKPIVTPGLDQGGSSSPSGS  186

Query  522   ---------AAPPSHQQHGKSPAAA  475
                      AAPP  Q +G +P+ A
Sbjct  187   PNASPPTSVAAPPPKQANGSAPSPA  211



>ref|XP_010913663.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=312

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 103/152 (68%), Gaps = 0/152 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T++L ++ +F+N N  LT+T+LA EINSR  +TVL+V+N  + ++S    DV++ V
Sbjct  22   AFNITSILGQFSDFSNLNNLLTQTQLASEINSRQIITVLSVNNAALSSVSNLPTDVLEKV  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            ++ H+VLDY+D    T L  ++  LTTL Q++G+A+G+ GFLN TD G   + +GSA   
Sbjct  82   LSFHVVLDYFDRDNITKLSNRSAILTTLLQASGLATGQNGFLNVTDMGNGQIALGSAAPG  141

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            +   S  +  +    Y+IS+L ISS+I+PPG+
Sbjct  142  SNLTSQFVKVLVTHPYNISVLHISSVIVPPGL  173



>ref|XP_009398985.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 102/158 (65%), Gaps = 0/158 (0%)
 Frame = -2

Query  1011  VWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKD  832
             V S  AF+VT +L ++ +F+ FN  L  T+L+ +I++R +VT+LAV NG + + SG+  +
Sbjct  20    VSSAIAFDVTRLLAQFSDFSTFNDLLIRTQLSADISTRKSVTILAVQNGALSSESGQPDE  79

Query  831   VIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
             VIK ++A+H+VLDY D +K   L   T  LTT+ Q++G ASG  GFLN TD     V  G
Sbjct  80    VIKKIIALHVVLDYLDSEKLHQLSSHTAILTTMLQASGRASGLSGFLNVTDLKNGQVAFG  139

Query  651   SAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE  538
             SAV  +P  S  +  +    YDIS++QIS LI+PPG+ 
Sbjct  140   SAVPGSPLSSYFVRVILTHPYDISVVQISGLIVPPGIR  177



>ref|NP_001046792.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAD19640.1| endosperm specific protein-like [Oryza sativa Japonica Group]
 dbj|BAF08706.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAG98518.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +L ++ +F+ FN  LT+T+LA EIN R T+TVLA+DNG  G +S    D  + V+
Sbjct  32   FNITRILGEFSDFSTFNHLLTQTKLADEINRRQTITVLALDNGAAGGVSSLPSDEQRKVL  91

Query  813  AVHIVLDYYDVkkf--ttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVK  640
            +VH+VLDYYD +K     ++ ++  LTTLFQS+G A+   GFLN T      ++ GSA  
Sbjct  92   SVHVVLDYYDTEKLGGMKMKNRSAVLTTLFQSSGQATDRMGFLNYTKRSDGIMVFGSAEP  151

Query  639  NAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPK--AAPPSHQQHGKSPA  481
             A   S ++  V    Y+IS+LQ++S I+PPG+ S++     APP H     +PA
Sbjct  152  GAQATSQMVKVVVTRPYNISVLQVNSPIVPPGIASVSNSNTGAPPPHPAKSSAPA  206



>ref|XP_002511740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50409.1| conserved hypothetical protein [Ricinus communis]
Length=425

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +FF   +FS +  +  A N+T +L  +P+++ FN+YLT+T+LA EINSR T+TVLA+ NG
Sbjct  7     LFFLFLAFSALSTTITAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALSNG  66

Query  864   GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M AL+ K    VIK+ +++ ++LDYYD  K   + K TT  TTL+Q+TG A G  GF+N
Sbjct  67    AMSALASKHPLSVIKNALSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGNAPGNLGFVN  126

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
              TD  G  V  GSA   +   S+   +V    Y+IS++++S+ I+ PG+ + AP  +P
Sbjct  127   ITDLQGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVIEVSAPIVAPGIFT-APAPSP  183



>ref|XP_010527113.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Tarenaya 
hassleriana]
Length=304

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             I   L+S +I      A N+T +L+K+PNF+  N+  TET +A  IN   T+TVLAVDNG
Sbjct  13    ILLILSSTTI-----SALNITRVLEKFPNFSTMNELFTETGVAATINQHQTITVLAVDNG  67

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              +G++S + ++  K+++  H+VLDY+D  K   L+ ++   TTL+Q+TG+   + GFLN 
Sbjct  68    AIGSISARPEEEQKNILMTHVVLDYFDELKLKGLKDRSNMFTTLYQTTGLGEQQNGFLNC  127

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES  535
             T+  G T+  GSAVK AP  +  ++ V    Y++S++QIS+ I+ PG+ S
Sbjct  128   TNING-TLAFGSAVKGAPLNARYVTTVFQNPYNLSVIQISTPIVAPGLGS  176



>gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas]
Length=423

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F FL SFS++  +  A N+T +L  +P+++ FN+YLT+T+LA EINSR T+TVLA++NG
Sbjct  6     LFLFL-SFSVISTTISAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNG  64

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              + +++     VIK+++++ ++LDYYD  K   + K TT  TTL+Q+TG A G  GF+N 
Sbjct  65    AISSIAKHPLPVIKNILSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGSAPGNLGFVNI  124

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             TD  G  V  GSA   +   S+   +V    Y+IS+L++S+ II PG+ + AP  +P
Sbjct  125   TDLQGGKVGFGSAAPGSKLESSYTKSVKQVPYNISVLEVSAPIIAPGILA-APAPSP  180



>gb|KFK32632.1| hypothetical protein AALP_AA6G268600 [Arabis alpina]
Length=279

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T +L+KYP F+  N+ L +T L   IN R T+TVLA+ N  +G++SG+ ++ IKS+
Sbjct  24   AVNITRVLEKYPEFSTMNELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEEIKSI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLDY+D  K   L+ K+T LTTL+QSTG+   + GFLN + + GK +  GSAVK 
Sbjct  84   LMNHVVLDYFDELKLKALKDKSTMLTTLYQSTGLGQQQNGFLNCSKSNGK-IYFGSAVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVES  535
             PQ +  I+ V    +++S++QIS  I+ PG+ S
Sbjct  143  TPQTAEYITTVFRNPFNLSVVQISMPIVAPGIGS  176



>ref|XP_009381782.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 11/198 (6%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++F  L     +  +  A ++  +L  +P ++ F +YLT+T++A EIN R T+TVL V++
Sbjct  9     VLFLLL----FVSSASSALDIVEILQPFPEYSTFTKYLTQTKVADEINRRKTITVLVVND  64

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               +  LS  S D +K+ ++VH++LDYYD      L  KT  LTTLFQ++G A+G  GFLN
Sbjct  65    SAIAPLSSLSGDALKNAISVHVILDYYDPYTLDNLPNKTALLTTLFQASGHATGRLGFLN  124

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPS  508
              T+  G+ +  GSA   AP  S L   VA   YDIS+L IS+ I+P G  S+A      +
Sbjct  125   YTELPGEQMTFGSAAPGAPLNSELNKVVAVRPYDISVLGISAAIVPSGSGSVA-----TT  179

Query  507   HQQHGKSPAAAPS--PRK  460
                   +PA AP+  PRK
Sbjct  180   SPMRKLAPAQAPTIAPRK  197



>ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
sylvestris]
Length=422

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             I  F L SF+I   S  A N+T +L K+P ++ FN YLT+T+LA EINSR T+T+LA+ N
Sbjct  6     IFLFTLMSFTI---SIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRTTITILALTN  62

Query  867   GGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
             G M  + GK    VIK+V+++HI+LDY+D  K   +   TT  TTL+Q+TG A+G  G +
Sbjct  63    GAMADVVGKHPLSVIKNVLSLHILLDYFDNTKLHKISDGTTLTTTLYQTTGNANGNLGSV  122

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             N TD  G  V  GSAV ++P  S    +V    Y+IS+L+ISS II PG+
Sbjct  123   NITDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGI  172



>ref|XP_009120424.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=264

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 103/177 (58%), Gaps = 9/177 (5%)
 Frame = -2

Query  1002  CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  823
               AFN+T +L+    F++FN  L++T LA  INSR T+TVLA+ N  M   S +S +  K
Sbjct  23    ANAFNITRILNLNNEFSSFNNLLSQTGLASTINSRQTITVLALSNDAMSIFSDQSTEDNK  82

Query  822   SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
               +++HIVLDYYD+KK  +L K++  LTTLFQS+G A G+QGF+NAT      VM GSAV
Sbjct  83    KSLSLHIVLDYYDIKKLKSLNKRSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAV  142

Query  642   KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAP  472
             + +   S LI +VA   Y+IS+L          + S  P   P     HG S    P
Sbjct  143   RGSLLDSKLIDSVATHPYNISVL---------HISSYIPIMNPEGPSDHGSSSTPLP  190



>emb|CDY42162.1| BnaC05g40570D [Brassica napus]
Length=251

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 98/153 (64%), Gaps = 1/153 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +FF  AS + +  S  +FN+T +L++   F+ FN  LT+T LA  INSR T+TVLA+ N 
Sbjct  10    LFFSFAS-TFLYTSSNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQTITVLALSND  68

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              +   S +S +  K V+++ I+LDYYD+KK  +L KK+  LTTLFQ++G A GEQGF+NA
Sbjct  69    AVSHFSDQSAEDNKKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNA  128

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             T      VM GSAV  +   S LI +VA   Y+
Sbjct  129   TVMNNGDVMFGSAVPGSILDSKLIDSVATHPYN  161



>ref|NP_180021.1| fasciclin-like arabinogalactan protein 3 [Arabidopsis thaliana]
 sp|Q9ZQ23.1|FLA3_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD18116.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAS76230.1| At2g24450 [Arabidopsis thaliana]
 gb|AAS92327.1| At2g24450 [Arabidopsis thaliana]
 dbj|BAF00374.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 dbj|BAF01512.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEC07579.1| fasciclin-like arabinogalactan protein 3 [Arabidopsis thaliana]
Length=280

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T +L+KYP F+   + L +T L   IN R T+TVLA++N  +G++SG+ ++ +K++
Sbjct  24   AVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVLALNNDAIGSISGRPEEEVKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLDY+D  K   L++K+T LTTL+QSTG+   + GFLN T + GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKEKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>gb|ABK24724.1| unknown [Picea sitchensis]
 gb|ACN41086.1| unknown [Picea sitchensis]
Length=409

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L KYP ++ FN  L++T+LA EINSR T+TVLA+ N  M +LSG     +K V
Sbjct  22   AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSQMASLSGLDLASLKRV  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++H+VLD++D KK   +   TT  TTL+Q+TG A G  GF+N TD     V  G A   
Sbjct  82   LSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAHG  141

Query  636  APQGSNLISAVAHEGYD  586
            A   +  + +V  EGY+
Sbjct  142  AKLDATYVKSVKQEGYN  158



>ref|XP_006296192.1| hypothetical protein CARUB_v10025354mg [Capsella rubella]
 gb|EOA29090.1| hypothetical protein CARUB_v10025354mg [Capsella rubella]
Length=280

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T +L+KYP F++  +   +T L   IN R T+TVLA+ N  +G++SG+ ++ IK++
Sbjct  24   AVNITRVLEKYPEFSSMLELFAKTELTPIINKRQTITVLALSNDAIGSISGRPEEEIKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLDYYD  K   L+ K+T LTTL+QSTG+   + GFLN + + GK +  GSAVK 
Sbjct  84   LMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKSNGK-IYFGSAVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum 
lycopersicum]
Length=414

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 111/169 (66%), Gaps = 3/169 (2%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             + FFL  F+++  S  A N+T +L+K+P ++ FN YL++T+LA EINSR T+TVLA+ NG
Sbjct  4     LHFFL--FTLLTVSVHAHNITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNG  61

Query  864   GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M A+  K    VIK+V+++H++LDY+D  K   +   TT  TTL+Q+TG A G  G +N
Sbjct  62    AMSAIVDKHPLSVIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNIGSVN  121

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA+ N+P  S    +V    Y+IS+L++S+ II PG+
Sbjct  122   ITDLKGGKVGFGSAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGI  170



>gb|ABR16637.1| unknown [Picea sitchensis]
Length=409

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L KYP ++ FN  L++T+LA EINSR T+TVLA+ N  M  LSG     +K V
Sbjct  22   AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSEMALLSGLDLASLKRV  81

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++H+VLD++D KK   +   TT  TTL+Q+TG A G  GF+N TD     V  G A   
Sbjct  82   LSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAHG  141

Query  636  APQGSNLISAVAHEGYD  586
            A   +  + +V  EGY+
Sbjct  142  AKLDATYVKSVKQEGYN  158



>ref|XP_002880584.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56843.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T +L+KYP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   AVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H++LDY+D  K   L++++T LTTL+QSTG+   + GFLN T + GK +  GS VK 
Sbjct  84   LMNHVILDYFDELKLKALKERSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>emb|CDY50538.1| BnaA01g30420D [Brassica napus]
Length=259

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 102/177 (58%), Gaps = 9/177 (5%)
 Frame = -2

Query  1002  CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  823
               AFN+T +L+    F+ FN  L++T LA  I+SR T+TVLA+ N  M   S +S +  K
Sbjct  18    ANAFNITRILNLNNEFSTFNNLLSQTGLASTIDSRQTITVLALSNDAMSLFSDQSTEDNK  77

Query  822   SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
               +++HIVLDYYD+KK  +L KK+  LTTLFQS+G A G+QGF+NAT      VM GSAV
Sbjct  78    KSLSLHIVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAV  137

Query  642   KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAP  472
             + +   S LI +VA   Y+IS+L          + S  P   P     HG S    P
Sbjct  138   RGSLLDSKLIDSVATHPYNISVL---------HISSYIPIMNPEGPSDHGSSSTPLP  185



>ref|XP_006845641.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
 gb|ERN07316.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
Length=398

