BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24516_g1_i1 len=985 path=[1:0-125 127:126-180 1968:181-206
1994:207-230 2018:231-282 2070:283-472 3094:473-489 2275:490-533
375:534-604 446:605-780 2564:781-783 2567:784-984]

Length=985
                                                                      Score     E

gb|EPS65223.1|  hypothetical protein M569_09558                         153   3e-40   
ref|XP_009615226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   8e-39   
ref|XP_010265495.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   9e-38   
ref|XP_009784353.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   1e-36   
gb|KCW80704.1|  hypothetical protein EUGRSUZ_C02101                     143   2e-36   
ref|XP_010048457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   9e-36   
ref|XP_011082708.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   1e-35   
gb|KDP33435.1|  hypothetical protein JCGZ_07006                         140   2e-35   
ref|XP_008799982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   2e-34   
ref|XP_008786366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   5e-34   
ref|XP_011034724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   7e-34   
ref|XP_006368661.1|  hypothetical protein POPTR_0001s07490g             136   1e-33   
ref|XP_010909123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   1e-33   
ref|XP_002527970.1|  conserved hypothetical protein                     134   3e-33   Ricinus communis
ref|XP_006357108.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   6e-33   
emb|CAN62804.1|  hypothetical protein VITISV_011795                     135   7e-33   Vitis vinifera
ref|XP_002271150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-32   Vitis vinifera
ref|XP_006382179.1|  putative surface family protein                    131   1e-31   
ref|XP_004244694.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
ref|XP_009394682.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
ref|XP_010324668.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   2e-31   
ref|XP_009593249.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   4e-31   
ref|XP_008799981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   5e-31   
ref|XP_004952427.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   5e-31   
ref|XP_004136457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   5e-31   
gb|KFK38614.1|  hypothetical protein AALP_AA3G137100                    128   5e-31   
ref|XP_008466329.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   1e-30   
ref|XP_006371803.1|  putative surface family protein                    127   2e-30   
gb|AFK47920.1|  unknown                                                 126   4e-30   
ref|XP_010465042.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   4e-30   
ref|XP_010914304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   5e-30   
gb|KDP41920.1|  hypothetical protein JCGZ_26938                         124   7e-30   
ref|XP_009787705.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   8e-30   
ref|XP_009781936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   9e-30   
ref|XP_007161299.1|  hypothetical protein PHAVU_001G058300g             125   1e-29   
gb|KEH39773.1|  fasciclin domain protein                                125   1e-29   
ref|XP_006357096.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   1e-29   
ref|XP_011015272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-29   
ref|XP_009612463.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-29   
ref|XP_010499304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   2e-29   
ref|XP_011045030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-29   
gb|KEH39771.1|  fasciclin-like arabinogalactan protein                  124   3e-29   
gb|KEH39774.1|  fasciclin domain protein                                123   4e-29   
gb|AFK40899.1|  unknown                                                 124   4e-29   
ref|XP_002882785.1|  hypothetical protein ARALYDRAFT_478625             122   7e-29   
ref|XP_008445580.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   9e-29   
ref|XP_002282846.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   Vitis vinifera
ref|XP_004305606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_003545530.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_010938482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   2e-28   
ref|XP_002512774.1|  Glycoprotein X precursor, putative                 122   3e-28   Ricinus communis
ref|XP_010938483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   9e-28   
emb|CAN66163.1|  hypothetical protein VITISV_008126                     120   1e-27   Vitis vinifera
ref|XP_006298989.1|  hypothetical protein CARUB_v10015115mg             119   1e-27   
ref|XP_004486594.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   1e-27   
ref|NP_187872.1|  fasciclin-like arabinogalactan protein 14             118   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28554.1|  unknown                                                 118   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498590.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
ref|XP_007011569.1|  Fasciclin-like arabinogalactan protein 17, p...    118   4e-27   
ref|XP_009363599.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   5e-27   
ref|XP_004138878.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   5e-27   
ref|NP_001130104.1|  hypothetical protein precursor                     118   5e-27   Zea mays [maize]
ref|XP_009396684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   6e-27   
gb|EYU22059.1|  hypothetical protein MIMGU_mgv1a011491mg                117   6e-27   
ref|XP_002452018.1|  hypothetical protein SORBIDRAFT_04g015850          117   6e-27   Sorghum bicolor [broomcorn]
ref|XP_008781934.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   9e-27   
gb|KEH39772.1|  fasciclin domain protein                                115   1e-26   
ref|XP_007224727.1|  hypothetical protein PRUPE_ppa024912mg             116   1e-26   
ref|XP_008219800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
ref|XP_009418876.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
ref|XP_008361057.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   2e-26   
ref|XP_006845641.1|  hypothetical protein AMTR_s00019p00223190          117   2e-26   
gb|KHN10392.1|  Fasciclin-like arabinogalactan protein 3                116   2e-26   
ref|XP_010486992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-26   
ref|XP_009377364.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-26   
ref|XP_008219801.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-26   
ref|XP_011082038.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   4e-26   
gb|EPS61284.1|  hypothetical protein M569_13515                         114   4e-26   
ref|XP_004305605.1|  PREDICTED: uncharacterized protein LOC101308896    119   5e-26   
ref|XP_008378295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   5e-26   
ref|XP_009338843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   6e-26   
ref|XP_006664971.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   6e-26   
ref|XP_009402000.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   1e-25   
ref|XP_007221854.1|  hypothetical protein PRUPE_ppa021523mg             114   1e-25   
ref|XP_009605451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   1e-25   
gb|KHM99327.1|  Fasciclin-like arabinogalactan protein 3                113   2e-25   
gb|ABR16344.1|  unknown                                                 114   4e-25   Picea sitchensis
ref|XP_010669451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-25   
ref|XP_010034870.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   6e-25   
ref|XP_008352034.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   6e-25   
emb|CDY52668.1|  BnaC01g38580D                                          111   8e-25   
gb|KCW53929.1|  hypothetical protein EUGRSUZ_J03138                     112   9e-25   
ref|XP_009381782.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   9e-25   
ref|XP_009120424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   9e-25   
ref|NP_001046792.1|  Os02g0461500                                       111   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010102851.1|  hypothetical protein L484_004423                   110   2e-24   
gb|KDP28734.1|  hypothetical protein JCGZ_14505                         111   3e-24   
ref|XP_010527113.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-24   
ref|XP_002511740.1|  conserved hypothetical protein                     111   3e-24   Ricinus communis
ref|XP_009398985.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   3e-24   
gb|KFK32632.1|  hypothetical protein AALP_AA6G268600                    109   5e-24   
ref|XP_010913663.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   5e-24   
ref|XP_008777689.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   9e-24   
emb|CDY50538.1|  BnaA01g30420D                                          107   2e-23   
gb|ABK24724.1|  unknown                                                 108   2e-23   Picea sitchensis
dbj|BAK06740.1|  predicted protein                                      107   3e-23   
emb|CDY42162.1|  BnaC05g40570D                                          106   3e-23   
ref|NP_180021.1|  fasciclin-like arabinogalactan protein 3              107   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785088.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   4e-23   
gb|EMT17229.1|  hypothetical protein F775_11240                         106   4e-23   
gb|EMS62729.1|  hypothetical protein TRIUR3_26693                       106   4e-23   
ref|XP_006352538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   4e-23   
gb|ABR16637.1|  unknown                                                 107   5e-23   Picea sitchensis
ref|XP_006296192.1|  hypothetical protein CARUB_v10025354mg             106   5e-23   
ref|XP_009767783.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   5e-23   
ref|XP_002880584.1|  hypothetical protein ARALYDRAFT_481301             105   7e-23   
ref|XP_003526450.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   8e-23   
ref|XP_010506492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   9e-23   
ref|XP_009615606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   1e-22   
ref|XP_010429425.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   1e-22   
ref|XP_004248342.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   1e-22   
ref|XP_002320736.1|  Fasciclin-like arabinogalactan protein 8 pre...    106   1e-22   Populus trichocarpa [western balsam poplar]
emb|CDY00793.1|  BnaC03g37770D                                          104   2e-22   
gb|EPS66997.1|  hypothetical protein M569_07779                         106   2e-22   
gb|KHN16466.1|  Fasciclin-like arabinogalactan protein 14               103   2e-22   
ref|XP_010243936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   2e-22   
emb|CDY28643.1|  BnaC09g32320D                                          106   2e-22   
ref|XP_010518164.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-22   
emb|CDY08417.1|  BnaA05g26530D                                          103   2e-22   
ref|XP_004229828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   3e-22   
ref|XP_009802278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   3e-22   
ref|XP_004244059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   3e-22   
ref|XP_010435371.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   3e-22   
ref|XP_010472452.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-22   
ref|XP_010417204.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-22   
ref|XP_009625162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   4e-22   
ref|XP_006415013.1|  hypothetical protein EUTSA_v10025352mg             105   4e-22   
ref|XP_006404978.1|  hypothetical protein EUTSA_v10000470mg             103   5e-22   
ref|XP_010056276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   5e-22   
ref|XP_010508167.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   6e-22   
ref|XP_010496525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   6e-22   
dbj|BAP11159.1|  putative Fasciclin-like Arabinogalactan-protein 10     101   6e-22   
emb|CDY20316.1|  BnaC04g36400D                                          103   6e-22   
ref|XP_006483738.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   6e-22   
ref|XP_006450136.1|  hypothetical protein CICLE_v10010765mg             103   6e-22   
ref|XP_009417795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   7e-22   
ref|XP_006445226.1|  hypothetical protein CICLE_v10020328mg             104   7e-22   
ref|XP_010092859.1|  hypothetical protein L484_022454                   104   7e-22   
ref|XP_009133982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   8e-22   
ref|XP_006491459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   8e-22   
dbj|BAP11158.1|  putative Fasciclin-like Arabinogalactan-protein 10     100   1e-21   
emb|CDX68507.1|  BnaC01g25850D                                          103   1e-21   
ref|XP_004144548.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-21   
ref|XP_008462050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-21   
ref|XP_010479980.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-21   
ref|XP_006286070.1|  hypothetical protein CARUB_v10007603mg             103   1e-21   
gb|KFK32403.1|  hypothetical protein AALP_AA6G237100                    103   1e-21   
gb|AAM66074.1|  endosperm-specific protein-like protein                 103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566043.1|  FASCICLIN-like arabinogalactan protein 8              103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-21   
ref|XP_011034618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-21   
ref|XP_007049368.1|  FASCICLIN-like arabinogalactan 2                   103   2e-21   
ref|XP_006339448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   2e-21   
emb|CDP12467.1|  unnamed protein product                                102   2e-21   
emb|CDP17792.1|  unnamed protein product                                103   2e-21   
ref|XP_009120095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   2e-21   
dbj|BAP11161.1|  putative Fasciclin-like Arabinogalactan-protein 10     100   2e-21   
gb|ABV27488.1|  fasciclin-like arabinogalactan protein 17               102   2e-21   Gossypium hirsutum [American cotton]
ref|XP_009140554.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   2e-21   
dbj|BAP11162.1|  putative Fasciclin-like Arabinogalactan-protein 10   99.4    3e-21   
gb|EPS62290.1|  fasciclin-like arabinogalactan protein 13               102   4e-21   
ref|XP_011082039.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    100   5e-21   
ref|XP_002882015.1|  hypothetical protein ARALYDRAFT_483684             102   5e-21   
ref|XP_008460132.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   5e-21   
ref|XP_002863317.1|  hypothetical protein ARALYDRAFT_497154             101   7e-21   
ref|XP_010689281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   8e-21   
emb|CDX87001.1|  BnaC03g52710D                                          101   8e-21   
gb|KDP29933.1|  hypothetical protein JCGZ_18502                         101   8e-21   
ref|XP_008463001.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   8e-21   
ref|XP_003523715.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    8e-21   
ref|XP_006296250.1|  hypothetical protein CARUB_v10025417mg             101   9e-21   
ref|XP_006401420.1|  hypothetical protein EUTSA_v10013639mg             101   1e-20   
emb|CDY37904.1|  BnaA06g19130D                                          100   1e-20   
ref|XP_011095539.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-20   
ref|XP_009150168.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-20   
gb|ABV27482.1|  fasciclin-like arabinogalactan protein 11               100   1e-20   Gossypium hirsutum [American cotton]
gb|AIY35291.1|  fasciclin-like arabinogalactan 11                       100   1e-20   
ref|XP_002267946.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-20   Vitis vinifera
ref|XP_009363600.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    2e-20   
gb|KDP39270.1|  hypothetical protein JCGZ_01027                         100   2e-20   
ref|XP_002316776.2|  hypothetical protein POPTR_0011s09590g             100   2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006346133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   2e-20   
emb|CAN65447.1|  hypothetical protein VITISV_011425                     100   2e-20   Vitis vinifera
ref|XP_006858016.1|  hypothetical protein AMTR_s00069p00195790          100   2e-20   
emb|CBI28444.3|  unnamed protein product                                101   2e-20   
gb|AAK20858.1|AF333971_1  fasciclin-like arabinogalactan-protein 2      100   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65777.1|  putative pollen surface protein                         100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270426.2|  PREDICTED: fasciclin-like arabinogalactan pr...    100   2e-20   Vitis vinifera
ref|NP_193009.1|  fasciclin-like arabinogalactan protein 2              100   2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61077.1|  hypothetical protein VITISV_012919                     100   2e-20   Vitis vinifera
ref|XP_010692313.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.8    2e-20   
ref|XP_009104281.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.8    3e-20   
ref|XP_010542030.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    3e-20   
ref|XP_007052018.1|  FASCICLIN-like arabinogalactan protein 8         99.8    3e-20   
dbj|BAJ34929.1|  fasciclin-like arabinogalactan protein               99.4    4e-20   
ref|XP_009146602.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    4e-20   
emb|CDX76814.1|  BnaC08g34000D                                        97.8    4e-20   
ref|XP_011010616.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    4e-20   
ref|XP_004148925.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    4e-20   
emb|CDY34771.1|  BnaA09g41380D                                        97.8    4e-20   
gb|KHG09433.1|  Fasciclin-like arabinogalactan protein 1              99.4    4e-20   
ref|XP_009117125.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    5e-20   
ref|XP_010928138.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    5e-20   
emb|CDP13717.1|  unnamed protein product                              99.0    5e-20   
gb|EYU33706.1|  hypothetical protein MIMGU_mgv1a007367mg              99.0    6e-20   
gb|ADP88924.1|  fasciclin-like AGP                                    98.6    6e-20   
ref|XP_004306902.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    7e-20   
ref|XP_010497131.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    7e-20   
ref|XP_006397729.1|  hypothetical protein EUTSA_v10001463mg           98.6    7e-20   
ref|XP_004144998.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    7e-20   
ref|XP_011097758.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    8e-20   
ref|XP_010252769.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    8e-20   
ref|XP_007024813.1|  FASCICLIN-like arabinogalactan protein 14 pr...  97.4    8e-20   
ref|XP_010485145.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.2    9e-20   
dbj|BAE75863.1|  putative fasciclin-like arabinogalactan protein      98.6    9e-20   Salicornia europaea [chicken-claws]
ref|XP_004305460.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    1e-19   
ref|XP_008788906.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    1e-19   
ref|XP_010526275.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    1e-19   
emb|CDX73808.1|  BnaA03g32390D                                        95.9    2e-19   
ref|XP_010557720.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    2e-19   
ref|XP_010438048.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    2e-19   
gb|EYU32014.1|  hypothetical protein MIMGU_mgv1a007039mg              97.4    2e-19   
ref|XP_011090995.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.4    2e-19   
ref|XP_010277448.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.4    2e-19   
ref|XP_009135245.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    2e-19   
ref|XP_010063266.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    2e-19   
ref|XP_007218052.1|  hypothetical protein PRUPE_ppa006158mg           97.4    2e-19   
gb|AIY35292.1|  fasciclin-like arabinogalactan 12                     97.1    2e-19   
ref|XP_011038795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    2e-19   
ref|XP_008232692.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    3e-19   
gb|KFK37339.1|  hypothetical protein AALP_AA4G243700                  96.7    3e-19   
emb|CDY18927.1|  BnaC04g04230D                                        96.7    3e-19   
gb|AGN92424.2|  putative fasciclin-like arabinogalactan protein 4     95.5    4e-19   
gb|KDO38095.1|  hypothetical protein CISIN_1g013841mg                 97.1    4e-19   
ref|XP_004291803.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    4e-19   
ref|XP_010536730.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    4e-19   
ref|XP_007212310.1|  hypothetical protein PRUPE_ppa006726mg           96.3    4e-19   
ref|XP_010088447.1|  hypothetical protein L484_018219                 96.7    4e-19   
ref|XP_006447810.1|  hypothetical protein CICLE_v10015469mg           96.3    4e-19   
ref|XP_006469451.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    5e-19   
ref|XP_006603146.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    5e-19   
ref|XP_002320524.2|  hypothetical protein POPTR_0014s16610g           95.9    5e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006601616.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    5e-19   
ref|XP_010447580.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    6e-19   
ref|XP_010432871.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    6e-19   
ref|XP_011011127.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    6e-19   
ref|XP_006844054.1|  hypothetical protein AMTR_s00006p00245830        95.5    7e-19   
ref|XP_007215592.1|  hypothetical protein PRUPE_ppa007675mg           95.1    7e-19   
gb|ABV27481.1|  fasciclin-like arabinogalactan protein 10             95.9    7e-19   Gossypium hirsutum [American cotton]
ref|XP_010545276.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    7e-19   
ref|XP_009385381.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    8e-19   
ref|XP_002866110.1|  hypothetical protein ARALYDRAFT_495659           95.9    8e-19   
ref|XP_009375067.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    8e-19   
ref|XP_006286247.1|  hypothetical protein CARUB_v10007817mg           94.0    8e-19   
ref|NP_200384.1|  fasciclin-like arabinogalactan protein 1            95.5    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004516114.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    9e-19   
ref|XP_002298869.2|  hypothetical protein POPTR_0001s37650g           95.5    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002522745.1|  conserved hypothetical protein                   95.1    1e-18   Ricinus communis
ref|XP_008227156.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    1e-18   
gb|KDO59100.1|  hypothetical protein CISIN_1g015356mg                 95.1    1e-18   
ref|XP_008380005.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    1e-18   
ref|XP_006474892.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    1e-18   
ref|XP_010675939.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    1e-18   
gb|ABV27484.1|  fasciclin-like arabinogalactan protein 13             95.1    1e-18   Gossypium hirsutum [American cotton]
gb|EYU43168.1|  hypothetical protein MIMGU_mgv1a011668mg              93.6    1e-18   
ref|XP_009143146.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    1e-18   
emb|CDX74743.1|  BnaA05g04890D                                        95.1    1e-18   
ref|XP_008229928.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    2e-18   
ref|XP_002462113.1|  hypothetical protein SORBIDRAFT_02g019380        94.4    2e-18   Sorghum bicolor [broomcorn]
ref|XP_008228867.1|  PREDICTED: mucin-17-like                         96.7    2e-18   
ref|XP_009388359.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    2e-18   
ref|XP_007142534.1|  hypothetical protein PHAVU_008G288800g           94.4    2e-18   
ref|XP_002878353.1|  AT3g60900/T4C21_310                              94.7    2e-18   
ref|XP_006452590.1|  hypothetical protein CICLE_v10008218mg           95.1    2e-18   
ref|XP_011100491.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    2e-18   
emb|CDY36762.1|  BnaA03g11240D                                        91.3    2e-18   
emb|CBI39739.3|  unnamed protein product                              94.4    2e-18   
gb|AGV54413.1|  fasciclin-like arabinogalactan protein 1-like pro...  94.4    2e-18   
ref|XP_007146643.1|  hypothetical protein PHAVU_006G057400g           94.4    2e-18   
gb|EAZ42295.1|  hypothetical protein OsJ_26868                        94.0    3e-18   
ref|XP_009379279.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    3e-18   
gb|EYU27439.1|  hypothetical protein MIMGU_mgv1a007268mg              94.0    3e-18   
gb|KHG10798.1|  Fasciclin-like arabinogalactan protein 2              94.0    3e-18   
gb|EYU42817.1|  hypothetical protein MIMGU_mgv1a007557mg              94.0    3e-18   
ref|XP_008343059.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    3e-18   
gb|KFK27162.1|  hypothetical protein AALP_AA8G343200                  94.0    4e-18   
ref|XP_003581094.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    4e-18   
ref|XP_010942271.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    4e-18   
ref|XP_009351261.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    4e-18   
ref|XP_008809683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    5e-18   
ref|XP_008342240.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    5e-18   
ref|XP_010102850.1|  hypothetical protein L484_004422                 91.7    6e-18   
ref|XP_009418107.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    6e-18   
ref|XP_007020499.1|  Fasciclin-like arabinogalactan protein 1         93.2    6e-18   
dbj|BAE71278.1|  putative fasciclin-like arabinogalactan protein ...  93.2    6e-18   
ref|NP_191649.1|  fasciclin-like arabinogalactan protein 10           93.2    7e-18   
ref|XP_004956400.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    7e-18   
ref|XP_002267825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    7e-18   
gb|AAK55685.1|AF378882_1  AT3g60900/T4C21_310                         92.8    7e-18   
ref|XP_004491619.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    7e-18   
ref|XP_004303568.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    8e-18   
ref|XP_003519683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    9e-18   
gb|ACU21313.1|  unknown                                               89.4    9e-18   
ref|XP_003618047.1|  Fasciclin-like arabinogalactan protein           92.4    1e-17   
ref|XP_010061458.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    1e-17   
ref|XP_009132640.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    1e-17   
gb|EMS65354.1|  hypothetical protein TRIUR3_14037                     91.7    1e-17   
ref|XP_006352015.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    2e-17   
ref|XP_008651121.1|  PREDICTED: uncharacterized protein LOC100274...  91.7    2e-17   
gb|ABV27483.1|  fasciclin-like arabinogalactan protein 12             91.7    2e-17   
gb|ABI95418.1|  fasciclin-like protein FLA28                          91.7    2e-17   
ref|NP_194865.1|  FASCICLIN-like arabinogalactan protein 5            90.1    2e-17   
gb|EMT28749.1|  hypothetical protein F775_29839                       91.3    2e-17   
ref|XP_010525235.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    2e-17   
ref|XP_004965683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    2e-17   
ref|XP_003545484.2|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    2e-17   
ref|XP_003534603.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    2e-17   
ref|XP_006652672.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    2e-17   
gb|AEI98736.1|  fasciclin-like arabinogalactan 2                      91.7    3e-17   
ref|NP_001061532.1|  Os08g0321000                                     91.3    3e-17   
ref|NP_001062666.1|  Os09g0248100                                     90.9    3e-17   
ref|XP_006660446.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    3e-17   
ref|XP_010943291.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    4e-17   
ref|XP_003552347.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    4e-17   
gb|EPS69372.1|  fasciclin-like arabinogalactan protein 19             89.7    4e-17   
ref|XP_008803592.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    4e-17   
emb|CDP18905.1|  unnamed protein product                              90.5    5e-17   
gb|KEH34088.1|  fasciclin-like arabinogalactan protein                90.5    6e-17   
ref|XP_009616556.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    7e-17   
ref|XP_004251538.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    8e-17   
ref|XP_007139983.1|  hypothetical protein PHAVU_008G075000g           89.7    1e-16   
emb|CDX67846.1|  BnaA07g18860D                                        89.4    1e-16   
ref|XP_003532178.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    1e-16   
dbj|BAK00054.1|  predicted protein                                    89.0    1e-16   
emb|CDY66159.1|  BnaCnng49680D                                        89.4    2e-16   
ref|XP_009792211.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    2e-16   
ref|XP_006357643.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    2e-16   
gb|ABI95393.1|  fasciclin-like protein FLA3                           88.6    2e-16   
ref|XP_006653238.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    3e-16   
emb|CDX71771.1|  BnaC08g31030D                                        88.2    4e-16   
ref|XP_008797603.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    4e-16   
ref|XP_009142340.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    4e-16   
ref|XP_003576707.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    4e-16   
emb|CDY20747.1|  BnaA02g08870D                                        88.2    4e-16   
emb|CDY37043.1|  BnaA04g26210D                                        87.8    5e-16   
ref|XP_009379991.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.8    5e-16   
dbj|BAJ90388.1|  predicted protein                                    87.8    5e-16   
ref|XP_006402530.1|  hypothetical protein EUTSA_v10005998mg           87.4    6e-16   
ref|XP_010323900.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    8e-16   
gb|AFK41095.1|  unknown                                               87.0    9e-16   
ref|XP_009799147.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    9e-16   
emb|CDX86346.1|  BnaA06g30630D                                        87.0    1e-15   
ref|XP_009370988.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    1e-15   
gb|ABV27490.1|  fasciclin-like arabinogalactan protein 19             86.3    1e-15   
ref|XP_009108932.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    1e-15   
ref|NP_001150349.1|  fasciclin-like arabinogalactan protein 8 pre...  84.3    2e-15   
ref|XP_004501250.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    2e-15   
ref|XP_008649024.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    2e-15   
ref|XP_006292436.1|  hypothetical protein CARUB_v10018654mg           85.9    2e-15   
ref|XP_003580362.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    3e-15   
emb|CDY36445.1|  BnaC03g67650D                                        83.6    3e-15   
ref|NP_001141906.1|  uncharacterized protein LOC100274054 precursor   85.5    3e-15   
emb|CDY23293.1|  BnaA08g12530D                                        83.6    3e-15   
ref|XP_009606546.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    3e-15   
ref|XP_006659292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    3e-15   
ref|XP_004973191.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    3e-15   
ref|XP_010069727.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    4e-15   
ref|XP_004492650.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    4e-15   
ref|XP_002867304.1|  hypothetical protein ARALYDRAFT_491605           83.2    4e-15   
ref|XP_010512424.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    5e-15   
ref|XP_009126981.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    5e-15   
ref|XP_010469133.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    5e-15   
emb|CDY52341.1|  BnaA09g38900D                                        84.7    6e-15   
gb|KCW58153.1|  hypothetical protein EUGRSUZ_H00875                   84.3    6e-15   
gb|ACL36352.1|  fascilin-like arabinogalactan protein                 84.3    6e-15   
ref|XP_009116767.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    6e-15   
ref|XP_007150828.1|  hypothetical protein PHAVU_005G184100g           84.7    6e-15   
gb|EMT07250.1|  hypothetical protein F775_26198                       84.7    6e-15   
ref|XP_006280472.1|  hypothetical protein CARUB_v10026407mg           84.7    7e-15   
ref|XP_002440657.1|  hypothetical protein SORBIDRAFT_09g004700        84.3    7e-15   
ref|NP_001147121.1|  rat frizzled homolog1                            84.0    9e-15   
gb|ACN30673.1|  unknown                                               84.0    1e-14   
ref|XP_008362415.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    1e-14   
ref|NP_001053617.1|  Os04g0574200                                     84.0    1e-14   
ref|XP_006412600.1|  hypothetical protein EUTSA_v10027390mg           82.0    1e-14   
ref|NP_001149463.1|  fasciclin-like arabinogalactan protein 8 pre...  81.6    2e-14   
ref|XP_007216704.1|  hypothetical protein PRUPE_ppa026501mg           84.0    2e-14   
ref|XP_008228897.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    2e-14   
ref|XP_008342793.1|  PREDICTED: uncharacterized protein LOC103405558  82.4    4e-14   
ref|XP_010545153.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.4    4e-14   
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    4e-14   
ref|XP_009354314.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.0    5e-14   
ref|XP_009370989.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.0    5e-14   
ref|NP_001151356.1|  fasciclin-like arabinogalactan protein 10 pr...  81.6    6e-14   
tpg|DAA36388.1|  TPA: fasciclin-like arabinogalactan protein 10       81.6    6e-14   
gb|EMT13908.1|  hypothetical protein F775_11763                       79.3    7e-14   
ref|XP_010919185.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    8e-14   
ref|XP_006657210.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.3    9e-14   
ref|XP_004305604.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.3    9e-14   
ref|XP_008780048.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.9    1e-13   
ref|XP_006647825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    1e-13   
ref|XP_009138006.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.3    1e-13   
emb|CDY13425.1|  BnaA03g51430D                                        79.0    2e-13   
gb|EAZ01938.1|  hypothetical protein OsI_23966                        79.0    2e-13   
ref|XP_008342795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    2e-13   
ref|XP_010418601.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    2e-13   
ref|XP_002448368.1|  hypothetical protein SORBIDRAFT_06g026030        80.5    2e-13   
ref|XP_003603528.1|  Fasciclin-like arabinogalactan protein           78.2    2e-13   
ref|XP_003560388.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    3e-13   
ref|XP_011085650.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  79.7    3e-13   
gb|AAA91129.1|  putative surface protein                              77.4    4e-13   
ref|XP_002438784.1|  hypothetical protein SORBIDRAFT_10g026140        77.8    4e-13   
dbj|BAK07384.1|  predicted protein                                    77.4    5e-13   
dbj|BAK07804.1|  predicted protein                                    77.0    5e-13   
ref|XP_009354315.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    6e-13   
ref|XP_006595480.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    7e-13   
ref|XP_009391103.1|  PREDICTED: flocculation protein FLO11-like       78.6    8e-13   
gb|ABI95423.1|  fasciclin-like protein FLA33                          76.6    9e-13   
emb|CDX72305.1|  BnaC07g43270D                                        77.0    9e-13   
gb|EMT00417.1|  hypothetical protein F775_14876                       76.3    1e-12   
gb|ABI95391.1|  fasciclin-like protein FLA1                           78.2    1e-12   
ref|XP_009365292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    1e-12   
ref|XP_008342794.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    2e-12   
gb|KHN31865.1|  Fasciclin-like arabinogalactan protein 3              75.9    2e-12   
gb|KHN13519.1|  Fasciclin-like arabinogalactan protein 1              73.9    2e-12   
ref|XP_008803297.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.0    2e-12   
gb|EAY87366.1|  hypothetical protein OsI_08770                        75.1    3e-12   
ref|NP_001047988.1|  Os02g0726000                                     75.1    3e-12   
ref|XP_004965239.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.3    4e-12   
ref|NP_001058255.1|  Os06g0656800                                     74.3    6e-12   
gb|ABI95395.1|  fasciclin-like protein FLA5                           75.9    6e-12   
gb|KHN08266.1|  Fasciclin-like arabinogalactan protein 2              71.6    6e-12   
ref|XP_009382277.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.3    2e-11   
ref|XP_007137111.1|  hypothetical protein PHAVU_009G1004000g          71.2    2e-11   
ref|XP_002436882.1|  hypothetical protein SORBIDRAFT_10g010500        74.3    2e-11   
ref|XP_003572987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.9    3e-11   
ref|NP_001131728.1|  endosperm specific protein precursor             73.6    3e-11   
ref|XP_004976555.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.6    3e-11   
ref|XP_010104070.1|  hypothetical protein L484_014256                 72.8    5e-11   
ref|NP_001105408.1|  endosperm specific protein1 precursor            72.8    6e-11   
ref|XP_010030212.1|  PREDICTED: uncharacterized protein LOC104420...  72.8    8e-11   
ref|XP_010030210.1|  PREDICTED: uncharacterized protein LOC104420...  72.8    8e-11   
emb|CAH66152.1|  OSIGBa0097I11.4                                      71.2    9e-11   
ref|XP_006649316.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.0    1e-10   
gb|EAY93407.1|  hypothetical protein OsI_15204                        70.9    1e-10   
emb|CAD40213.2|  OSJNBa0019J05.11                                     70.5    2e-10   
gb|EMS55677.1|  hypothetical protein TRIUR3_04850                     70.9    2e-10   
ref|XP_010253181.1|  PREDICTED: fasciclin-like arabinogalactan pr...  70.9    3e-10   
ref|XP_004244698.2|  PREDICTED: skin secretory protein xP2-like       68.9    5e-10   
dbj|BAJ90216.1|  predicted protein                                    69.7    6e-10   
gb|KEH23329.1|  fasciclin-like arabinogalactan protein                69.7    7e-10   
ref|XP_010933921.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.3    9e-10   
ref|XP_003623747.1|  Fasciclin-like arabinogalactan protein           69.3    9e-10   
gb|ABI95392.1|  fasciclin-like protein FLA2                           69.3    1e-09   
ref|XP_004953764.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.3    1e-09   
gb|EEE60667.1|  hypothetical protein OsJ_14125                        67.4    1e-09   
gb|EAZ25443.1|  hypothetical protein OsJ_09260                        68.9    1e-09   
ref|XP_006607004.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.5    1e-09   
gb|EEC74435.1|  hypothetical protein OsI_09823                        65.5    2e-09   
ref|NP_001048836.2|  Os03g0128000                                     65.5    2e-09   
ref|XP_010922339.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.2    2e-09   
gb|AAM19119.1|AC104427_17  Putative endosperm specific protein        67.8    3e-09   
gb|AFW66310.1|  hypothetical protein ZEAMMB73_332533                  66.6    4e-09   
ref|XP_008679063.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.0    6e-09   
ref|XP_008680887.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.6    6e-09   
ref|XP_010229273.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.6    6e-09   
ref|XP_008802746.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.2    1e-08   
ref|XP_002452625.1|  hypothetical protein SORBIDRAFT_04g029330        65.9    1e-08   
ref|XP_002458743.1|  hypothetical protein SORBIDRAFT_03g039440        65.9    1e-08   
ref|XP_004987197.1|  PREDICTED: fasciclin-like arabinogalactan pr...  64.3    4e-08   
ref|XP_010252126.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.9    5e-08   
ref|XP_002991166.1|  hypothetical protein SELMODRAFT_448310           63.2    6e-08   
ref|XP_002982557.1|  hypothetical protein SELMODRAFT_58104            61.2    7e-08   
ref|XP_003571006.2|  PREDICTED: fasciclin-like arabinogalactan pr...  63.2    8e-08   
ref|XP_011089459.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.2    9e-08   
ref|XP_002970944.1|  hypothetical protein SELMODRAFT_441324           62.8    1e-07   
ref|XP_002488894.1|  hypothetical protein SORBIDRAFT_2276s002020      62.8    1e-07   
ref|XP_008674840.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.8    1e-07   
ref|XP_004954690.1|  PREDICTED: fasciclin-like arabinogalactan pr...  60.8    2e-07   
ref|XP_010232543.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.4    2e-07   
ref|XP_004970532.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.0    2e-07   
ref|XP_002439922.1|  hypothetical protein SORBIDRAFT_09g022560        62.0    2e-07   
ref|XP_008776771.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.0    2e-07   
ref|XP_004970533.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.0    2e-07   
gb|EEC71769.1|  hypothetical protein OsI_04379                        62.0    2e-07   
ref|NP_001044764.1|  Os01g0841100                                     62.0    3e-07   
ref|NP_001169235.1|  uncharacterized protein LOC100383093 precursor   61.6    3e-07   
ref|XP_008649714.1|  PREDICTED: fasciclin-like arabinogalactan pr...  61.2    4e-07   
ref|XP_008223499.1|  PREDICTED: fasciclin-like arabinogalactan pr...  61.2    4e-07   
ref|XP_006644987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  61.2    4e-07   