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 138/275 (50%), Gaps = 34/275 (12%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGK--SKDVIK  823
             FN+T +LD++P FN FN YLT T++ GEIN R T+T+LA+++  M +++G   + +V+ 
Sbjct  119  CFNITKILDQHPEFNVFNSYLTLTKVVGEINKRNTITILAIEDSAMSSITGGNFAPEVLH  178

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGK-TVMIGSA  646
            ++M+VH+VLDYYD KK   L + T  LT LFQSTG A G+QGFLN T +     ++ GSA
Sbjct  179  NIMSVHVVLDYYDSKKLDNLSEGTALLTALFQSTGSAVGQQGFLNVTKSKQTGEILFGSA  238

Query  645  VKNAPQGSNLISAVAHEGYDisilqissliIPPGVE------------------------  538
            V  +   + L+ +VA E Y+IS+LQIS  IIP G++                        
Sbjct  239  VLGSALSAKLVKSVASEPYNISVLQISRPIIPQGIDKSNNASKVSPSVAPAPAPKASAPA  298

Query  537  -------SIAPKAAPPSHQQHGKSPAAAPSPRKllspsnspsdspsdspsalspPGVSPS  379
                   + AP  + P+    G    A   P          +   +  PS  +  G  P+
Sbjct  299  PKASAPATEAPTPSSPALAPPGNHTPAPEGPTSPPENEGPTAAPLASPPSPPAAEGPGPA  358

Query  378  VPETDSPASGPNGEGDSSAATTAREACLGFVMAII  274
                D  A GP+    S+ A      CL  V+  +
Sbjct  359  AEGPDGSAQGPSDSEKSAGARVVSSTCLVAVLGFL  393



>ref|XP_010506492.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X1 
[Camelina sativa]
 ref|XP_010506494.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X2 
[Camelina sativa]
 ref|XP_010506495.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X3 
[Camelina sativa]
Length=423

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGA----FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAV  874
             F  LA F+  + +C +     N+T +L   P++++FN YLT+T+LA EINSR T+TVL +
Sbjct  9     FSLLAFFTFSILACASTVSSHNITQILTDSPDYSSFNSYLTQTKLADEINSRTTITVLVL  68

Query  873   DNGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQG  697
             +NG M +L+GK    VIKS +++ ++LDYYD  K   L K TT  TTL+Q+TG A G  G
Sbjct  69    NNGAMSSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLG  128

Query  696   FLNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKA  520
             F+N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV +  AP A
Sbjct  129   FVNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSA  188

Query  519   A  517
             A
Sbjct  189   A  189



>ref|XP_010429425.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=281

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 104/167 (62%), Gaps = 1/167 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F  LA    +     A N+T  L+KYP F++  +   +T L   IN R T+TVLA+ N  
Sbjct  9     FLCLAILLAVSSIVSAVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDA  68

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             +G++SG+ ++ +K+++  H+VLDY+D  K   L+ K+T LTTL+QSTG+   + GFLN T
Sbjct  69    IGSISGRPEEELKNILMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCT  128

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              + GK +  GS VK APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  129   KSNGK-IYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>emb|CDY00793.1| BnaC03g37770D [Brassica napus]
Length=266

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 101/154 (66%), Gaps = 2/154 (1%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             +IFFF ++F  +     +FN+TT+L +  +F+ FN+ L++T LA  INSR T+TVLA+ N
Sbjct  9     LIFFFASAF--LYTPSNSFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALAN  66

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               +   + +S +  K ++++H++LDYYD+KK  +L KKT  LTTLFQ +G A G+QGF+N
Sbjct  67    DAVYLFADQSMEDNKVILSLHVILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVN  126

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
              T      +  GSAV+ +   S LI +VA E ++
Sbjct  127   VTVKDNGDIAFGSAVRGSLLDSQLIDSVASEPFN  160



>emb|CDY20316.1| BnaC04g36400D [Brassica napus]
Length=286

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T  LDKYP F+   + L +T+L   IN R T+T+LA+ N  +G++SG+ +D +K++
Sbjct  24   AVNITRALDKYPEFSTMTELLAKTKLTPIINKRQTITLLALSNDAIGSISGRPEDELKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLD+YD  K   ++ K+T LTTL+QSTG+   + GFL  + T GK +  GSAVK 
Sbjct  84   LMNHVVLDFYDGLKLKAIKDKSTMLTTLYQSTGLGQQQNGFLKCSKTNGK-IYFGSAVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    +++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
 gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
Length=421

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = -2

Query  1041  FFFLASFSI--MVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             +  L SF++  +V +  A N+T +L  +P ++ FN+YLT+T+LA EIN+R T+TVLA++N
Sbjct  6     YSLLLSFTLSALVSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNN  65

Query  867   GGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
             G M AL+ K    VIK+ +++ +VLDYYD  K   + K TT  TTL+Q+TG A G  GF+
Sbjct  66    GAMTALAAKHPLSVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFV  125

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPP  511
             N TD  G  V  GSA   +   S+   +V    Y+ISIL+IS  II PG+ + AP   P 
Sbjct  126   NITDLQGGKVGFGSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGILT-APAPTPS  184

Query  510   S  508
             S
Sbjct  185   S  185



>ref|XP_009417795.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 116/179 (65%), Gaps = 2/179 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +     SF +++ S  A N+T +L ++P+F+NFN  L++  +A E+N R T+TVLAVDN 
Sbjct  9     LLLVFVSFLVLLSSATAHNITRLLSQFPDFSNFNSLLSQADIASEVNRRQTITVLAVDNS  68

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
                +LS    D +K V+++H++LDYYD +K   L++++T  TTLFQ+TG+A+   GFLNA
Sbjct  69    AASSLSSLDSDTLKQVLSIHVILDYYDKEKIHNLKRRSTLFTTLFQTTGVAANRMGFLNA  128

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES--IAPKAAP  514
             T      +  GS V  +P  +  + +VA + Y++S+LQIS++I+P G+    +AP  AP
Sbjct  129   TKLSDGRLAFGSGVPGSPLVATYVKSVAAKPYNLSVLQISAVIVPQGINGTPLAPFGAP  187



>emb|CDY08417.1| BnaA05g26530D [Brassica napus]
Length=251

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S  +FN+T +L++   F+ FN  LT+T LA  INSR T+TVLA+ N  +   S +S +  
Sbjct  22    STNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQTITVLALSNDAVSHFSDQSAEDN  81

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K V+++ I+LDYYD+KK  +L KK+  LTTLFQ++G A GEQGF+NAT      VM GSA
Sbjct  82    KKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNATVMDNGDVMFGSA  141

Query  645   VKNAPQGSNLISAVAHEGYD  586
             V  +   S LI +VA   Y+
Sbjct  142   VPGSILDSKLIDSVATHPYN  161



>ref|XP_010518164.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 113/174 (65%), Gaps = 4/174 (2%)
 Frame = -2

Query  1026  SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGA  853
             +FSI+ +  +  + N+T +L   P++++FN YLT+T+LA EINSR T+TVL ++NG M +
Sbjct  16    TFSILAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSS  75

Query  852   LSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDT  676
             L+GK    VIKS +++ ++LDYYD  K   L K TT  TTL+Q+TG A G  GF+N TD 
Sbjct  76    LAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDL  135

Query  675   GGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
              G  V  GSAV  +   S+   +V    Y+ISIL+I + II PGV +  AP AA
Sbjct  136   KGGKVGFGSAVSGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAA  189



>gb|EPS66997.1| hypothetical protein M569_07779, partial [Genlisea aurea]
Length=401

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+TT+LDKYP  + FN YLT T+LA EIN R T+TV AVDN GM  L  K   +  IK
Sbjct  21   AHNITTILDKYPELSTFNHYLTVTQLAPEINHRETITVCAVDNAGMSDLLSKHLTIGAIK  80

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTV  661
            +V+A+H++LDY+D KK   +   T    T+FQ+TG A+G  GF+N TD  G  V
Sbjct  81   NVLALHVLLDYFDAKKLHQITDGTALSATMFQATGSATGSSGFVNITDLAGGKV  134



>ref|XP_010417204.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=280

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T  L+KYP F++  +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   AVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLDY+D  K   L+ K+T LTTL+QSTG+   + GFLN T + GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_010472452.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=280

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T  L+KYP F++  +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   AVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLDY+D  K   L+ K+T LTTL+QSTG+   + GFLN T + GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Solanum 
tuberosum]
Length=415

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (2%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             + FFL  F++   S  A N+T +L+++P ++ FN YL++T+LA EINSR T+TVLA+ NG
Sbjct  4     LHFFL--FTLFTVSVHAHNITEILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPNG  61

Query  864   GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M A+  K    VIK+V+++H++LDY+D  K   +   TT  TTL+Q+TG A G  G +N
Sbjct  62    AMSAVVDKHPLSVIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNVGSVN  121

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA+ N+P  S    +V    Y+IS+L++S+ II PG+
Sbjct  122   ITDLKGGKVGFGSAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGI  170



>gb|EMS62729.1| hypothetical protein TRIUR3_26693 [Triticum urartu]
Length=261

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +L+K P F  FN  L++T LA EIN R T+TVL VDN     ++    D  K V+
Sbjct  26   FNITEVLNKSPEFLTFNSLLSKTNLAEEINKRQTITVLVVDNSAASGITSLPTDTQKKVL  85

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            AVH++L+YYD  K   +EK T  LT+LFQ+TG A+   GF+N T +    ++ GSA   A
Sbjct  86   AVHVILNYYDPMKLENIEKGTALLTSLFQTTGAATDRMGFVNYTHSADDQMVFGSAEPGA  145

Query  633  PQGSNLISAVAHEGYDisilqissliIPP  547
            P  S L+  VA   Y++S++Q+S+ IIPP
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVSAAIIPP  174



>ref|XP_006404978.1| hypothetical protein EUTSA_v10000470mg [Eutrema salsugineum]
 gb|ESQ46431.1| hypothetical protein EUTSA_v10000470mg [Eutrema salsugineum]
Length=277

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T  L+KYP F+   +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALEKYPEFSTMTELFAKTELTPIINKRQTLTVLALSNDAIGSISGRPEEELKNILM  85

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
             H+VLDYYD  K   L+ K+T LTTL+QSTG+   + GFLN + + GK +  GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKSNGK-IYFGSAVKGAP  144

Query  630  QGSNLISAVAHEGYDisilqissliIPPGV  541
            Q +  I+ V    Y++S++QIS  I+ PG+
Sbjct  145  QTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_009140554.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=285

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T  LDKYP F+   +   +T+L   IN R T+T+LA+ N  +G++SG+ +D +K++
Sbjct  24   AVNITRALDKYPEFSTMTELFAKTKLTPIINKRQTITLLALSNDAIGSISGRPEDELKNI  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLD+YD  K   ++ K+T LTTL+QSTG+   + GFL  + T GK +  GSAVK 
Sbjct  84   LMNHVVLDFYDGLKLKAIKDKSTMLTTLYQSTGLGQQQNGFLKCSKTNGK-IYFGSAVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    +++SI+QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPFNLSIVQISMPIVAPGL  174



>gb|EMT17229.1| hypothetical protein F775_11240 [Aegilops tauschii]
Length=261

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +L++ P F  FN  L++T LA EIN R T+TVL VDN     +     D  K V+
Sbjct  26   FNITEVLNESPEFLTFNSLLSKTNLAEEINKRQTITVLVVDNSAASGIMSLPTDTQKKVL  85

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            AVH++LDYYD  K  T+EK T  LT+LFQ+TG A+   GF+N T +    ++ GSA   A
Sbjct  86   AVHVILDYYDPMKLETIEKGTALLTSLFQTTGAATDRMGFVNYTRSADDQMVFGSAEPGA  145

Query  633  PQGSNLISAVAHEGYDisilqissliIPP  547
            P  S L+  VA   Y++S++Q+ + IIPP
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVRAAIIPP  174



>dbj|BAK06740.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 102/169 (60%), Gaps = 0/169 (0%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +LD+ P F+ FN  L++T L  EIN R T+TVL VDN    A++    D  K V+
Sbjct  27   FNITEVLDESPEFSTFNSLLSKTNLVEEINKRQTITVLVVDNSAASAITSLPTDTQKKVL  86

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            AV ++LDYYD  K   +EK+T  LTTLFQ+TG A+   G +N T +    +  GSA   A
Sbjct  87   AVQVILDYYDPMKLEGIEKRTALLTTLFQTTGAATDRAGLVNYTHSADDQMAFGSAEPGA  146

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKS  487
            P  S L+  VA   Y++S++Q+S+ IIPP + S    ++ P  + HG S
Sbjct  147  PLSSQLVKVVACRPYNLSVMQVSAAIIPPSISSSDKGSSGPPGKAHGSS  195



>gb|ABV27488.1| fasciclin-like arabinogalactan protein 17 [Gossypium hirsutum]
Length=285

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 106/169 (63%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSI-MVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             + FF+A+  + +  +C A N+T  L  Y +++  +    +T+L   IN R T+T+LA+DN
Sbjct  8     LLFFIAAILLPLATTCTALNITKSLAPYSDYSTLSDLFRKTKLTDAINRRQTITILALDN  67

Query  867   GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
               + +++ +S D ++ ++  HI+LDYYD +K   L KK+  LTTL+Q+TG A  +QGF+N
Sbjct  68    SSIQSITDRSSDELRKILMNHIILDYYDRQKIQKLGKKSALLTTLYQTTGSAINQQGFVN  127

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              T      V+ GSAVK AP    L+ +V  + +++S+L IS+ I+ PG+
Sbjct  128   ITRIARGEVVFGSAVKGAPLVGKLLGSVISQPFNLSVLHISTPIVAPGI  176



>ref|XP_010508167.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = -2

Query  1032  LASFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
             L +FSI+ +  +  + N+T +L   P++++FN YLT+T+LA EINSR T+TVL ++NG M
Sbjct  14    LFTFSILAFASTVSSHNITQILADSPDYSSFNNYLTQTKLADEINSRTTITVLVLNNGAM  73