>gb|EPS65223.1| hypothetical protein M569_09558, partial [Genlisea aurea]
Length=276

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 147/232 (63%), Gaps = 19/232 (8%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            FN+T +L++YP+F++FN +LT+  LA +INSR T+TVLAVDNGG+ +LSG S D +K+V+
Sbjct  23   FNITHILEQYPDFDSFNNFLTQAKLASQINSRQTITVLAVDNGGVSSLSGMSSDAMKNVL  82

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            + H+VLDYYD  K   L  K+  LTTLFQS+G+  G QGFLN T   G  V  GSAV  A
Sbjct  83   SAHVVLDYYDEAKLHKLSNKSAILTTLFQSSGLGRGQQGFLNVTILSGGKVAFGSAVAGA  142

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKS-----------  346
            P G+NLV +V  + Y++S+LQ+SSLIIPPG++S     +PPS++    +           
Sbjct  143  PLGANLVKSVFSQPYNVSVLQVSSLIIPPGIDSATNATSPPSNRVPVPAPPPPVANPGPH  202

Query  345  PAAAPSPRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGESDSSAT  190
            P+AA SP      + S S   +A  PS   PA    DSPAS P  +S S  T
Sbjct  203  PSAAASPE-----ATSDSPQAAAEVPS---PATGTNDSPASSPAADSPSVET  246



>ref|XP_009615226.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
tomentosiformis]
Length=299

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 174/286 (61%), Gaps = 38/286 (13%)
 Frame = -2

Query  873  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK  694
            ++    AFN+T +L++Y +F+NFN YLT+T +A  INSR T+TVL V+N  +  LSGKS+
Sbjct  16   ILCHAKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQTITVLVVENSNLSPLSGKSQ  75

Query  693  DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMI  514
            DV+ ++M VH++LDYYDV+K   L  KT +  TLFQ+TG A+ DQG+LN TD G  +V +
Sbjct  76   DVLANIMRVHVLLDYYDVQKLQKLPNKTMKAPTLFQTTGQANSDQGYLNVTDLGSGSVAL  135

Query  513  GSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-------SIAPKAAPPSHQQH  355
            GSA K +  GSNLV ++A + Y+ISILQIS++IIP G++       S   +A  PS   +
Sbjct  136  GSAAKGSTLGSNLVKSIASQPYNISILQISNVIIPLGIDSSTNSPSSSPNRAPSPSTSDN  195

Query  354  --GKSPAAAPSPRKLLspsnspsdspSAL-----------TPSGVAPAAT--------ET  238
              G SP +APSP K  +P+ SPS +P +            TP+  +P+ T        + 
Sbjct  196  SSGPSPGSAPSPNKTSTPTPSPSAAPGSGSPPEPEPPAADTPAEPSPSPTSHAPGSPPKP  255

Query  237  DSP-------ASGPNGESDSSATTALEACLGFVMAIISANLFFFML  121
            D+P       A  P  +   SAT+ L+  L FV AI  +NLFF ++
Sbjct  256  DAPTADTPIAADAPTEDHSPSATSVLDISLIFV-AI--SNLFFVLV  298



>ref|XP_010265495.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nelumbo 
nucifera]
Length=295

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 154/257 (60%), Gaps = 16/257 (6%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L +Y +F+NFN YLT+T LA  IN R T+TVLAVDNG + +LSGKS D+I
Sbjct  35   STEAFNITRLLSQYSDFSNFNDYLTQTKLADSINRRQTITVLAVDNGAVSSLSGKSPDLI  94

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K V+++H++LDYYD+ K   L  K+T LTTLFQSTG+A   QGFLN T      V  GSA
Sbjct  95   KKVLSLHVILDYYDIDKIKKLSNKSTILTTLFQSTGVAVNKQGFLNVTRFASGEVRFGSA  154

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI----APKAAPPSHQQHGKSPAA  337
            VK +   + L+  VA + Y++S+LQ+SS+I P G+E I     P     +  +   SPA 
Sbjct  155  VKGSSLDAQLIKKVAAQPYNLSVLQVSSVIYPTGIEDIKFTPTPPPPRANAPRKSLSPAK  214

Query  336  APSP--------RKLLspsnspsdspSALTPSGVA--PAATET-DSPASGPNGESDSSAT  190
            AP+P        +  +   +  +D+P++  PS VA  PA   T D+ A GP G S SSAT
Sbjct  215  APAPASDSPSDAKAPVEGPSRDADTPASSPPSPVADGPAGDSTGDADAPGPEGPSASSAT  274

Query  189  -TALEACLGFVMAIISA  142
              A  A     M   S+
Sbjct  275  RVAFSAFFALAMGFFSS  291



>ref|XP_009784353.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
sylvestris]
Length=300

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L++Y +F+NFN YLT+T +A  INSR T+TVL V+N  +  LSGKS+DV+ ++
Sbjct  23   AFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQTITVLVVENSNLSPLSGKSQDVLANI  82

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            M VH++LDYYDV+K   L  KT +   LFQ+TG A+ DQG+LN TD G  +V +GSA K 
Sbjct  83   MRVHVLLDYYDVQKLQKLPNKTMKAPALFQTTGQANSDQGYLNVTDLGSGSVALGSAAKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVE  397
            A  GSNLV +VA + Y+ISILQIS+ IIP G++
Sbjct  143  ATLGSNLVKSVASQPYNISILQISNAIIPLGID  175



>gb|KCW80704.1| hypothetical protein EUGRSUZ_C02101 [Eucalyptus grandis]
Length=286

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 117/279 (42%), Positives = 160/279 (57%), Gaps = 31/279 (11%)
 Frame = -2

Query  897  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
             F A F     +  AFN+T +L +YP+F+ FN +LT+T L  +IN R T+TVLA+DN  +
Sbjct  9    LFFAVFIFSSSAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQTITVLALDNSAV  68

Query  717  GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            G +SGK  DV+KS+++ H+VLDYYD++K T L KK+T LTTL+QS+G A   QGFLN T 
Sbjct  69   GDISGKPADVLKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNVTK  128

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQ  358
              G+ ++ GSAVK A   + LV AVA + Y+IS+LQ+SS II PG+++  P     +   
Sbjct  129  QSGE-IVFGSAVKGASHNAKLVKAVAAQPYNISVLQVSSPIIAPGIDASNPNGTVHNATT  187

Query  357  HGKSPAAAP------SPRK----------LLspsnspsdspSALTPSGVAPAATETDSPA  226
               SPAA P      SP K              ++SP+D+P A  P   AP   E D+P 
Sbjct  188  PSASPAATPKKAPASSPAKSPVADTPDSSEAPAADSPADAPEADAPEASAP---EADAPT  244

Query  225  SGPNGESD-----------SSATTALEACLGFVMAIISA  142
            S P   SD           SS+   L    G VM ++SA
Sbjct  245  SSPPAPSDADADAPAPGKSSSSRVTLPVGAGIVMGLLSA  283



>ref|XP_010048457.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Eucalyptus 
grandis]
Length=345

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 117/281 (42%), Positives = 159/281 (57%), Gaps = 35/281 (12%)
 Frame = -2

Query  897  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
             F A F     +  AFN+T +L +YP+F+ FN +LT+T L  +IN R T+TVLA+DN  +
Sbjct  68   LFFAVFIFSSSAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQTITVLALDNSAV  127

Query  717  GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            G +SGK  DV+KS+++ H+VLDYYD++K T L KK+T LTTL+QS+G A   QGFLN T 
Sbjct  128  GDISGKPADVLKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNVTK  187

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-------------  397
              G+ ++ GSAVK A   + LV AVA + Y+IS+LQ+SS II PG++             
Sbjct  188  QSGE-IVFGSAVKGASHNAKLVKAVAAQPYNISVLQVSSPIIAPGIDASNPNGTVHNATT  246

Query  396  -----SIAPKAAPPSHQQHGKSPAAAPSPRKLLspsnspsdspSALTPSGVAPAATETDS  232
                 +  PK AP S     KSP A          ++SP+D+P A  P   AP   E D+
Sbjct  247  PSASPAATPKKAPASSP--AKSPVADTPDSSEAPAADSPADAPEADAPEASAP---EADA  301

Query  231  PASGPNGESD-----------SSATTALEACLGFVMAIISA  142
            P S P   SD           SS+   L    G VM ++SA
Sbjct  302  PTSSPPAPSDADADAPAPGKSSSSRVTLPVGAGIVMGLLSA  342



>ref|XP_011082708.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Sesamum 
indicum]
Length=322

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 119/170 (70%), Gaps = 0/170 (0%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++   L SFS++  S  AFN+T +L +Y +F+ FN +LT T+LA EINSR ++TVL V+N
Sbjct  5    VVKISLFSFSLLFHSAVAFNITQVLSQYASFSTFNSFLTLTNLASEINSRQSITVLVVEN  64

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              +  LSGKS DV+K +M+VH++LDY+DV K   L  K+T +TTLFQ+TG+A G QGF+N
Sbjct  65   NNLSPLSGKSSDVLKKIMSVHVILDYFDVPKLQKLSNKSTIVTTLFQTTGLAKGQQGFVN  124

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE  397
             T     ++  GSAV  +   SNLV +V  + Y+ S+LQ++++IIP G++
Sbjct  125  VTQLSSDSIAFGSAVPGSTISSNLVKSVVSQPYNFSVLQVTNVIIPEGID  174



>gb|KDP33435.1| hypothetical protein JCGZ_07006 [Jatropha curcas]
Length=299

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
              FL  F++   +  AFN+T +L  YP F+ FN+ L++T LA +INSR T+TVLAV N  
Sbjct  9    LLFLVLFTVFSSTSMAFNITRLLSNYPEFSTFNRLLSQTGLAQQINSRQTITVLAVANRA  68

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +  LSGK  DV K V+  H++LDYYD  K + L++K+  LTTL+Q+TG+A   QGFLN T
Sbjct  69   IRDLSGKPLDVTKRVLGAHVILDYYDETKLSKLQEKSNILTTLYQTTGVAVDQQGFLNVT  128

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
             T  K +M G A K AP   +L   VA + Y+IS+L++S +I  PG+ES   K+ PP   
Sbjct  129  RT-PKGIMFGPAAKGAPLTVSLKGVVASQPYNISVLKVSGVIEAPGIES---KSTPPPEG  184

Query  360  QHGKSPAAAPSP  325
             H K+P  AP+P
Sbjct  185  SHKKAPLPAPTP  196



>ref|XP_008799982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 158/277 (57%), Gaps = 21/277 (8%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++   L  F +++ S  AFN+T +L+ +P F  F+ YL +T L  EIN R T+TVL VDN
Sbjct  7    VVILVLFPF-LLLSSTMAFNITMILEPFPEFATFSNYLNQTKLVHEINHRQTITVLVVDN  65

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              M A+S   ++ +K VM VH++LDYYD++K + + +++  LTTLFQ+TG+A+   GFLN
Sbjct  66   SRMSAISSLPEESLKHVMEVHVILDYYDIRKISRIPRRSFLLTTLFQTTGIATNRMGFLN  125

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV---ESIAPKAA  376
             T   G++V+ GSAV+ AP  S L+  +    Y+IS+LQIS  IIPPG+     IAP +A
Sbjct  126  LTHKAGESVVFGSAVRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGIYGAPPIAPVSA  185

Query  375  PPSHQQHG-KSPAA----APSPRKLLspsnspsdspSALTPSGVAPAATET-----DSPA  226
            PP       ++P A      SP   +  + + +   S  TP+  +P A E+     + P+
Sbjct  186  PPKKTNPSVEAPEADDTPIESPEDDIVDAPADAPGESVETPAD-SPKADESVSDAPEEPS  244

Query  225  SGPNGESDSSATTALE------ACLGFVMAIISANLF  133
            +      D+S +T+L       A LG VM I+    F
Sbjct  245  TSCKKVIDASTSTSLSNRLSIGAILGLVMGIVFLRAF  281



>ref|XP_008786366.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=277

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 148/258 (57%), Gaps = 20/258 (8%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L+ +P F  F+ YL +T L  EIN R T+TVL VDN  M A+S   ++ +
Sbjct  19   SAVAFNITAILEPFPEFATFSNYLNQTKLVHEINHRQTITVLVVDNSRMSAISSLPEESL  78

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K VM VH++LDYYD++K   + +K+  LTTLFQ+TG+A+   GFLN T   G++V+ GSA
Sbjct  79   KHVMGVHVILDYYDIRKINNIPRKSFILTTLFQTTGIATNRMGFLNVTHKAGESVVFGSA  138

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE--------SIAPKAAPPSHQQHGK  349
            V+ AP  S L+  V    Y+IS+L IS  IIPPG++        S  PK   PS +    
Sbjct  139  VRGAPHTSTLIKKVVAMPYNISVLHISEPIIPPGIDGAPHIAPISSLPKETEPSAETPEV  198

Query  348  SPAAAPSPRKLLspsnspsdspSALTPSGVAPAATETDSPAS-GPNGESD----SSATTA  184
              A   SP + +  + + +   SA TP+  +P A E  S AS GP+        +SA+T+
Sbjct  199  EDAPTESPEEDIVDAPANAPGESADTPAD-SPEADEPASDASEGPSISRKKVFHASASTS  257

Query  183  LE------ACLGFVMAII  148
            L       A LG VM I+
Sbjct  258  LRSRLSIGAILGLVMWIV  275



>ref|XP_011034724.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Populus 
euphratica]
Length=314

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 125/195 (64%), Gaps = 0/195 (0%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +F    S  ++  +  A N+T +L +YP+F+ F+ YLT+T LAGEINSR T+TVL V+NG
Sbjct  8    LFALCFSSFLLFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENG  67

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             M  LSGK    IK+V++ H++LDYYDV K   L+KKT  LTTLFQS+G A G QGFLN 
Sbjct  68   NMSPLSGKPNGEIKNVLSEHVILDYYDVAKLQKLQKKTAMLTTLFQSSGQAKGQQGFLNV  127

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSH  364
            T  G  +V  GSAV  +   SNLV +V+ + Y+IS+LQ+S++I+P G  +     +P   
Sbjct  128  TVLGSNSVAFGSAVPGSSLSSNLVKSVSSQPYNISVLQVSNIIVPAGTGNTNSSTSPVPV  187

Query  363  QQHGKSPAAAPSPRK  319
                 SP  A SP K
Sbjct  188  GPPKTSPTPASSPNK  202



>ref|XP_006368661.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
 gb|ERP65230.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
Length=310

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 102/153 (67%), Gaps = 0/153 (0%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +F    S  ++  +  A N+T +L +YP+F+ F+ YLT+T LAGEINSR T+TVL V+NG
Sbjct  8    LFALCFSSFLLFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENG  67

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             M  LSGK    IK+V++ H++LDYYDV K   L+ KT  LTTLFQS+G A G QGFLN 
Sbjct  68   NMSPLSGKPNGEIKNVLSGHVILDYYDVAKLQKLQNKTAMLTTLFQSSGQAKGQQGFLNV  127

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            T  G  +V  GSAV  +   SNLV +V+ + Y+
Sbjct  128  TVLGSNSVAFGSAVPGSSLSSNLVKSVSSQPYN  160



>ref|XP_010909123.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=259

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 144/252 (57%), Gaps = 27/252 (11%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L+ Y +++ FN YLT+T LA EIN R T+T+L VDN  M A+  K  +++
Sbjct  17   SVEAFNITHILESYSSYSTFNNYLTQTKLAEEINHRQTITILVVDNSKMSAVFSKPIEIL  76

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K++MA+HI+LDYYD  K + +  K+  LTTLFQ++G+A+   GFLN T+     V+ GSA
Sbjct  77   KNIMAIHIILDYYDTNKLSHIPHKSALLTTLFQTSGIANNKLGFLNVTNMPNDDVVFGSA  136

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGK---SPAAA  334
               AP  S     V  + Y+ISIL+IS LI+PPG+ES A +A+PP+ Q+  K   S A A
Sbjct  137  TPEAPLSSTFTKMVVTKPYNISILEISDLILPPGIES-AKQASPPATQEKAKPTNSTAHA  195

Query  333  PSPRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGES----------DSSATTA  184
            P+            +   A TP   A A    DSP   P  ++           S++ T 
Sbjct  196  PA----------TIEESPADTP---ADAPNIVDSPMDSPQADAPDALDAPTTHSSASQTL  242

Query  183  LEACLGFVMAII  148
            +   LG V+ +I
Sbjct  243  VNGILGLVVGVI  254



>ref|XP_002527970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34382.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 118/170 (69%), Gaps = 1/170 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
              FLA F I   +  AFN+T +L  YP+F+ FN  LT+T LA +INSR T+TVLAV NG 
Sbjct  8    LLFLALFCIFSSTSTAFNITRILSNYPDFSTFNSLLTQTGLAQQINSRQTITVLAVSNGA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G +SGK  D++K +++ H++LDYYD KK   ++K+++ LTTL+Q+TG A+  QGFLN T
Sbjct  68   IGGVSGKPVDIVKRILSAHVILDYYDQKKLENIKKQSSILTTLYQTTGSANDQQGFLNVT  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI  391
             T    ++ GSAVK AP   +L  +VA + Y+IS+LQ+  +I  PG+E++
Sbjct  128  KTPNG-IVFGSAVKGAPLTVSLEGSVASQPYNISVLQVGGVIEAPGIENM  176



>ref|XP_006357108.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Solanum 
tuberosum]
Length=328

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 124/192 (65%), Gaps = 17/192 (9%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            +FN+T++L+ Y +++NFN YLT+T +A  INSR T+TVL V+N  +  L G S+DVI ++
Sbjct  22   SFNITSLLNHYSSYSNFNNYLTQTGVAAAINSRQTITVLVVENNNLSPLKGMSQDVIANI  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            M VH++LDYYDV K   L  KT +  TLFQ+TG A+ DQGFLN TD G  ++ +GSA K 
Sbjct  82   MRVHVLLDYYDVPKMQMLPNKTMKTPTLFQTTGYANNDQGFLNMTDLGTGSISLGSAAKG  141

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVES--------------IAPKAAP---PS  367
               GS LV ++A + Y+ISILQIS++IIP G++S                  +AP   P+
Sbjct  142  ETLGSKLVKSIASQPYNISILQISNVIIPSGIDSSTQASPPPSSPHAPAPISSAPTYSPA  201

Query  366  HQQHGKSPAAAP  331
            +  HG S A AP
Sbjct  202  YSPHGSSAAPAP  213



>emb|CAN62804.1| hypothetical protein VITISV_011795 [Vitis vinifera]
Length=365

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L +Y +F+ FN YLT+T LA +IN R ++T+LAVDNGG+  LSGK KDVIK V
Sbjct  25   AFNITQLLAQYSDFSTFNGYLTDTQLAADINKRQSITILAVDNGGLSPLSGKPKDVIKKV  84

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++H+VLDY+DV K   L   T  L TLFQ++G ++G QGFLN T      V+ GSAV  
Sbjct  85   VSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSAVHG  144

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVE  397
               G+NLV ++A + Y+IS+LQIS++IIP G++
Sbjct  145  TTLGANLVKSIASQPYNISVLQISTVIIPSGLD  177



>ref|XP_002271150.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=312

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L ++ +F+ FN YLT+T LA +IN R ++T+LAVDNGG+  LSGK KDVIK V
Sbjct  25   AFNITQLLAQFSDFSTFNGYLTDTQLAADINKRQSITILAVDNGGLSPLSGKPKDVIKKV  84

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++H+VLDY+DV K   L   T  L TLFQ++G ++G QGFLN T      V+ GSAV  
Sbjct  85   VSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSAVHG  144

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVE  397
               G+NLV ++A + Y+IS+LQIS++IIP G++
Sbjct  145  TTLGANLVKSIASQPYNISVLQISTVIIPSGLD  177



>ref|XP_006382179.1| putative surface family protein [Populus trichocarpa]
 gb|ERP59976.1| putative surface family protein [Populus trichocarpa]
Length=302

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 143/251 (57%), Gaps = 41/251 (16%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
              F+A F  ++ +  AFN T +L +YP F NFN  L+++ LA E+NSR T+TVL +DNG 
Sbjct  8    LLFIA-FLCLISTSTAFNSTKILAQYPEFANFNDLLSQSGLAQEMNSRQTITVLVLDNGS  66

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +  LSG+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G+A   QGFLN +
Sbjct  67   IDGLSGRPLDIAKRILSAHVILDYYDQIKLSKLQKASTIVTTLYQASGVADNRQGFLNIS  126

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIA---------  388
             T  + +  GSA+K AP  ++LV ++  + Y+IS+LQ+S  I  PG+E++A         
Sbjct  127  RT-AEGIKFGSAMKGAPLVASLVKSIYSQPYNISVLQVSEPIETPGIENMAPPPPPGTAA  185

Query  387  --------------PKAAPPSHQQHGKSPAAAPSPRKLLspsnspsdspSALTPSGVAPA  250
                          P AAPP+ +   KSPA +PS                A  PS   P 
Sbjct  186  VPKKAPAPAPSTKTPPAAPPTAKTPAKSPAKSPS---------------KAPAPSKEGP-  229

Query  249  ATETDSPASGP  217
            +T T +PA GP
Sbjct  230  STPTKAPAEGP  240



>ref|XP_004244694.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Solanum 
lycopersicum]
Length=251

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 148/252 (59%), Gaps = 17/252 (7%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F FL++      S  AFNVT +L +YP++ NFN  +++T LA EIN++ T+T+LA+ NG 
Sbjct  12   FLFLSA-----SSASAFNVTKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIPNGA  66

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G L+ K  DV+K ++  H+VLDYYD  K   L+ KT++LTT+FQ +G AS DQGFLN T
Sbjct  67   IGDLTSKPNDVVKKILTTHVVLDYYDTMKLQKLKDKTSKLTTMFQESGKASNDQGFLNVT  126

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
                 T + GSAVK+A + S L  +V ++ Y+ISIL IS  I+ PG++S    ++  +  
Sbjct  127  -AKDNTFVFGSAVKDAQRDSRLEKSVMNQPYNISILGISQPIVTPGIDSPLSPSS--APS  183

Query  360  QHGKSPAAAPSPRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGESDSSATTAL  181
                +P ++P   +  +   + + +  A +PS         DSPA+     S SSA   L
Sbjct  184  PKANTPKSSPPKAESPAEEEAEAPTKDADSPSA--------DSPAADAQAPSSSSA-DKL  234

Query  180  EACLGFVMAIIS  145
            +   GF + + S
Sbjct  235  KISFGFFVVLAS  246



>ref|XP_009394682.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 122/175 (70%), Gaps = 7/175 (4%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+TT+L K+P+F+ F+  LT T LA +INSR T+TVLAV+NG + + SG+  DV+K +++
Sbjct  20   NITTILAKFPDFSTFSDLLTRTQLASDINSRKTITVLAVNNGAISSASGQPTDVLKKILS  79