Query  858   GALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
              +L+GK    VIKS +++ ++LDYYD  K   L K TT  TTL+Q+TG A G  GF+N T
Sbjct  74    SSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNIT  133

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
             D  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV +  AP AA
Sbjct  134   DLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAA  189



>ref|XP_003526450.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=239

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = -2

Query  1032  LASFSIMVWSCGA---FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             L S ++++  C +    ++T +L +YP +  FN+YLTET+LA +INSR  VTVLA+D+  
Sbjct  8     LLSVALVLAFCSSIQGLDITKLLGEYPEYAQFNKYLTETKLADQINSRNAVTVLALDDAA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M +LSGKS+D +K++++ H+++++YD KK    E   TK+ TLFQS+G+A   QG++   
Sbjct  68    MASLSGKSQDAVKAILSTHVLVNFYDEKKLMEAEGSRTKVETLFQSSGVAKPNQGYIYVA  127

Query  681   DTGGKTVMIGSAVK--NAPQGSNLISAVAHEGYDisilqissliIPPGVE  538
                   +  GSA    NAP    L+ +V  +   +S+LQ+S  I+ PGVE
Sbjct  128   LINEGEIAFGSAAAAPNAPFEVVLVRSVTSQPDTVSVLQVSKPIVAPGVE  177



>ref|XP_010092859.1| hypothetical protein L484_022454 [Morus notabilis]
 gb|EXB52677.1| hypothetical protein L484_022454 [Morus notabilis]
Length=424

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 90/144 (63%), Gaps = 5/144 (3%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             + F   S   +     A N+T +L ++P+++++N+YLT+T+LA EINSR TVTVL ++NG
Sbjct  8     LVFLCLSILALNAVVSAHNITAILSEFPDYSDYNKYLTQTKLADEINSRTTVTVLVLNNG  67

Query  864   GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
                AL+ K    V+K V+++HIVLDY+D +K   L   +T  TTL+Q+TG A G  G +N
Sbjct  68    AFSALASKHPASVLKKVLSLHIVLDYFDAQKLHKLPDGSTLSTTLYQTTGNAPGNLGSIN  127

Query  687   ATDTGGKTVMIGSAVKNAPQGSNL  616
              TD  G  V  GSA     QGS L
Sbjct  128   ITDLKGGKVGFGSAA----QGSKL  147



>ref|XP_009133982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=280

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T  L+KYP F+   +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+V
Sbjct  24   AVNITRALEKYPEFSTMVELFGKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNV  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +  H+VLDY+D  K   L+ ++T LTTL+QSTG+   + GFLN T T GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKDRSTLLTTLYQSTGLGQQQNGFLNCTKTNGK-IYFGSGVKG  142

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGV  541
            APQ +  I+ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVIQISMPIVAPGL  174



>ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis]
Length=418

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 103/169 (61%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F FL    + +    A N+T +L  +P ++ FN YLT+T+LA EINSR T+TVL + NG
Sbjct  4     VFLFLTLSLLAITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNG  63

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M  L+ K    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N
Sbjct  64    AMSDLTAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVN  123

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S    +V    Y++S+L+ISS II PG+
Sbjct  124   ITDLQGGKVGFGSAASGSKLDSTYTKSVKQIPYNVSVLEISSPIIAPGI  172



>ref|XP_006483738.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Citrus 
sinensis]
 gb|KDO67241.1| hypothetical protein CISIN_1g042255mg [Citrus sinensis]
Length=280

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            F++  +L  +PN   F+  L++T+L   IN R T+TVLAVDN  +G L+ +  D IK+++
Sbjct  29   FDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNIL  88

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            +VH++LDYYD+        KT+  TT+FQSTG A+ +QG++N T   G+  + GS+VKN+
Sbjct  89   SVHVILDYYDM-NKLKKLPKTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNS  147

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGV  541
            P  +  + +V  + ++IS+LQ+S  I+ PG+
Sbjct  148  PPVAKFVKSVFSQPFNISVLQVSQPIVAPGL  178



>dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             + S++       N+T +L  +P ++ FN YL++T+LA EINSR T+TVLA+ NG M  L+
Sbjct  2     TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLA  61

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGK  667
                  VIKS +++ I+LDYYD +K   + K TT  TTL+Q+TG A G  GF+N TD  G 
Sbjct  62    KHPLSVIKSALSLLILLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  666   TVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122   KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>ref|XP_006450136.1| hypothetical protein CICLE_v10010765mg [Citrus clementina]
 gb|ESR63376.1| hypothetical protein CICLE_v10010765mg [Citrus clementina]
Length=280

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            F++  +L  +PN   F+  L++T+L   IN R T+TVLAVDN  +G L+ +  D IK+++
Sbjct  29   FDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNIL  88

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            +VH++LDYYD+        KT+  TT+FQSTG A+ +QG++N T   G+  + GS+VKN+
Sbjct  89   SVHVILDYYDM-NKLKKLPKTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNS  147

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGV  541
            P  +  + +V  + ++IS+LQ+S  I+ PG+
Sbjct  148  PPVAKFVKSVFSQPFNISVLQVSQPIVAPGL  178



>ref|XP_010056276.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Eucalyptus 
grandis]
Length=425

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKSVM  814
            N+T +L+ +P ++ F+ YL++T+LA EINSR T+TVLA+DNG M AL+GK    VIK+ +
Sbjct  26   NITAILEGFPEYSLFSSYLSQTKLADEINSRQTITVLALDNGAMSALAGKKPLSVIKNEL  85

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            AVH+VLDY+D +K   + K +T  TTL+Q+TG A G  GF+N TD  G  V  G+A   +
Sbjct  86   AVHVVLDYFDPQKLHQIPKGSTLSTTLYQTTGNAPGNTGFVNITDLQGGKVGFGAAAPGS  145

Query  633  PQGSNLISAVAHEGYD  586
               S+   +V    Y+
Sbjct  146  KLDSSYTKSVKQIPYN  161



>gb|KHN16466.1| Fasciclin-like arabinogalactan protein 14 [Glycine soja]
Length=208

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 95/151 (63%), Gaps = 5/151 (3%)
 Frame = -2

Query  1032  LASFSIMVWSCGA---FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             L S ++++  C +    ++T +L +YP +  FN+YLTET+LA +INSR  VTVLA+D+  
Sbjct  8     LLSVALVLAFCSSIQGLDITKLLGEYPEYAQFNKYLTETKLADQINSRNAVTVLALDDAA  67

Query  861   MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
             M +LSGKS+D +K++++ H+++++YD KK    E   TK+ TLFQS+G+A   QG++   
Sbjct  68    MASLSGKSQDAVKAILSTHVLVNFYDEKKLMEAEGSRTKVETLFQSSGVAKPNQGYIYVA  127

Query  681   DTGGKTVMIGSAVK--NAPQGSNLISAVAHE  595
                   +  GSA    NAP    L+ +V  +
Sbjct  128   LINEGEIAFGSAAAAPNAPFEVVLVRSVTSQ  158



>ref|XP_011082039.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 3 [Sesamum indicum]
Length=266

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 14/189 (7%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             +  AFN+T ML++YP F+ FN  L++TR       R TVTVLA+  G +G LS K++DV 
Sbjct  20    TTSAFNITRMLEQYPEFSEFNGLLSKTR------RRRTVTVLALSAGHLGDLSSKTEDVQ  73

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K +++ H+VLDYYD  K   L+     LTTL+Q++G A  +QGF+N T      ++ GSA
Sbjct  74    KRILSNHVVLDYYDTTKLNKLKNGKAVLTTLYQASGTADDQQGFINVTHNTEGHIIFGSA  133

Query  645   VKNAPQGSNLISAVAHEGYDisilqissliIPPGVES----IAPKAAP-PSHQQHG---K  490
              K +   S L  AV  + Y+IS+L ISS II  G++     + P+AAP PS         
Sbjct  134   EKGSQMNSQLEGAVVAQPYNISVLSISSPIIANGIDGNRSPMPPQAAPSPSDAASSPTDD  193

Query  489   SPAAAPSPR  463
             +PA+A SP 
Sbjct  194   APASAESPE  202



>ref|XP_006491459.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like, partial 
[Citrus sinensis]
Length=459

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 103/169 (61%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F FL    + +    A N+T +L  +P ++ FN YLT+T+LA EINSR T+TVL + NG
Sbjct  45    VFLFLTLSLLAITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNG  104

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M  L+ K    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N
Sbjct  105   AMSDLTAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVN  164

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S    +V    Y++S+L+ISS II PG+
Sbjct  165   ITDLQGGKVGFGSAASGSKLDSTYTKSVKQIPYNVSVLEISSPIIAPGI  213



>dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             + S++       N+T +L  +P ++ FN YL++T+LA EINSR T+TVLA+ NG M  L+
Sbjct  2     TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLA  61

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGK  667
                  VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N TD  G 
Sbjct  62    KHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  666   TVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122   KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>ref|NP_566043.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
 sp|O22126.1|FLA8_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 8; Short=AtAGP8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB82617.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19815.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AAN31110.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AEC10559.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
Length=420

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 111/171 (65%), Gaps = 4/171 (2%)
 Frame = -2

Query  1041  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVD  871
             F  LA +FS++ +  +  + N+T +L   P++++FN YL++T+LA EINSR T+TVL ++
Sbjct  7     FSLLAFTFSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLN  66

Query  870   NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
             NG M AL+GK    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF
Sbjct  67    NGAMSALAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV
Sbjct  127   VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>gb|AAM66074.1| endosperm-specific protein-like protein [Arabidopsis thaliana]
Length=420

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 111/171 (65%), Gaps = 4/171 (2%)
 Frame = -2

Query  1041  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVD  871
             F  LA +FS++ +  +  + N+T +L   P++++FN YL++T+LA EINSR T+TVL ++
Sbjct  7     FSLLAFTFSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLN  66

Query  870   NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
             NG M AL+GK    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF
Sbjct  67    NGAMSALAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV
Sbjct  127   VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus 
euphratica]
Length=421

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 107/169 (63%), Gaps = 2/169 (1%)
 Frame = -2

Query  1011  VWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK-  835
             V +  A N+T +L  +P ++ FN+YLT+T+LA EIN+R T+TVLA++NG M AL+ K   
Sbjct  18    VSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAMTALAAKHPL  77

Query  834   DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMI  655
              VIK+ +++ +VLDYYD  K   + K TT  TTL+Q+TG A G  GF+N TD  G  V  
Sbjct  78    SVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGF  137

Query  654   GSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPS  508
             GSA   +   S+   +V    Y+ISIL+IS  II PG+ + AP   P S
Sbjct  138   GSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGILT-APAPTPSS  185



>dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             + S++       N+T +L  +P ++ FN YL++T+LA EINSR T+TVLA+ NG M  L+
Sbjct  2     TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTLTVLALPNGAMSDLA  61

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGK  667
                  VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N TD  G 
Sbjct  62    KHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  666   TVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122   KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea 
aurea]
Length=400

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDVIKS  820
            A N+T +LD YP +++FN  LT+T+LA EI+SR  VTVLA+ N  + ++SGK    V+KS
Sbjct  1    ATNITKILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSELSSISGKYPLGVVKS  60

Query  819  VMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVK  640
            V+++H++LDY+D  K   +   +   TTL Q+TG A+G  GF+N TD  G  V  GS + 
Sbjct  61   VLSLHVLLDYFDAAKLHKISDGSVLSTTLLQTTGNAAGNVGFVNITDLRGGKVGFGSGIA  120

Query  639  NAPQGSNLISAVAHEGYD  586
             +P  S    +V    Y+
Sbjct  121  GSPLDSTFTKSVQQIPYN  138



>ref|XP_008460132.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis 
melo]
Length=423

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -2

Query  1002  CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDVI  826
               A N+T ML  YP ++ F+ YL +TRLA EINSR T+TVL V NG +  +  K    VI
Sbjct  20    VSAHNITDMLKDYPQYSVFSNYLQQTRLADEINSRQTITVLVVSNGALSPILDKHPLSVI  79

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA  646
             K+++++HIVLDYYD  K   +   TT  TTL+Q+TG A G  GF+N TD  G  V  GSA
Sbjct  80    KNILSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVAFGSA  139

Query  645   VKNAPQGSNLISAVAHEGYD  586
             V  +   S+   +V    Y+
Sbjct  140   VPGSKLESSYTKSVVSMPYN  159



>ref|XP_006352538.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=415

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  829
             +  A N+T +L KYP F+ FN YLTET LA EINSR T+TV AVDN GM  L  K   + 
Sbjct  24    TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMAELLSKHLSIY  83

Query  828   -IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
              IK+V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  84    TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  651   SAVKNAPQGSNLISAVAHEGYD  586
              A  +    +  + +V    Y+
Sbjct  144   PAENHGTLPATFVKSVEEIPYN  165



>emb|CDP17792.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDV  829
             S  A N+T +L  +P ++ +N++LT+T+LA EINSR T+TVL + N  M +L+ K    V
Sbjct  59    SIYAHNITEILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAMDSLAAKHPLSV  118

Query  828   IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGS  649
             +K  +++H+VLDYYD  K   +   TT  TTL+Q+TG A G QGF+N TD  G  V  GS
Sbjct  119   VKKALSLHVVLDYYDAGKLHDISNGTTLSTTLYQTTGNAPGNQGFVNITDLKGGKVGFGS  178

Query  648   AVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             AV  +   S    +V    Y+IS+++IS+ II PGV
Sbjct  179   AVPGSKLDSTYTKSVKQIPYNISVIEISAPIIAPGV  214



>ref|XP_009767783.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=416

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 82/139 (59%), Gaps = 2/139 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+T +L KYP F+ FN YLTET LA EIN+R T+TV AVDN GM  L  K   +  IK
Sbjct  27   AHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIK  86

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVAFGPAE  146

Query  642  KNAPQGSNLISAVAHEGYD  586
             +    +  + AV    Y+
Sbjct  147  NHGNLPATFVKAVEEIPYN  165



>dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             + S++       N+T +L  +P ++ FN YL++T+LA EINSR T+TVLA+ NG M  L+
Sbjct  2     TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLA  61

Query  846   GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGK  667
                  VIK+ +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N TD  G 
Sbjct  62    KHPLSVIKNALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  666   TVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122   KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>ref|XP_002882015.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58274.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 114/180 (63%), Gaps = 5/180 (3%)
 Frame = -2

Query  1041  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVD  871
             F  LA +FS++    +  + N+T +L   P++++FN YL++T+LA EINSR T+TVL ++
Sbjct  7     FSLLAFTFSLLAVASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLN  66

Query  870   NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
             NG M AL+GK    VIKS +++ ++LDYYD  K   + K TT  TTL+Q+TG A G  GF
Sbjct  67    NGAMSALAGKHPLSVIKSALSLLVLLDYYDPLKLHKISKGTTLSTTLYQTTGNAPGNLGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
             +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PG+ +  AP AA
Sbjct  127   VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGILTAPAPSAA  186



>ref|XP_009615606.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 82/139 (59%), Gaps = 2/139 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+T +L KYP F+ FN YLTET LA EIN+R T+TV AVDN GM  L  K   +  IK
Sbjct  27   AHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIK  86

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAE  146

Query  642  KNAPQGSNLISAVAHEGYD  586
             +    +  + AV    Y+
Sbjct  147  NHGNLPATFVKAVEEIPYN  165



>ref|XP_007052018.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
 gb|EOX96175.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
Length=425

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  1038  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
              FL + S++  +  A N+T +L+ +P+++ +N +L++T+LA EINSR T+T L + NG M
Sbjct  9     LFLFTLSLVAITAHAHNITAILEGFPDYSVYNSFLSQTKLADEINSRETITCLVLSNGAM  68

Query  858   GALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNAT  682
              AL+ K    VIK+++++H++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N T
Sbjct  69    SALTAKHPLSVIKNILSLHVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNIT  128

Query  681   DTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             D  G  V  GSA+  +   S+   +V    Y+ISI++IS+ II PG+
Sbjct  129   DLQGGKVAFGSAIPGSKLDSSYTKSVKQIPYNISIIEISAPIIAPGI  175



>ref|XP_004248342.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=415

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 76/122 (62%), Gaps = 2/122 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  829
             +  A N+T +L KYP F+ FN YLTET LA EINSR T+TV AVDN GM  L  K   + 
Sbjct  24    TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMEELLSKHLSIY  83

Query  828   -IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
              IK+V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  84    TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  651   SA  646
              A
Sbjct  144   PA  145



>ref|XP_009363600.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=291

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 115/189 (61%), Gaps = 16/189 (8%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             +  AFN+T +L+K  +F+NFN  L+ET+LA EIN R T+TVLAVDNGG+G LSG S D+ 
Sbjct  20    TSSAFNITKILEKQSDFSNFNSLLSETKLANEINKRKTITVLAVDNGGVGGLSGGSSDLT  79

Query  825   KSVMAVHIVLDYYDVkkftt--lekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
             K +++VH+VLDYYD  K        K+  LTT+FQSTG A  +QGF+  +      +   
Sbjct  80    KKILSVHVVLDYYDTDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVS-VKDNHISFA  138

Query  651   SAVKNAPQGS---NLISAVAHEGYDisilqissliIPPGVESI--APKAAPPSHQQHGKS  487
             SA K    G    NL+ +V  + Y+IS+LQ+ S+I  P +E+   +P  +P S       
Sbjct  139   SAYKGNNNGGNHVNLVKSVVSQPYNISVLQVGSIIDVPDIENTDSSPAQSPKS-------  191

Query  486   PAAAPSPRK  460
              A AP+P K
Sbjct  192   -AKAPTPSK  199



>ref|XP_006296250.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
 gb|EOA29148.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
Length=420

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = -2

Query  1041  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVD  871
             F  LA +FS++ +  +  + N+T +L   P++++FN YLT+T+LA EINSR T+TVL ++
Sbjct  7     FSLLAFAFSLLAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLN  66

Query  870   NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
             NG M +L+GK    VIK  +++ ++LDYYD +K   L K TT  TTL+Q+TG A G  GF
Sbjct  67    NGAMSSLAGKHPLSVIKGALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
             +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV +  AP AA
Sbjct  127   VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAA  186



>emb|CDY28643.1| BnaC09g32320D [Brassica napus]
Length=423

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 88/147 (60%), Gaps = 8/147 (5%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             I + L    ++     A NVT +L  +P+F++FN +LT+T LAGEIN R T+TVLAVDN 
Sbjct  10    ISYILPIILLLAVETHAHNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNA  69

Query  864   GMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
              M AL+ K   +  IK+++++H++LDY+  KK   +   +    TLFQ+TG A G  GF+
Sbjct  70    AMSALTSKGYPISTIKNILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFV  129

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLIS  610
             N TD  G  V +G      P G +L S
Sbjct  130   NITDLRGGKVGLG------PDGGDLSS  150



>ref|XP_010243936.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=408

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 2/143 (1%)
 Frame = -2

Query  1008  WSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV  829
              + GA N+T +L K+P F+ FN YLT T LA EIN R T+TV AVDN GM  L  K   +
Sbjct  22    CTTGAHNITRILAKHPEFSTFNHYLTVTHLAAEINRRETITVCAVDNAGMSELLSKHLSI  81

Query  828   --IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMI  655
               IK+V+++HI+LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  
Sbjct  82    YAIKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGF  141

Query  654   GSAVKNAPQGSNLISAVAHEGYD  586
             G+   +    S  + ++    Y+
Sbjct  142   GAEANDGKIDSTFVKSIQEIPYN  164



>ref|XP_004244059.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=411

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 83/145 (57%), Gaps = 2/145 (1%)
 Frame = -2

Query  1014  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK  835
              + +  A N+T +L  +  F+ FN YLT T LA EIN R T+TV AVDN GM  L  K  
Sbjct  19    FICATEAHNITHILADHKQFSTFNHYLTTTHLAAEINRRQTITVCAVDNAGMSDLLSKQL  78

Query  834   DV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTV  661
              +  IK+V++ H++LDY+D KK   +   T    T+FQ+TG A+G  GF+N TD  G  V
Sbjct  79    SIYTIKNVLSFHVLLDYFDAKKLHQITNGTALAATMFQATGSATGSSGFVNITDLRGGKV  138

Query  660   MIGSAVKNAPQGSNLISAVAHEGYD  586
              +  A  N P  +  + ++A   Y+
Sbjct  139   GLSPADYNGPPPAKFVKSIAEIPYN  163



>ref|XP_010435371.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 110/185 (59%), Gaps = 11/185 (6%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAF-------NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTV  883
             F+ +A+  ++++    F       N+T +L K P+F+ FN YL+ T LA EIN R T+TV
Sbjct  24    FWGVATILVLIFQLHLFFSLSSAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITV  83

Query  882   LAVDNGGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMAS  709
             LAVDN  M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+
Sbjct  84    LAVDNSAMSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSAT  143

Query  708   GEQGFLNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIA  529
             G  G++N TDT G  V  G    ++   ++ + ++  + Y+IS+L IS ++  P  E  A
Sbjct  144   GTSGYVNITDTKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--A  201

Query  528   PKAAP  514
             P A+P
Sbjct  202   PTASP  206



>ref|XP_009802278.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=415

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 103/173 (60%), Gaps = 4/173 (2%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             S ++++ +  A ++T +L K+P F+ FN YLT T LA EIN R T+TV AVDN GM  L 
Sbjct  15    SLALLLCATEAHDITRILAKHPQFSTFNHYLTTTHLANEINRRQTITVFAVDNAGMSDLL  74

Query  846   GKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTG  673
              K   +  +K+V++ H++LDY+  KK   +   T    T+FQ+TG ASG  GF+N T+  
Sbjct  75    SKHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNVK  134

Query  672   GKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             G  V+   A  + P  +  + +V    Y+IS++QIS+++  P  E+ AP   P
Sbjct  135   GGKVVFSPADYDGPPPAKFVKSVEEIPYNISVIQISTIL--PSAEAEAPTPGP  185



>ref|XP_006858016.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
 gb|ERN19483.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
Length=421

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 98/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A N+T ML  +P+++ +N YLT+T+L  EIN+R T+TV  ++N  M AL+     V+K+V
Sbjct  24   AHNITEMLSAFPDYSLYNSYLTQTKLCDEINTRQTLTVFVLNNAAMSALAKHPLSVVKNV  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++ IVLDY+D +K  ++   +   TTL+Q+TG A G  GF+N TD  G  V  GSA   
Sbjct  84   LSLLIVLDYFDNQKLHSITDGSMLSTTLYQTTGDAKGNFGFVNITDLKGGKVGFGSAAPG  143

Query  636  APQGSNLISAVAHEGYDisilqissliIPPGVES  535
            +P  S    +V    Y+IS+++IS+ II PG+ S
Sbjct  144  SPLDSTYTKSVKQVPYNISVMEISAPIIAPGLLS  177



>ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
 gb|ESQ56466.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
Length=405

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (59%), Gaps = 8/180 (4%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             +IF F   FS+      A N+T +L K P+F+ FN YLT T LA EIN R T+TVLAVDN
Sbjct  13    LIFQFHLLFSL----SNAHNITKILAKDPDFSTFNHYLTATHLADEINRRQTITVLAVDN  68

Query  867   GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M ++   G S   I++++++H+++DY+  KK   +   TT   ++FQSTG A+G  G+
Sbjct  69    SAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGTTSTASMFQSTGSATGTSGY  128

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             +N TD  G  V  G    ++   +  + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  129   VNITDIKGGKVAFGVQDDDSKLTAQYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  186



>ref|XP_009625162.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=415

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 103/173 (60%), Gaps = 4/173 (2%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             S ++++ +  A N+T +L K+P F+ FN YLT T LA EIN R T+T+ AVDN GM  L 
Sbjct  15    SLALLLCATEAHNITRILAKHPQFSTFNHYLTTTHLAYEINRRQTITICAVDNAGMSDLL  74

Query  846   GKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTG  673
              K   +  +K+V++ H++LDY+  KK   +   T    T+FQ+TG ASG  GF+N T+  
Sbjct  75    SKHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNLK  134

Query  672   GKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             G  V+   A  + P  +  + +V    Y+IS++QIS+++  P  E+ AP   P
Sbjct  135   GGKVVFSPADYDGPPPAKFVKSVEEIPYNISVIQISTIL--PSAEAEAPTPGP  185



>emb|CDX76814.1| BnaC08g34000D [Brassica napus]
Length=280

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T  L+ YP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALENYPEFSTMIELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNILM  85

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
             H+VLDYYD  K   L+ K+T LTTL+QSTG+   + GFLN +   GK ++ GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKANGK-IVFGSAVKGAP  144

Query  630  QGSNLISAVAHEGYDisilqissliIPPGV  541
              +  I+ V    +++S++QIS  I+ PG+
Sbjct  145  LTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>emb|CDY34771.1| BnaA09g41380D [Brassica napus]
Length=280

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T  L+ YP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALENYPEFSTMIELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNILM  85

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
             H+VLDYYD  K   L+ K+T LTTL+QSTG+   + GFLN +   GK ++ GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKANGK-IVFGSAVKGAP  144

Query  630  QGSNLISAVAHEGYDisilqissliIPPGV  541
              +  I+ V    +++S++QIS  I+ PG+
Sbjct  145  LTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_011095539.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=415

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+T +LDKYP+F+ FN YLT T+LA EIN R T+TV AVDN  M  L  K  ++  IK
Sbjct  28   AHNITRILDKYPDFSTFNHYLTLTQLAPEINRRETITVCAVDNARMSDLLSKHLNIGAIK  87

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTV  661
            +V+++H++LDY+D KK   +   T    T+FQ+TG A G  GF+N TD  G  V
Sbjct  88   NVLSLHVLLDYFDSKKLHQITDGTALAATMFQATGSAPGSAGFVNITDLKGGKV  141



>emb|CAN65447.1| hypothetical protein VITISV_011425 [Vitis vinifera]
Length=416

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +   + + S +  S  A N+T ML  +P ++ +N YL++T+LA EINSR T+T L ++N 
Sbjct  4     LHLLVXALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNA  63

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M AL+GK    VIK  + + +VLDYYD KK   +   TT  TTL+Q+TG A G  GF+N
Sbjct  64    AMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVN  123

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S+   +V    Y+IS+L+IS+ II PG+
Sbjct  124   ITDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_009117125.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=280

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  811
            N+T  L+ YP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALENYPEFSTMIELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNILM  85

Query  810  VHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNAP  631
             H+VLDYYD  K   L+ K+T LTTL+QSTG+   + GFLN +   GK ++ GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKANGK-IVFGSAVKGAP  144

Query  630  QGSNLISAVAHEGYDisilqissliIPPGV  541
              +  I+ V    +++S++QIS  I+ PG+
Sbjct  145  LTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_004144998.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004153890.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004160662.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 gb|KGN46232.1| hypothetical protein Csa_6G076800 [Cucumis sativus]
Length=423

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 93/155 (60%), Gaps = 4/155 (3%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++F  +A+ + +V    A N+T ML  +P ++ F+ YL +TRLA EINSR T+TVL V N
Sbjct  8     LLFLAIAATAAIV---SAHNITDMLKDFPQYSVFSNYLQQTRLADEINSRQTITVLVVAN  64

Query  867   GGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
             G +  +  K    VIK+++++HIVLDYYD  K   +   TT  TTL+Q+TG A G  GF+
Sbjct  65    GALSPILDKHPLSVIKNLLSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFV  124

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             N TD  G  V  GSAV  +   S+   +V    Y+
Sbjct  125   NITDLQGGKVGFGSAVPGSKLESSYTKSVVSLPYN  159