Query  669  VHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAP  490
            +H+VLDYYD  KF  L  ++  LTTLFQS+G+ASG  GFLN TD     V  GSAV  + 
Sbjct  80   LHVVLDYYDGDKFHKLRNRSAILTTLFQSSGVASGRSGFLNVTDMDNGQVSFGSAVPGSS  139

Query  489  QGSNLVSAVAHEGYDisilqissliIPPGV-ESIAPKAAPPSHQQHGKSPAAAPS  328
              +N V+ +A + Y+IS+++ISS+I+PPG+ +  APKA+P        S +AAPS
Sbjct  140  LDANFVTVLATQPYNISVVEISSVIVPPGLSDGAAPKASP------ATSKSAAPS  188



>ref|XP_010324668.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Solanum 
lycopersicum]
Length=265

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -2

Query  894  FLASFSIMVWSCG-AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
             L SF I+  S   AFN+T +L +Y +++ FN+ L+++ LA +INSRGT+T+LAV NG +
Sbjct  8    LLCSFLILFASSASAFNITKILGQYSDYSTFNELLSKSGLASDINSRGTITLLAVPNGAV  67

Query  717  GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            G L+ KS DV+K V+A H+VLDYYD  K   ++ KT ++TT+FQ +G A+ DQGFLN T 
Sbjct  68   GDLTSKSDDVLKRVLATHVVLDYYDPMKLQKMKDKTAKMTTMFQQSGKAAYDQGFLNVTA  127

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  370
              G  V  GSAV  A + S L  +V ++ Y+ISIL IS  I+ PG++ ++AP +APP
Sbjct  128  KDGSFVF-GSAVVGAQRDSKLEKSVMNQPYNISILGISQPIVTPGLDGTMAPISAPP  183



>ref|XP_009593249.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=272

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            I   L  F ++  S  AFN+T +L ++ +++ FN  L+++ LA EIN R T+T+LAV NG
Sbjct  5    IVALLCYFLLLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRATITILAVPNG  64

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             +G L+ KS DV+KSV++ ++VLDYYD+ K   L+ KT +LTT++Q +G A  DQGFLN 
Sbjct  65   AIGDLTSKSDDVLKSVLSTYVVLDYYDIPKLKNLKDKTAKLTTMYQQSGKAGYDQGFLNV  124

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  370
            T   G  V  GSAVK A + S L  +V ++ Y+ISIL IS  I+ PG++ ++AP +APP
Sbjct  125  TAKDGSFVF-GSAVKGAQRDSRLEKSVMNQPYNISILGISQPIVTPGLDGTLAPVSAPP  182



>ref|XP_008799981.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L+ +P F  F+ YL++T L  EIN R T+TVL VDN  M A+S   ++ +
Sbjct  20   SAMAFNITMILEPFPEFATFSNYLSQTKLVHEINHRQTITVLVVDNSRMSAISSLPEESL  79

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K VM VH++LDYYD+ K +++ +K   LTTLFQ+TG+A+   GFLN +   GK+V+ GSA
Sbjct  80   KHVMEVHVILDYYDITKISSIPRKNFLLTTLFQTTGIATSRIGFLNLSHKAGKSVVFGSA  139

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            V+ AP  S L+  +    Y+IS+LQIS  IIPPG+
Sbjct  140  VRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGI  174



>ref|XP_004952427.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Setaria 
italica]
Length=295

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              AFN+T +L ++P+F  FN  L++  LA +IN R T+TVLAVDNG  G +S    DV +
Sbjct  21   AAAFNITRLLGEFPDFTTFNNLLSQAKLADDINRRQTITVLAVDNGAAGGISSLPSDVQR  80

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
             V+++H+VLDYYD  K   ++  TT LTT+FQS+G A+   GFLN T     T++ GSA 
Sbjct  81   KVLSMHVVLDYYDTAKLGAIKNHTTLLTTMFQSSGQATDRMGFLNFTKRSDGTMVFGSAE  140

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ-------QHGKSP  343
              AP+ S +V +VA   Y+IS+LQ+S+ I+PPGV   A   APP H+          K  
Sbjct  141  PGAPKNSQMVKSVASRPYNISVLQVSAPIVPPGVGGSADAGAPPPHKATALAPAPAAKGK  200

Query  342  AAAPSPR  322
              APSP+
Sbjct  201  KGAPSPK  207



>ref|XP_004136457.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 ref|XP_004162501.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 gb|KGN60156.1| hypothetical protein Csa_3G881690 [Cucumis sativus]
Length=280

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 112/165 (68%), Gaps = 2/165 (1%)
 Frame = -2

Query  882  FSIMVWSCG-AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            F+ +++S   AFN+T +L ++P+F NFN  LT+T LA +INSR T+T+LAVDNG +  +S
Sbjct  12   FNFLLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINSRKTITILAVDNGAISGIS  71

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkf-ttlekkttrlttLFQSTGMASGDQGFLNATDTGG  529
            GK  DV+K +++VH++LDYYDV+K        TT LTTL+Q++G A+ +QGFL  T    
Sbjct  72   GKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGTATNEQGFLKVTLINE  131

Query  528  KTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES  394
              V   SAVK A   S LV +V  + Y+I +LQI+S I  PG+++
Sbjct  132  GEVAFKSAVKGATADSKLVKSVVSQPYNIVVLQITSPIQVPGIDT  176



>gb|KFK38614.1| hypothetical protein AALP_AA3G137100 [Arabis alpina]
Length=256

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            +IFFF +SF  +  S  +FN+T +LD++ +F+ FN  LT+T LA  INSR T+TVLAV N
Sbjct  9    LIFFFASSF--LYTSSNSFNITNILDQHHDFSTFNDLLTQTQLASAINSRQTITVLAVSN  66

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
            G + +LS K K ++K+++++HIVLDYYD KK   L KK+  LTTLFQS+G+A G QGFLN
Sbjct  67   GALSSLSDKPKAMLKNILSLHIVLDYYDEKKLKNLNKKSVILTTLFQSSGLARGQQGFLN  126

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAV  463
            AT T    V  GSAV  +P  + L  +V
Sbjct  127  ATVTKDGDVSFGSAVPGSPLNAQLEESV  154



>ref|XP_008466329.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=278

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 129/209 (62%), Gaps = 22/209 (11%)
 Frame = -2

Query  882  FSIMVWSCG-AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            F+ +++S   AFN+T +L ++P+F NFN  LT+T LA +IN+R T+T+LAVDNG +  +S
Sbjct  12   FNFLLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINNRKTITILAVDNGAISGIS  71

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkf-ttlekkttrlttLFQSTGMASGDQGFLNATDTGG  529
            GK  DV+K +++VH++LDYYDV+K        TT LTTL+Q++G A+  QGFL  T    
Sbjct  72   GKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGAATNQQGFLKVTLINE  131

Query  528  KTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES---------------  394
              V   SAVK A   S LV +VA + Y+IS+LQI+S I  PG+++               
Sbjct  132  GEVAFESAVKGATADSKLVKSVASQPYNISVLQITSPIQVPGIDAKPTNSTTAPPPSKSS  191

Query  393  ---IAPKAAP-PSHQQH-GKSPAAAPSPR  322
                +PK AP PS +    KSP AA SP+
Sbjct  192  SPAGSPKEAPVPSAETPVAKSPKAAKSPK  220



>ref|XP_006371803.1| putative surface family protein [Populus trichocarpa]
 gb|ERP49600.1| putative surface family protein [Populus trichocarpa]
Length=271

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 130/200 (65%), Gaps = 6/200 (3%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
              F+A   ++  +  AFN+T +L +YP F +FN  LT++ LA E++SR T+TVLA+DN  
Sbjct  8    LLFIAILCLISSTSTAFNITKILAQYPEFVSFNDLLTQSGLAKEMSSRETITVLALDNSS  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G LSG+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G A   QGFLN +
Sbjct  68   IGGLSGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNIS  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
             T  + +  GSAVK AP  ++LV  V  + Y+IS+LQ+S  I  PG+E++AP   P +  
Sbjct  128  RT-AEGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIENMAPPPPPAAVP  186

Query  360  QH-----GKSPAAAPSPRKL  316
            +       KSP+ AP+P K+
Sbjct  187  KKAPAPTAKSPSKAPAPSKV  206



>gb|AFK47920.1| unknown [Medicago truncatula]
Length=287

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 96/286 (34%), Positives = 148/286 (52%), Gaps = 36/286 (13%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET L G+IN R T+TV A+DNG 
Sbjct  8    FLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDNGA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M ++S K  + I+++MA H++LDYYD  K      K   LTTL+QS+G+A   QG+L   
Sbjct  68   MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMHKREPLTTLYQSSGIAVDQQGYLKVN  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI---------A  388
             T    + IGSAV  AP    LV  V  + Y+I+I+Q++  I+ PG+E+          A
Sbjct  128  RTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPIMFPGLETQTLGAPSNGSA  187

Query  387  PKA-----------APPSHQQHGKSPAAAPSPRKLLspsnspsdspSALTPSGVAPAATE  241
            P A           APP+  ++  +P+AA  P          ++   + +PS   P+ + 
Sbjct  188  PAAETNVDVSSVFKAPPAKAKNASAPSAAEEP---------ITEVSDSPSPSD-EPSESP  237

Query  240  TDSPAS------GPNGESDSSATTALEACLGFVMAIISANLFFFML  121
             ++PA       GP G+  ++      +    V+  + A + FF L
Sbjct  238  VEAPAKSPSLAPGPGGDEAAADAAPTSSSSRIVVGFVGAVMCFFSL  283



>ref|XP_010465042.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=254

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 104/149 (70%), Gaps = 2/149 (1%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            + FFF+++F  +  S  +FN+T +L+++ +F+ FN+ LTET LA  INSR T+TVL V N
Sbjct  7    LFFFFVSTF--LYTSSNSFNITNILNEHDDFSTFNKLLTETQLASTINSRQTITVLVVSN  64

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
            GG+ +LSG+  ++IK ++++HI+LDYYD KK   L KK+  LTTLFQS+G A G QGFLN
Sbjct  65   GGLSSLSGQPINLIKKILSLHIILDYYDEKKLKNLNKKSVLLTTLFQSSGQARGQQGFLN  124

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVA  460
            AT T    V+ GSAV      + L+ +VA
Sbjct  125  ATVTKDGDVLFGSAVPGPDVNAELLDSVA  153



>ref|XP_010914304.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=282

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A+NVT +L+ + +F  FN YLT T LA EIN R T+TVL VDN  M ALS    + +K V
Sbjct  21   AYNVTQILEPFSDFATFNNYLTRTKLADEINRRQTITVLVVDNSKMSALSSLDVETLKHV  80

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            MAVH++LDYYD  K + +   +  LTTLFQ+TG+A  + GFLN T    + ++ GSA + 
Sbjct  81   MAVHVILDYYDENKLSHISNNSALLTTLFQTTGIAKNNLGFLNVTRKPNEAMLFGSAFQK  140

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV-------ESIAPKAAP--PSHQQHGKSP  343
            AP  S     +    Y+ISILQIS  I+PPG+        S+APK AP      +  KS 
Sbjct  141  APLSSTFSKVIITMPYNISILQISDPIVPPGIGGAKKTSSSMAPKNAPALAPVAKPAKST  200

Query  342  AAAPSP  325
            A AP+P
Sbjct  201  ANAPAP  206



>gb|KDP41920.1| hypothetical protein JCGZ_26938 [Jatropha curcas]
Length=228

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = -2

Query  837  MLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMAVHIV  658
            ML++Y ++  FN  L++T +A  INSR T+TVLAVDNG +GAL+G S DV K ++ +H+V
Sbjct  1    MLNQYSDYGTFNDLLSKTRIAEAINSRRTITVLAVDNGNLGALTGYSTDVQKHILDLHVV  60

Query  657  LDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAPQGSN  478
            LDYYD  K   ++KK+  LTTL+QSTG A G QGFLN T+ GG ++  GSAVK +   +N
Sbjct  61   LDYYDETKLKNIKKKSALLTTLYQSTGSARGQQGFLNVTNDGG-SIRFGSAVKGSGLNAN  119

Query  477  LVSAVAHEGYDisilqissliIPPGVES--IAPKAAPPSHQQHGKSPAAAPSPR  322
            LV +V  + Y+IS+LQ+S++IIP G+++    P A  PS  +  +  A  P+P 
Sbjct  120  LVGSVTSQPYNISVLQVSNIIIPQGLDTSNTPPPAKTPSPSEAPEPSAETPTPE  173



>ref|XP_009787705.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=267

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -2

Query  894  FLASFSIMV-WSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
             L +F ++   S  AFN+T +L +Y +++ FN+ L+++ LA EIN R T+T+LAV NG +
Sbjct  8    ILCTFLLLAATSASAFNITKILSQYSDYSTFNELLSKSGLAAEINKRATITILAVPNGAI  67

Query  717  GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            G L+ KS DV+K  ++ +++LDYYD+ K  ++++KT ++T ++Q +G A+ DQGFLN T 
Sbjct  68   GDLTSKSDDVLKRELSTYVILDYYDIPKLRSMKEKTAKMTNMYQQSGKAAYDQGFLNVTA  127

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  370
              G  V  GSAVK A + S L  +V ++ Y+ISIL IS  ++ PG++ ++AP +APP
Sbjct  128  KDGSFVF-GSAVKGAQRDSRLEKSVMNQPYNISILGISQPMVTPGLDGTLAPVSAPP  183



>ref|XP_009781936.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=273

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 120/179 (67%), Gaps = 2/179 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            I   L  F ++  S  AFN+T +L ++ +++ FN  L+++ LA EIN R T+T+LAV NG
Sbjct  5    IVTLLCYFLLLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRTTITILAVPNG  64

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             +G L+ KS DV+ SV++ ++VLDYYD+ K  +L+ KT ++TT++Q +G A  DQGFLN 
Sbjct  65   AIGDLTSKSDDVLNSVLSTYVVLDYYDIPKLKSLKDKTAKMTTMYQQSGKARFDQGFLNM  124

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  370
            T   G  V  GSAVK+A + S L  +V ++ Y+IS+L IS   + PG++ ++AP + PP
Sbjct  125  TAKDGSFVF-GSAVKDAQRDSRLEKSVMNQPYNISVLGISQPFVTPGLDGTLAPVSTPP  182



>ref|XP_007161299.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
 gb|ESW33293.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
Length=282

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 127/203 (63%), Gaps = 16/203 (8%)
 Frame = -2

Query  894  FLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMG  715
            FL +FS  V+    F++T ML+K P  ++FN+Y+TE  LA +INSR T+TVLAV N  + 
Sbjct  13   FLLAFSSAVY---GFDITKMLEKEPELSSFNKYITEAKLADQINSRNTITVLAVGNDAIS  69

Query  714  ALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDT  535
            +++GKS ++IK++++ H++LDYYD KK    +  T +LTTLFQS+G A  +QGF+  +  
Sbjct  70   SIAGKSPELIKAIISTHVILDYYDEKKLVEAQASTPQLTTLFQSSGNAVKEQGFVKVSLI  129

Query  534  GGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIA------PKAAP  373
            G   +   S    +   S LV  +A E Y+ISILQ++  IIPPG++S         KA+P
Sbjct  130  GEGEIAFSSV--GSSDYSELVKPIASEPYNISILQVTKPIIPPGLDSQTAQSPQQAKASP  187

Query  372  PSHQQHGKSP-----AAAPSPRK  319
            P+  +  K+P     A APSP K
Sbjct  188  PTSSKTAKAPAPSKTAKAPSPAK  210



>gb|KEH39773.1| fasciclin domain protein [Medicago truncatula]
Length=287

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 105/169 (62%), Gaps = 0/169 (0%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET L G+IN R T+TV A+DNG 
Sbjct  8    FLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDNGA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M ++S K  + I+++MA H++LDYYD  K     +K   L TL+QS+G+A   QG+L   
Sbjct  68   MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMRKRELLITLYQSSGIAVDQQGYLKVN  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES  394
             T    + IGSAV  AP    LV  V  + Y+I+I+Q++  I+ PG+E+
Sbjct  128  RTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPILYPGLET  176



>ref|XP_006357096.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Solanum 
tuberosum]
Length=262

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 114/172 (66%), Gaps = 13/172 (8%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T +L +YP++ NFN  +++T LA EIN++ T+T+LA+ NG +G L+ KS DV+K ++ 
Sbjct  24   NITKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIPNGAIGDLTSKSNDVVKKILT  83

Query  669  VHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAP  490
             H+VLDYYD  K   L+ KTT+LTT+FQ +G AS DQGFLN T     T + GSAVK+A 
Sbjct  84   THVVLDYYDTMKLQKLKDKTTKLTTMFQESGKASNDQGFLNVT-AKDNTFVFGSAVKDAQ  142

Query  489  QGSNLVSAVAHEGYDisilqissliIPPGVESI------------APKAAPP  370
            + S L  +V ++ Y+ISIL IS  I+ PG++S              PK++PP
Sbjct  143  RDSRLEKSVMNQPYNISILGISQPIVTPGIDSPLAPSSAPPPKANTPKSSPP  194



>ref|XP_011015272.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Populus 
euphratica]
Length=271

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 129/200 (65%), Gaps = 6/200 (3%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
              F+A   ++  +  AFN+T +L +YP F  FN  LT++ LA E++SR T+TVLA+DN  
Sbjct  8    LLFIAILCLISSTSTAFNITKILGQYPEFVGFNDLLTQSGLAKEMSSRETITVLALDNSS  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G L+G+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G A   QGFLN +
Sbjct  68   IGGLNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNIS  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
             T  + +  GSAVK AP  ++LV  V  + Y+IS+LQ+S  I  PG+E++AP   P +  
Sbjct  128  RT-AEGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIENMAPPPPPAAVP  186

Query  360  QH-----GKSPAAAPSPRKL  316
            +       KSP+ AP+P K+
Sbjct  187  KKAPAPTAKSPSKAPAPSKV  206



>ref|XP_009612463.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=276

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -2

Query  894  FLASFSIMV-WSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
             L +F ++   S  AFN+T +L +Y +++ FN+ L+++ LA EIN R T+TVLAV NG +
Sbjct  8    LLCTFLLLAATSASAFNITKILSQYSDYSTFNELLSKSGLATEINKRATITVLAVPNGAI  67

Query  717  GALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            G L+ KS DV+K  ++ H+VLDYYD  K   +++KT +LT ++Q +G A+ DQGFLN T 
Sbjct  68   GDLTSKSDDVLKRDLSTHVVLDYYDPMKLRNMKEKTAKLTNMYQQSGKAAYDQGFLNVTA  127

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  370
              G  V  GSAVK A + S L  +V ++ Y+ISIL IS  I  PG++ ++AP +APP
Sbjct  128  KDGSFV-FGSAVKGAQRDSRLEKSVMNQPYNISILGISQPIFTPGLDGTLAPVSAPP  183



>ref|XP_010499304.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=250

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 103/149 (69%), Gaps = 2/149 (1%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            + FFF+++F  +  S  +FN+T +L+++ +F+ FN+ L+ET LA  INSR T+TVL V N
Sbjct  7    LFFFFVSTF--LYTSSNSFNITNILNEHDDFSTFNKLLSETQLASTINSRQTITVLVVSN  64

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
            G + +LSG+  ++IK ++++HI+LDYYD KK   L KK+  LTTLFQS+G A G QGFLN
Sbjct  65   GALSSLSGQPANLIKKILSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLN  124

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVA  460
            AT T    V+ GSAV      + L+ +VA
Sbjct  125  ATVTKDGNVLFGSAVPGPDLNAELLDSVA  153



>ref|XP_011045030.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X1 
[Populus euphratica]
 ref|XP_011045031.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X2 
[Populus euphratica]
Length=271

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 129/200 (65%), Gaps = 6/200 (3%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
              F+A   ++  +  AFN+T +L +YP F  FN  LT++ LA E++SR T+TVLA+DN  
Sbjct  8    LLFIAILCLISSTSTAFNITKILAQYPEFVGFNDLLTQSGLAKEMSSRETITVLALDNSS  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G L+G+  D+ K +++ H++LDYYD  K + L+K +T +TTL+Q++G A   QGFLN +
Sbjct  68   IGGLNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNIS  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
             T  + +  GSAVK AP  ++LV  V  + Y+IS+LQ+S  I  PG+E++AP   P +  
Sbjct  128  RT-AEGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIENMAPPPPPAAVP  186

Query  360  QH-----GKSPAAAPSPRKL  316
            +       KSP+ AP+P K+
Sbjct  187  KKAPAPTAKSPSKAPAPSKV  206



>gb|KEH39771.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=287

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 105/169 (62%), Gaps = 0/169 (0%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET L G+IN R T+TV A+DNG 
Sbjct  8    FLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDNGA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M ++S K  + I+++MA H++LDYYD  K      K   LTTL+QS+G+A   QG+L   
Sbjct  68   MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMHKREPLTTLYQSSGIAVDQQGYLKVN  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES  394
             T    + IGSAV  AP    LV  V  + Y+I+I+Q++  I+ PG+E+
Sbjct  128  RTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPILFPGLET  176



>gb|KEH39774.1| fasciclin domain protein [Medicago truncatula]
Length=268

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 116/189 (61%), Gaps = 1/189 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
               LA F  +  S  A ++T +L + P+F  FN+ LTET L  +INSR T+TVLAV +G 
Sbjct  8    LLCLALFLAVSSSIHALDITKLLGQNPDFAAFNKQLTETKLVDQINSRNTITVLAVSDGA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M A+SGKS   IK++M+ H+VLDY+D KK +        LTTLFQ++G A   QGFL   
Sbjct  68   MSAISGKSPQAIKAIMSTHVVLDYFDEKKLSEAVGSGILLTTLFQASGQAKNQQGFLKVK  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
              G   +  GSAV  AP    LV  V  + Y+ISILQ++  II PGV+S++  A+ P+  
Sbjct  128  LIGEGEMDFGSAVSGAPIDVALVKTVVKQPYNISILQVAKPIIFPGVDSVS-TASAPTAA  186

Query  360  QHGKSPAAA  334
            ++  SP+AA
Sbjct  187  KNASSPSAA  195



>gb|AFK40899.1| unknown [Lotus japonicus]
Length=285

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 3/177 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AF++T +L +YP F+ F++YLTET L  +INSR T+TVLAVDN  + A+SGKS D IK+V
Sbjct  23   AFDITKILSQYPEFSTFSKYLTETKLTEQINSRNTITVLAVDNSAISAISGKSADAIKAV  82

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            ++ HIVLD++D KK         +LTTL+Q++G+A   QGFL     G   V  GSAV  
Sbjct  83   VSTHIVLDFFDEKKLMEALGSKQQLTTLYQASGLAVNQQGFLKVALIGEGEVAFGSAVNG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVESIAPK---AAPPSHQQHGKSPAAA  334
            A   + LV  V  + Y+IS+LQ+S  I+ PG +  +P    A  P   Q  K+P  A
Sbjct  143  AATDAELVKTVTSQPYNISVLQVSKPIVFPGADKASPSQGAAKAPVPAQGAKAPVPA  199



>ref|XP_002882785.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59044.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            IFFF AS + +  S  +FN+T +L+++ +F+ FNQ L+ET LA  IN R T+TVL V NG
Sbjct  7    IFFFFAS-TFLYSSSNSFNITNILNEHDDFSTFNQLLSETQLASTINKRQTITVLVVSNG  65

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             + ++SG+   VIK ++++HIVLDYYD KK   L KK+  LTTLFQS+G+A G QGFLNA
Sbjct  66   ALSSISGQPTAVIKKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGLARGQQGFLNA  125

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVA  460
            T T    V  GSAV  +   + L   VA
Sbjct  126  TVTKDGDVAFGSAVPGSSLDAQLQDTVA  153



>ref|XP_008445580.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=296

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 127/236 (54%), Gaps = 37/236 (16%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T +L+++P F  FN  LT+T L  +IN+R T+TVLA++N  +GA+SG S DVIK +++
Sbjct  34   NITRLLNRFPEFGAFNDLLTKTRLFEQINTRQTITVLALNNATVGAISGNSLDVIKQILS  93

Query  669  VHIVLDYYDVkkftt-lekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
             H++LDYYDV K       K T LTT+FQSTG A   QGFL         V  GSA K A
Sbjct  94   AHVILDYYDVAKMRKLSADKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSASKKA  153

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPG------------------VESIAPKA-APP  370
            P  + LV  VA + Y+IS+LQIS+ I+ PG                  VE+ AP+A AP 
Sbjct  154  PLSAKLVKPVASQPYNISVLQISAPIVIPGIGVYNLPPPAPEAPLVAPVEAPAPEADAPG  213

Query  369  SHQQHGKSPAAAPSPRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGESD  202
              +    SP+ APSP                      AP+A   D+P S P  ESD
Sbjct  214  PAEDEADSPSDAPSPAS-----------------KAPAPSADAPDAPVSSPPKESD  252



>ref|XP_002282846.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=305

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L ++P+F+ FN YL++T+++  IN R T+TVLAV+NG +  ++GKS D IK++
Sbjct  27   AFNITRLLGQFPDFSTFNSYLSQTNISIGINRRQTITVLAVENGAIAPITGKSMDDIKNI  86

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            + +H++LDYYDV K   L  KT  LTTLFQ+TG A+G QGFLN T+     V+ GSAV  
Sbjct  87   LRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGSAVAG  146

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +   + LV  VA + ++IS+LQIS+ I+ PG+
Sbjct  147  SGLQAKLVKTVASQPFNISVLQISTPILAPGI  178



>ref|XP_004305606.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=282

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 157/278 (56%), Gaps = 24/278 (9%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +FF L S  + + SC AFN+T +L+K  +F+ FN+YL+ T LA EIN + T+TVLA++N 
Sbjct  10   MFFVLLSM-LSIRSCSAFNITKLLNKESDFSTFNKYLSATKLADEINKQSTITVLALNND  68

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlek--kttrlttLFQSTGMASGDQGFL  550
             MG +S  +   +KSVM+VHI+LDY+D +K   L K   +T+LTTLFQS+G A   QGF+
Sbjct  69   AMGGISSDNSFPLKSVMSVHIILDYFDKEKLAKLAKNNSSTKLTTLFQSSGEAKDQQGFV  128

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAP  373
                  G+ +  GSA K A   S LV +V  + Y+IS+L++SS+I  P +  S AP+ AP
Sbjct  129  RVEVVDGE-IFFGSASKGAQMNSKLVRSVTAQPYNISVLEVSSIIRVPNINASPAPEKAP  187

Query  372  PSHQQHGKSPA---AAPSPRKLLspsnspsdspSALTPS----------GVAPAATETDS  232
                + GKSP+    A SP +  + S +  +   A +PS          G        DS
Sbjct  188  --APKKGKSPSLKDEAESPSEDTAESPAGDEKDEAPSPSKATDSTPPKPGYEDDVITADS  245

Query  231  PASGPNGESDSSATTALEACLGF---VMAIISANLFFF  127
            P+S P    D S   A +A +GF    M + S  + FF
Sbjct  246  PSSTPTAW-DYSDARATDAEMGFRVVTMGLASVLVAFF  282



>ref|XP_003545530.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Glycine 
max]
Length=306

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AF++T +L +YP F+ FN+YLTET LA EINSR T+TVLAV++  M +++ KS + IK++
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNTITVLAVEDSAMNSIAAKSPEAIKAI  82

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            ++ H++LD++D KK    +  + +LTTLFQ++G+A   QGFL     G   +  GSAV  
Sbjct  83   ISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFGSAVSG  142

Query  495  AP-QGSNLVSAVAHEGYDisilqissliIPPGVESIAP  385
            AP   + L+  V  E Y+ISILQ++  I+ PGV+S  P
Sbjct  143  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQTP  180



>ref|XP_010938482.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=257

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 109/173 (63%), Gaps = 1/173 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AF +T +L  +  F  F+ YL +T L  EIN R T+T+L VDN  M A+S   ++ +K V
Sbjct  2    AFKITAILKPFSEFATFSNYLNQTKLVHEINHRQTITILVVDNSKMSAISSLPEESLKHV  61

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            M VH++LDYYD++K + +  K+  LTTLFQ+TG+A+   GFLN T    ++V+ GSAV  
Sbjct  62   MEVHVILDYYDIRKISHIPSKSFLLTTLFQTTGVATKRMGFLNVTRKADESVVFGSAVLG  121

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAA  337
            AP  S L+  V    Y+IS+LQ+S  IIPPG++  AP  AP S+      P+A
Sbjct  122  APHTSTLIKNVMTMPYNISVLQVSEPIIPPGIDG-APPMAPISNPSEMIDPSA  173



>ref|XP_002512774.1| Glycoprotein X precursor, putative [Ricinus communis]
 gb|EEF49277.1| Glycoprotein X precursor, putative [Ricinus communis]
Length=339

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            SF I+  +  AFN+T +L  + +F+NFN  LT+T LA  INSR T+T+LAVDNG +  +S
Sbjct  17   SFFILFSTVSAFNITKILSDHSDFSNFNDLLTKTQLAATINSRQTITILAVDNGNISPIS  76

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGK  526
            G+S D+ K ++++H++LDYYD  K   L  KT  LTTL+QS+G A G +GFLNAT    +
Sbjct  77   GQSVDMQKKILSMHVILDYYDDAKLQKLPNKTELLTTLYQSSGQAKGQEGFLNATLVNNQ  136

Query  525  TVMIGSAVKNAPQGSNLVSAVAHEGYD  445
             V +GSAV  +   + LV AV  + Y+
Sbjct  137  -VTLGSAVPGSGLNAKLVKAVVTQPYN  162



>ref|XP_010938483.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=277

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 106/168 (63%), Gaps = 3/168 (2%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L+ +  F  F+ YL +T L  EIN R T+T+L +DN  M A+S   ++ +
Sbjct  19   SAMAFNITAILEPFSKFTTFSNYLNQTKLVHEINHRRTITILVIDNSRMSAISSLPEESL  78

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K VM VH++LDYYD++K + + +K+  LT LFQ+T +A+   GFLN T    ++ + GSA
Sbjct  79   KHVMEVHVILDYYDIRKISHIPRKSFLLTILFQTTDVATKRMGFLNVTRMADESEVFGSA  138

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE---SIAPKAAPP  370
            +  AP  S L+  V    Y+IS+LQ+S  IIPPG++    + P + PP
Sbjct  139  ILRAPHTSTLIKKVMTMPYNISVLQVSEPIIPPGIDGALPMTPISNPP  186



>emb|CAN66163.1| hypothetical protein VITISV_008126 [Vitis vinifera]
Length=305

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L ++P+F+ FN YL++T+++  IN R T+TVLAV+NG +  ++ KS D IK++
Sbjct  27   AFNITRLLGQFPDFSTFNSYLSQTNISIGINKRQTITVLAVENGAIAPITXKSLDDIKNI  86

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            + +H++LDYYDV K   L  KT  LTTLFQ+TG A+G QGFLN T+     V+ GSAV  
Sbjct  87   LRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGSAVAG  146

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +   + LV  VA + ++IS+LQIS+ I+ PG+
Sbjct  147  SGLQAKLVKTVASQPFNISVLQISTPILAPGI  178



>ref|XP_006298989.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
 gb|EOA31887.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
Length=252

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  +FN+T +L+++ +F+ FN  L+ET LA  IN R T+TVL V NG + +LSG+  DVI
Sbjct  21   SSNSFNITNILNEHDDFSTFNNLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTDVI  80

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K ++++HIVLDYYD KK   L KK+  LTTLFQS+G A G QGFLNAT      V  GSA
Sbjct  81   KKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGQAKGQQGFLNATVMTNGDVAFGSA  140

Query  504  VKNAPQGSNLVSAVA  460
            V  + + S L+ +VA
Sbjct  141  VPGSDRNSQLLDSVA  155



>ref|XP_004486594.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cicer 
arietinum]
Length=344

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 111/169 (66%), Gaps = 4/169 (2%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++  F+    ++  S   F+VT ML +YP ++ ++ YLT+T LA EIN++ T+TVL VDN
Sbjct  10   MVLIFVVVVMLLPISITCFDVTKMLSQYPAYSTYSNYLTQTQLATEINAKPTITVLVVDN  69

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             GM  +SGK  DVIK V++VH++LDY+DV+KF  L  KT  ++T+F+S GM    + F+ 
Sbjct  70   SGMAPISGKPMDVIKKVLSVHVILDYFDVQKFQHLGNKTITVSTMFESKGM----ERFIK  125

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD     V   SA    P G+NL+ A+  + Y+IS++QIS++IIPP +
Sbjct  126  ITDLNTGAVTFTSAADPNPTGANLIKAIVAQPYNISLVQISTVIIPPSL  174



>ref|NP_187872.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
 sp|Q9LTW9.1|FLA14_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51033.1|AC069474_32 hypothetical protein; 8734-7967 [Arabidopsis thaliana]
 dbj|BAB02409.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65936.1| fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
 gb|AEE75229.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
Length=255

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  +FN+T +L+++ +F+NFNQ L+ET LA  IN R T+TVL V NG + +LSG+   VI
Sbjct  20   SSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTSVI  79

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K ++++HIVLDYYD KK   L KKT  LTTLFQS+G+A G QGFLNAT      V  GSA
Sbjct  80   KKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSA  139

Query  504  VKNAPQGSNLVSAVA  460
            V  +   + L   VA
Sbjct  140  VPGSSLDAQLQDTVA  154



>gb|ABK28554.1| unknown [Arabidopsis thaliana]
Length=256

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  +FN+T +L+++ +F+NFNQ L+ET LA  IN R T+TVL V NG + +LSG+   VI
Sbjct  20   SSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTSVI  79

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K ++++HIVLDYYD KK   L KKT  LTTLFQS+G+A G QGFLNAT      V  GSA
Sbjct  80   KKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSA  139

Query  504  VKNAPQGSNLVSAVA  460
            V  +   + L   VA
Sbjct  140  VPGSSLDAQLQDTVA  154



>ref|XP_004498590.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cicer 
arietinum]
Length=316

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 116/182 (64%), Gaps = 5/182 (3%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AF++T +L + P+F  FN+YLTET LA  INSR T+T+LAV + G+ +LSGKS+  I
Sbjct  20   SIHAFDITKLLGQNPDFATFNKYLTETKLAEPINSRNTITILAVSDAGLSSLSGKSQQFI  79

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K+ ++ H++LD++D KK    +     LTTL+QS+G+A   QGF+     G   +  GSA
Sbjct  80   KASLSTHVILDFFDEKKLMEAQGSGQLLTTLYQSSGLAMNQQGFIKVALIGEGEIAFGSA  139

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAPSP  325
            V  AP   +LV  V  + Y+ISILQ++ LI+ PG++     A  P+   + ++PAAA +P
Sbjct  140  VNGAPLDVSLVKTVVSQPYNISILQVTKLIVVPGLD-----AQTPASSGNAQAPAAAKTP  194

Query  324  RK  319
             +
Sbjct  195  AE  196



>ref|XP_007011569.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
 gb|EOY29188.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
Length=277

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 111/167 (66%), Gaps = 3/167 (2%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +F FL + S    +  AFNVT +L +YP++ +FN  L++T LA EI+ R T+T+LA+DN 
Sbjct  10   VFAFLLALS---TTSTAFNVTKVLGQYPDYGSFNDLLSQTKLAEEISHRQTITILALDNA  66

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             + +++ +  D +K ++  H+VLDY+D  K   L KK+  LTTL+Q+TG+A G QGFLN 
Sbjct  67   SISSIASRPSDEVKKILMNHVVLDYFDTFKIQKLGKKSVILTTLYQTTGLAQGQQGFLNI  126

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPG  403
            T  G   V+ GSAVK AP  S L+ +V  + +++S+L +S+ I+ PG
Sbjct  127  TKLGPGEVVFGSAVKGAPLVSKLLGSVVSQPFNLSVLHVSTPIVAPG  173



>ref|XP_009363599.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=262

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 98/151 (65%), Gaps = 6/151 (4%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            +F ++  S  AF++  +L+K  +F++F  YL ET L  EIN R T+TVLAVDNGG+ ++S
Sbjct  13   AFFLVFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKRSTITVLAVDNGGISSIS  72

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkft--tlekkttrlttLFQSTGMASGDQGFLN--ATD  538
            GKS+DVIK +++ H+VLDYYD KK T      K + LTT+ QSTG A   QGF+N    D
Sbjct  73   GKSQDVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFINLGKID  132

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
             GG  +  GSAVK +   + LV +V  + ++
Sbjct  133  EGG--LAFGSAVKGSKLNAKLVKSVVSQPFN  161



>ref|XP_004138878.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 ref|XP_004160862.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 gb|KGN62878.1| hypothetical protein Csa_2G379090 [Cucumis sativus]
Length=300

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 103/151 (68%), Gaps = 1/151 (1%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T +L+++P+F  FN+ LT+THL  +INSR T+TVLA+ N  +GA++G S DVIK +++
Sbjct  35   NITRLLNRFPDFGAFNELLTKTHLYEQINSRQTITVLALSNATVGAIAGNSLDVIKQILS  94

Query  669  VHIVLDYYDVkkfttlek-kttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
             H++LDYYDV+K   L   K T LTT+FQSTG A   QGFL         V  GSA K A
Sbjct  95   AHVILDYYDVEKMRKLSTDKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSAAKKA  154

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGV  400
            P  + L+  VA + Y+IS+LQ+S+ I+ PG+
Sbjct  155  PLSAKLMKTVASQPYNISLLQVSAPIVIPGI  185



>ref|NP_001130104.1| hypothetical protein precursor [Zea mays]
 gb|ACF78231.1| unknown [Zea mays]
 gb|AFW70826.1| hypothetical protein ZEAMMB73_792931 [Zea mays]
Length=296

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 115/198 (58%), Gaps = 6/198 (3%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +   LA FS       AFN+T +L ++ +F  FN  L++T LA +IN R T+TVLAVDNG
Sbjct  10   LVLILACFS---SPAAAFNITRLLGQFSDFTTFNNLLSQTKLAEDINRRQTITVLAVDNG  66

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
              G +S    DV + V+++H+VLDYYD  K   ++  +  LTT+FQS+G A+   GFLN 
Sbjct  67   AAGGISSLPSDVQRKVLSMHVVLDYYDTAKLEAIKNHSALLTTMFQSSGQATDRMGFLNF  126

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPK---AAP  373
            T      ++ GSA   A   S++V +V    Y+IS+LQ+S+ I+PPGV   A      AP
Sbjct  127  TKRSDGVMVFGSAQPGAQMTSHMVKSVTSRPYNISVLQVSAPIVPPGVGGSADSGKGGAP  186

Query  372  PSHQQHGKSPAAAPSPRK  319
            P H+    +P  A   +K
Sbjct  187  PPHKATAPAPGPATKGKK  204



>ref|XP_009396684.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (65%), Gaps = 6/175 (3%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T ML + P+F+ FN  LT+THLA +INSR T+T+LAV NG + ++S +  D IK +++
Sbjct  26   NITKMLAQLPDFSTFNDLLTQTHLAADINSRSTITILAVSNGAVSSVSDEPIDTIKKILS  85

Query  669  VHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAP  490
            +H++LDYYD  K   +   T  LTTLFQ++G A+G  GFLN T+     +  GSAV  + 
Sbjct  86   LHVILDYYDDNKIHKISNHTAILTTLFQASGGAAGQNGFLNVTNMENGQIAFGSAVAGSS  145

Query  489  QGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAPSP  325
              +N V  +A + Y+IS+LQISS+I+PP +   A      S  Q  K PA++P+P
Sbjct  146  LTANFVKVLATQPYNISVLQISSVIVPPSLSGGA------SSNQSTKPPASSPTP  194



>gb|EYU22059.1| hypothetical protein MIMGU_mgv1a011491mg [Erythranthe guttata]
Length=280

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 110/178 (62%), Gaps = 1/178 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
             F +++  ++  +  A N+T +LD+YP F  +N  LT T LA +IN R T+T+LA+ N  
Sbjct  9    LFVISAVLLLSATTSAHNITLILDQYPEFTTYNSLLTATDLATKINRRKTLTILALTNDR  68

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G L+GKS DV   +++ HIVLDY+D+ K    +   + +TTL+QSTG A   QGFLN  
Sbjct  69   IGDLAGKSVDVQTRILSTHIVLDYFDMLKLYKFKNTKSVVTTLYQSTGTADDMQGFLNVI  128

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE-SIAPKAAPP  370
             +    +  GSA+  AP  + +  +VA + Y+IS+L IS +I+ PG++ S  P  APP
Sbjct  129  HSTDGNIYFGSAMNGAPLDAKVEGSVAKQPYNISVLSISHVIVAPGIDGSFKPVTAPP  186



>ref|XP_002452018.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
 gb|EES04994.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
Length=296

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 117/193 (61%), Gaps = 18/193 (9%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              AFN+T +L ++ +F  FN  L++T LA +IN R T+TVLAVDNG  G +S    DV +
Sbjct  21   AAAFNITRLLGEFSDFTTFNNLLSQTKLAEDINRRQTITVLAVDNGAAGGISSLPSDVQR  80

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
             V+++H+VLDYYD  K   ++  +  LTT+FQS+G A+   GFLN T      ++ GSA 
Sbjct  81   KVLSMHVVLDYYDTAKLGAIKNHSALLTTMFQSSGKATDRMGFLNFTKRSDGVMLFGSAQ  140

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGV-------ESIAP--------KAAPPS  367
              A   S++V +VA   Y+IS+LQ+S  I+PPGV       E+ AP        +AAPP+
Sbjct  141  PGAQMTSHMVKSVASRPYNISVLQVSDPIVPPGVGGSADSGEATAPAPATKGKKEAAPPN  200

Query  366  HQQHGKSPAAAPS  328
             ++   +PA APS
Sbjct  201  DKE---APAPAPS  210



>ref|XP_008781934.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=308

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 101/152 (66%), Gaps = 0/152 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L ++ +F+N N  LT T LA EINSR TVTVLAV+N  + ++S    DV+K V
Sbjct  22   AFNITQILGQFSDFSNLNNLLTRTQLASEINSRQTVTVLAVNNAALSSVSNLPTDVLKKV  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +A+H+VLDY+D  K T L  ++  L TLFQ++G+A+G  GFLN TD G   + +GSA   
Sbjct  82   LALHVVLDYFDRDKITRLSNRSAILATLFQASGLATGQNGFLNVTDMGNGQIALGSAAPG  141

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +   +  V  +    Y+IS+L+IS +I PPG+
Sbjct  142  SNLDARFVGVLVTHPYNISVLKISGVITPPGL  173



>gb|KEH39772.1| fasciclin domain protein [Medicago truncatula]
Length=227

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 105/192 (55%), Gaps = 8/192 (4%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F  LA F  +  S  AF++  +LD+ P F+ FN+YL ET L G+IN R T+TV  +DNG 
Sbjct  8    FLCLALFLTVSTSIQAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTLTVFTLDNGA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M ++S K  + I+++MA H++LDYYD  K     +K   L TL+QS+G+A   QG+L   
Sbjct  68   MSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMRKRELLITLYQSSGIAVDQQGYLKVN  127

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQ  361
             T    + IGSAV   P  +   +A A    +  I ++S    P    S +P  AP    
Sbjct  128  RTSDGDLAIGSAVSAPPAKAK--NASAPSAAEEPITEVSDSPSPSDEPSESPVEAP----  181

Query  360  QHGKSPAAAPSP  325
               KSP+ AP P
Sbjct  182  --AKSPSLAPGP  191



>ref|XP_007224727.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
 gb|EMJ25926.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
Length=268

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 94/148 (64%), Gaps = 2/148 (1%)
 Frame = -2

Query  882  FSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSG  703
            F +   S  AF++T +L+K   F+NFN YL ET L  +INSR T+TVLAV NG + +L+G
Sbjct  15   FIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSRSTITVLAVGNGAISSLAG  74

Query  702  KSKDVIKSVMAVHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGG  529
            KS+DV+K +++ H++LDYYD +K T      K T LTT+FQS+G A   QGF+NA     
Sbjct  75   KSQDVVKKILSAHVILDYYDEQKLTKLAKSSKATTLTTMFQSSGQAQNQQGFINAGIVNE  134

Query  528  KTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
              +  GSA K +   + LV +V  + ++
Sbjct  135  GELAFGSAAKGSKLNAKLVKSVVSQPFN  162



>ref|XP_008219800.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=285

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 4/159 (3%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L+K  +F+NFN  L++T LA EIN R T+T+LAVDNGG G LSG+S D+ 
Sbjct  26   SVSAFNITKILEKQSDFSNFNNLLSQTKLADEINRRSTITILAVDNGGAGGLSGQSSDMA  85

Query  684  KSVMAVHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            K +++VH+VLDYYD  K        K+  LTTLFQSTG A  +QGF+  +   G+ +  G
Sbjct  86   KKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQ-ISFG  144

Query  510  SAVKNAPQGS-NLVSAVAHEGYDisilqissliIPPGVE  397
            SA K     S N V +V  + Y+IS+LQ+ S+I  P +E
Sbjct  145  SAAKGGNGNSVNFVKSVVSQPYNISVLQVGSIINVPDIE  183



>ref|XP_009418876.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 102/155 (66%), Gaps = 0/155 (0%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              + N+T +L ++ +F+ FN  LT+T L  +INSR T+TVLAVDNG   ++S +  D +K
Sbjct  19   AASHNITRILAQFDDFSTFNSLLTQTQLVSDINSRRTITVLAVDNGAASSVSSRPTDELK  78

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
             +++VH+VLDYYD  K   L   T  LTTLFQ+TG+ASG  GFLN T+ G   +  GSAV
Sbjct  79   KILSVHVVLDYYDDAKLHKLPNHTAILTTLFQATGLASGRNGFLNVTNMGNGQIAFGSAV  138

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVE  397
              +   +N V  VA   Y+IS++QISS+I+PP + 
Sbjct  139  PGSSLVANFVKVVATRPYNISVIQISSVIVPPNIS  173



>ref|XP_008361057.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=262

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 97/151 (64%), Gaps = 6/151 (4%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            +F ++  S  AF++  +L+K  +F++F  YL ET L  EIN R T+TVLAVDNGG+ ++S
Sbjct  13   AFFLVFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKRSTITVLAVDNGGISSIS  72

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkft--tlekkttrlttLFQSTGMASGDQGFLN--ATD  538
            GKS+DVIK +++ H+VLDYYD KK T      K + LTT+ QSTG A   QGF+N    D
Sbjct  73   GKSQDVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFINLGKID  132

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
             GG  +  GSAVK +   +  V +V  + ++
Sbjct  133  EGG--LAFGSAVKGSKLNAKFVKSVVSQPFN  161



>ref|XP_006845641.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
 gb|ERN07316.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
Length=398

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 106/156 (68%), Gaps = 3/156 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGK--SKDVIK  682
             FN+T +LD++P FN FN YLT T + GEIN R T+T+LA+++  M +++G   + +V+ 
Sbjct  119  CFNITKILDQHPEFNVFNSYLTLTKVVGEINKRNTITILAIEDSAMSSITGGNFAPEVLH  178

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGK-TVMIGSA  505
            ++M+VH+VLDYYD KK   L + T  LT LFQSTG A G QGFLN T +     ++ GSA
Sbjct  179  NIMSVHVVLDYYDSKKLDNLSEGTALLTALFQSTGSAVGQQGFLNVTKSKQTGEILFGSA  238

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE  397
            V  +   + LV +VA E Y+IS+LQIS  IIP G++
Sbjct  239  VLGSALSAKLVKSVASEPYNISVLQISRPIIPQGID  274



>gb|KHN10392.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=305

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AF++T +L +YP F+ FN+YLTET LA EINSR T+TVLAV++  M +++ KS + IK++
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNTITVLAVEDSAMNSIAAKSPEAIKAI  82

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            ++ H++LD++D KK    +  + +LTTLFQ++G+A   QGFL     G   +  G AV  
Sbjct  83   ISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFG-AVSG  141

Query  495  AP-QGSNLVSAVAHEGYDisilqissliIPPGVESIAP  385
            AP   + L+  V  E Y+ISILQ++  I+ PGV+S  P
Sbjct  142  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQTP  179



>ref|XP_010486992.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=255

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              +FN+T +L+++ +F+ FN+ L+ET LA  INSR T+TVL V NG + +LSG+  ++IK
Sbjct  21   SNSFNITNILNEHDDFSTFNKLLSETQLASTINSRQTITVLVVSNGAISSLSGQPTNLIK  80

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
             ++++HI+LDYYD KK   L KK+  LTTLFQS+G A G QGFLNAT T    V+ GSAV
Sbjct  81   KILSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLNATVTKDGNVLFGSAV  140

Query  501  KNAPQGSNLVSAVA  460
                  + L+ +VA
Sbjct  141  PGPDLNAELLDSVA  154



>ref|XP_009377364.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Pyrus x 
bretschneideri]
Length=283

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 4/154 (3%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
               LA F ++  S  AF++  +L+K    ++F  YL ET L  EIN R T+TVLAVDNGG
Sbjct  9    ILCLALF-LVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRSTITVLAVDNGG  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttl--ekkttrlttLFQSTGMASGDQGFLN  547
            M ++SGKS+DVIK +++ H+VLDY+D KK T+L    K + LTT+ QS+G A   QGF+ 
Sbjct  68   MSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGFII  127

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
               + G+ +  GSAVK A   + LV AV  + Y+
Sbjct  128  VGKSDGE-IAFGSAVKGAKLNAKLVKAVVSQPYN  160



>ref|XP_008219801.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=271

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 94/148 (64%), Gaps = 2/148 (1%)
 Frame = -2

Query  882  FSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSG  703
            F +   S  AF++T +L+K   F+NFN YL ET L  +INSR T+TVLAV NG + +L+G
Sbjct  15   FIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSRSTITVLAVGNGAISSLAG  74

Query  702  KSKDVIKSVMAVHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGG  529
            KS+DV+K +++ H++LDYYD +K T      K T LTT+FQS+G A   QGF+NA     
Sbjct  75   KSQDVVKKILSAHVILDYYDEQKLTKLAKSSKVTTLTTMFQSSGQAQNQQGFINAGVINE  134

Query  528  KTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
              +  GSA K +   + LV +V  + ++
Sbjct  135  GELAFGSAAKGSILNAKLVKSVVSQPFN  162



>ref|XP_011082038.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Sesamum 
indicum]
Length=255

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 110/186 (59%), Gaps = 11/186 (6%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFNVT +L+KYP++  FN  L++T +A EIN R T+T+LA+ NG  G +S K +DV K +
Sbjct  24   AFNVTLILEKYPDYTEFNNLLSKTGVADEINRRNTITILALSNGRFGDISSKKEDVQKRI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            ++ H+VLDYYDV K          LTTL Q+ G A   QGFLN        V + SAVK 
Sbjct  84   ISTHVVLDYYDVAKLKQYNTSKGPLTTLCQTYGQAKQQQGFLNVV-VKDSEVFLSSAVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVE-------SIAPKAAPPSHQQHGKSPAA  337
            A   S + S+VA + Y+ISIL ISS II PG++       +  P AA P+  +    PA 
Sbjct  143  ASMDSKVESSVASQPYNISILSISSPIIAPGIDGALSPASAKQPNAAAPAGSE---GPAV  199

Query  336  APSPRK  319
            A  P++
Sbjct  200  AEGPKQ  205



>gb|EPS61284.1| hypothetical protein M569_13515, partial [Genlisea aurea]
Length=220

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 0/183 (0%)
 Frame = -2

Query  876  IMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKS  697
            I   S   FN+T +L +YP F+NF+  LT T LA EIN R T+TVLAV N  +G ++GK 
Sbjct  3    ISAISVSGFNITVLLGRYPEFSNFSDLLTRTQLAEEINHRSTITVLAVTNDKLGGVAGKP  62

Query  696  KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVM  517
             DV K +++ H++LDY+DV K   L+   T +TTL+Q++G+A+  QGFL+       +V+
Sbjct  63   LDVAKRILSNHVILDYFDVLKLNKLKNTRTEVTTLYQASGVANDAQGFLDIVHKLDGSVV  122

Query  516  IGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAA  337
             GSAV+ +     L  +VA + Y+IS+L +S +II PG++    KA   +      SP A
Sbjct  123  FGSAVRGSGLDCKLEGSVASQPYNISVLAVSQVIIAPGMDGTYSKAPASAPPPKANSPTA  182

Query  336  APS  328
             PS
Sbjct  183  VPS  185



>ref|XP_004305605.1| PREDICTED: uncharacterized protein LOC101308896 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   119 bits (298),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 122/189 (65%), Gaps = 8/189 (4%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            + FFL    + + SC AFN+T +L+K  +F+ FNQ+L++T LA +IN R T+TVLAVDN 
Sbjct  10   VSFFLVMMLLSISSCSAFNITKLLEKEDDFSTFNQHLSDTKLADQINKRSTITVLAVDNS  69

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFL  550
             +G L   S  V+K++M+VH++LDYYD +K T      K+  LTTL+Q++G+A  +QGF+
Sbjct  70   AIGGLGDDS--VVKAIMSVHVILDYYDKEKLTKLAKNNKSATLTTLYQTSGLAKNEQGFV  127

Query  549  N-ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
              ATD  G  +  GSA K +   S LV +V  + Y+IS+LQ+SS+I  P + +  +P+ A
Sbjct  128  RIATDDDG--ITFGSASKGSQMNSKLVKSVTSQPYNISVLQVSSIIEVPNINADPSPEKA  185

Query  375  PPSHQQHGK  349
            P    +  K
Sbjct  186  PAPKSRKAK  194



>ref|XP_008378295.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Malus domestica]
Length=283

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 98/155 (63%), Gaps = 4/155 (3%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +   LA F ++  S  AF++  +L+K    ++F  YL ET L  EIN R T+TVLAVDNG
Sbjct  8    VILCLALF-LVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRSTITVLAVDNG  66

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttl--ekkttrlttLFQSTGMASGDQGFL  550
            GM ++SGKS+DVIK +++ H+VLDY+D KK T+L    K + LTT+ QS+G A   QGF+
Sbjct  67   GMSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGFI  126

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
                + G+ +  GSAVK     + LV AV  + Y+
Sbjct  127  IVGKSDGE-IAFGSAVKGGKLNAKLVKAVVSQPYN  160



>ref|XP_009338843.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=267

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 111/183 (61%), Gaps = 15/183 (8%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T +L+K  +F+NFN  L+ET LA EIN R T+T+LAVDNG  G LSGKS D+ K +++
Sbjct  21   NITKLLEKQSDFSNFNNLLSETKLADEINRRSTITILAVDNGAAGGLSGKSSDLTKKILS  80

Query  669  VHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVK-  499
            VH+VLDYYD  K        K+  LTTLFQSTG A  +QGF+  +      V  GSA K 
Sbjct  81   VHVVLDYYDTDKLKKIFKSNKSATLTTLFQSTGEARKEQGFITVS-VKDNQVSFGSAAKG  139

Query  498  -NAPQGSNLVSAVAHEGYDisilqissliIPPGVES--IAPKAAPPSHQQHGKSPAAAPS  328
             N     +LV +V  + Y+IS+LQ+ S+I  P +E+   AP  +P S        A APS
Sbjct  140  NNGDNHVSLVKSVISQPYNISVLQVGSIINVPDIENSGSAPAHSPKS--------AKAPS  191

Query  327  PRK  319
            P K
Sbjct  192  PSK  194



>ref|XP_006664971.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Oryza 
brachyantha]
Length=305

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 4/180 (2%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            FN+T +L +  +F+ FN  L +  LA EIN R T+TVLAVDNG  G +S    DV + V+
Sbjct  26   FNITRILGELSDFSTFNNLLMQKKLADEINRRQTITVLAVDNGAAGGISSLPSDVQRKVL  85

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            +VH+VLDYYD KK   ++  +TRLTTLFQS+G A+   GFLN T     T++ GSA   A
Sbjct  86   SVHVVLDYYDTKKLNAMKNHSTRLTTLFQSSGQATNHMGFLNCTKHSDGTMVFGSAEPGA  145

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGVESI----APKAAPPSHQQHGKSPAAAPSP  325
            P  S LV  +A   Y+IS+LQ+SS I+PP + +     +   AP       K+P +AP+P
Sbjct  146  PVTSQLVKLIASRPYNISVLQVSSAIVPPSIGTTNANNSKADAPLPALTKAKTPISAPAP  205



>ref|XP_009402000.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 111/169 (66%), Gaps = 2/169 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            F     + +++ S    A ++  +L  +  F+ F +YLT+T +A EIN R T+TVLAVDN
Sbjct  8    FLVFLPYLLLISSSAVAALDIVGILQPFDEFSTFTKYLTQTKVADEINRRQTITVLAVDN  67

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              + ALS  S D +K+V++VH++LDYYD  K   + KKT  LTTLFQ++G+A+ + GFLN
Sbjct  68   SAISALSSLSADTLKNVISVHVILDYYDPYKLDKVPKKTALLTTLFQASGLAANNMGFLN  127

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             T+  G+ +M GSA   AP  SNL   VA   Y++S+LQ+S+ I+PPG+
Sbjct  128  YTELPGEQMMFGSAAPGAPLNSNLQKVVAARPYNVSVLQVSTAIMPPGI  176



>ref|XP_007221854.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
 gb|EMJ23053.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
Length=285