>emb|CDP12467.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = -2

Query  1026  SFSIMVWSC---------GAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAV  874
             S S++  SC          AFN+T +L   P+F+NFN  L++  L   INS+  VT+LA+
Sbjct  7     STSLIFLSCLLLASSVTTAAFNITAILGDIPSFSNFNDLLSKAGLVKAINSQSPVTILAI  66

Query  873   DNGGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
              N  +G L+GK  DVIK  +  H+VLDYYD+       K  T++TTLFQ TG+A+ +QGF
Sbjct  67    PNEHIGDLAGKPADVIKITLMTHVVLDYYDL-LKLANAKNGTRMTTLFQKTGVATYDQGF  125

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVE  538
             L    + G+ ++  SA K AP    +++ V    ++ SI+ +SS I+ PGV+
Sbjct  126   LILNRSHGQ-LIFSSAAKGAPHNVQVVATVTQHPFNYSIISVSSAIMTPGVD  176



>ref|XP_004306902.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Fragaria 
vesca subsp. vesca]
Length=421

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKSVM  814
            N+T +L+  P ++ +N +LT+TRLA EIN+R TVTVL + NG M +L+ K    VIK+ +
Sbjct  24   NITAILEATPEYSQYNSFLTQTRLADEINTRTTVTVLVLTNGVMSSLAAKHPLSVIKNAL  83

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++HI+LDYYD  K   +   +   TTL+Q+TG A G  GF+N TD  G  V  GSA   +
Sbjct  84   SLHILLDYYDPAKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLSGGKVGFGSAAPGS  143

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGV  541
               S+   +V    Y+IS+L+IS+ ++ PG+
Sbjct  144  KLDSSYTKSVKQIPYNISVLEISAPVLAPGI  174



>ref|XP_010526275.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Tarenaya 
hassleriana]
Length=282

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 108/170 (64%), Gaps = 4/170 (2%)
 Frame = -2

Query  1035  FLASFSIMVWS---CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             FL    ++V+S     A N+T +L+KYPNF+  N   T T L   IN R T+T+LAVDN 
Sbjct  13    FLLLAILIVFSSTTISAVNITRVLEKYPNFSTMNDLFTRTGLNVPINKRQTITILAVDND  72

Query  864   GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
              MG++SG+ ++ IK+++  H+VLDYYD  K   L+ ++T LTTL+Q+TG+   + GFLN 
Sbjct  73    AMGSISGRPEEEIKNILMNHVVLDYYDEIKLKGLKDRSTLLTTLYQTTGLGQQQNGFLNC  132

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVES  535
             T   GK +  GS VK +P  +  ++ V    +++S++QIS  I+ PG+ S
Sbjct  133   TKMNGK-IFFGSGVKGSPLNAQYVNPVFQNPFNLSVVQISMPIVAPGLGS  181



>emb|CDX68507.1| BnaC01g25850D [Brassica napus]
Length=401

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 105/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             II F L S S       A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN
Sbjct  13    IIMFQLLSLS------NAHNITKILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDN  66

Query  867   GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G+
Sbjct  67    SAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGY  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             +N TD  G  V  G    ++   +  I ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  127   VNITDIKGGKVAFGVQDDDSQLTARYIKSIFEKAYNISVLHISQVLTSPEAE--APTASP  184



>ref|XP_002270426.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Vitis vinifera]
Length=416

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +   + + S +  S  A N+T ML  +P ++ +N YL++T+LA EINSR T+T L ++N 
Sbjct  4     LHLLVLALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNA  63

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M AL+GK    VIK  + + +VLDYYD KK   +   TT  TTL+Q+TG A G  GF+N
Sbjct  64    AMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVN  123

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S+   +V    Y+IS+L+IS+ II PG+
Sbjct  124   ITDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>gb|AIY35292.1| fasciclin-like arabinogalactan 12 [Gossypium hirsutum]
Length=415

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 113/172 (66%), Gaps = 2/172 (1%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             + S++  +  A N+T +L+ +P+++ +N +LT+T+LA EIN+R T+T L ++NG M AL+
Sbjct  15    TLSLLAVAVNAHNITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALT  74

Query  846   GKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGG  670
              K    V+K+++++H++LDYYD +K   +   TT  TTL+Q+TG A G  GF+N TD  G
Sbjct  75    AKHPLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQG  134

Query  669   KTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
               V  GSAV  +   S+   +V    Y+ISIL+IS+ II PGV S  AP A+
Sbjct  135   GKVGFGSAVPGSKLDSSYTKSVKQVPYNISILEISAPIIAPGVLSAPAPSAS  186



>ref|XP_010692313.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
              FF  S  I+     A N+T +L   PN + FN YLT+T+L  EINSR T+TVLA+DN  
Sbjct  5     LFFTFSLLILFTISYAHNITEILSSDPNLSQFNSYLTQTKLDDEINSRQTITVLALDNSA  64

Query  861   MGAL-SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
             M +L S  S  VIK+++++H++LDYYD KK  +LE  T K TTL+Q+TG A+ ++G +N 
Sbjct  65    MSSLTSNHSLSVIKNLLSLHVLLDYYDPKKLHSLENGTVKTTTLYQTTGSATSDEGSVNI  124

Query  684   TD  679
             TD
Sbjct  125   TD  126



>ref|XP_009151619.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
 emb|CDX83056.1| BnaA01g20560D [Brassica napus]
Length=401

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 105/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             II F L S S       A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN
Sbjct  13    IIMFQLLSLS------NAHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDN  66

Query  867   GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G+
Sbjct  67    SAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGY  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             +N TD  G  V  G    ++   +  I ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  127   VNITDIKGGKVAFGVQDDDSQLTARYIKSIFEKAYNISVLHISQVLTSPEAE--APTASP  184



>ref|XP_009104281.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=424

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = -2

Query  1014  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK  835
             ++++    N+T +L + P +++FN YL++T+L  EINSR T+T+L ++N  M +L+GK  
Sbjct  19    VIYTVSGHNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKHP  78

Query  834   -DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVM  658
               V+K+ +++ ++LDYYD  K   + + TT  TTL+Q+TG A+G  GF+N TD  G  V 
Sbjct  79    LSVVKTALSLLVLLDYYDPLKLHKISQGTTLPTTLYQTTGRAAGNLGFVNVTDLKGGKVG  138

Query  657   IGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              GSA   +  G+N   +V    Y+IS+L+I++ II PG+
Sbjct  139   FGSAAPGSKLGANYTKSVKQIPYNISVLEINAPIIAPGI  177



>ref|XP_010496525.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 106/179 (59%), Gaps = 13/179 (7%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             IFF L+S         A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN 
Sbjct  39    IFFSLSS---------AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNS  89

Query  864   GMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
              M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+G  G++
Sbjct  90    AMSSILSRGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYV  149

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             N TD  G  V  G    ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  150   NITDIKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  206



>ref|XP_003523715.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=232

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 98/162 (60%), Gaps = 2/162 (1%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
             ++T +L +YP +  FN+YLTET+LA +INS   VTVLA+D+  M +LS K +D +K+++
Sbjct  25   LDITKLLGQYPEYAQFNKYLTETKLADQINSLNAVTVLALDDAAMASLSAKPQDAVKAIL  84

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVK--  640
            + H+++++YD KK    E    K+ TLFQS+G+A   QG++         +  GSA    
Sbjct  85   STHVLVNFYDEKKLMEAEGSRAKVETLFQSSGVAKPNQGYIYVALINEGEIAFGSAAAAP  144

Query  639  NAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
            NAP    L+ +V  +    SILQ+S  I+ PGVES A    P
Sbjct  145  NAPFEVVLVRSVTSQPDAASILQVSKPIVAPGVESAASATVP  186



>ref|XP_009146602.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=270

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG-KSKDV  829
             S  +FN+T +L++   F+ FN  L++T LA  INSR T+TVLA+ N  M   S  +S + 
Sbjct  21    SSNSFNITNILNQNNEFSIFNNLLSQTGLASTINSRQTITVLALSNDAMSFFSTIQSIEE  80

Query  828   IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGS  649
              K  +++H+VLDYYD+KKF ++ KK+  LTTLFQSTG A G QGF+N T      VM GS
Sbjct  81    NKIRLSLHVVLDYYDIKKFRSMNKKSVILTTLFQSTGQAKGLQGFINTTIMNNGDVMFGS  140

Query  648   AVKNAPQGSNLISAVAHEGYD  586
             AV  +   S LI +VA   Y+
Sbjct  141   AVPGSGIYSKLIDSVATHPYN  161



>dbj|BAJ34929.1| fasciclin-like arabinogalactan protein [Vitis hybrid cultivar]
Length=416

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +   + + S +  S  A N+T ML  +P ++ +N YL++T+LA EINSR T+T L ++N 
Sbjct  4     LHLLVFALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNA  63

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M AL+GK    VIK  + + +VLDYYD KK   +   TT  TTL+Q+TG A G  GF+N
Sbjct  64    AMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVN  123

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S+   +V    Y+IS+L+IS+ II PG+
Sbjct  124   ITDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 ref|XP_004167979.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 gb|KGN43405.1| hypothetical protein Csa_7G031660 [Cucumis sativus]
Length=418

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 102/168 (61%), Gaps = 4/168 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  829
             S  A N+T +L K+P F+ FN YLT T LAGEIN R T+TVLA+DN  M AL  K   V 
Sbjct  24    SADAHNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSVG  83

Query  828   -IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
              IK+V+++H+++DYY  KK   L K TT  +TLFQ+TG A+G  G++N T+  G  V  G
Sbjct  84    TIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGFG  143

Query  651   SAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPS  508
             S        S  + +V    Y+ISILQIS +I     E  AP AAP S
Sbjct  144   SEDNGGDLNSFYVKSVVEMPYNISILQISKVITSADAE--APTAAPVS  189



>ref|XP_006397729.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
 gb|ESQ39182.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
Length=418

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 106/169 (63%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +  F+ S   + ++    N+T +L   P +++FN YL++T+LA EINSR T+T+L ++NG
Sbjct  9     LLAFVFSLLAVAFTVRGHNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNG  68

Query  864   GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M +L+GK    VIK+ +++ ++LDYYD +K   + K TT  TTL+Q+TG A G  GF+N
Sbjct  69    AMSSLAGKHPLSVIKNALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVN  128

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S+   +V    Y+IS+L+I + II PGV
Sbjct  129   ITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIIAPGV  177



>gb|KFK32403.1| hypothetical protein AALP_AA6G237100 [Arabis alpina]
Length=397

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++  FL S S       A N+T +L K P F+ FN YLT T LA EIN R T+TVLAVDN
Sbjct  11    LVLTFLFSLS------NAHNITKILAKDPEFSTFNHYLTATHLADEINRRQTITVLAVDN  64

Query  867   GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G+
Sbjct  65    SAMSSILSKGYSLYTIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGY  124

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             +N TD  G  V  G    ++   +  + ++  + Y+IS++ IS ++  P  E  AP A+P
Sbjct  125   VNITDIKGGKVAFGVQDDDSELTARYVKSIFEKAYNISVVHISQVLTSPEAE--APTASP  182



>ref|XP_009120095.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
 emb|CDY17354.1| BnaA10g09880D [Brassica napus]
Length=426

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 8/131 (6%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A NVT +L  +P+F++FN +LT+T LAGEIN R T+TVLAVDN  M AL+ K   +  +K
Sbjct  27   AHNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNAAMSALTSKGYPISTVK  86

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H++LDY+  KK   +   +    TLFQ+TG A G  GF+N TD  G  V +G   
Sbjct  87   NILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGLG---  143

Query  642  KNAPQGSNLIS  610
               P G +L S
Sbjct  144  ---PDGGDLSS  151



>ref|XP_008462050.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Cucumis 
melo]
Length=421

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 102/168 (61%), Gaps = 4/168 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  829
             S  A N+T +L K+P F+ FN YLT T LAGEIN R T+TVLA+DN  M AL  K   V 
Sbjct  27    SADAHNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSVG  86

Query  828   -IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
              IK+V+++H+++DYY  KK   L K TT  +TLFQ+TG A+G  G++N T+  G  V  G
Sbjct  87    TIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGFG  146

Query  651   SAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPS  508
             S        S  + +V    Y+ISILQIS +I     E  AP AAP S
Sbjct  147   SEDNGGDLNSFYVKSVVEMPYNISILQISKVITSADAE--APTAAPVS  192



>ref|XP_010479980.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 105/179 (59%), Gaps = 13/179 (7%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +FF L+S         A N+T +L K P F+ FN YL+ T LA EIN R T+TVLAVDN 
Sbjct  39    LFFSLSS---------AHNITRILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNS  89

Query  864   GMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
              M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+G  G++
Sbjct  90    AMSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYV  149

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             N TD  G  V  G    ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  150   NITDIKGGKVAFGVQEDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  206



>ref|XP_010438048.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=286

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 100/161 (62%), Gaps = 3/161 (2%)
 Frame = -2

Query  1017  IMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG  844
             ++V+S    A N+T   +KY NF+  +   T+T+L   I+   T+TVLAV N  + +++ 
Sbjct  15    LLVFSKVVAADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSNDAISSITN  74

Query  843   KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKT  664
             +S   +K+++  H++LDYYD  K   + +K+  LTTL+Q+TG+     GFLN T   G+ 
Sbjct  75    RSDVELKNILMTHVILDYYDELKLQAMREKSIMLTTLYQTTGLGEEMNGFLNVTKMEGR-  133

Query  663   VMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             V  GSAVKN+P  +  +S V H  Y++SI++IS  I+ PG+
Sbjct  134   VYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
 gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
Length=399

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSC----GAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLA  877
             +F  LA F + ++S      A N+T +L K+P F+ FN YLT T LA EIN R T+TVLA
Sbjct  8     LFPSLALFILFIFSSSTTSNAHNITRILAKHPEFSTFNHYLTTTHLASEINRRQTITVLA  67