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 2/142 (1%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  AFN+T +L+K  +F+NFN  L++T LA EIN R T+T+LAVDNGG G LSG+S D+ 
Sbjct  26   SVSAFNITKLLEKQSDFSNFNNLLSQTKLADEINRRSTITILAVDNGGAGGLSGESSDMA  85

Query  684  KSVMAVHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            K +++VH+VLDYYD  K        K+  LTTLFQSTG A  +QGF+  +   G+     
Sbjct  86   KKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQISFES  145

Query  510  SAVKNAPQGSNLVSAVAHEGYD  445
            +A        N V +V  + Y+
Sbjct  146  AAKGGNGNSVNFVKSVVSQPYN  167



>ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
tomentosiformis]
Length=422

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 4/170 (2%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            I  F L S +I   S  A N+T +L K+P ++ FN YLT+T LA EINSR T+TVLA+ N
Sbjct  6    IFLFTLMSITI---SIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRQTITVLALTN  62

Query  726  GGMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
            G M  + GK    VIK+V+++HI+LDY+D  K   +   TT  TTL+Q+TG A+G+ G +
Sbjct  63   GAMSDVVGKHPLSVIKNVLSLHILLDYFDSTKLHKISDGTTLSTTLYQTTGNANGNLGSV  122

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            N TD  G  V  GSAV ++P  S    +V    Y+IS+L+ISS II PG+
Sbjct  123  NITDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGI  172



>gb|KHM99327.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=303

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 101/292 (35%), Positives = 157/292 (54%), Gaps = 53/292 (18%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            +  AF++T +L +YP F+ FN+YLTET LA +INSR T+TVLAV++  M +++ KS + I
Sbjct  20   AIRAFDITQLLGQYPEFSTFNKYLTETKLADQINSRNTITVLAVEDSAMHSIAAKSPEAI  79

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K+++  H++LD++D KK    +  + +LTTLFQ++G+A   QGFL       K  ++G  
Sbjct  80   KAIIGTHVILDFFDEKKLMEAQASSQQLTTLFQASGLAVNQQGFL-------KVALVGEG  132

Query  504  VKNAP-QGSNLVSAVAHEGYDisilqissliIPPGVESIAP-------------------  385
               AP   + L+  V  E Y+ISILQ++  I+ PGV+S  P                   
Sbjct  133  EIAAPVDATELMRTVTSEPYNISILQVTKPILVPGVDSQTPASSSGAQSSQGAKAPIAAQ  192

Query  384  --KAAP-----------PSHQQHGKSP-----AAAPSPRKLLspsnspsdspSALTP--S  265
              KA P           P   Q  KSP     A AP+P +  + S SP+    A +P  +
Sbjct  193  SAKATPMPSSQGVNAKAPVQAQVAKSPVPAQSAKAPTPLE-NAASPSPASESVAESPEVA  251

Query  264  GVAPAATETDSPASGPNGE----SDSSATTALEACLGFVMAIIS-ANLFFFM  124
              APA +   + A GP  +    +D +A++A    +G VMA+++ A+LF  +
Sbjct  252  AEAPATSPVGAEAPGPLADDVAPADVTASSASTTKMGLVMAVMAFASLFIVL  303



>gb|ABR16344.1| unknown [Picea sitchensis]
Length=387

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 94/152 (62%), Gaps = 3/152 (2%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F  L SF   +    AFN+T +LD YP+++ FN  LT T LA EINSR T+TVL V+NG 
Sbjct  6    FVLLLSF---LCCANAFNITKILDAYPDYSIFNDDLTRTKLADEINSRKTITVLVVNNGA  62

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M +LSG     +K  +++H+VLD++D +K   +   TT  TTL+Q+TG A+G+ GF+N T
Sbjct  63   MASLSGLDLASVKRALSLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINIT  122

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            D  G  V  G + + A   S  V +V  +G++
Sbjct  123  DLKGGKVGFGLSGRGAKLDSTYVKSVKQDGFN  154



>ref|XP_010669451.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 138/261 (53%), Gaps = 20/261 (8%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            II  F         S  AFN+T  L+++  F+ +N  LT++ +A  IN +GTVTVL VDN
Sbjct  8    IILIFTTILCTTTTSISAFNITYFLEQHSEFSTYNNLLTQSGVAAAINKQGTVTVLVVDN  67

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              +G ++G  +  +  ++A H++LDYYD  K   L  K+ + T LFQ TG  +G+QG LN
Sbjct  68   SAVGPITGVPQSKLSFILATHVILDYYDATKLDNLNGKSVKATNLFQQTGKTNGEQGLLN  127

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPK-----  382
             T++ G  V+  S+ K APQ S +V  V+ + + IS++QIS  I+ PG++          
Sbjct  128  ITNSDG-NVIFASSAKGAPQDSKMVKVVSSQPFHISVIQISKPIVTPGLDQGGSSSPSGS  186

Query  381  ---------AAPPSHQQHGKSPAAAPSPRKLLspsnspsdspSALTPS-GVAPAATETDS  232
                     AAPP  Q +G    +APSP      ++SP ++ S +  S G APA      
Sbjct  187  PNASPPTSVAAPPPKQANG----SAPSPADEEEAADSPMEADSPMAESEGPAPADGPAGG  242

Query  231  PASGPNGESDSSATTALEACL  169
            P+  P+ E D +     +A L
Sbjct  243  PSPAPSPEDDEADKETADAKL  263



>ref|XP_010034870.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Eucalyptus 
grandis]
Length=345

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 0/152 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L KYP F+ FN  LT + +A  IN+R ++TVLAVDN GM ALSG   + +K +
Sbjct  22   AFNITNILSKYPEFSTFNNDLTLSQVASAINARQSITVLAVDNSGMSALSGNPAETVKDI  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++ +VLDYYD +K   L  KT  LTTL Q++G A G QGFLN T +    +  GSAV+ 
Sbjct  82   LSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSAVQG  141

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +   +NLV +V  + ++IS+LQISS I+PP +
Sbjct  142  SSVHANLVKSVTSQPFNISVLQISSAIVPPNI  173



>ref|XP_008352034.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
 ref|XP_008361056.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=291

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 111/184 (60%), Gaps = 16/184 (9%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T +L+K  +F+NFN  L+ET LA EIN R T+T+LAVDNGG+G LSG+S D+ K +++
Sbjct  25   NITKILEKQSDFSNFNSLLSETKLANEINKRKTITILAVDNGGVGGLSGQSSDLTKKILS  84

Query  669  VHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            VH++LDYYD  K        K+  LTT+FQSTG A   QGF+  +      +   SA K 
Sbjct  85   VHVILDYYDSDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVS-VKDNHISFASAYKG  143

Query  495  APQGS---NLVSAVAHEGYDisilqissliIPPGVESI--APKAAPPSHQQHGKSPAAAP  331
               G    NLV +V  + Y+IS+LQ+ S+I  P +E+   AP  +P S        A AP
Sbjct  144  NNNGGNHVNLVKSVVSQPYNISVLQVGSIIDVPDIENTDSAPAQSPKS--------AKAP  195

Query  330  SPRK  319
            SP K
Sbjct  196  SPSK  199



>emb|CDY52668.1| BnaC01g38580D [Brassica napus]
Length=262

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 109/191 (57%), Gaps = 13/191 (7%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +FFF ++F     +  AFN+T +L+    F+ FN  L++T LA  INSR T+TVLA+ N 
Sbjct  13   LFFFASTF----LNAHAFNITRILNLNNEFSTFNNLLSQTGLASTINSRQTITVLALSND  68

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             M   S +S +  K  +++HIVLDYYD+KK  +L KK+  LTTLFQS+G A G QGF+NA
Sbjct  69   AMSLFSDQSTEDNKKSLSLHIVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINA  128

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSH  364
            T      VM GSAV+ +   S L+ +VA   Y+IS+L          + S  P   P   
Sbjct  129  TVMNNGDVMFGSAVRGSLLDSKLIDSVATHPYNISVL---------HISSYIPIMNPEGP  179

Query  363  QQHGKSPAAAP  331
              HG S    P
Sbjct  180  SDHGSSSTPLP  190



>gb|KCW53929.1| hypothetical protein EUGRSUZ_J03138 [Eucalyptus grandis]
Length=309

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 0/152 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L KYP F+ FN  LT + +A  IN+R ++TVLAVDN GM ALSG   + +K +
Sbjct  22   AFNITNILSKYPEFSTFNNDLTLSQVASAINARQSITVLAVDNSGMSALSGNPAETVKDI  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++ +VLDYYD +K   L  KT  LTTL Q++G A G QGFLN T +    +  GSAV+ 
Sbjct  82   LSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSAVQG  141

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +   +NLV +V  + ++IS+LQISS I+PP +
Sbjct  142  SSVHANLVKSVTSQPFNISVLQISSAIVPPNI  173



>ref|XP_009381782.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 132/248 (53%), Gaps = 17/248 (7%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++F  L     +  +  A ++  +L  +P ++ F +YLT+T +A EIN R T+TVL V++
Sbjct  9    VLFLLL----FVSSASSALDIVEILQPFPEYSTFTKYLTQTKVADEINRRKTITVLVVND  64

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              +  LS  S D +K+ ++VH++LDYYD      L  KT  LTTLFQ++G A+G  GFLN
Sbjct  65   SAIAPLSSLSGDALKNAISVHVILDYYDPYTLDNLPNKTALLTTLFQASGHATGRLGFLN  124

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPG---------VES  394
             T+  G+ +  GSA   AP  S L   VA   YDIS+L IS+ I+P G         +  
Sbjct  125  YTELPGEQMTFGSAAPGAPLNSELNKVVAVRPYDISVLGISAAIVPSGSGSVATTSPMRK  184

Query  393  IAPKAAP---PSHQQHGKSPAAAPSPRKLLspsnspsdspSALTPSGVAPAATETDSPAS  223
            +AP  AP   P  +    +PA AP     +  +     + SA TP+G   ++    +P  
Sbjct  185  LAPAQAPTIAPRKKTGPSAPAGAPKSSPTV-AAPVEGPAGSATTPTGAPKSSPTVAAPIE  243

Query  222  GPNGESDS  199
            GP G + S
Sbjct  244  GPTGSAAS  251



>ref|XP_009120424.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=264

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 132/249 (53%), Gaps = 12/249 (5%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              AFN+T +L+    F++FN  L++T LA  INSR T+TVLA+ N  M   S +S +  K
Sbjct  23   ANAFNITRILNLNNEFSSFNNLLSQTGLASTINSRQTITVLALSNDAMSIFSDQSTEDNK  82

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
              +++HIVLDYYD+KK  +L K++  LTTLFQS+G A G QGF+NAT      VM GSAV
Sbjct  83   KSLSLHIVLDYYDIKKLKSLNKRSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAV  142

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAP--S  328
            + +   S L+ +VA   Y+IS+L          + S  P   P     HG S    P   
Sbjct  143  RGSLLDSKLIDSVATHPYNISVL---------HISSYIPIMNPEGPSDHGSSSTPLPPQP  193

Query  327  PRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGESDSSATTALEA-CLGFVMAI  151
            P       + P   PS+ T   VA A   T  P S     S +S  +A+ A  L F  A 
Sbjct  194  PNDDDYEFDEPPSPPSSTTKPFVAAATAATAKPPSAAKANSTTSGVSAINAPDLAFAFAF  253

Query  150  ISANLFFFM  124
            + ++ +FFM
Sbjct  254  VISSFWFFM  262



>ref|NP_001046792.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAD19640.1| endosperm specific protein-like [Oryza sativa Japonica Group]
 dbj|BAF08706.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAG98518.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            FN+T +L ++ +F+ FN  LT+T LA EIN R T+TVLA+DNG  G +S    D  + V+
Sbjct  32   FNITRILGEFSDFSTFNHLLTQTKLADEINRRQTITVLALDNGAAGGVSSLPSDEQRKVL  91

Query  672  AVHIVLDYYDVkkf--ttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVK  499
            +VH+VLDYYD +K     ++ ++  LTTLFQS+G A+   GFLN T      ++ GSA  
Sbjct  92   SVHVVLDYYDTEKLGGMKMKNRSAVLTTLFQSSGQATDRMGFLNYTKRSDGIMVFGSAEP  151

Query  498  NAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPK--AAPPSHQQHGKSPA  340
             A   S +V  V    Y+IS+LQ++S I+PPG+ S++     APP H     +PA
Sbjct  152  GAQATSQMVKVVVTRPYNISVLQVNSPIVPPGIASVSNSNTGAPPPHPAKSSAPA  206



>ref|XP_010102851.1| hypothetical protein L484_004423 [Morus notabilis]
 gb|EXB94232.1| hypothetical protein L484_004423 [Morus notabilis]
Length=300

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 102/176 (58%), Gaps = 8/176 (5%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L ++P F  FN +L++T LA EIN R T+TVL VDN    +LSGK  DV+K +
Sbjct  24   AFNITKILSQHPEFATFNGFLSQTKLADEINRRQTITVLVVDNAAASSLSGKPLDVVKKI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQ-GFLNATDTGGKTVMIGSAVK  499
            ++VH++LDYYDV+K T L              G  + DQ GF+N +      +  GS+ K
Sbjct  84   LSVHVILDYYDVEKLTKLGISNKTSALTTLLAGAGAADQRGFINVSLVNEGEIAFGSSAK  143

Query  498  NAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAP  331
                 S LV +VA   ++IS+LQI++ +  PG+ES  P   PP        P+AAP
Sbjct  144  GGALNSKLVESVAAHPFNISVLQITAPVQVPGIES-TPVGTPPPK------PSAAP  192



>gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas]
Length=423

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +F FL SFS++  +  A N+T +L  +P+++ FN+YLT+T LA EINSR T+TVLA++NG
Sbjct  6    LFLFL-SFSVISTTISAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNG  64

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             + +++     VIK+++++ ++LDYYD  K   + K TT  TTL+Q+TG A G+ GF+N 
Sbjct  65   AISSIAKHPLPVIKNILSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGSAPGNLGFVNI  124

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            TD  G  V  GSA   +   S+   +V    Y+IS+L++S+ II PG+ + AP  +P
Sbjct  125  TDLQGGKVGFGSAAPGSKLESSYTKSVKQVPYNISVLEVSAPIIAPGILA-APAPSP  180



>ref|XP_010527113.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Tarenaya 
hassleriana]
Length=304

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 108/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            I   L+S +I      A N+T +L+K+PNF+  N+  TET +A  IN   T+TVLAVDNG
Sbjct  13   ILLILSSTTI-----SALNITRVLEKFPNFSTMNELFTETGVAATINQHQTITVLAVDNG  67

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             +G++S + ++  K+++  H+VLDY+D  K   L+ ++   TTL+Q+TG+     GFLN 
Sbjct  68   AIGSISARPEEEQKNILMTHVVLDYFDELKLKGLKDRSNMFTTLYQTTGLGEQQNGFLNC  127

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES  394
            T+  G T+  GSAVK AP  +  V+ V    Y++S++QIS+ I+ PG+ S
Sbjct  128  TNING-TLAFGSAVKGAPLNARYVTTVFQNPYNLSVIQISTPIVAPGLGS  176



>ref|XP_002511740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50409.1| conserved hypothetical protein [Ricinus communis]
Length=425

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +FF   +FS +  +  A N+T +L  +P+++ FN+YLT+T LA EINSR T+TVLA+ NG
Sbjct  7    LFFLFLAFSALSTTITAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALSNG  66

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M AL+ K    VIK+ +++ ++LDYYD  K   + K TT  TTL+Q+TG A G+ GF+N
Sbjct  67   AMSALASKHPLSVIKNALSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGNAPGNLGFVN  126

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             TD  G  V  GSA   +   S+   +V    Y+IS++++S+ I+ PG+ + AP  +P
Sbjct  127  ITDLQGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVIEVSAPIVAPGIFT-APAPSP  183



>ref|XP_009398985.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 101/158 (64%), Gaps = 0/158 (0%)
 Frame = -2

Query  870  VWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKD  691
            V S  AF+VT +L ++ +F+ FN  L  T L+ +I++R +VT+LAV NG + + SG+  +
Sbjct  20   VSSAIAFDVTRLLAQFSDFSTFNDLLIRTQLSADISTRKSVTILAVQNGALSSESGQPDE  79

Query  690  VIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            VIK ++A+H+VLDY D +K   L   T  LTT+ Q++G ASG  GFLN TD     V  G
Sbjct  80   VIKKIIALHVVLDYLDSEKLHQLSSHTAILTTMLQASGRASGLSGFLNVTDLKNGQVAFG  139

Query  510  SAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE  397
            SAV  +P  S  V  +    YDIS++QIS LI+PPG+ 
Sbjct  140  SAVPGSPLSSYFVRVILTHPYDISVVQISGLIVPPGIR  177



>gb|KFK32632.1| hypothetical protein AALP_AA6G268600 [Arabis alpina]
Length=279

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T +L+KYP F+  N+ L +T L   IN R T+TVLA+ N  +G++SG+ ++ IKS+
Sbjct  24   AVNITRVLEKYPEFSTMNELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEEIKSI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDY+D  K   L+ K+T LTTL+QSTG+     GFLN + + GK +  GSAVK 
Sbjct  84   LMNHVVLDYFDELKLKALKDKSTMLTTLYQSTGLGQQQNGFLNCSKSNGK-IYFGSAVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVES  394
             PQ +  ++ V    +++S++QIS  I+ PG+ S
Sbjct  143  TPQTAEYITTVFRNPFNLSVVQISMPIVAPGIGS  176



>ref|XP_010913663.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=312

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 101/152 (66%), Gaps = 0/152 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T++L ++ +F+N N  LT+T LA EINSR  +TVL+V+N  + ++S    DV++ V
Sbjct  22   AFNITSILGQFSDFSNLNNLLTQTQLASEINSRQIITVLSVNNAALSSVSNLPTDVLEKV  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            ++ H+VLDY+D    T L  ++  LTTL Q++G+A+G  GFLN TD G   + +GSA   
Sbjct  82   LSFHVVLDYFDRDNITKLSNRSAILTTLLQASGLATGQNGFLNVTDMGNGQIALGSAAPG  141

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +   S  V  +    Y+IS+L ISS+I+PPG+
Sbjct  142  SNLTSQFVKVLVTHPYNISVLHISSVIVPPGL  173



>ref|XP_008777689.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=272

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 114/197 (58%), Gaps = 20/197 (10%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
             GA+N+T +L+ Y +F+ FN YLT+T LA EIN   T+TVL VDN  M  +     +++K
Sbjct  20   VGAYNITQILEPYSSFSIFNNYLTQTKLADEINRHQTITVLVVDNSKMSVIFSYLNEILK  79

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
              MA+H++LDYYD+ K + +  K+T LTTLF ++G+A+   G LN T+     V+ GSA 
Sbjct  80   HTMAIHVILDYYDINKLSHILHKSTLLTTLFLTSGIANNKLGILNVTNMPNDIVIFGSAT  139

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVE---------------SIAPKAAPPS  367
              A   S  +  V  + Y+IS+LQ+S+LII PG+E               ++AP A P +
Sbjct  140  PEATLSSTFIKVVITKPYNISVLQMSNLIILPGIEGAKQASPLATLKKALALAPMAKPTN  199

Query  366  HQQHG-----KSPAAAP  331
               H      KSPA+ P
Sbjct  200  STSHAPTTIEKSPASTP  216



>emb|CDY50538.1| BnaA01g30420D [Brassica napus]
Length=259

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 131/249 (53%), Gaps = 12/249 (5%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              AFN+T +L+    F+ FN  L++T LA  I+SR T+TVLA+ N  M   S +S +  K
Sbjct  18   ANAFNITRILNLNNEFSTFNNLLSQTGLASTIDSRQTITVLALSNDAMSLFSDQSTEDNK  77

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
              +++HIVLDYYD+KK  +L KK+  LTTLFQS+G A G QGF+NAT      VM GSAV
Sbjct  78   KSLSLHIVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAV  137

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSPAAAP--S  328
            + +   S L+ +VA   Y+IS+L          + S  P   P     HG S    P   
Sbjct  138  RGSLLDSKLIDSVATHPYNISVL---------HISSYIPIMNPEGPSDHGSSSTPLPPQP  188

Query  327  PRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGESDSSATTALEA-CLGFVMAI  151
            P       + P   PS+ T   VA A   T  P S     + +S  +A+ A  L F  A 
Sbjct  189  PNDDDYTFDEPPSPPSSTTKPFVAAATAATAKPPSAAKANTTTSGVSAINAPDLAFAFAF  248

Query  150  ISANLFFFM  124
            + ++ +FFM
Sbjct  249  VISSFWFFM  257



>gb|ABK24724.1| unknown [Picea sitchensis]
 gb|ACN41086.1| unknown [Picea sitchensis]
Length=409

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L KYP ++ FN  L++T LA EINSR T+TVLA+ N  M +LSG     +K V
Sbjct  22   AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSQMASLSGLDLASLKRV  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++H+VLD++D KK   +   TT  TTL+Q+TG A G+ GF+N TD     V  G A   
Sbjct  82   LSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAHG  141

Query  495  APQGSNLVSAVAHEGYD  445
            A   +  V +V  EGY+
Sbjct  142  AKLDATYVKSVKQEGYN  158



>dbj|BAK06740.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 123/216 (57%), Gaps = 6/216 (3%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            FN+T +LD+ P F+ FN  L++T+L  EIN R T+TVL VDN    A++    D  K V+
Sbjct  27   FNITEVLDESPEFSTFNSLLSKTNLVEEINKRQTITVLVVDNSAASAITSLPTDTQKKVL  86

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            AV ++LDYYD  K   +EK+T  LTTLFQ+TG A+   G +N T +    +  GSA   A
Sbjct  87   AVQVILDYYDPMKLEGIEKRTALLTTLFQTTGAATDRAGLVNYTHSADDQMAFGSAEPGA  146

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQHGKSP-AAAPS---P  325
            P  S LV  VA   Y++S++Q+S+ IIPP + S    ++ P  + HG S  A+ P+    
Sbjct  147  PLSSQLVKVVACRPYNLSVMQVSAAIIPPSISSSDKGSSGPPGKAHGSSSNASVPTITDA  206

Query  324  RKLLspsnspsdspSALTPSGVAPAATETDSPASGP  217
              L S   + +     L+PSG  P  T  D+ AS P
Sbjct  207  ETLQSFDEASAADDDGLSPSGGGP--TTADAAASSP  240



>emb|CDY42162.1| BnaC05g40570D [Brassica napus]
Length=251

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 99/153 (65%), Gaps = 1/153 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +FF  AS + +  S  +FN+T +L++   F+ FN  LT+T+LA  INSR T+TVLA+ N 
Sbjct  10   LFFSFAS-TFLYTSSNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQTITVLALSND  68

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             +   S +S +  K V+++ I+LDYYD+KK  +L KK+  LTTLFQ++G A G+QGF+NA
Sbjct  69   AVSHFSDQSAEDNKKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNA  128

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            T      VM GSAV  +   S L+ +VA   Y+
Sbjct  129  TVMNNGDVMFGSAVPGSILDSKLIDSVATHPYN  161



>ref|NP_180021.1| fasciclin-like arabinogalactan protein 3 [Arabidopsis thaliana]
 sp|Q9ZQ23.1|FLA3_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD18116.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAS76230.1| At2g24450 [Arabidopsis thaliana]
 gb|AAS92327.1| At2g24450 [Arabidopsis thaliana]
 dbj|BAF00374.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 dbj|BAF01512.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEC07579.1| fasciclin-like arabinogalactan protein 3 [Arabidopsis thaliana]
Length=280

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T +L+KYP F+   + L +T L   IN R T+TVLA++N  +G++SG+ ++ +K++
Sbjct  24   AVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVLALNNDAIGSISGRPEEEVKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDY+D  K   L++K+T LTTL+QSTG+     GFLN T + GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKEKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
sylvestris]
Length=422

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            I  F L SF+I   S  A N+T +L K+P ++ FN YLT+T LA EINSR T+T+LA+ N
Sbjct  6    IFLFTLMSFTI---SIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRTTITILALTN  62

Query  726  GGMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
            G M  + GK    VIK+V+++HI+LDY+D  K   +   TT  TTL+Q+TG A+G+ G +
Sbjct  63   GAMADVVGKHPLSVIKNVLSLHILLDYFDNTKLHKISDGTTLTTTLYQTTGNANGNLGSV  122

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            N TD  G  V  GSAV ++P  S    +V    Y+IS+L+ISS II PG+
Sbjct  123  NITDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGI  172



>gb|EMT17229.1| hypothetical protein F775_11240 [Aegilops tauschii]
Length=261

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            FN+T +L++ P F  FN  L++T+LA EIN R T+TVL VDN     +     D  K V+
Sbjct  26   FNITEVLNESPEFLTFNSLLSKTNLAEEINKRQTITVLVVDNSAASGIMSLPTDTQKKVL  85

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            AVH++LDYYD  K  T+EK T  LT+LFQ+TG A+   GF+N T +    ++ GSA   A
Sbjct  86   AVHVILDYYDPMKLETIEKGTALLTSLFQTTGAATDRMGFVNYTRSADDQMVFGSAEPGA  145

Query  492  PQGSNLVSAVAHEGYDisilqissliIPP  406
            P  S LV  VA   Y++S++Q+ + IIPP
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVRAAIIPP  174



>gb|EMS62729.1| hypothetical protein TRIUR3_26693 [Triticum urartu]
Length=261

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            FN+T +L+K P F  FN  L++T+LA EIN R T+TVL VDN     ++    D  K V+
Sbjct  26   FNITEVLNKSPEFLTFNSLLSKTNLAEEINKRQTITVLVVDNSAASGITSLPTDTQKKVL  85

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            AVH++L+YYD  K   +EK T  LT+LFQ+TG A+   GF+N T +    ++ GSA   A
Sbjct  86   AVHVILNYYDPMKLENIEKGTALLTSLFQTTGAATDRMGFVNYTHSADDQMVFGSAEPGA  145

Query  492  PQGSNLVSAVAHEGYDisilqissliIPP  406
            P  S LV  VA   Y++S++Q+S+ IIPP
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVSAAIIPP  174



>ref|XP_006352538.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=415

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  688
            +  A N+T +L KYP F+ FN YLTETHLA EINSR T+TV AVDN GM  L  K   + 
Sbjct  24   TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMAELLSKHLSIY  83

Query  687  -IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
             IK+V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  84   TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  510  SAVKNAPQGSNLVSAVAHEGYD  445
             A  +    +  V +V    Y+
Sbjct  144  PAENHGTLPATFVKSVEEIPYN  165



>gb|ABR16637.1| unknown [Picea sitchensis]
Length=409

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            AFN+T +L KYP ++ FN  L++T LA EINSR T+TVLA+ N  M  LSG     +K V
Sbjct  22   AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSEMALLSGLDLASLKRV  81

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++H+VLD++D KK   +   TT  TTL+Q+TG A G+ GF+N TD     V  G A   
Sbjct  82   LSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAHG  141

Query  495  APQGSNLVSAVAHEGYD  445
            A   +  V +V  EGY+
Sbjct  142  AKLDATYVKSVKQEGYN  158



>ref|XP_006296192.1| hypothetical protein CARUB_v10025354mg [Capsella rubella]
 gb|EOA29090.1| hypothetical protein CARUB_v10025354mg [Capsella rubella]
Length=280

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T +L+KYP F++  +   +T L   IN R T+TVLA+ N  +G++SG+ ++ IK++
Sbjct  24   AVNITRVLEKYPEFSSMLELFAKTELTPIINKRQTITVLALSNDAIGSISGRPEEEIKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDYYD  K   L+ K+T LTTL+QSTG+     GFLN + + GK +  GSAVK 
Sbjct  84   LMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKSNGK-IYFGSAVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_009767783.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=416

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L KYP F+ FN YLTETHLA EIN+R T+TV AVDN GM  L  K   +  IK
Sbjct  27   AHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIK  86

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVAFGPAE  146

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +    +  V AV    Y+
Sbjct  147  NHGNLPATFVKAVEEIPYN  165



>ref|XP_002880584.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56843.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T +L+KYP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   AVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H++LDY+D  K   L++++T LTTL+QSTG+     GFLN T + GK +  GS VK 
Sbjct  84   LMNHVILDYFDELKLKALKERSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_003526450.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=239

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = -2

Query  891  LASFSIMVWSCGA---FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            L S ++++  C +    ++T +L +YP +  FN+YLTET LA +INSR  VTVLA+D+  
Sbjct  8    LLSVALVLAFCSSIQGLDITKLLGEYPEYAQFNKYLTETKLADQINSRNAVTVLALDDAA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M +LSGKS+D +K++++ H+++++YD KK    E   T++ TLFQS+G+A  +QG++   
Sbjct  68   MASLSGKSQDAVKAILSTHVLVNFYDEKKLMEAEGSRTKVETLFQSSGVAKPNQGYIYVA  127

Query  540  DTGGKTVMIGSAVK--NAPQGSNLVSAVAHEGYDisilqissliIPPGVE  397
                  +  GSA    NAP    LV +V  +   +S+LQ+S  I+ PGVE
Sbjct  128  LINEGEIAFGSAAAAPNAPFEVVLVRSVTSQPDTVSVLQVSKPIVAPGVE  177



>ref|XP_010506492.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X1 
[Camelina sativa]
 ref|XP_010506494.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X2 
[Camelina sativa]
 ref|XP_010506495.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X3 
[Camelina sativa]
Length=423

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGA----FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAV  733
            F  LA F+  + +C +     N+T +L   P++++FN YLT+T LA EINSR T+TVL +
Sbjct  9    FSLLAFFTFSILACASTVSSHNITQILTDSPDYSSFNSYLTQTKLADEINSRTTITVLVL  68

Query  732  DNGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQG  556
            +NG M +L+GK    VIKS +++ ++LDYYD  K   L K TT  TTL+Q+TG A G+ G
Sbjct  69   NNGAMSSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLG  128

Query  555  FLNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKA  379
            F+N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV +  AP A
Sbjct  129  FVNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSA  188

Query  378  A  376
            A
Sbjct  189  A  189



>ref|XP_009615606.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L KYP F+ FN YLTETHLA EIN+R T+TV AVDN GM  L  K   +  IK
Sbjct  27   AHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIK  86

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAE  146

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +    +  V AV    Y+
Sbjct  147  NHGNLPATFVKAVEEIPYN  165



>ref|XP_010429425.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=281

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 103/167 (62%), Gaps = 1/167 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F  LA    +     A N+T  L+KYP F++  +   +T L   IN R T+TVLA+ N  
Sbjct  9    FLCLAILLAVSSIVSAVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDA  68

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            +G++SG+ ++ +K+++  H+VLDY+D  K   L+ K+T LTTL+QSTG+     GFLN T
Sbjct  69   IGSISGRPEEELKNILMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCT  128

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             + GK +  GS VK APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  129  KSNGK-IYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_004248342.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=415

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  688
            +  A N+T +L KYP F+ FN YLTETHLA EINSR T+TV AVDN GM  L  K   + 
Sbjct  24   TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMEELLSKHLSIY  83

Query  687  -IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
             IK+V+++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  84   TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  510  SAVKNAPQGSNLVSAVAHEGYD  445
             A  +    +  V +V    Y+
Sbjct  144  PAENHGNLPATFVKSVEEIPYN  165



>ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
 gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
Length=421

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = -2

Query  900  FFFLASFSI--MVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            +  L SF++  +V +  A N+T +L  +P ++ FN+YLT+T LA EIN+R T+TVLA++N
Sbjct  6    YSLLLSFTLSALVSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNN  65

Query  726  GGMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
            G M AL+ K    VIK+ +++ +VLDYYD  K   + K TT  TTL+Q+TG A G+ GF+
Sbjct  66   GAMTALAAKHPLSVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFV  125

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPP  370
            N TD  G  V  GSA   +   S+   +V    Y+ISIL+IS  II PG+ + AP   P 
Sbjct  126  NITDLQGGKVGFGSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGILT-APAPTPS  184

Query  369  S  367
            S
Sbjct  185  S  185



>emb|CDY00793.1| BnaC03g37770D [Brassica napus]
Length=266

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 100/154 (65%), Gaps = 2/154 (1%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            +IFFF ++F  +     +FN+TT+L +  +F+ FN+ L++T LA  INSR T+TVLA+ N
Sbjct  9    LIFFFASAF--LYTPSNSFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALAN  66

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              +   + +S +  K ++++H++LDYYD+KK  +L KKT  LTTLFQ +G A G QGF+N
Sbjct  67   DAVYLFADQSMEDNKVILSLHVILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVN  126

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
             T      +  GSAV+ +   S L+ +VA E ++
Sbjct  127  VTVKDNGDIAFGSAVRGSLLDSQLIDSVASEPFN  160



>gb|EPS66997.1| hypothetical protein M569_07779, partial [Genlisea aurea]
Length=401

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+TT+LDKYP  + FN YLT T LA EIN R T+TV AVDN GM  L  K   +  IK
Sbjct  21   AHNITTILDKYPELSTFNHYLTVTQLAPEINHRETITVCAVDNAGMSDLLSKHLTIGAIK  80

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +V+A+H++LDY+D KK   +   T    T+FQ+TG A+G  GF+N TD  G  V
Sbjct  81   NVLALHVLLDYFDAKKLHQITDGTALSATMFQATGSATGSSGFVNITDLAGGKV  134



>gb|KHN16466.1| Fasciclin-like arabinogalactan protein 14 [Glycine soja]
Length=208

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 95/151 (63%), Gaps = 5/151 (3%)
 Frame = -2

Query  891  LASFSIMVWSCGA---FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            L S ++++  C +    ++T +L +YP +  FN+YLTET LA +INSR  VTVLA+D+  
Sbjct  8    LLSVALVLAFCSSIQGLDITKLLGEYPEYAQFNKYLTETKLADQINSRNAVTVLALDDAA  67

Query  720  MGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            M +LSGKS+D +K++++ H+++++YD KK    E   T++ TLFQS+G+A  +QG++   
Sbjct  68   MASLSGKSQDAVKAILSTHVLVNFYDEKKLMEAEGSRTKVETLFQSSGVAKPNQGYIYVA  127

Query  540  DTGGKTVMIGSAVK--NAPQGSNLVSAVAHE  454
                  +  GSA    NAP    LV +V  +
Sbjct  128  LINEGEIAFGSAAAAPNAPFEVVLVRSVTSQ  158



>ref|XP_010243936.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=408

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 83/143 (58%), Gaps = 2/143 (1%)
 Frame = -2

Query  867  WSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV  688
             + GA N+T +L K+P F+ FN YLT THLA EIN R T+TV AVDN GM  L  K   +
Sbjct  22   CTTGAHNITRILAKHPEFSTFNHYLTVTHLAAEINRRETITVCAVDNAGMSELLSKHLSI  81

Query  687  --IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMI  514
              IK+V+++HI+LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  
Sbjct  82   YAIKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGF  141

Query  513  GSAVKNAPQGSNLVSAVAHEGYD  445
            G+   +    S  V ++    Y+
Sbjct  142  GAEANDGKIDSTFVKSIQEIPYN  164



>emb|CDY28643.1| BnaC09g32320D [Brassica napus]
Length=423

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 89/147 (61%), Gaps = 8/147 (5%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            I + L    ++     A NVT +L  +P+F++FN +LT+THLAGEIN R T+TVLAVDN 
Sbjct  10   ISYILPIILLLAVETHAHNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNA  69

Query  723  GMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
             M AL+ K   +  IK+++++H++LDY+  KK   +   +    TLFQ+TG A G  GF+
Sbjct  70   AMSALTSKGYPISTIKNILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFV  129

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVS  469
            N TD  G  V +G      P G +L S
Sbjct  130  NITDLRGGKVGLG------PDGGDLSS  150



>ref|XP_010518164.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 113/174 (65%), Gaps = 4/174 (2%)
 Frame = -2

Query  885  SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGA  712
            +FSI+ +  +  + N+T +L   P++++FN YLT+T LA EINSR T+TVL ++NG M +
Sbjct  16   TFSILAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSS  75

Query  711  LSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDT  535
            L+GK    VIKS +++ ++LDYYD  K   L K TT  TTL+Q+TG A G+ GF+N TD 
Sbjct  76   LAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDL  135

Query  534  GGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
             G  V  GSAV  +   S+   +V    Y+ISIL+I + II PGV +  AP AA
Sbjct  136  KGGKVGFGSAVSGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAA  189



>emb|CDY08417.1| BnaA05g26530D [Brassica napus]
Length=251

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 92/140 (66%), Gaps = 0/140 (0%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            S  +FN+T +L++   F+ FN  LT+T+LA  INSR T+TVLA+ N  +   S +S +  
Sbjct  22   STNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQTITVLALSNDAVSHFSDQSAEDN  81

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K V+++ I+LDYYD+KK  +L KK+  LTTLFQ++G A G+QGF+NAT      VM GSA
Sbjct  82   KKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNATVMDNGDVMFGSA  141

Query  504  VKNAPQGSNLVSAVAHEGYD  445
            V  +   S L+ +VA   Y+
Sbjct  142  VPGSILDSKLIDSVATHPYN  161



>ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum 
lycopersicum]
Length=414

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 111/169 (66%), Gaps = 3/169 (2%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            + FFL  F+++  S  A N+T +L+K+P ++ FN YL++T LA EINSR T+TVLA+ NG
Sbjct  4    LHFFL--FTLLTVSVHAHNITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNG  61

Query  723  GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M A+  K    VIK+V+++H++LDY+D  K   +   TT  TTL+Q+TG A G+ G +N
Sbjct  62   AMSAIVDKHPLSVIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNIGSVN  121

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA+ N+P  S    +V    Y+IS+L++S+ II PG+
Sbjct  122  ITDLKGGKVGFGSAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGI  170



>ref|XP_009802278.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=415

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 104/173 (60%), Gaps = 4/173 (2%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            S ++++ +  A ++T +L K+P F+ FN YLT THLA EIN R T+TV AVDN GM  L 
Sbjct  15   SLALLLCATEAHDITRILAKHPQFSTFNHYLTTTHLANEINRRQTITVFAVDNAGMSDLL  74

Query  705  GKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTG  532
             K   +  +K+V++ H++LDY+  KK   +   T    T+FQ+TG ASG  GF+N T+  
Sbjct  75   SKHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNVK  134

Query  531  GKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            G  V+   A  + P  +  V +V    Y+IS++QIS+++  P  E+ AP   P
Sbjct  135  GGKVVFSPADYDGPPPAKFVKSVEEIPYNISVIQISTIL--PSAEAEAPTPGP  185



>ref|XP_004244059.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=411

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -2

Query  873  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK  694
             + +  A N+T +L  +  F+ FN YLT THLA EIN R T+TV AVDN GM  L  K  
Sbjct  19   FICATEAHNITHILADHKQFSTFNHYLTTTHLAAEINRRQTITVCAVDNAGMSDLLSKQL  78

Query  693  DV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
             +  IK+V++ H++LDY+D KK   +   T    T+FQ+TG A+G  GF+N TD  G  V
Sbjct  79   SIYTIKNVLSFHVLLDYFDAKKLHQITNGTALAATMFQATGSATGSSGFVNITDLRGGKV  138

Query  519  MIGSAVKNAPQGSNLVSAVAHEGYD  445
             +  A  N P  +  V ++A   Y+
Sbjct  139  GLSPADYNGPPPAKFVKSIAEIPYN  163



>ref|XP_010435371.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 111/185 (60%), Gaps = 11/185 (6%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAF-------NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTV  742
            F+ +A+  ++++    F       N+T +L K P+F+ FN YL+ THLA EIN R T+TV
Sbjct  24   FWGVATILVLIFQLHLFFSLSSAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITV  83

Query  741  LAVDNGGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMAS  568
            LAVDN  M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+
Sbjct  84   LAVDNSAMSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSAT  143

Query  567  GDQGFLNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIA  388
            G  G++N TDT G  V  G    ++   ++ V ++  + Y+IS+L IS ++  P  E  A
Sbjct  144  GTSGYVNITDTKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--A  201

Query  387  PKAAP  373
            P A+P
Sbjct  202  PTASP  206



>ref|XP_010472452.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=280

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T  L+KYP F++  +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   AVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDY+D  K   L+ K+T LTTL+QSTG+     GFLN T + GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_010417204.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=280

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T  L+KYP F++  +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   AVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDY+D  K   L+ K+T LTTL+QSTG+     GFLN T + GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK-IYFGSGVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_009625162.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=415

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 104/173 (60%), Gaps = 4/173 (2%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            S ++++ +  A N+T +L K+P F+ FN YLT THLA EIN R T+T+ AVDN GM  L 
Sbjct  15   SLALLLCATEAHNITRILAKHPQFSTFNHYLTTTHLAYEINRRQTITICAVDNAGMSDLL  74

Query  705  GKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTG  532
             K   +  +K+V++ H++LDY+  KK   +   T    T+FQ+TG ASG  GF+N T+  
Sbjct  75   SKHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNLK  134

Query  531  GKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            G  V+   A  + P  +  V +V    Y+IS++QIS+++  P  E+ AP   P
Sbjct  135  GGKVVFSPADYDGPPPAKFVKSVEEIPYNISVIQISTIL--PSAEAEAPTPGP  185



>ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
 gb|ESQ56466.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
Length=405

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 107/180 (59%), Gaps = 8/180 (4%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            +IF F   FS+      A N+T +L K P+F+ FN YLT THLA EIN R T+TVLAVDN
Sbjct  13   LIFQFHLLFSL----SNAHNITKILAKDPDFSTFNHYLTATHLADEINRRQTITVLAVDN  68

Query  726  GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M ++   G S   I++++++H+++DY+  KK   +   TT   ++FQSTG A+G  G+
Sbjct  69   SAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGTTSTASMFQSTGSATGTSGY  128

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            +N TD  G  V  G    ++   +  V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  129  VNITDIKGGKVAFGVQDDDSKLTAQYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  186



>ref|XP_006404978.1| hypothetical protein EUTSA_v10000470mg [Eutrema salsugineum]
 gb|ESQ46431.1| hypothetical protein EUTSA_v10000470mg [Eutrema salsugineum]
Length=277

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T  L+KYP F+   +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALEKYPEFSTMTELFAKTELTPIINKRQTLTVLALSNDAIGSISGRPEEELKNILM  85

Query  669  VHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAP  490
             H+VLDYYD  K   L+ K+T LTTL+QSTG+     GFLN + + GK +  GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKSNGK-IYFGSAVKGAP  144

Query  489  QGSNLVSAVAHEGYDisilqissliIPPGV  400
            Q +  ++ V    Y++S++QIS  I+ PG+
Sbjct  145  QTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_010056276.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Eucalyptus 
grandis]
Length=425

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKSVM  673
            N+T +L+ +P ++ F+ YL++T LA EINSR T+TVLA+DNG M AL+GK    VIK+ +
Sbjct  26   NITAILEGFPEYSLFSSYLSQTKLADEINSRQTITVLALDNGAMSALAGKKPLSVIKNEL  85

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            AVH+VLDY+D +K   + K +T  TTL+Q+TG A G+ GF+N TD  G  V  G+A   +
Sbjct  86   AVHVVLDYFDPQKLHQIPKGSTLSTTLYQTTGNAPGNTGFVNITDLQGGKVGFGAAAPGS  145

Query  492  PQGSNLVSAVAHEGYD  445
               S+   +V    Y+
Sbjct  146  KLDSSYTKSVKQIPYN  161



>ref|XP_010508167.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = -2

Query  891  LASFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
            L +FSI+ +  +  + N+T +L   P++++FN YLT+T LA EINSR T+TVL ++NG M
Sbjct  14   LFTFSILAFASTVSSHNITQILADSPDYSSFNNYLTQTKLADEINSRTTITVLVLNNGAM  73

Query  717  GALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
             +L+GK    VIKS +++ ++LDYYD  K   L K TT  TTL+Q+TG A G+ GF+N T
Sbjct  74   SSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNIT  133

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
            D  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV +  AP AA
Sbjct  134  DLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAA  189



>ref|XP_010496525.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 107/179 (60%), Gaps = 13/179 (7%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            IFF L+S         A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN 
Sbjct  39   IFFSLSS---------AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNS  89

Query  723  GMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
             M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+G  G++
Sbjct  90   AMSSILSRGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYV  149

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            N TD  G  V  G    ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  150  NITDIKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  206



>dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            + S++       N+T +L  +P ++ FN YL++T LA EINSR T+TVLA+ NG M  L+
Sbjct  2    TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLA  61

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGK  526
                 VIKS +++ I+LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N TD  G 
Sbjct  62   KHPLSVIKSALSLLILLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  525  TVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122  KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>emb|CDY20316.1| BnaC04g36400D [Brassica napus]
Length=286

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T  LDKYP F+   + L +T L   IN R T+T+LA+ N  +G++SG+ +D +K++
Sbjct  24   AVNITRALDKYPEFSTMTELLAKTKLTPIINKRQTITLLALSNDAIGSISGRPEDELKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLD+YD  K   ++ K+T LTTL+QSTG+     GFL  + T GK +  GSAVK 
Sbjct  84   LMNHVVLDFYDGLKLKAIKDKSTMLTTLYQSTGLGQQQNGFLKCSKTNGK-IYFGSAVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    +++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_006483738.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Citrus 
sinensis]
 gb|KDO67241.1| hypothetical protein CISIN_1g042255mg [Citrus sinensis]
Length=280

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            F++  +L  +PN   F+  L++T L   IN R T+TVLAVDN  +G L+ +  D IK+++
Sbjct  29   FDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNIL  88

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            +VH++LDYYD+        KT+  TT+FQSTG A+  QG++N T   G+  + GS+VKN+
Sbjct  89   SVHVILDYYDM-NKLKKLPKTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNS  147

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGV  400
            P  +  V +V  + ++IS+LQ+S  I+ PG+
Sbjct  148  PPVAKFVKSVFSQPFNISVLQVSQPIVAPGL  178



>ref|XP_006450136.1| hypothetical protein CICLE_v10010765mg [Citrus clementina]
 gb|ESR63376.1| hypothetical protein CICLE_v10010765mg [Citrus clementina]
Length=280

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
            F++  +L  +PN   F+  L++T L   IN R T+TVLAVDN  +G L+ +  D IK+++
Sbjct  29   FDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNIL  88

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            +VH++LDYYD+        KT+  TT+FQSTG A+  QG++N T   G+  + GS+VKN+
Sbjct  89   SVHVILDYYDM-NKLKKLPKTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNS  147

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGV  400
            P  +  V +V  + ++IS+LQ+S  I+ PG+
Sbjct  148  PPVAKFVKSVFSQPFNISVLQVSQPIVAPGL  178



>ref|XP_009417795.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 116/179 (65%), Gaps = 2/179 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +     SF +++ S  A N+T +L ++P+F+NFN  L++  +A E+N R T+TVLAVDN 
Sbjct  9    LLLVFVSFLVLLSSATAHNITRLLSQFPDFSNFNSLLSQADIASEVNRRQTITVLAVDNS  68

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
               +LS    D +K V+++H++LDYYD +K   L++++T  TTLFQ+TG+A+   GFLNA
Sbjct  69   AASSLSSLDSDTLKQVLSIHVILDYYDKEKIHNLKRRSTLFTTLFQTTGVAANRMGFLNA  128

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES--IAPKAAP  373
            T      +  GS V  +P  +  V +VA + Y++S+LQIS++I+P G+    +AP  AP
Sbjct  129  TKLSDGRLAFGSGVPGSPLVATYVKSVAAKPYNLSVLQISAVIVPQGINGTPLAPFGAP  187



>ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis]
Length=418

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 103/169 (61%), Gaps = 1/169 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +F FL    + +    A N+T +L  +P ++ FN YLT+T LA EINSR T+TVL + NG
Sbjct  4    VFLFLTLSLLAITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNG  63

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M  L+ K    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N
Sbjct  64   AMSDLTAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVN  123

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA   +   S    +V    Y++S+L+ISS II PG+
Sbjct  124  ITDLQGGKVGFGSAASGSKLDSTYTKSVKQIPYNVSVLEISSPIIAPGI  172



>ref|XP_010092859.1| hypothetical protein L484_022454 [Morus notabilis]
 gb|EXB52677.1| hypothetical protein L484_022454 [Morus notabilis]
Length=424

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 90/144 (63%), Gaps = 5/144 (3%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            + F   S   +     A N+T +L ++P+++++N+YLT+T LA EINSR TVTVL ++NG
Sbjct  8    LVFLCLSILALNAVVSAHNITAILSEFPDYSDYNKYLTQTKLADEINSRTTVTVLVLNNG  67

Query  723  GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
               AL+ K    V+K V+++HIVLDY+D +K   L   +T  TTL+Q+TG A G+ G +N
Sbjct  68   AFSALASKHPASVLKKVLSLHIVLDYFDAQKLHKLPDGSTLSTTLYQTTGNAPGNLGSIN  127

Query  546  ATDTGGKTVMIGSAVKNAPQGSNL  475
             TD  G  V  GSA     QGS L
Sbjct  128  ITDLKGGKVGFGSAA----QGSKL  147



>ref|XP_009133982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=280

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T  L+KYP F+   +   +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+V
Sbjct  24   AVNITRALEKYPEFSTMVELFGKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNV  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDY+D  K   L+ ++T LTTL+QSTG+     GFLN T T GK +  GS VK 
Sbjct  84   LMNHVVLDYFDELKLKALKDRSTLLTTLYQSTGLGQQQNGFLNCTKTNGK-IYFGSGVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    Y++S++QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPYNLSVIQISMPIVAPGL  174



>ref|XP_006491459.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like, partial 
[Citrus sinensis]
Length=459

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 103/169 (61%), Gaps = 1/169 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +F FL    + +    A N+T +L  +P ++ FN YLT+T LA EINSR T+TVL + NG
Sbjct  45   VFLFLTLSLLAITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNG  104

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M  L+ K    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N
Sbjct  105  AMSDLTAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVN  164

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA   +   S    +V    Y++S+L+ISS II PG+
Sbjct  165  ITDLQGGKVGFGSAASGSKLDSTYTKSVKQIPYNVSVLEISSPIIAPGI  213



>dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            + S++       N+T +L  +P ++ FN YL++T LA EINSR T+TVLA+ NG M  L+
Sbjct  2    TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLA  61

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGK  526
                 VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N TD  G 
Sbjct  62   KHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  525  TVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122  KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>emb|CDX68507.1| BnaC01g25850D [Brassica napus]
Length=401

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (59%), Gaps = 10/180 (6%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            II F L S S       A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN
Sbjct  13   IIMFQLLSLS------NAHNITKILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDN  66

Query  726  GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G+
Sbjct  67   SAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGY  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            +N TD  G  V  G    ++   +  + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  127  VNITDIKGGKVAFGVQDDDSQLTARYIKSIFEKAYNISVLHISQVLTSPEAE--APTASP  184



>ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 ref|XP_004167979.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 gb|KGN43405.1| hypothetical protein Csa_7G031660 [Cucumis sativus]
Length=418

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  688
            S  A N+T +L K+P F+ FN YLT THLAGEIN R T+TVLA+DN  M AL  K   V 
Sbjct  24   SADAHNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSVG  83

Query  687  -IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
             IK+V+++H+++DYY  KK   L K TT  +TLFQ+TG A+G  G++N T+  G  V  G
Sbjct  84   TIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGFG  143

Query  510  SAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPS  367
            S        S  V +V    Y+ISILQIS +I     E  AP AAP S
Sbjct  144  SEDNGGDLNSFYVKSVVEMPYNISILQISKVITSADAE--APTAAPVS  189



>ref|XP_008462050.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Cucumis 
melo]
Length=421

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  688
            S  A N+T +L K+P F+ FN YLT THLAGEIN R T+TVLA+DN  M AL  K   V 
Sbjct  27   SADAHNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSVG  86

Query  687  -IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
             IK+V+++H+++DYY  KK   L K TT  +TLFQ+TG A+G  G++N T+  G  V  G
Sbjct  87   TIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGFG  146

Query  510  SAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPS  367
            S        S  V +V    Y+ISILQIS +I     E  AP AAP S
Sbjct  147  SEDNGGDLNSFYVKSVVEMPYNISILQISKVITSADAE--APTAAPVS  192



>ref|XP_010479980.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 106/179 (59%), Gaps = 13/179 (7%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +FF L+S         A N+T +L K P F+ FN YL+ THLA EIN R T+TVLAVDN 
Sbjct  39   LFFSLSS---------AHNITRILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNS  89

Query  723  GMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
             M ++   G S   I++++++H+++DYY  KK   +   +T   ++FQSTG A+G  G++
Sbjct  90   AMSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYV  149

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            N TD  G  V  G    ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  150  NITDIKGGKVAFGVQEDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  206



>ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
 gb|EOA18968.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
Length=402

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  26   AHNITRILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIR  85

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DYY  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  145

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  186



>gb|KFK32403.1| hypothetical protein AALP_AA6G237100 [Arabis alpina]
Length=397

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++  FL S S       A N+T +L K P F+ FN YLT THLA EIN R T+TVLAVDN
Sbjct  11   LVLTFLFSLS------NAHNITKILAKDPEFSTFNHYLTATHLADEINRRQTITVLAVDN  64

Query  726  GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G+
Sbjct  65   SAMSSILSKGYSLYTIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGY  124

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            +N TD  G  V  G    ++   +  V ++  + Y+IS++ IS ++  P  E  AP A+P
Sbjct  125  VNITDIKGGKVAFGVQDDDSELTARYVKSIFEKAYNISVVHISQVLTSPEAE--APTASP  182



>gb|AAM66074.1| endosperm-specific protein-like protein [Arabidopsis thaliana]
Length=420

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 111/171 (65%), Gaps = 4/171 (2%)
 Frame = -2

Query  900  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVD  730
            F  LA +FS++ +  +  + N+T +L   P++++FN YL++T LA EINSR T+TVL ++
Sbjct  7    FSLLAFTFSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLN  66

Query  729  NGGMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
            NG M AL+GK    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF
Sbjct  67   NGAMSALAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV
Sbjct  127  VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>ref|NP_566043.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
 sp|O22126.1|FLA8_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 8; Short=AtAGP8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB82617.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19815.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AAN31110.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AEC10559.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
Length=420

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 111/171 (65%), Gaps = 4/171 (2%)
 Frame = -2

Query  900  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVD  730
            F  LA +FS++ +  +  + N+T +L   P++++FN YL++T LA EINSR T+TVL ++
Sbjct  7    FSLLAFTFSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLN  66

Query  729  NGGMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
            NG M AL+GK    VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF
Sbjct  67   NGAMSALAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV
Sbjct  127  VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>ref|XP_009151619.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
 emb|CDX83056.1| BnaA01g20560D [Brassica napus]
Length=401

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (59%), Gaps = 10/180 (6%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            II F L S S       A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN
Sbjct  13   IIMFQLLSLS------NAHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDN  66

Query  726  GGMGAL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G+
Sbjct  67   SAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGY  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            +N TD  G  V  G    ++   +  + ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  127  VNITDIKGGKVAFGVQDDDSQLTARYIKSIFEKAYNISVLHISQVLTSPEAE--APTASP  184



>ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus 
euphratica]
Length=421

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 107/169 (63%), Gaps = 2/169 (1%)
 Frame = -2

Query  870  VWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-  694
            V +  A N+T +L  +P ++ FN+YLT+T LA EIN+R T+TVLA++NG M AL+ K   
Sbjct  18   VSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAMTALAAKHPL  77

Query  693  DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMI  514
             VIK+ +++ +VLDYYD  K   + K TT  TTL+Q+TG A G+ GF+N TD  G  V  
Sbjct  78   SVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGF  137

Query  513  GSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPS  367
            GSA   +   S+   +V    Y+ISIL+IS  II PG+ + AP   P S
Sbjct  138  GSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGILT-APAPTPSS  185



>ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
 gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
Length=399

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 93/159 (58%), Gaps = 6/159 (4%)
 Frame = -2

Query  903  IFFFLASFSIMVWSC----GAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLA  736
            +F  LA F + ++S      A N+T +L K+P F+ FN YLT THLA EIN R T+TVLA
Sbjct  8    LFPSLALFILFIFSSSTTSNAHNITRILAKHPEFSTFNHYLTTTHLASEINRRQTITVLA  67

Query  735  VDNGGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGD  562
            +DN  M AL  K   +  +K+V+++H+++DY+  KK   +   T   +T+FQ+TG A G 
Sbjct  68   LDNAAMSALLDKQLSLYTVKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQATGAAPGS  127

Query  561  QGFLNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
             G++N TD  G  V  G+   N    +  V +VA   Y+
Sbjct  128  SGYINITDLKGGKVGFGAEDNNGKLDAVYVKSVAEIPYN  166



>ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Solanum 
tuberosum]
Length=415

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (2%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            + FFL  F++   S  A N+T +L+++P ++ FN YL++T LA EINSR T+TVLA+ NG
Sbjct  4    LHFFL--FTLFTVSVHAHNITEILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPNG  61

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M A+  K    VIK+V+++H++LDY+D  K   +   TT  TTL+Q+TG A G+ G +N
Sbjct  62   AMSAVVDKHPLSVIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNVGSVN  121

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA+ N+P  S    +V    Y+IS+L++S+ II PG+
Sbjct  122  ITDLKGGKVGFGSAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGI  170



>emb|CDP12467.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = -2

Query  885  SFSIMVWSC---------GAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAV  733
            S S++  SC          AFN+T +L   P+F+NFN  L++  L   INS+  VT+LA+
Sbjct  7    STSLIFLSCLLLASSVTTAAFNITAILGDIPSFSNFNDLLSKAGLVKAINSQSPVTILAI  66