Query  876   VDNGGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGE  703
             +DN  M AL  K   +  +K+V+++H+++DY+  KK   +   T   +T+FQ+TG A G 
Sbjct  68    LDNAAMSALLDKQLSLYTVKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQATGAAPGS  127

Query  702   QGFLNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
              G++N TD  G  V  G+   N    +  + +VA   Y+
Sbjct  128   SGYINITDLKGGKVGFGAEDNNGKLDAVYVKSVAEIPYN  166



>ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
 gb|EOA18968.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
Length=402

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 104/179 (58%), Gaps = 4/179 (2%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +   +    ++     A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN 
Sbjct  10    VLALIVQLHLLSSLSNAHNITRILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDNS  69

Query  864   GMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
              M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+G  G++
Sbjct  70    AMSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYV  129

Query  690   NATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             N TD  G  V  G    ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  130   NITDIKGGKVAFGVQEDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  186



>emb|CDX73808.1| BnaA03g32390D [Brassica napus]
Length=249

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            +FN+TT+L +  +F+ FN+ L++T LA  INSR T+TVLA+ N  +     +S +  K V
Sbjct  24   SFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALANDAVYLFGDQSMEDNKVV  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++HI+LDYYD+KK  +L KKT  LTTLFQ +G A G+QGF+N T      +  GSAV  
Sbjct  84   LSLHIILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVNVTVKDNGDIAFGSAVPG  143

Query  636  APQGSNLISAVAHEGYD  586
            +   S +I +VA E ++
Sbjct  144  SLLDSQVIDSVASEPFN  160



>ref|XP_004305460.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=274

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 115/187 (61%), Gaps = 8/187 (4%)
 Frame = -2

Query  1011  VWSCG-AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK  835
             ++SC  AFN+T ML  Y +F+ FN YLT T +A +IN R ++T+  VDNG MG+++ KS 
Sbjct  15    LFSCSYAFNITQMLSNYKDFSTFNDYLTRTTVADQINKRESLTIFVVDNGAMGSVTKKSL  74

Query  834   DVIKSVMAVHIVLDYYDVkkfttl-ekkttklttlFQSTGMASGEQGFLNAT---DTGGK  667
             D+   ++++H+ L+Y+D KK   L   + T +TTL Q+ G  +G+QGFL AT   ++ G 
Sbjct  75    DMASKILSLHVALEYFDTKKLQQLPTNEPTLMTTLLQANGQPTGQQGFLKATIGGNSSGG  134

Query  666   TVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKS  487
               +  S   ++ Q ++++ +V  + Y+IS++QIS+ I+P     I+P  A P+      S
Sbjct  135   GGVSISLASSSDQSASVVQSVTSQPYNISVIQISNAIVP---NIISPPTAAPTKMPSSPS  191

Query  486   PAAAPSP  466
              + A SP
Sbjct  192   ESPADSP  198



>ref|XP_009135245.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=263

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            +FN+TT+L +  +F+ FN+ L++T LA  INSR T+TVLA+ N  +     +S +  K V
Sbjct  24   SFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALANDAVYLFGDQSMEDNKVV  83

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKN  637
            +++HI+LDYYD+KK  +L KKT  LTTLFQ +G A G+QGF+N T      +  GSAV  
Sbjct  84   LSLHIILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVNVTVKDNGDIAFGSAVPG  143

Query  636  APQGSNLISAVAHEGYD  586
            +   S +I +VA E ++
Sbjct  144  SLLDSQVIDSVASEPFN  160



>ref|XP_011097758.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=416

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 79/130 (61%), Gaps = 2/130 (2%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +     S  ++  +  A N+T +L K+P F+ FN YLT T+LA EIN R T+TV AVDN 
Sbjct  11    VVVLCISLFLLPSTSDAHNITRILAKFPEFSTFNHYLTVTQLAPEINRRETITVCAVDNA  70

Query  864   GMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFL  691
             GM  L  K   +  +K+V+++H++LDY+D KK   +   T    T+FQ+TG A+G  GF+
Sbjct  71    GMADLLSKHLTLGALKNVLSLHVLLDYFDAKKLHEITDGTALAATMFQATGSATGSSGFV  130

Query  690   NATDTGGKTV  661
             N TD  G  V
Sbjct  131   NITDLKGGKV  140



>ref|XP_008232692.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
 ref|XP_008232693.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
Length=425

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKS  820
            A N+T +L  +P ++ +N +LT+TRLA EIN+R T+T+L ++N  + AL+ K    V+K+
Sbjct  23   AHNITAILSAFPEYSQYNSFLTQTRLADEINTRQTITILVLNNAAISALAAKHPLSVVKN  82

Query  819  VMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVK  640
             +++H++LDYYD  K   + K +T  TTL+Q+TG A G  GF+N TD  G  V  GSA  
Sbjct  83   ALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAP  142

Query  639  NAPQGSNLISAVAHEGYD  586
             +   S+   +V    Y+
Sbjct  143  GSKLDSSYTKSVKQIPYN  160



>gb|AGN92424.2| putative fasciclin-like arabinogalactan protein 4, partial [Centaurium 
erythraea]
Length=328

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = -2

Query  1035  FLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMG  856
             FL   S+  +S  A N+T +L KY +++ FN+YL+ET+L GEINSR T+TVL ++NG M 
Sbjct  7     FLCFLSLFAFS-NAHNITDILSKYSDYSEFNKYLSETKLDGEINSRQTITVLVLNNGAMD  65

Query  855   ALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             +L+GK    VIK  +++ ++LDY+D  K   L   TT  TTL+Q+TG A G+ G +N TD
Sbjct  66    SLAGKHPLSVIKKALSLLVLLDYFDGAKLHQLSDGTTLTTTLYQTTGNADGDLGHVNITD  125

Query  678   TGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
               G  V +GSA   +   S    +V    Y+IS+L+IS+ II PG+
Sbjct  126   LKGGKVGLGSAAPGSKLDSTYTKSVEQIKYNISVLEISAPIIAPGL  171



>gb|ABV27484.1| fasciclin-like arabinogalactan protein 13 [Gossypium hirsutum]
Length=425

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 108/163 (66%), Gaps = 1/163 (1%)
 Frame = -2

Query  1026  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALS  847
             + S++V +    N+T +L+ +P+++ +N +LT+T+LA EIN+R T+T L ++NG M AL+
Sbjct  13    TLSLVVIAVNGHNITAILEGFPDYSVYNSFLTQTKLADEINTRETITCLVLNNGAMSALT  72

Query  846   GKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGG  670
              K    V+K+++++H++LDYYD +K   +   TT  TTL+Q+TG A G  GF+N TD  G
Sbjct  73    SKHPLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQG  132

Query  669   KTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
               V  GSA+  +   S+   +V    Y+ISIL+IS+ II PG+
Sbjct  133   GKVGFGSAIPGSKLDSSYTKSVKQIPYNISILEISAPIIAPGI  175



>ref|XP_010277448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Nelumbo 
nucifera]
Length=427

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 102/177 (58%), Gaps = 2/177 (1%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
             F    S SI V    A N+T +L  +P ++  N YLT T+LA EIN+R T+T L + N  
Sbjct  10    FLLFLSLSIFVIPSTAHNITEILSGFPEYSAMNDYLTRTKLADEINTRETITCLVLPNSA  69

Query  861   MGALSG-KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
             M AL+  K   V+K+V+ + ++LDYYD  K   + K TT  TTL+Q TG A G  GF+N 
Sbjct  70    MSALAANKPLSVVKNVLRLLVLLDYYDGAKLHQISKGTTLTTTLYQVTGDAHGNLGFVNI  129

Query  684   TDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
             TD  G  V  GSA   +   S    +V    Y+IS+L+IS+ II PG+ +  AP AA
Sbjct  130   TDLKGGKVGFGSAAPGSKLDSTYTKSVKQIPYNISVLEISAPIIAPGILTAPAPSAA  186



>gb|EYU33706.1| hypothetical protein MIMGU_mgv1a007367mg [Erythranthe guttata]
Length=410

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  829
             +  A N+T +L KYP  + FN YLT T+LA EIN R T+TV AVDNGGMG L  K   + 
Sbjct  27    TVDAHNITRILAKYPELSTFNHYLTVTQLAPEINRRETITVCAVDNGGMGDLLSKRLTIG  86

Query  828   -IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTV  661
              I++V+ +H++LDY+D KK   +   T    T+FQ+TG A G  GF+N T+  G  V
Sbjct  87    AIRNVLELHVLLDYFDAKKLHQITDGTALAATMFQATGSAPGSSGFVNITELKGGKV  143



>ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis 
melo]
Length=414

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 77/131 (59%), Gaps = 2/131 (2%)
 Frame = -2

Query  1038  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
             F LA   +++ +  A N+T +L+K+P F+ FN YLT T LA EIN R T+TV  VDN  M
Sbjct  14    FVLAVLFLVISTATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAM  73

Query  858   GALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
               L  K   +  IK+ +++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N 
Sbjct  74    SDLLAKQLSIYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNI  133

Query  684   TDTGGKTVMIG  652
             TD  G  V  G
Sbjct  134   TDLKGGKVGFG  144



>gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata]
Length=422

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 103/172 (60%), Gaps = 6/172 (3%)
 Frame = -2

Query  1032  LASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGA  853
             LA+ SI      A N+T +LD YP ++ FN  L++T+LA EINSR  VTV  + NG + +
Sbjct  15    LAAVSI----AAATNITEILDGYPEYSEFNTLLSQTKLADEINSREPVTVCVLPNGALSS  70

Query  852   LSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDT  676
              +GK    V+++++A+H++LDY+D  K   + + +   TTL+Q+TG A G  GF+N TD 
Sbjct  71    FTGKYPLSVVENILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNADGNLGFVNITDL  130

Query  675   GGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKA  520
              G  V  GS V  +P  S    +V    Y++S++++S  I P  V + AP A
Sbjct  131   KGGKVGFGSGVAGSPLDSTYTKSVKQIPYNVSVIEVSKAIAPAAVLT-APSA  181



>ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
 gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
Length=425

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKS  820
            A N+T +L  +P+++ +N +LT+T+LA EIN+R T+T+L ++N  + AL+ K    V+K+
Sbjct  23   AHNITEILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAISALAAKHPLSVVKN  82

Query  819  VMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVK  640
             +++H++LDYYD  K   + K +T  TTL+Q+TG A G  GF+N TD  G  V  GSA  
Sbjct  83   ALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAP  142

Query  639  NAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             +   S+   +V    Y+ISIL+I++ II PG+
Sbjct  143  GSKLDSSYTKSVKQIPYNISILEINAPIIAPGI  175



>emb|CDY18927.1| BnaC04g04230D [Brassica napus]
Length=416

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 5/180 (3%)
 Frame = -2

Query  1041  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVD  871
             F  LA +FS++    +    N+T +L   P +++FN YL++T+LA EINSR T+T+L ++
Sbjct  7     FSLLALTFSLLALASTVRCHNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLN  66

Query  870   NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
             NG M +L+GK    VIK+ +++ ++LDYYD +K   +   T   TTL+Q+TG A G  GF
Sbjct  67    NGAMASLAGKHPLSVIKNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
             +N TD  G  V  GSA   +   S+   +V    Y+IS+L+I + II PG+ +  AP AA
Sbjct  127   VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAA  186



>ref|XP_006601616.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Glycine 
max]
Length=355

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 107/170 (63%), Gaps = 6/170 (4%)
 Frame = -2

Query  960  NFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMAVHIVLDYYDV  781
             F+ FN+YLTET+LA +INSR T+TVLAV++  M +++ KS + IK+++  H++LD++D 
Sbjct  102  EFSTFNKYLTETKLADQINSRNTITVLAVEDSAMHSIAAKSPEAIKAIIGTHVILDFFDE  161

Query  780  kkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG-SAVKNAPQGSNLISAV  604
            KK    +  + +LTTLFQ++G+A  +QGFL     G   +  G +A       + L+  V
Sbjct  162  KKLMEAQASSQQLTTLFQASGLAVNQQGFLKVALVGEGEIAFGSAASDAPADATELVRTV  221

Query  603  AHEGYDisilqissliIPPGVESIAPKA---APPSHQQHGKSPAAAPSPR  463
              E Y+ISILQ++  I+ PGV+S  P +   A PS  Q  K+P AA S +
Sbjct  222  TSEPYNISILQVTKPILAPGVDSPTPASSSGAQPS--QGAKAPIAAQSAK  269



>gb|KDP29933.1| hypothetical protein JCGZ_18502 [Jatropha curcas]
Length=408

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  829
             +C A N+T +L K+P F+ FN YLT T LA EIN R T+TVLA+DN  M +L  K   V 
Sbjct  23    TCCAHNITRILAKHPAFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLLAKQLSVY  82

Query  828   -IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
              +++V+++H+++DY+  KK   +   TT  +T+FQ+TG A+G  G++N TD  G  V  G
Sbjct  83    TLRNVLSLHVLVDYFGAKKLHQITDGTTLTSTMFQATGSATGTSGYVNITDLKGGKVAFG  142

Query  651   SAVKN  637
             S   N
Sbjct  143   SEDNN  147



>ref|XP_010432871.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=286

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 100/161 (62%), Gaps = 3/161 (2%)
 Frame = -2

Query  1017  IMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG  844
             ++V+S    A N+T   +KY NF+  +   T+T+L   I+   T+TVLAV N  + +++ 
Sbjct  15    LLVFSKVVTADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSNDAISSITN  74

Query  843   KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKT  664
             +S   +K+++  H++LDYYD  K   + +K+  LTTL+Q+TG+     GFLN T   G+ 
Sbjct  75    RSDVELKNILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEEMNGFLNVTKLEGR-  133

Query  663   VMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             V  GSAVKN+P  +  +S V H  Y++SI++IS  I+ PG+
Sbjct  134   VYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>ref|XP_002267946.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Vitis vinifera]
Length=407