Query  732  DNGGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
             N  +G L+GK  DVIK  +  H+VLDYYD+       K  TR+TTLFQ TG+A+ DQGF
Sbjct  67   PNEHIGDLAGKPADVIKITLMTHVVLDYYDL-LKLANAKNGTRMTTLFQKTGVATYDQGF  125

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVE  397
            L    + G+ ++  SA K AP    +V+ V    ++ SI+ +SS I+ PGV+
Sbjct  126  LILNRSHGQ-LIFSSAAKGAPHNVQVVATVTQHPFNYSIISVSSAIMTPGVD  176



>emb|CDP17792.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DV  688
            S  A N+T +L  +P ++ +N++LT+T LA EINSR T+TVL + N  M +L+ K    V
Sbjct  59   SIYAHNITEILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAMDSLAAKHPLSV  118

Query  687  IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGS  508
            +K  +++H+VLDYYD  K   +   TT  TTL+Q+TG A G+QGF+N TD  G  V  GS
Sbjct  119  VKKALSLHVVLDYYDAGKLHDISNGTTLSTTLYQTTGNAPGNQGFVNITDLKGGKVGFGS  178

Query  507  AVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            AV  +   S    +V    Y+IS+++IS+ II PGV
Sbjct  179  AVPGSKLDSTYTKSVKQIPYNISVIEISAPIIAPGV  214



>ref|XP_009120095.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
 emb|CDY17354.1| BnaA10g09880D [Brassica napus]
Length=426

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 8/131 (6%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A NVT +L  +P+F++FN +LT+THLAGEIN R T+TVLAVDN  M AL+ K   +  +K
Sbjct  27   AHNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNAAMSALTSKGYPISTVK  86

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H++LDY+  KK   +   +    TLFQ+TG A G  GF+N TD  G  V +G   
Sbjct  87   NILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGLG---  143

Query  501  KNAPQGSNLVS  469
               P G +L S
Sbjct  144  ---PDGGDLSS  151



>dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            + S++       N+T +L  +P ++ FN YL++T LA EINSR T+TVLA+ NG M  L+
Sbjct  2    TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTLTVLALPNGAMSDLA  61

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGK  526
                 VIKS +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N TD  G 
Sbjct  62   KHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  525  TVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122  KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>gb|ABV27488.1| fasciclin-like arabinogalactan protein 17 [Gossypium hirsutum]
Length=285

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 102/169 (60%), Gaps = 0/169 (0%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++FF  A    +  +C A N+T  L  Y +++  +    +T L   IN R T+T+LA+DN
Sbjct  8    LLFFIAAILLPLATTCTALNITKSLAPYSDYSTLSDLFRKTKLTDAINRRQTITILALDN  67

Query  726  GGMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
              + +++ +S D ++ ++  HI+LDYYD +K   L KK+  LTTL+Q+TG A   QGF+N
Sbjct  68   SSIQSITDRSSDELRKILMNHIILDYYDRQKIQKLGKKSALLTTLYQTTGSAINQQGFVN  127

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             T      V+ GSAVK AP    L+ +V  + +++S+L IS+ I+ PG+
Sbjct  128  ITRIARGEVVFGSAVKGAPLVGKLLGSVISQPFNLSVLHISTPIVAPGI  176



>ref|XP_009140554.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=285

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T  LDKYP F+   +   +T L   IN R T+T+LA+ N  +G++SG+ +D +K++
Sbjct  24   AVNITRALDKYPEFSTMTELFAKTKLTPIINKRQTITLLALSNDAIGSISGRPEDELKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLD+YD  K   ++ K+T LTTL+QSTG+     GFL  + T GK +  GSAVK 
Sbjct  84   LMNHVVLDFYDGLKLKAIKDKSTMLTTLYQSTGLGQQQNGFLKCSKTNGK-IYFGSAVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            APQ +  ++ V    +++SI+QIS  I+ PG+
Sbjct  143  APQTAEYITTVFRNPFNLSIVQISMPIVAPGL  174



>dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            + S++       N+T +L  +P ++ FN YL++T LA EINSR T+TVLA+ NG M  L+
Sbjct  2    TLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLA  61

Query  705  GKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGK  526
                 VIK+ +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N TD  G 
Sbjct  62   KHPLSVIKNALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGG  121

Query  525  TVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             V  GSA   +   S+   +V    Y++S+L+I+S II PG+
Sbjct  122  KVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea 
aurea]
Length=400

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKS  679
            A N+T +LD YP +++FN  LT+T LA EI+SR  VTVLA+ N  + ++SGK    V+KS
Sbjct  1    ATNITKILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSELSSISGKYPLGVVKS  60

Query  678  VMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVK  499
            V+++H++LDY+D  K   +   +   TTL Q+TG A+G+ GF+N TD  G  V  GS + 
Sbjct  61   VLSLHVLLDYFDAAKLHKISDGSVLSTTLLQTTGNAAGNVGFVNITDLRGGKVGFGSGIA  120

Query  498  NAPQGSNLVSAVAHEGYD  445
             +P  S    +V    Y+
Sbjct  121  GSPLDSTFTKSVQQIPYN  138



>ref|XP_011082039.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 3 [Sesamum indicum]
Length=266

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 110/189 (58%), Gaps = 14/189 (7%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            +  AFN+T ML++YP F+ FN  L++T        R TVTVLA+  G +G LS K++DV 
Sbjct  20   TTSAFNITRMLEQYPEFSEFNGLLSKTR------RRRTVTVLALSAGHLGDLSSKTEDVQ  73

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K +++ H+VLDYYD  K   L+     LTTL+Q++G A   QGF+N T      ++ GSA
Sbjct  74   KRILSNHVVLDYYDTTKLNKLKNGKAVLTTLYQASGTADDQQGFINVTHNTEGHIIFGSA  133

Query  504  VKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES----IAPKAAP-PSHQQHG---K  349
             K +   S L  AV  + Y+IS+L ISS II  G++     + P+AAP PS         
Sbjct  134  EKGSQMNSQLEGAVVAQPYNISVLSISSPIIANGIDGNRSPMPPQAAPSPSDAASSPTDD  193

Query  348  SPAAAPSPR  322
            +PA+A SP 
Sbjct  194  APASAESPE  202



>ref|XP_002882015.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58274.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 114/180 (63%), Gaps = 5/180 (3%)
 Frame = -2

Query  900  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVD  730
            F  LA +FS++    +  + N+T +L   P++++FN YL++T LA EINSR T+TVL ++
Sbjct  7    FSLLAFTFSLLAVASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLN  66

Query  729  NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
            NG M AL+GK    VIKS +++ ++LDYYD  K   + K TT  TTL+Q+TG A G+ GF
Sbjct  67   NGAMSALAGKHPLSVIKSALSLLVLLDYYDPLKLHKISKGTTLSTTLYQTTGNAPGNLGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
            +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PG+ +  AP AA
Sbjct  127  VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGILTAPAPSAA  186



>ref|XP_008460132.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis 
melo]
Length=423

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVI  685
              A N+T ML  YP ++ F+ YL +T LA EINSR T+TVL V NG +  +  K    VI
Sbjct  20   VSAHNITDMLKDYPQYSVFSNYLQQTRLADEINSRQTITVLVVSNGALSPILDKHPLSVI  79

Query  684  KSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSA  505
            K+++++HIVLDYYD  K   +   TT  TTL+Q+TG A G+ GF+N TD  G  V  GSA
Sbjct  80   KNILSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVAFGSA  139

Query  504  VKNAPQGSNLVSAVAHEGYD  445
            V  +   S+   +V    Y+
Sbjct  140  VPGSKLESSYTKSVVSMPYN  159



>ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39576.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 105/176 (60%), Gaps = 4/176 (2%)
 Frame = -2

Query  894  FLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMG  715
             ++   + +    A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN  M 
Sbjct  13   LISQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMS  72

Query  714  AL--SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
            ++   G S   I++++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N T
Sbjct  73   SILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNIT  132

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            D  G  V  G    ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  133  DIKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  186



>ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=402

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
             F L    ++  +  AFN+T +L K+P F+ FN+YLT+THLA EIN R T+T+LA+DN  
Sbjct  9    IFALLVVVLLAPATTAFNITKILKKHPEFSTFNEYLTQTHLANEINHRQTITILALDNSA  68

Query  720  MGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
            M +L  K   +  +++V+++H+++DYY  KK   +   TT   +LFQS+G A G+ G++N
Sbjct  69   MSSLLSKGLTLFTLRNVLSLHVLVDYYGAKKLHQITDGTTVTASLFQSSGDADGNSGYVN  128

Query  546  ATDT-GGK  526
             TD  GGK
Sbjct  129  ITDMHGGK  136



>emb|CDX87001.1| BnaC03g52710D [Brassica napus]
Length=402

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  23   AHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIR  82

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  83   NILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  142

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  143  DDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  183



>gb|KDP29933.1| hypothetical protein JCGZ_18502 [Jatropha curcas]
Length=408

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 81/125 (65%), Gaps = 2/125 (2%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV-  688
            +C A N+T +L K+P F+ FN YLT THLA EIN R T+TVLA+DN  M +L  K   V 
Sbjct  23   TCCAHNITRILAKHPAFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLLAKQLSVY  82

Query  687  -IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
             +++V+++H+++DY+  KK   +   TT  +T+FQ+TG A+G  G++N TD  G  V  G
Sbjct  83   TLRNVLSLHVLVDYFGAKKLHQITDGTTLTSTMFQATGSATGTSGYVNITDLKGGKVAFG  142

Query  510  SAVKN  496
            S   N
Sbjct  143  SEDNN  147



>ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis 
melo]
Length=414

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 78/131 (60%), Gaps = 2/131 (2%)
 Frame = -2

Query  897  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
            F LA   +++ +  A N+T +L+K+P F+ FN YLT THLA EIN R T+TV  VDN  M
Sbjct  14   FVLAVLFLVISTATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAM  73

Query  717  GALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
              L  K   +  IK+ +++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N 
Sbjct  74   SDLLAKQLSIYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNI  133

Query  543  TDTGGKTVMIG  511
            TD  G  V  G
Sbjct  134  TDLKGGKVGFG  144



>ref|XP_003523715.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=232

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 98/162 (60%), Gaps = 2/162 (1%)
 Frame = -2

Query  852  FNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVM  673
             ++T +L +YP +  FN+YLTET LA +INS   VTVLA+D+  M +LS K +D +K+++
Sbjct  25   LDITKLLGQYPEYAQFNKYLTETKLADQINSLNAVTVLALDDAAMASLSAKPQDAVKAIL  84

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVK--  499
            + H+++++YD KK    E    ++ TLFQS+G+A  +QG++         +  GSA    
Sbjct  85   STHVLVNFYDEKKLMEAEGSRAKVETLFQSSGVAKPNQGYIYVALINEGEIAFGSAAAAP  144

Query  498  NAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            NAP    LV +V  +    SILQ+S  I+ PGVES A    P
Sbjct  145  NAPFEVVLVRSVTSQPDAASILQVSKPIVAPGVESAASATVP  186



>ref|XP_006296250.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
 gb|EOA29148.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
Length=420

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = -2

Query  900  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVD  730
            F  LA +FS++ +  +  + N+T +L   P++++FN YLT+T LA EINSR T+TVL ++
Sbjct  7    FSLLAFAFSLLAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLN  66

Query  729  NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
            NG M +L+GK    VIK  +++ ++LDYYD +K   L K TT  TTL+Q+TG A G+ GF
Sbjct  67   NGAMSSLAGKHPLSVIKGALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
            +N TD  G  V  GSA   +   S+   +V    Y+ISIL+I + II PGV +  AP AA
Sbjct  127  VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAA  186



>ref|XP_006401420.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
 gb|ESQ42873.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
Length=424

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (59%), Gaps = 8/148 (5%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            II + L    ++     A NVT +L  +P+F++FN +LT+THLA EIN R TVTV AVDN
Sbjct  9    IITYILPILLLLTVKSHAHNVTRLLANHPSFSSFNHFLTQTHLADEINRRTTVTVCAVDN  68

Query  726  GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M AL+ K   +  +K+++++H++LDY+  KK   +   +    TLFQ+TG A G  GF
Sbjct  69   AAMSALTSKGYTITTLKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAQGMTGF  128

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVS  469
            +N TD  G  V  G      P G +L S
Sbjct  129  VNITDLRGGKVGFG------PDGGDLSS  150



>emb|CDY37904.1| BnaA06g19130D [Brassica napus]
Length=398

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P F+ FN YL+ THLA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  23   AHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIR  82

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  83   NILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  142

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  143  DDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  183



>ref|XP_011095539.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=415

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +LDKYP+F+ FN YLT T LA EIN R T+TV AVDN  M  L  K  ++  IK
Sbjct  28   AHNITRILDKYPDFSTFNHYLTLTQLAPEINRRETITVCAVDNARMSDLLSKHLNIGAIK  87

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +V+++H++LDY+D KK   +   T    T+FQ+TG A G  GF+N TD  G  V
Sbjct  88   NVLSLHVLLDYFDSKKLHQITDGTALAATMFQATGSAPGSAGFVNITDLKGGKV  141



>ref|XP_009150168.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
Length=399

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P F+ FN YL+ THLA EIN R T+TVLAVDN  M ++   G S   I+
Sbjct  23   AHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIR  82

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  83   NILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQE  142

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V ++  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  143  DDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAE--APTASP  183



>gb|ABV27482.1| fasciclin-like arabinogalactan protein 11 [Gossypium hirsutum]
Length=417

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 92/156 (59%), Gaps = 3/156 (2%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++    ++F ++  +  A NVT +L K+P+ + FN YLT THLA EIN R T+TVLA+DN
Sbjct  8    VVLLIFSAF-LLFQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDN  66

Query  726  GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M +L  K+  +  IK+++++H++LDY+  KK   +   T    T+FQ+TG+A+G  GF
Sbjct  67   AAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            +N TD  G  V  G+        S  V +V    Y+
Sbjct  127  VNITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYN  162



>gb|AIY35291.1| fasciclin-like arabinogalactan 11 [Gossypium hirsutum]
Length=417

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 92/156 (59%), Gaps = 3/156 (2%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++    ++F ++  +  A NVT +L K+P+ + FN YLT THLA EIN R T+TVLA+DN
Sbjct  8    VVLLIFSAF-LLFQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDN  66

Query  726  GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M +L  K+  +  IK+++++H++LDY+  KK   +   T    T+FQ+TG+A+G  GF
Sbjct  67   AAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            +N TD  G  V  G+        S  V +V    Y+
Sbjct  127  VNITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYN  162



>ref|XP_002267946.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Vitis vinifera]
Length=407

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -2

Query  885  SFSIMVWSCG--AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGA  712
            S  ++  SC   A N+T +L KYP F+ F+ YLT THLAGEIN R T+TVLAV N GM  
Sbjct  14   SVCLLFLSCATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMAD  73

Query  711  LSGK--SKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            L  K  S  VIK+V+++H+++DY+  +K   +   T    TLFQSTG A G  GF+N TD
Sbjct  74   LLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITD  133



>ref|XP_009363600.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=291

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 113/189 (60%), Gaps = 16/189 (8%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            +  AFN+T +L+K  +F+NFN  L+ET LA EIN R T+TVLAVDNGG+G LSG S D+ 
Sbjct  20   TSSAFNITKILEKQSDFSNFNSLLSETKLANEINKRKTITVLAVDNGGVGGLSGGSSDLT  79

Query  684  KSVMAVHIVLDYYDVkkftt--lekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            K +++VH+VLDYYD  K        K+  LTT+FQSTG A   QGF+  +      +   
Sbjct  80   KKILSVHVVLDYYDTDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVS-VKDNHISFA  138

Query  510  SAVKNAPQGS---NLVSAVAHEGYDisilqissliIPPGVESI--APKAAPPSHQQHGKS  346
            SA K    G    NLV +V  + Y+IS+LQ+ S+I  P +E+   +P  +P S       
Sbjct  139  SAYKGNNNGGNHVNLVKSVVSQPYNISVLQVGSIIDVPDIENTDSSPAQSPKS-------  191

Query  345  PAAAPSPRK  319
             A AP+P K
Sbjct  192  -AKAPTPSK  199



>gb|KDP39270.1| hypothetical protein JCGZ_01027 [Jatropha curcas]
Length=404

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 80/139 (58%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A NVT +L K+P+ + FN YLT THLAGEIN R T+TV AVDN  M  L  K   +  IK
Sbjct  22   AHNVTRLLAKHPSLSTFNHYLTITHLAGEINRRTTITVCAVDNAAMSELLSKHPSIYTIK  81

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V  G   
Sbjct  82   NILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPED  141

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +   G   V +V    Y+
Sbjct  142  NDGKLGVYFVKSVEEVPYN  160



>ref|XP_002316776.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
 gb|EEE97388.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
Length=408

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IKSV  676
            N+T +L K+P+F+ FN YLT THLAGEINSR T+TV AVDN  M  L  K   +  IK++
Sbjct  25   NITHILGKHPSFSTFNHYLTLTHLAGEINSRNTITVCAVDNAAMSELLSKHPSIATIKNI  84

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            +++H++LDY+  KK   + + T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  85   LSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFG  139



>ref|XP_006346133.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=409

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 80/139 (58%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGK--SKDVIK  682
            A N+T +L  +  F+ FN YLT THLA EIN R T+TV  VDN GM  L  K  S + IK
Sbjct  25   AHNITHILANHTQFSTFNHYLTTTHLATEINRRQTITVCVVDNAGMSDLLSKHLSINTIK  84

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V++ H++LDY+D KK   +   T    T+FQ+TG A+G  GF+N TD  G  V    A 
Sbjct  85   NVLSFHVLLDYFDAKKLHQITNGTALAATIFQATGSATGSSGFVNITDLKGGKVGFSPAD  144

Query  501  KNAPQGSNLVSAVAHEGYD  445
             N P  +  V ++    Y+
Sbjct  145  YNGPPPAKFVKSIEEIPYN  163



>emb|CAN65447.1| hypothetical protein VITISV_011425 [Vitis vinifera]
Length=416

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +   + + S +  S  A N+T ML  +P ++ +N YL++T LA EINSR T+T L ++N 
Sbjct  4    LHLLVXALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNA  63

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M AL+GK    VIK  + + +VLDYYD KK   +   TT  TTL+Q+TG A G+ GF+N
Sbjct  64   AMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVN  123

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA   +   S+   +V    Y+IS+L+IS+ II PG+
Sbjct  124  ITDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_006858016.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
 gb|ERN19483.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
Length=421

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 98/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            A N+T ML  +P+++ +N YLT+T L  EIN+R T+TV  ++N  M AL+     V+K+V
Sbjct  24   AHNITEMLSAFPDYSLYNSYLTQTKLCDEINTRQTLTVFVLNNAAMSALAKHPLSVVKNV  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +++ IVLDY+D +K  ++   +   TTL+Q+TG A G+ GF+N TD  G  V  GSA   
Sbjct  84   LSLLIVLDYFDNQKLHSITDGSMLSTTLYQTTGDAKGNFGFVNITDLKGGKVGFGSAAPG  143

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGVES  394
            +P  S    +V    Y+IS+++IS+ II PG+ S
Sbjct  144  SPLDSTYTKSVKQVPYNISVMEISAPIIAPGLLS  177



>emb|CBI28444.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -2

Query  885  SFSIMVWSCG--AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGA  712
            S  ++  SC   A N+T +L KYP F+ F+ YLT THLAGEIN R T+TVLAV N GM  
Sbjct  127  SVCLLFLSCATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMAD  186

Query  711  LSGK--SKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            L  K  S  VIK+V+++H+++DY+  +K   +   T    TLFQSTG A G  GF+N TD
Sbjct  187  LLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITD  246



>gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein 2 [Arabidopsis thaliana]
Length=403

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN  M ++  +G S   I+
Sbjct  26   AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIR  85

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD  145

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V +V  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAE--APTASP  186



>gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana]
Length=403

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN  M ++  +G S   I+
Sbjct  26   AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIR  85

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD  145

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V +V  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAE--APTASP  186



>ref|XP_002270426.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Vitis vinifera]
Length=416

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +   + + S +  S  A N+T ML  +P ++ +N YL++T LA EINSR T+T L ++N 
Sbjct  4    LHLLVLALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNA  63

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M AL+GK    VIK  + + +VLDYYD KK   +   TT  TTL+Q+TG A G+ GF+N
Sbjct  64   AMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVN  123

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA   +   S+   +V    Y+IS+L+IS+ II PG+
Sbjct  124  ITDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
 sp|Q9SU13.1|FLA2_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB40990.1| putative pollen surface protein [Arabidopsis thaliana]
 emb|CAB78315.1| putative pollen surface protein [Arabidopsis thaliana]
 gb|AAL31207.1| AT4g12730/T20K18_80 [Arabidopsis thaliana]
 gb|AAM98329.1| At4g12730/T20K18_80 [Arabidopsis thaliana]
 dbj|BAF02161.1| fasciclin-like arabinogalactan protein FLA2 [Arabidopsis thaliana]
 gb|AEE83171.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
Length=403

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YL+ THLA EIN R T+TVLAVDN  M ++  +G S   I+
Sbjct  26   AHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIR  85

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   +T   ++FQSTG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQD  145

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
             ++   ++ V +V  + Y+IS+L IS ++  P  E  AP A+P
Sbjct  146  DDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAE--APTASP  186



>emb|CAN61077.1| hypothetical protein VITISV_012919 [Vitis vinifera]
Length=407

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -2

Query  885  SFSIMVWSCG--AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGA  712
            S  ++  SC   A N+T +L KYP F+ F+ YLT THLAGEIN R T+TVLAV N GM  
Sbjct  14   SVCLLFLSCXTHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMAD  73

Query  711  LSGK--SKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            L  K  S  VIK+V+++H+++DY+  +K   +   T    TLFQSTG A G  GF+N TD
Sbjct  74   LLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITD  133



>ref|XP_010692313.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
             FF  S  I+     A N+T +L   PN + FN YLT+T L  EINSR T+TVLA+DN  
Sbjct  5    LFFTFSLLILFTISYAHNITEILSSDPNLSQFNSYLTQTKLDDEINSRQTITVLALDNSA  64

Query  720  MGAL-SGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
            M +L S  S  VIK+++++H++LDYYD KK  +LE  T + TTL+Q+TG A+ D+G +N 
Sbjct  65   MSSLTSNHSLSVIKNLLSLHVLLDYYDPKKLHSLENGTVKTTTLYQTTGSATSDEGSVNI  124

Query  543  TD  538
            TD
Sbjct  125  TD  126



>ref|XP_009104281.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=424

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = -2

Query  873  MVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK  694
            ++++    N+T +L + P +++FN YL++T L  EINSR T+T+L ++N  M +L+GK  
Sbjct  19   VIYTVSGHNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKHP  78

Query  693  -DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVM  517
              V+K+ +++ ++LDYYD  K   + + TT  TTL+Q+TG A+G+ GF+N TD  G  V 
Sbjct  79   LSVVKTALSLLVLLDYYDPLKLHKISQGTTLPTTLYQTTGRAAGNLGFVNVTDLKGGKVG  138

Query  516  IGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             GSA   +  G+N   +V    Y+IS+L+I++ II PG+
Sbjct  139  FGSAAPGSKLGANYTKSVKQIPYNISVLEINAPIIAPGI  177



>ref|XP_010542030.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=397

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 99/159 (62%), Gaps = 2/159 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YLT THLA +IN R T+TVLAVDN GM ++   G S   I+
Sbjct  27   AHNITRILAKDPDFSTFNHYLTATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIR  86

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   TT  +T+FQ+TG A G  G++N TD  G  V  G   
Sbjct  87   NILSLHVLVDYFGAKKLHQITHGTTSTSTMFQATGSAPGTSGYVNITDLKGGKVAFGVQD  146

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAP  385
             +    S+ V +V  + Y+IS+LQIS ++  P  E+  P
Sbjct  147  DDNKLTSHYVKSVYEKAYNISVLQISQVMTSPEAEAPTP  185



>ref|XP_007052018.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
 gb|EOX96175.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
Length=425

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  897  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
             FL + S++  +  A N+T +L+ +P+++ +N +L++T LA EINSR T+T L + NG M
Sbjct  9    LFLFTLSLVAITAHAHNITAILEGFPDYSVYNSFLSQTKLADEINSRETITCLVLSNGAM  68

Query  717  GALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNAT  541
             AL+ K    VIK+++++H++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N T
Sbjct  69   SALTAKHPLSVIKNILSLHVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNIT  128

Query  540  DTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            D  G  V  GSA+  +   S+   +V    Y+ISI++IS+ II PG+
Sbjct  129  DLQGGKVAFGSAIPGSKLDSSYTKSVKQIPYNISIIEISAPIIAPGI  175



>dbj|BAJ34929.1| fasciclin-like arabinogalactan protein [Vitis hybrid cultivar]
Length=416

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +   + + S +  S  A N+T ML  +P ++ +N YL++T LA EINSR T+T L ++N 
Sbjct  4    LHLLVFALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNA  63

Query  723  GMGALSGKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M AL+GK    VIK  + + +VLDYYD KK   +   TT  TTL+Q+TG A G+ GF+N
Sbjct  64   AMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVN  123

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA   +   S+   +V    Y+IS+L+IS+ II PG+
Sbjct  124  ITDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_009146602.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=270

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSG-KSKDV  688
            S  +FN+T +L++   F+ FN  L++T LA  INSR T+TVLA+ N  M   S  +S + 
Sbjct  21   SSNSFNITNILNQNNEFSIFNNLLSQTGLASTINSRQTITVLALSNDAMSFFSTIQSIEE  80

Query  687  IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGS  508
             K  +++H+VLDYYD+KKF ++ KK+  LTTLFQSTG A G QGF+N T      VM GS
Sbjct  81   NKIRLSLHVVLDYYDIKKFRSMNKKSVILTTLFQSTGQAKGLQGFINTTIMNNGDVMFGS  140

Query  507  AVKNAPQGSNLVSAVAHEGYD  445
            AV  +   S L+ +VA   Y+
Sbjct  141  AVPGSGIYSKLIDSVATHPYN  161



>emb|CDX76814.1| BnaC08g34000D [Brassica napus]
Length=280

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSV  676
            + N+T  L+ YP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K++
Sbjct  24   SVNITRALENYPEFSTMIELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKN  496
            +  H+VLDYYD  K   L+ K+T LTTL+QSTG+     GFLN +   GK ++ GSAVK 
Sbjct  84   LMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKANGK-IVFGSAVKG  142

Query  495  APQGSNLVSAVAHEGYDisilqissliIPPGV  400
            AP  +  ++ V    +++S++QIS  I+ PG+
Sbjct  143  APLTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_011010616.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=407

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IKSV  676
            N+T +L K+P+F+ FN YLT THLAGEINS+ T+TV AVDN  M  L  K   +  IK++
Sbjct  25   NITRILGKHPSFSTFNHYLTLTHLAGEINSKTTITVCAVDNAAMSELLSKHPSIATIKNI  84

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            +++H++LDY+  KK   + + T    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  85   LSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSAGFVNITDVKGGKVAFG  139



>ref|XP_004148925.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 ref|XP_004170859.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 gb|KGN44020.1| Fasciclin-like arabinogalactan protein 11 [Cucumis sativus]
Length=415

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 77/131 (59%), Gaps = 2/131 (2%)
 Frame = -2

Query  897  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
              LA   +++ +  A N+T +L+K+P F+ FN YLT THLA EIN R T+TV  VDN  M
Sbjct  14   LVLAVLFLVIATATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAM  73

Query  717  GALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
              L  K   +  IK+ +++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N 
Sbjct  74   SDLLAKQLSIYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNI  133

Query  543  TDTGGKTVMIG  511
            TD  G  V  G
Sbjct  134  TDLKGGKVGFG  144



>emb|CDY34771.1| BnaA09g41380D [Brassica napus]
Length=280

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T  L+ YP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALENYPEFSTMIELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNILM  85

Query  669  VHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAP  490
             H+VLDYYD  K   L+ K+T LTTL+QSTG+     GFLN +   GK ++ GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKANGK-IVFGSAVKGAP  144

Query  489  QGSNLVSAVAHEGYDisilqissliIPPGV  400
              +  ++ V    +++S++QIS  I+ PG+
Sbjct  145  LTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>gb|KHG09433.1| Fasciclin-like arabinogalactan protein 1 [Gossypium arboreum]
Length=417

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 3/156 (2%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++    ++F ++  +  A N+T +L K+P+ + FN YLT THLA EIN R T+TVLA+DN
Sbjct  8    VVLLIFSAF-LLFQTSNAHNITRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDN  66