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  1026  SFSIMVWSCG--AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGA  853
             S  ++  SC   A N+T +L KYP F+ F+ YLT T LAGEIN R T+TVLAV N GM  
Sbjct  14    SVCLLFLSCATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMAD  73

Query  852   LSGK--SKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             L  K  S  VIK+V+++H+++DY+  +K   +   T    TLFQSTG A G  GF+N TD
Sbjct  74    LLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITD  133



>ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum 
indicum]
Length=426

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 95/156 (61%), Gaps = 1/156 (1%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDV  829
             S  A N+T +L  +P ++ FN  L++T+LA EINSR  VTV  + NG + + +GK    V
Sbjct  20    SASASNITEILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGALSSFTGKYPLSV  79

Query  828   IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGS  649
             IK+++A+H++LDY+D  K   + + +   TTL+Q+TG A+G  GF+N TD  G  V  GS
Sbjct  80    IKNILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNAAGNLGFVNITDLRGGKVGFGS  139

Query  648   AVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              V  +P  S    +V    Y++S++++S  I P  V
Sbjct  140   GVPGSPLDSTFTKSVKQVPYNLSVIEVSKAIAPSAV  175



>ref|XP_010447580.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=284

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 100/161 (62%), Gaps = 3/161 (2%)
 Frame = -2

Query  1017  IMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG  844
             ++V+S    A N+T   +KY NF+  +   T+T+L   I+   T+TVLAV N  + +++ 
Sbjct  15    LLVFSKVVTADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSNDAISSITN  74

Query  843   KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKT  664
             +S   +K+++  H++LDYYD  K   + +K+  +TTL+Q+TG+     GFLN T   G+ 
Sbjct  75    RSDVELKNILMTHVILDYYDELKLQGMREKSIMVTTLYQTTGLGEEMNGFLNVTKMEGR-  133

Query  663   VMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             V  GSAVKN+P  +  +S V H  Y++SI++IS  I+ PG+
Sbjct  134   VYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>ref|XP_007024813.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
 gb|EOY27435.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
Length=304

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 90/237 (38%), Positives = 125/237 (53%), Gaps = 13/237 (5%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             +  AFN+T +L ++P+F  FN YL  T +A +INS  TVTVL V NG M  +SG+S D +
Sbjct  21    AADAFNITQILSQFPDFTTFNNYLIHTGVADQINSEQTVTVLVVANGNMSEVSGQSPDAM  80

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlF-QSTGMASGEQGFLNATDTGGKTVMIGS  649
             K  ++VH++LDY+ V+K   L+ KT    T   Q +G A  +QGFLN    G   V  GS
Sbjct  81    KKTLSVHVILDYFGVEKLKNLQNKTALTLTTLYQQSGQAQNQQGFLNVAHVGNGGVAFGS  140

Query  648   AVKNAPQGSNLISAVAHEGYDisilqissliIPPG---VESIAPKAAPPSHQQHGKSPAA  478
             A   +   S  I  VA + Y+IS+LQIS++I  P      S  P+ AP S       P A
Sbjct  141   AAAGSNLDSIFIKPVASQPYNISVLQISNIINVPSNSTTPSSPPEQAPASSPITKPHPPA  200

Query  477   APSPRKllspsnspsdspsdspsalspPGVSPSVPETDSPASGPNGEGDSSAATTAR  307
             A  PRK                   SPPG +   P+ DSPA+ P    +++A + A+
Sbjct  201   ASPPRK---------VLAPAPSPKKSPPGNASPPPDADSPAASPPNPSNATAPSVAK  248



>emb|CBI28444.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  1026  SFSIMVWSCG--AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGA  853
             S  ++  SC   A N+T +L KYP F+ F+ YLT T LAGEIN R T+TVLAV N GM  
Sbjct  127   SVCLLFLSCATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMAD  186

Query  852   LSGK--SKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             L  K  S  VIK+V+++H+++DY+  +K   +   T    TLFQSTG A G  GF+N TD
Sbjct  187   LLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITD  246



>ref|XP_006401420.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
 gb|ESQ42873.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
Length=424

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 8/148 (5%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             II + L    ++     A NVT +L  +P+F++FN +LT+T LA EIN R TVTV AVDN
Sbjct  9     IITYILPILLLLTVKSHAHNVTRLLANHPSFSSFNHFLTQTHLADEINRRTTVTVCAVDN  68

Query  867   GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M AL+ K   +  +K+++++H++LDY+  KK   +   +    TLFQ+TG A G  GF
Sbjct  69    AAMSALTSKGYTITTLKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAQGMTGF  128

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLIS  610
             +N TD  G  V  G      P G +L S
Sbjct  129   VNITDLRGGKVGFG------PDGGDLSS  150



>ref|XP_006286247.1| hypothetical protein CARUB_v10007817mg [Capsella rubella]
 gb|EOA19145.1| hypothetical protein CARUB_v10007817mg [Capsella rubella]
Length=286

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 99/161 (61%), Gaps = 3/161 (2%)
 Frame = -2

Query  1017  IMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSG  844
             ++V+S    A N+T    KY NF+  +   T+T+L   I+   T+TVLAV N  + +++ 
Sbjct  15    LLVFSKVVTADNITLAFQKYSNFSTMSSLFTQTKLTVPISKYQTITVLAVSNDAISSITN  74

Query  843   KSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKT  664
             +S   +K+++  H++LDYYD  K   + +K+  LTTL+Q+TG+     GFLN T   G+ 
Sbjct  75    RSDVELKNILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEEMNGFLNVTKLNGR-  133

Query  663   VMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             V  GSAVKN+P  +  +S V H  Y++SI+QIS  I+ PG+
Sbjct  134   VYFGSAVKNSPLNAEYVSTVYHNPYNLSIIQISMPIVAPGL  174



>ref|XP_002878353.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54612.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 108/173 (62%), Gaps = 1/173 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F F  S   + ++    N+T +L   P +++FN YL++T+LA EINSR T+TVL ++NG
Sbjct  9     LFAFTLSLLAVAYTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNG  68

Query  864   GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M +L+GK    V+K+ +++ ++LDYYD  K   L K +T  TTL+Q+TG A G  GF+N
Sbjct  69    AMSSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLAKGSTLTTTLYQTTGHAPGNLGFVN  128

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIA  529
              TD  G  V  GSA   +   S+   +V    Y+IS+L+I++ II PG+ + A
Sbjct  129   VTDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAA  181



>ref|XP_002316776.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
 gb|EEE97388.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
Length=408

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IKSV  817
            N+T +L K+P+F+ FN YLT T LAGEINSR T+TV AVDN  M  L  K   +  IK++
Sbjct  25   NITHILGKHPSFSTFNHYLTLTHLAGEINSRNTITVCAVDNAAMSELLSKHPSIATIKNI  84

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
            +++H++LDY+  KK   + + T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  85   LSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFG  139



>ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39576.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
                ++   + +    A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN  
Sbjct  11    LVLISQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSA  70

Query  861   MGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
             M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N
Sbjct  71    MSSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVN  130

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
              TD  G  V  G    ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  131   ITDIKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  186



>gb|ABV27482.1| fasciclin-like arabinogalactan protein 11 [Gossypium hirsutum]
Length=417

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 91/156 (58%), Gaps = 3/156 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++    ++F ++  +  A NVT +L K+P+ + FN YLT T LA EIN R T+TVLA+DN
Sbjct  8     VVLLIFSAF-LLFQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDN  66

Query  867   GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M +L  K+  +  IK+++++H++LDY+  KK   +   T    T+FQ+TG+A+G  GF
Sbjct  67    AAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             +N TD  G  V  G+        S  + +V    Y+
Sbjct  127   VNITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYN  162



>gb|AIY35291.1| fasciclin-like arabinogalactan 11 [Gossypium hirsutum]
Length=417

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 91/156 (58%), Gaps = 3/156 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++    ++F ++  +  A NVT +L K+P+ + FN YLT T LA EIN R T+TVLA+DN
Sbjct  8     VVLLIFSAF-LLFQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDN  66

Query  867   GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M +L  K+  +  IK+++++H++LDY+  KK   +   T    T+FQ+TG+A+G  GF
Sbjct  67    AAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             +N TD  G  V  G+        S  + +V    Y+
Sbjct  127   VNITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYN  162



>gb|KFK37339.1| hypothetical protein AALP_AA4G243700 [Arabis alpina]
Length=415

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 110/171 (64%), Gaps = 4/171 (2%)
 Frame = -2

Query  1041  FFFLA-SFSIMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVD  871
             F  LA + S++  S    + N+T +L   P++++FN YLT+T+LA EINSR T+T+L ++
Sbjct  7     FSLLAITLSLLAVSTTVKSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITLLVLN  66

Query  870   NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
             NG M +L+GK    VIK+ +++ ++LDYYD +K   L K TT  TTL+Q+TG A G  GF
Sbjct  67    NGAMSSLAGKHPLSVIKNALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
             +N TD  G  V  GSA   +   S+   +V    Y+IS+L+I++ II PGV
Sbjct  127   VNITDLKGGKVGFGSAAPGSKLESSYTRSVKQIPYNISVLEINAPIIAPGV  177



>ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=402

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = -2

Query  1041  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGG  862
              F L    ++  +  AFN+T +L K+P F+ FN+YLT+T LA EIN R T+T+LA+DN  
Sbjct  9     IFALLVVVLLAPATTAFNITKILKKHPEFSTFNEYLTQTHLANEINHRQTITILALDNSA  68

Query  861   MGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
             M +L  K   +  +++V+++H+++DYY  KK   +   TT   +LFQS+G A G  G++N
Sbjct  69    MSSLLSKGLTLFTLRNVLSLHVLVDYYGAKKLHQITDGTTVTASLFQSSGDADGNSGYVN  128

Query  687   ATDT-GGK  667
              TD  GGK
Sbjct  129   ITDMHGGK  136



>emb|CDX87001.1| BnaC03g52710D [Brassica napus]
Length=402

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  23   AHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIR  82

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  83   NILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  142

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  143  DDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  183



>dbj|BAE75863.1| putative fasciclin-like arabinogalactan protein [Salicornia europaea]
Length=427

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+T +L K+P+F++FN YLT T LA EIN+R T+TVLA+DN  M +L+ K   +  +K
Sbjct  25   AHNITKILAKFPDFSSFNHYLTTTHLAPEINTRQTITVLAIDNAAMASLTSKHLPISTLK  84

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTV  661
            +++++H++LDY+  KK   +   +    T++Q+TG A G  GF+N TD  G  V
Sbjct  85   NILSLHVLLDYFGAKKLHQITDGSALAATMYQATGSAPGTAGFVNITDLKGGKV  138



>emb|CAN61077.1| hypothetical protein VITISV_012919 [Vitis vinifera]
Length=407

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  1026  SFSIMVWSCG--AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGA  853
             S  ++  SC   A N+T +L KYP F+ F+ YLT T LAGEIN R T+TVLAV N GM  
Sbjct  14    SVCLLFLSCXTHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMAD  73

Query  852   LSGK--SKDVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATD  679
             L  K  S  VIK+V+++H+++DY+  +K   +   T    TLFQSTG A G  GF+N TD
Sbjct  74    LLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITD  133



>ref|XP_009379279.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Pyrus x 
bretschneideri]
Length=425

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDVIKSVM  814
            N+T +L  +P+++ +N YLT+TRLA EIN+  T+TVL ++N  + AL+ K    VIK+ +
Sbjct  25   NITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVLNNAAISALAAKHPLAVIKNAL  84

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++H++LDYYD  K   +   +   TTL+Q+TG A G  GF+N TD  G  V  GSA   +
Sbjct  85   SLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPGS  144

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGV  541
               S+   +V    Y+IS+L+IS+ +I PG+
Sbjct  145  KLDSSYTKSVKQIPYNISVLEISAPVIAPGI  175



>emb|CDY37904.1| BnaA06g19130D [Brassica napus]
Length=398

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P F+ FN YL+ T LA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  23   AHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIR  82

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  83   NILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  142

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  143  DDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  183



>ref|XP_006346133.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=409

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGK--SKDVIK  823
            A N+T +L  +  F+ FN YLT T LA EIN R T+TV  VDN GM  L  K  S + IK
Sbjct  25   AHNITHILANHTQFSTFNHYLTTTHLATEINRRQTITVCVVDNAGMSDLLSKHLSINTIK  84

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +V++ H++LDY+D KK   +   T    T+FQ+TG A+G  GF+N TD  G  V    A 
Sbjct  85   NVLSFHVLLDYFDAKKLHQITNGTALAATIFQATGSATGSSGFVNITDLKGGKVGFSPAD  144

Query  642  KNAPQGSNLISAVAHEGYD  586
             N P  +  + ++    Y+
Sbjct  145  YNGPPPAKFVKSIEEIPYN  163



>ref|XP_009150168.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
Length=399

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P F+ FN YL+ T LA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  23   AHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIR  82

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  83   NILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  142

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             ++   ++ + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  143  DDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  183



>ref|XP_008343059.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Malus domestica]
Length=425

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 95/151 (63%), Gaps = 1/151 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDVIKSVM  814
            N+T +L  +P+++ +N YLT+TRLA EIN+  T+TVL  +N  + AL+ K    VIK+ +
Sbjct  25   NITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVFNNAAISALAAKHPLSVIKNAL  84

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++H++LDYYD  K   +   +   TTL+Q+TG A G  GF+N TD  G  V  GSA   +
Sbjct  85   SLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPGS  144

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGV  541
               S+   +V    Y+IS+L+IS+ +I PG+
Sbjct  145  KLDSSYTKSVKQIPYNISVLEISAPVIAPGI  175



>ref|XP_008228867.1| PREDICTED: mucin-17-like [Prunus mume]
Length=1019

 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -2

Query  1005  SCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  826
             S   FN+T  L+ YP FN FN YLTET++  +IN+R TVTVL V+N  M +L GKS ++ 
Sbjct  201   SSSTFNITKFLNNYPEFNQFNTYLTETQVCDQINARSTVTVLVVNNTAMSSLVGKSTEIK  260

Query  825   KSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMAS-GEQGFLNATDTGGKTVMIGS  649
             K V+++H+V+DYY  + F  L    T   T    +   S G QG LNA  T G TV I S
Sbjct  261   KKVLSLHVVMDYYTSQSFHNLPSSQTTQLTTLLQSSFQSIGFQGLLNA--THGDTVSILS  318

Query  648   AV  643
             AV
Sbjct  319   AV  320


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            AFN+T +L+KYP F+ FN YLT T+++ +IN R T+T+L  +N  M +L G+  DVI+ V
Sbjct  370  AFNITQILNKYPEFSIFNDYLTRTQVSNQINERRTLTILVANNEAMSSLVGQPMDVIRKV  429

Query  816  MAVHIVLDYYDVkkfttl-ekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGS  649
            +++ +VLDYY+V+KF  L   K T++ TL ++    +G+QGF+N T+  G T+ I S
Sbjct  430  LSLQVVLDYYNVQKFHNLPVSKPTRIITLLEAADKPNGQQGFVNITN--GDTISIVS  484


 Score = 85.9 bits (211),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            FN+T +L+ YP F+ FN YLT+T++  +IN+R TVTVL V+N  M +L GKS ++ K V+
Sbjct  539  FNITKILNDYPEFSQFNTYLTDTQVCDQINARTTVTVLVVNNAAMSSLVGKSTEIQKRVL  598

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMAS-GEQGFLNATDTGGKTVMIGSA  646
            ++H++ DYY  + F       T   T        S G QG LNA  T G  V I SA
Sbjct  599  SLHVITDYYTSQSFHNFPTLKTTQLTTLLQASFQSNGFQGLLNA--TSGDAVSIVSA  653


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  817
            A+N+T +L+KYP+F+ FN YLT T+++ +IN    +TVL V N  M +L GKS DVI  V
Sbjct  27   AYNITEVLNKYPDFSIFNDYLTRTKVSNQINEHRIMTVLVVKNASMSSLVGKSIDVINKV  86

Query  816  MAVHIVLDYY  787
            M +H+ LDYY
Sbjct  87   MRIHVFLDYY  96


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 86/141 (61%), Gaps = 11/141 (8%)
 Frame = -2

Query  999  GAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKS  820
             AF++T +L    +FN FN YLT+T++A +IN   T+T+  V+NG M ++  K  ++ K 
Sbjct  712  AAFDITKILSSNSDFNLFNNYLTQTQVANQINEHKTMTLFVVNNGAMTSIVDKPMEIKKK  771

Query  819  VMAVHIVLDYYDVkkfttl-ekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSA-  646
            ++++H+++DYY V+KF  L   + T++ TL Q T   SG+QGF+N T+  G T+ I SA 
Sbjct  772  ILSLHVIMDYYTVQKFHNLPVSQPTRINTLLQVTDKPSGQQGFVNITN--GDTISIVSAA  829

Query  645  -------VKNAPQGSNLISAV  604
                   V++    +N IS V
Sbjct  830  GSDQAVVVQDVADKTNTISVV  850



>emb|CDP13717.1| unnamed protein product [Coffea canephora]
Length=411

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 3/159 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+T +L ++P F+ FN +LT T LA +IN+R T+TV AVDN GM  L GK   +  +K
Sbjct  29   AHNITKILAEFPEFSTFNHFLTTTHLANDINNRETITVCAVDNAGMADLLGKHLSIFALK  88

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +V+++H++LDY+  KK   +   T    T++Q+TG A G  GF+N TD  G  V  G AV
Sbjct  89   NVLSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSGFVNITDLKGGKVGFG-AV  147

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAP  526
             N    +  + +V    Y+IS++QIS ++  P  E+  P
Sbjct  148  DNGGIDATFVKSVKEIPYNISVIQISKILPSPDAEAPTP  186



>gb|AAK55685.1|AF378882_1 AT3g60900/T4C21_310 [Arabidopsis thaliana]
Length=410

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 105/169 (62%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F F  S   +  +    N+T +L   P +++FN YL++T+LA EINSR T+TVL ++NG
Sbjct  9     LFAFTLSLLTVASTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNG  68

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M +L+GK    V+K+ +++ ++LDYYD  K   L K TT  TTL+Q+TG A G  GF+N
Sbjct  69    AMSSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVN  128

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S+   +V    Y+IS+L+I++ II PG+
Sbjct  129   VTDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGI  177



>ref|NP_191649.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
 sp|Q9LZX4.1|FLA10_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 10; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB82694.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AAM65173.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AEE80125.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
Length=422

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 105/169 (62%), Gaps = 1/169 (1%)
 Frame = -2

Query  1044  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNG  865
             +F F  S   +  +    N+T +L   P +++FN YL++T+LA EINSR T+TVL ++NG
Sbjct  9     LFAFTLSLLTVASTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNG  68

Query  864   GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLN  688
              M +L+GK    V+K+ +++ ++LDYYD  K   L K TT  TTL+Q+TG A G  GF+N
Sbjct  69    AMSSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVN  128

Query  687   ATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYDisilqissliIPPGV  541
              TD  G  V  GSA   +   S+   +V    Y+IS+L+I++ II PG+
Sbjct  129   VTDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGI  177



>ref|XP_011010616.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=407

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IKSV  817
            N+T +L K+P+F+ FN YLT T LAGEINS+ T+TV AVDN  M  L  K   +  IK++
Sbjct  25   NITRILGKHPSFSTFNHYLTLTHLAGEINSKTTITVCAVDNAAMSELLSKHPSIATIKNI  84

Query  816  MAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIG  652
            +++H++LDY+  KK   + + T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  85   LSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSAGFVNITDVKGGKVAFG  139



>emb|CDX74743.1| BnaA05g04890D [Brassica napus]
Length=416

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 102/160 (64%), Gaps = 2/160 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDVIKSVM  814
            N+T +L   P +++FN YL++T+LA EINSR T+T+L ++NG M +L+GK    VIK+ +
Sbjct  27   NITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNAL  86

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++ ++LDYYD +K   +   T   TTL+Q+TG A G  GF+N TD  G  V  GSA   +
Sbjct  87   SLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGS  146

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
               S+   +V    Y+IS+L+I + II PG+ +  AP AA
Sbjct  147  KLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAA  186



>gb|KDP39270.1| hypothetical protein JCGZ_01027 [Jatropha curcas]
Length=404

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A NVT +L K+P+ + FN YLT T LAGEIN R T+TV AVDN  M  L  K   +  IK
Sbjct  22   AHNVTRLLAKHPSLSTFNHYLTITHLAGEINRRTTITVCAVDNAAMSELLSKHPSIYTIK  81

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G   
Sbjct  82   NILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPED  141

Query  642  KNAPQGSNLISAVAHEGYD  586
             +   G   + +V    Y+
Sbjct  142  NDGKLGVYFVKSVEEVPYN  160



>ref|XP_009143146.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=416

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 102/160 (64%), Gaps = 2/160 (1%)
 Frame = -2

Query  990  NVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKS-KDVIKSVM  814
            N+T +L   P +++FN YL++T+LA EINSR T+T+L ++NG M +L+GK    VIK+ +
Sbjct  27   NITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNAL  86

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++ ++LDYYD +K   +   T   TTL+Q+TG A G  GF+N TD  G  V  GSA   +
Sbjct  87   SLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGS  146

Query  633  PQGSNLISAVAHEGYDisilqissliIPPGVESI-APKAA  517
               S+   +V    Y+IS+L+I + II PG+ +  AP AA
Sbjct  147  KLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAA  186



>gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana]
Length=403

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN  M ++  +G S   I+
Sbjct  26   AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIR  85

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD  145

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             ++   ++ + +V  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAE--APTASP  186



>ref|XP_004148925.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 ref|XP_004170859.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 gb|KGN44020.1| Fasciclin-like arabinogalactan protein 11 [Cucumis sativus]
Length=415

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 2/131 (2%)
 Frame = -2

Query  1038  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGM  859
               LA   +++ +  A N+T +L+K+P F+ FN YLT T LA EIN R T+TV  VDN  M
Sbjct  14    LVLAVLFLVIATATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAM  73

Query  858   GALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNA  685
               L  K   +  IK+ +++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N 
Sbjct  74    SDLLAKQLSIYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNI  133

Query  684   TDTGGKTVMIG  652
             TD  G  V  G
Sbjct  134   TDLKGGKVGFG  144



>gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein 2 [Arabidopsis thaliana]
Length=403

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN  M ++  +G S   I+
Sbjct  26   AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIR  85

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD  145

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             ++   ++ + +V  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAE--APTASP  186



>ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
 sp|Q9SU13.1|FLA2_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB40990.1| putative pollen surface protein [Arabidopsis thaliana]
 emb|CAB78315.1| putative pollen surface protein [Arabidopsis thaliana]
 gb|AAL31207.1| AT4g12730/T20K18_80 [Arabidopsis thaliana]
 gb|AAM98329.1| At4g12730/T20K18_80 [Arabidopsis thaliana]
 dbj|BAF02161.1| fasciclin-like arabinogalactan protein FLA2 [Arabidopsis thaliana]
 gb|AEE83171.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
Length=403

 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P+F+ FN YL+ T LA EIN R T+TVLAVDN  M ++  +G S   I+
Sbjct  26   AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIR  85

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD  145

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAPKAAP  514
             ++   ++ + +V  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAE--APTASP  186



>gb|KHG09433.1| Fasciclin-like arabinogalactan protein 1 [Gossypium arboreum]
Length=417

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 90/156 (58%), Gaps = 3/156 (2%)
 Frame = -2

Query  1047  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDN  868
             ++    ++F ++  +  A N+T +L K+P+ + FN YLT T LA EIN R T+TVLA+DN
Sbjct  8     VVLLIFSAF-LLFQTSNAHNITRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDN  66

Query  867   GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGF  694
               M +L  K+  +  IK+++++H++LDY+  KK   +   T    T+FQ+TG+A G  GF
Sbjct  67    AAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVAPGVSGF  126

Query  693   LNATDTGGKTVMIGSAVKNAPQGSNLISAVAHEGYD  586
             +N TD  G  V  G+        S  + +V    Y+
Sbjct  127   VNITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYN  162



>ref|XP_002462113.1| hypothetical protein SORBIDRAFT_02g019380 [Sorghum bicolor]
 gb|EER98634.1| hypothetical protein SORBIDRAFT_02g019380 [Sorghum bicolor]
Length=405

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 80/136 (59%), Gaps = 0/136 (0%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            +N+T +L  Y  ++ FN+ L++TRLA +IN R T+TVLAVDN  M AL   S   I+ ++
Sbjct  33   YNITKILAPYKEYSKFNEMLSKTRLAYDINRRQTITVLAVDNSAMSALDHYSLQTIRHIL  92

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++H+++DYY  KK   L    T  +++FQ+TG ASG  G++N T   GK   +     + 
Sbjct  93   SLHVLVDYYGDKKLKKLAHGATASSSMFQATGSASGMSGYVNITRKDGKVSFMTEDADDT  152

Query  633  PQGSNLISAVAHEGYD  586
             + S  + +V    YD
Sbjct  153  AKPSRYVKSVKEYPYD  168



>gb|EYU27439.1| hypothetical protein MIMGU_mgv1a007268mg [Erythranthe guttata]
Length=413

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  823
            A N+T +L+K P F+ F+ YLT T+LA EIN R T+TV AVDN GM  L  K   +  I+
Sbjct  30   AHNITHILEKNPEFSTFSHYLTVTQLAPEINRRETITVCAVDNAGMSDLLAKHLSIGGIR  89

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTV  661
            +V+++H++LDY+D KK   +   T    T++Q+TG A+G  GF+N TD  G  V
Sbjct  90   NVLSLHVLLDYFDAKKLHQITDGTALAATMYQATGEATGSAGFVNITDLKGGKV  143



>ref|XP_010542030.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=397

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 98/159 (62%), Gaps = 2/159 (1%)
 Frame = -2

Query  996  AFNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  823
            A N+T +L K P+F+ FN YLT T LA +IN R T+TVLAVDN GM ++   G S   I+
Sbjct  27   AHNITRILAKDPDFSTFNHYLTATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIR  86

Query  822  SVMAVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAV  643
            +++++H+++DY+  KK   +   TT  +T+FQ+TG A G  G++N TD  G  V  G   
Sbjct  87   NILSLHVLVDYFGAKKLHQITHGTTSTSTMFQATGSAPGTSGYVNITDLKGGKVAFGVQD  146

Query  642  KNAPQGSNLISAVAHEGYDisilqissliIPPGVESIAP  526
             +    S+ + +V  + Y+IS+LQIS ++  P  E+  P
Sbjct  147  DDNKLTSHYVKSVYEKAYNISVLQISQVMTSPEAEAPTP  185



>ref|XP_004956400.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Setaria 
italica]
Length=403

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = -2

Query  993  FNVTTMLDKYPNFNNFNQYLTETRLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  814
            +N+T +L+ Y  ++ FN+ L+ TRLA +IN R T+TVLAVDN  M AL   S   I+ ++
Sbjct  32   YNITKLLEPYKQYSRFNEMLSRTRLAYDINRRQTITVLAVDNAAMSALDHYSLQTIRHIL  91

Query  813  AVHIVLDYYDVkkfttlekkttklttlFQSTGMASGEQGFLNATDTGGKTVMIGSAVKNA  634
            ++H+++DYY  KK   L + +T  ++++Q+TG ASG  G++N T   GK         + 
Sbjct  92   SLHVLVDYYGDKKLKKLARGSTTSSSMYQATGAASGMSGYVNITRKDGKVSFTTDDADDT  151

Query  633  PQGSNLISAVAHEGYD  586
             + +  + ++    YD
Sbjct  152  AKPTRYVKSIKEYPYD  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2752291252704