Query  726  GGMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
              M +L  K+  +  IK+++++H++LDY+  KK   +   T    T+FQ+TG+A G  GF
Sbjct  67   AAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVAPGVSGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            +N TD  G  V  G+        S  V +V    Y+
Sbjct  127  VNITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYN  162



>ref|XP_009117125.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=280

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIKSVMA  670
            N+T  L+ YP F+   + L +T L   IN R T+TVLA+ N  +G++SG+ ++ +K+++ 
Sbjct  26   NITRALENYPEFSTMIELLAKTELTPIINKRQTITVLALSNDAIGSISGRPEEELKNILM  85

Query  669  VHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNAP  490
             H+VLDYYD  K   L+ K+T LTTL+QSTG+     GFLN +   GK ++ GSAVK AP
Sbjct  86   NHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCSKANGK-IVFGSAVKGAP  144

Query  489  QGSNLVSAVAHEGYDisilqissliIPPGV  400
              +  ++ V    +++S++QIS  I+ PG+
Sbjct  145  LTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_010928138.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Elaeis guineensis]
Length=399

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 101/168 (60%), Gaps = 8/168 (5%)
 Frame = -2

Query  870  VWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKD  691
            V   G  N+T +L ++P F+ FN YLT THLAGEIN R T+TVLAV N GM  L  K  +
Sbjct  20   VQVSGGHNITEILAEHPEFSTFNHYLTATHLAGEINRRKTITVLAVSNAGMAPLLAKHLN  79

Query  690  V--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVM  517
            V  +K+ +++H+++DY+  +K   L   T   ++LFQ+TG A G  GF+N T+     V 
Sbjct  80   VYALKNALSLHVLVDYFGAQKLHQLNGGTAASSSLFQATGAAPGTTGFVNITNHRAGRVS  139

Query  516  IGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
               A  +AP  +N V ++    YD++I+QISS +  P  E+ AP  AP
Sbjct  140  F--AADSAP--ANFVKSIKEISYDLAIIQISSALSSP--EAEAPTPAP  181



>emb|CDP13717.1| unnamed protein product [Coffea canephora]
Length=411

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 97/159 (61%), Gaps = 3/159 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L ++P F+ FN +LT THLA +IN+R T+TV AVDN GM  L GK   +  +K
Sbjct  29   AHNITKILAEFPEFSTFNHFLTTTHLANDINNRETITVCAVDNAGMADLLGKHLSIFALK  88

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++LDY+  KK   +   T    T++Q+TG A G  GF+N TD  G  V  G AV
Sbjct  89   NVLSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSGFVNITDLKGGKVGFG-AV  147

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAP  385
             N    +  V +V    Y+IS++QIS ++  P  E+  P
Sbjct  148  DNGGIDATFVKSVKEIPYNISVIQISKILPSPDAEAPTP  186



>gb|EYU33706.1| hypothetical protein MIMGU_mgv1a007367mg [Erythranthe guttata]
Length=410

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L KYP  + FN YLT T LA EIN R T+TV AVDNGGMG L  K   +  I+
Sbjct  30   AHNITRILAKYPELSTFNHYLTVTQLAPEINRRETITVCAVDNGGMGDLLSKRLTIGAIR  89

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +V+ +H++LDY+D KK   +   T    T+FQ+TG A G  GF+N T+  G  V
Sbjct  90   NVLELHVLLDYFDAKKLHQITDGTALAATMFQATGSAPGSSGFVNITELKGGKV  143



>gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata]
Length=393

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 2/117 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T ML K+P F+ FN YL+ THLA EIN R T+TV AVDN GM  L  K   +  IK
Sbjct  15   AHNITQMLAKHPEFSTFNHYLSVTHLADEINRRRTITVCAVDNSGMADLLAKHLSIYSIK  74

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            +V++ HI+ DY+  KK   +   +    T+FQ+TG ASG  GF+N TD  G  V  G
Sbjct  75   NVLSAHIIADYFGSKKLHQITDGSVLAATVFQATGAASGISGFVNITDLKGGKVGFG  131



>ref|XP_004306902.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Fragaria 
vesca subsp. vesca]
Length=421

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKSVM  673
            N+T +L+  P ++ +N +LT+T LA EIN+R TVTVL + NG M +L+ K    VIK+ +
Sbjct  24   NITAILEATPEYSQYNSFLTQTRLADEINTRTTVTVLVLTNGVMSSLAAKHPLSVIKNAL  83

Query  672  AVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVKNA  493
            ++HI+LDYYD  K   +   +   TTL+Q+TG A G+ GF+N TD  G  V  GSA   +
Sbjct  84   SLHILLDYYDPAKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLSGGKVGFGSAAPGS  143

Query  492  PQGSNLVSAVAHEGYDisilqissliIPPGV  400
               S+   +V    Y+IS+L+IS+ ++ PG+
Sbjct  144  KLDSSYTKSVKQIPYNISVLEISAPVLAPGI  174



>ref|XP_010497131.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Camelina 
sativa]
Length=327

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A NVT +L  +P+F++F+ YLT+THLA EIN R T+TV AVDN  M AL+ K   +  +K
Sbjct  23   AHNVTRLLANHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTISTLK  82

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H++LDY+  KK   +   +    T+FQ+TG A G  GF+N TD  G  V  G   
Sbjct  83   NILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFG---  139

Query  501  KNAPQGSNLVS  469
               P G +L S
Sbjct  140  ---PDGGDLSS  147



>ref|XP_006397729.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
 gb|ESQ39182.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
Length=418

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 106/169 (63%), Gaps = 1/169 (1%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +  F+ S   + ++    N+T +L   P +++FN YL++T LA EINSR T+T+L ++NG
Sbjct  9    LLAFVFSLLAVAFTVRGHNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNG  68

Query  723  GMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLN  547
             M +L+GK    VIK+ +++ ++LDYYD +K   + K TT  TTL+Q+TG A G+ GF+N
Sbjct  69   AMSSLAGKHPLSVIKNALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVN  128

Query  546  ATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             TD  G  V  GSA   +   S+   +V    Y+IS+L+I + II PGV
Sbjct  129  ITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIIAPGV  177



>ref|XP_004144998.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004153890.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004160662.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 gb|KGN46232.1| hypothetical protein Csa_6G076800 [Cucumis sativus]
Length=423

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 93/155 (60%), Gaps = 4/155 (3%)
 Frame = -2

Query  906  IIFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDN  727
            ++F  +A+ + +V    A N+T ML  +P ++ F+ YL +T LA EINSR T+TVL V N
Sbjct  8    LLFLAIAATAAIV---SAHNITDMLKDFPQYSVFSNYLQQTRLADEINSRQTITVLVVAN  64

Query  726  GGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
            G +  +  K    VIK+++++HIVLDYYD  K   +   TT  TTL+Q+TG A G+ GF+
Sbjct  65   GALSPILDKHPLSVIKNLLSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFV  124

Query  549  NATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYD  445
            N TD  G  V  GSAV  +   S+   +V    Y+
Sbjct  125  NITDLQGGKVGFGSAVPGSKLESSYTKSVVSLPYN  159



>ref|XP_011097758.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=416

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 2/130 (2%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            +     S  ++  +  A N+T +L K+P F+ FN YLT T LA EIN R T+TV AVDN 
Sbjct  11   VVVLCISLFLLPSTSDAHNITRILAKFPEFSTFNHYLTVTQLAPEINRRETITVCAVDNA  70

Query  723  GMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
            GM  L  K   +  +K+V+++H++LDY+D KK   +   T    T+FQ+TG A+G  GF+
Sbjct  71   GMADLLSKHLTLGALKNVLSLHVLLDYFDAKKLHEITDGTALAATMFQATGSATGSSGFV  130

Query  549  NATDTGGKTV  520
            N TD  G  V
Sbjct  131  NITDLKGGKV  140



>ref|XP_010252769.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=412

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T++L K P+F+ FNQ+LT THLA EIN R T+T+  VDNGGM  L  K   +  IK
Sbjct  25   AHNITSILAKNPDFSIFNQFLTLTHLAVEINQRETITICTVDNGGMSDLLSKQLSIYTIK  84

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++LDY+  +K   +   T    T+FQ+TG A G  GF+N TD  G  V  G+  
Sbjct  85   NVLSLHVLLDYFGAQKLHQITNGTALTATMFQATGSAPGSSGFVNITDLKGGKVGFGAES  144

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +    +  V +V    Y+
Sbjct  145  NHGNLDATFVKSVEEIPYN  163



>ref|XP_007024813.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
 gb|EOY27435.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
Length=304

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 128/228 (56%), Gaps = 9/228 (4%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVI  685
            +  AFN+T +L ++P+F  FN YL  T +A +INS  TVTVL V NG M  +SG+S D +
Sbjct  21   AADAFNITQILSQFPDFTTFNNYLIHTGVADQINSEQTVTVLVVANGNMSEVSGQSPDAM  80

Query  684  KSVMAVHIVLDYYDVkk-fttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGS  508
            K  ++VH++LDY+ V+K      K    LTTL+Q +G A   QGFLN    G   V  GS
Sbjct  81   KKTLSVHVILDYFGVEKLKNLQNKTALTLTTLYQQSGQAQNQQGFLNVAHVGNGGVAFGS  140

Query  507  AVKNAPQGSNLVSAVAHEGYDisilqissliIPPG---VESIAPKAAPPSHQQHGKSPAA  337
            A   +   S  +  VA + Y+IS+LQIS++I  P      S  P+ AP S       P A
Sbjct  141  AAAGSNLDSIFIKPVASQPYNISVLQISNIINVPSNSTTPSSPPEQAPASSPITKPHPPA  200

Query  336  APSPRKLLspsnspsdspSALTPSGVAPAATETDSPASGPNGESDSSA  193
            A  PRK+L+P+ SP  SP      G A    + DSPA+ P   S+++A
Sbjct  201  ASPPRKVLAPAPSPKKSP-----PGNASPPPDADSPAASPPNPSNATA  243



>ref|XP_010485145.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Camelina 
sativa]
Length=386

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A NVT +L  +P+F++F+ YLT+THLA EIN R T+TV AVDN  M AL+ K   +  +K
Sbjct  23   AHNVTRLLANHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTITTLK  82

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H++LDY+  KK   +   +    T+FQ+TG A G  GF+N TD  G  V  G   
Sbjct  83   NILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFG---  139

Query  501  KNAPQGSNLVS  469
               P G +L S
Sbjct  140  ---PDGGDLSS  147



>dbj|BAE75863.1| putative fasciclin-like arabinogalactan protein [Salicornia europaea]
Length=427

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P+F++FN YLT THLA EIN+R T+TVLA+DN  M +L+ K   +  +K
Sbjct  25   AHNITKILAKFPDFSSFNHYLTTTHLAPEINTRQTITVLAIDNAAMASLTSKHLPISTLK  84

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +++++H++LDY+  KK   +   +    T++Q+TG A G  GF+N TD  G  V
Sbjct  85   NILSLHVLLDYFGAKKLHQITDGSALAATMYQATGSAPGTAGFVNITDLKGGKV  138



>ref|XP_004305460.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=274

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 120/194 (62%), Gaps = 11/194 (6%)
 Frame = -2

Query  870  VWSCG-AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK  694
            ++SC  AFN+T ML  Y +F+ FN YLT T +A +IN R ++T+  VDNG MG+++ KS 
Sbjct  15   LFSCSYAFNITQMLSNYKDFSTFNDYLTRTTVADQINKRESLTIFVVDNGAMGSVTKKSL  74

Query  693  DVIKSVMAVHIVLDYYDVkkfttl-ekkttrlttLFQSTGMASGDQGFLNAT---DTGGK  526
            D+   ++++H+ L+Y+D KK   L   + T +TTL Q+ G  +G QGFL AT   ++ G 
Sbjct  75   DMASKILSLHVALEYFDTKKLQQLPTNEPTLMTTLLQANGQPTGQQGFLKATIGGNSSGG  134

Query  525  TVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAPPSHQQH--G  352
              +  S   ++ Q +++V +V  + Y+IS++QIS+ I+P     I+P  A P+       
Sbjct  135  GGVSISLASSSDQSASVVQSVTSQPYNISVIQISNAIVP---NIISPPTAAPTKMPSSPS  191

Query  351  KSPAAAP-SPRKLL  313
            +SPA +P SP+ LL
Sbjct  192  ESPADSPGSPKGLL  205



>ref|XP_008788906.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=481

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 106/180 (59%), Gaps = 8/180 (4%)
 Frame = -2

Query  903  IFFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            + F L  FS  +      N+T +L ++P F+ FN YLT THLAGEIN R T+TVLAV N 
Sbjct  81   VLFLL--FSGCLAVSREHNITKILAEHPEFSTFNHYLTATHLAGEINRRKTITVLAVSNT  138

Query  723  GMGALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFL  550
            GM  L  K   +  +K+V+++H+++DY+  KK   +   T   +TLFQ+TG ASG  GF+
Sbjct  139  GMAPLLAKHLPLYTLKNVLSLHVLVDYFGAKKLHQINGGTAASSTLFQATGAASGTAGFV  198

Query  549  NATD-TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKAAP  373
            N T+   G+       V +AP   N V ++    YD++++QISS++  P  E  AP  AP
Sbjct  199  NITNHRAGRVSFAAEDVGDAPP-VNFVKSIKEIPYDLAVIQISSVLSSPEAE--APTPAP  255



>ref|XP_010526275.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Tarenaya 
hassleriana]
Length=282

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 106/170 (62%), Gaps = 3/170 (2%)
 Frame = -2

Query  897  FFLASFSIMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNG  724
            F L +  I+  S    A N+T +L+KYPNF+  N   T T L   IN R T+T+LAVDN 
Sbjct  13   FLLLAILIVFSSTTISAVNITRVLEKYPNFSTMNDLFTRTGLNVPINKRQTITILAVDND  72

Query  723  GMGALSGKSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             MG++SG+ ++ IK+++  H+VLDYYD  K   L+ ++T LTTL+Q+TG+     GFLN 
Sbjct  73   AMGSISGRPEEEIKNILMNHVVLDYYDEIKLKGLKDRSTLLTTLYQTTGLGQQQNGFLNC  132

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVES  394
            T   GK +  GS VK +P  +  V+ V    +++S++QIS  I+ PG+ S
Sbjct  133  TKMNGK-IFFGSGVKGSPLNAQYVNPVFQNPFNLSVVQISMPIVAPGLGS  181



>emb|CDX73808.1| BnaA03g32390D [Brassica napus]
Length=249

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 89/139 (64%), Gaps = 0/139 (0%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              +FN+TT+L +  +F+ FN+ L++T LA  INSR T+TVLA+ N  +     +S +  K
Sbjct  22   SDSFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALANDAVYLFGDQSMEDNK  81

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
             V+++HI+LDYYD+KK  +L KKT  LTTLFQ +G A G QGF+N T      +  GSAV
Sbjct  82   VVLSLHIILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVNVTVKDNGDIAFGSAV  141

Query  501  KNAPQGSNLVSAVAHEGYD  445
              +   S ++ +VA E ++
Sbjct  142  PGSLLDSQVIDSVASEPFN  160



>ref|XP_010557720.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
 ref|XP_010557721.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=409

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A N+T +L K P+F+ FN YL+ THLA +IN R T+TVLAVDN GM ++   G S   I+
Sbjct  26   AHNITRILAKDPSFSTFNHYLSATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIR  85

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++H+++DY+  KK   +   TT  +T+FQ+TG A+G  G++N TD  G  V  G   
Sbjct  86   NILSLHVLVDYFGAKKLHQITDGTTSTSTMFQATGSATGTSGYVNITDLKGGKVAFGVQD  145

Query  501  KNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAP  385
             ++   ++ + +V  + Y+IS+LQIS ++  P  E+  P
Sbjct  146  DDSKLTAHYIKSVFEKAYNISVLQISQVLTSPEAEAPTP  184



>ref|XP_010438048.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=286

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 99/161 (61%), Gaps = 3/161 (2%)
 Frame = -2

Query  876  IMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSG  703
            ++V+S    A N+T   +KY NF+  +   T+T L   I+   T+TVLAV N  + +++ 
Sbjct  15   LLVFSKVVAADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSNDAISSITN  74

Query  702  KSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKT  523
            +S   +K+++  H++LDYYD  K   + +K+  LTTL+Q+TG+     GFLN T   G+ 
Sbjct  75   RSDVELKNILMTHVILDYYDELKLQAMREKSIMLTTLYQTTGLGEEMNGFLNVTKMEGR-  133

Query  522  VMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            V  GSAVKN+P  +  VS V H  Y++SI++IS  I+ PG+
Sbjct  134  VYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata]
Length=422

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 103/172 (60%), Gaps = 6/172 (3%)
 Frame = -2

Query  891  LASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGA  712
            LA+ SI      A N+T +LD YP ++ FN  L++T LA EINSR  VTV  + NG + +
Sbjct  15   LAAVSI----AAATNITEILDGYPEYSEFNTLLSQTKLADEINSREPVTVCVLPNGALSS  70

Query  711  LSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDT  535
             +GK    V+++++A+H++LDY+D  K   + + +   TTL+Q+TG A G+ GF+N TD 
Sbjct  71   FTGKYPLSVVENILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNADGNLGFVNITDL  130

Query  534  GGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESIAPKA  379
             G  V  GS V  +P  S    +V    Y++S++++S  I P  V + AP A
Sbjct  131  KGGKVGFGSGVAGSPLDSTYTKSVKQIPYNVSVIEVSKAIAPAAVLT-APSA  181



>ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum 
indicum]
Length=426

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 95/156 (61%), Gaps = 1/156 (1%)
 Frame = -2

Query  864  SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DV  688
            S  A N+T +L  +P ++ FN  L++T LA EINSR  VTV  + NG + + +GK    V
Sbjct  20   SASASNITEILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGALSSFTGKYPLSV  79

Query  687  IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGS  508
            IK+++A+H++LDY+D  K   + + +   TTL+Q+TG A+G+ GF+N TD  G  V  GS
Sbjct  80   IKNILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNAAGNLGFVNITDLRGGKVGFGS  139

Query  507  AVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             V  +P  S    +V    Y++S++++S  I P  V
Sbjct  140  GVPGSPLDSTFTKSVKQVPYNLSVIEVSKAIAPSAV  175



>ref|XP_010277448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Nelumbo 
nucifera]
Length=427

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 102/177 (58%), Gaps = 2/177 (1%)
 Frame = -2

Query  900  FFFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGG  721
            F    S SI V    A N+T +L  +P ++  N YLT T LA EIN+R T+T L + N  
Sbjct  10   FLLFLSLSIFVIPSTAHNITEILSGFPEYSAMNDYLTRTKLADEINTRETITCLVLPNSA  69

Query  720  MGALSG-KSKDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
            M AL+  K   V+K+V+ + ++LDYYD  K   + K TT  TTL+Q TG A G+ GF+N 
Sbjct  70   MSALAANKPLSVVKNVLRLLVLLDYYDGAKLHQISKGTTLTTTLYQVTGDAHGNLGFVNI  129

Query  543  TDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
            TD  G  V  GSA   +   S    +V    Y+IS+L+IS+ II PG+ +  AP AA
Sbjct  130  TDLKGGKVGFGSAAPGSKLDSTYTKSVKQIPYNISVLEISAPIIAPGILTAPAPSAA  186



>ref|XP_009135245.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=263

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 89/139 (64%), Gaps = 0/139 (0%)
 Frame = -2

Query  861  CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDVIK  682
              +FN+TT+L +  +F+ FN+ L++T LA  INSR T+TVLA+ N  +     +S +  K
Sbjct  22   SDSFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALANDAVYLFGDQSMEDNK  81

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
             V+++HI+LDYYD+KK  +L KKT  LTTLFQ +G A G QGF+N T      +  GSAV
Sbjct  82   VVLSLHIILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVNVTVKDNGDIAFGSAV  141

Query  501  KNAPQGSNLVSAVAHEGYD  445
              +   S ++ +VA E ++
Sbjct  142  PGSLLDSQVIDSVASEPFN  160



>ref|XP_010063266.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW70477.1| hypothetical protein EUGRSUZ_F03689 [Eucalyptus grandis]
Length=409

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P F+ FN YLTETHLA EINSR T+TV+A+DN  M  L      +  +K
Sbjct  26   AHNITRLLAKHPEFSTFNHYLTETHLAAEINSRTTITVMALDNAAMSRLLAPHPTIATLK  85

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +V+++H++LDY+  KK   +   T    TLFQ+TG A G  GF+N TD  G  V
Sbjct  86   NVLSLHVLLDYFGPKKLHQITNGTALAATLFQATGSAPGSTGFVNITDLKGGKV  139



>ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
 gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
Length=425

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKS  679
            A N+T +L  +P+++ +N +LT+T LA EIN+R T+T+L ++N  + AL+ K    V+K+
Sbjct  23   AHNITEILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAISALAAKHPLSVVKN  82

Query  678  VMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVK  499
             +++H++LDYYD  K   + K +T  TTL+Q+TG A G+ GF+N TD  G  V  GSA  
Sbjct  83   ALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAP  142

Query  498  NAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
             +   S+   +V    Y+ISIL+I++ II PG+
Sbjct  143  GSKLDSSYTKSVKQIPYNISILEINAPIIAPGI  175



>gb|AIY35292.1| fasciclin-like arabinogalactan 12 [Gossypium hirsutum]
Length=415

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 113/172 (66%), Gaps = 2/172 (1%)
 Frame = -2

Query  885  SFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALS  706
            + S++  +  A N+T +L+ +P+++ +N +LT+T LA EIN+R T+T L ++NG M AL+
Sbjct  15   TLSLLAVAVNAHNITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALT  74

Query  705  GKSK-DVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGG  529
             K    V+K+++++H++LDYYD +K   +   TT  TTL+Q+TG A G+ GF+N TD  G
Sbjct  75   AKHPLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQG  134

Query  528  KTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
              V  GSAV  +   S+   +V    Y+ISIL+IS+ II PGV S  AP A+
Sbjct  135  GKVGFGSAVPGSKLDSSYTKSVKQVPYNISILEISAPIIAPGVLSAPAPSAS  186



>ref|XP_011038795.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=406

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 2/115 (2%)
 Frame = -2

Query  849  NVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IKSV  676
            N+T++L K+P+ + FN YLT THLAGEIN R T+TV AVDN  M  +  K   +  IK++
Sbjct  24   NITSILGKHPSLSTFNHYLTLTHLAGEINRRTTITVCAVDNAAMSEILSKKPSISTIKNI  83

Query  675  MAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIG  511
            +++H++LDY+  KK   +   +    T+FQ+TG A G  GF+N TD  G  V  G
Sbjct  84   LSLHVLLDYFGTKKLHQIRDGSALAATMFQATGSAPGSTGFVNITDVKGGKVAFG  138



>ref|XP_008232692.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
 ref|XP_008232693.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
Length=425

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSK-DVIKS  679
            A N+T +L  +P ++ +N +LT+T LA EIN+R T+T+L ++N  + AL+ K    V+K+
Sbjct  23   AHNITAILSAFPEYSQYNSFLTQTRLADEINTRQTITILVLNNAAISALAAKHPLSVVKN  82

Query  678  VMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAVK  499
             +++H++LDYYD  K   + K +T  TTL+Q+TG A G+ GF+N TD  G  V  GSA  
Sbjct  83   ALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAP  142

Query  498  NAPQGSNLVSAVAHEGYD  445
             +   S+   +V    Y+
Sbjct  143  GSKLDSSYTKSVKQIPYN  160



>gb|KFK37339.1| hypothetical protein AALP_AA4G243700 [Arabis alpina]
Length=415

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 110/171 (64%), Gaps = 4/171 (2%)
 Frame = -2

Query  900  FFFLA-SFSIMVWS--CGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVD  730
            F  LA + S++  S    + N+T +L   P++++FN YLT+T LA EINSR T+T+L ++
Sbjct  7    FSLLAITLSLLAVSTTVKSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITLLVLN  66

Query  729  NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
            NG M +L+GK    VIK+ +++ ++LDYYD +K   L K TT  TTL+Q+TG A G+ GF
Sbjct  67   NGAMSSLAGKHPLSVIKNALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
            +N TD  G  V  GSA   +   S+   +V    Y+IS+L+I++ II PGV
Sbjct  127  VNITDLKGGKVGFGSAAPGSKLESSYTRSVKQIPYNISVLEINAPIIAPGV  177



>emb|CDY18927.1| BnaC04g04230D [Brassica napus]
Length=416

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 5/180 (3%)
 Frame = -2

Query  900  FFFLA-SFSIMVW--SCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVD  730
            F  LA +FS++    +    N+T +L   P +++FN YL++T LA EINSR T+T+L ++
Sbjct  7    FSLLALTFSLLALASTVRCHNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLN  66

Query  729  NGGMGALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGF  553
            NG M +L+GK    VIK+ +++ ++LDYYD +K   +   T   TTL+Q+TG A G+ GF
Sbjct  67   NGAMASLAGKHPLSVIKNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGF  126

Query  552  LNATDTGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGVESI-APKAA  376
            +N TD  G  V  GSA   +   S+   +V    Y+IS+L+I + II PG+ +  AP AA
Sbjct  127  VNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAA  186



>gb|AGN92424.2| putative fasciclin-like arabinogalactan protein 4, partial [Centaurium 
erythraea]
Length=328

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 105/166 (63%), Gaps = 2/166 (1%)
 Frame = -2

Query  894  FLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMG  715
            FL   S+  +S  A N+T +L KY +++ FN+YL+ET L GEINSR T+TVL ++NG M 
Sbjct  7    FLCFLSLFAFS-NAHNITDILSKYSDYSEFNKYLSETKLDGEINSRQTITVLVLNNGAMD  65

Query  714  ALSGKS-KDVIKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATD  538
            +L+GK    VIK  +++ ++LDY+D  K   L   TT  TTL+Q+TG A GD G +N TD
Sbjct  66   SLAGKHPLSVIKKALSLLVLLDYFDGAKLHQLSDGTTLTTTLYQTTGNADGDLGHVNITD  125

Query  537  TGGKTVMIGSAVKNAPQGSNLVSAVAHEGYDisilqissliIPPGV  400
              G  V +GSA   +   S    +V    Y+IS+L+IS+ II PG+
Sbjct  126  LKGGKVGLGSAAPGSKLDSTYTKSVEQIKYNISVLEISAPIIAPGL  171



>gb|KDO38095.1| hypothetical protein CISIN_1g013841mg [Citrus sinensis]
Length=435

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P F+ FN YLT THLA EIN R T+TVLA+DN  M +L  K   V  ++
Sbjct  60   AHNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQLSVYTLR  119

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++ DY+  KK   +   T   +++FQ+TG A G  G++N TD  G  V  G+  
Sbjct  120  NVLSLHVLTDYFGSKKLHQITNGTALTSSMFQATGSAPGSSGYVNVTDLKGGKVGFGAED  179

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +    +  V +VA   Y+
Sbjct  180  NDGKLDATYVKSVAEFPYN  198



>ref|XP_004291803.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Fragaria 
vesca subsp. vesca]
Length=407

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 78/128 (61%), Gaps = 8/128 (6%)
 Frame = -2

Query  897  FFLASFSIMVWSCGAFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGM  718
            F L SF+       A N+T +L K+P F+ FN+YL+ THLA +IN R T+TV AVDN  M
Sbjct  17   FLLFSFA------HAHNITHLLAKHPEFSTFNRYLSLTHLAADINDRTTITVCAVDNSAM  70

Query  717  GALSGKSKDV--IKSVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNA  544
             AL  K   +  IK+++++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N 
Sbjct  71   SALLAKHLSIYSIKNILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNI  130

Query  543  TDTGGKTV  520
            TD  G  V
Sbjct  131  TDLKGGKV  138



>ref|XP_010536730.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=427

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGAL--SGKSKDVIK  682
            A NVT +L K+P+F+ FN YL+ETHLA EIN R T+TV AVDN  M  +   G +   +K
Sbjct  29   AHNVTRLLAKHPSFSTFNHYLSETHLANEINRRTTITVCAVDNAAMSDIISKGYTISTVK  88

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +++++HI+LDY+  KK   +   +     LFQ+TG A G  GF+N TD  G  V  G   
Sbjct  89   NILSLHILLDYFGAKKLHQIRDGSGVCXXLFQATGSAPGTSGFVNITDLRGGKVGFG---  145

Query  501  KNAPQGSNL  475
               P G +L
Sbjct  146  ---PDGGDL  151



>ref|XP_007212310.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
 gb|EMJ13509.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
Length=398

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P F+ FN YLT THLA EIN   T+TV AVDN  M AL  K   +  IK
Sbjct  25   AHNITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIK  84

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +++++HI+LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V
Sbjct  85   NILSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLKGGKV  138



>ref|XP_010088447.1| hypothetical protein L484_018219 [Morus notabilis]
 gb|EXB36062.1| hypothetical protein L484_018219 [Morus notabilis]
Length=417

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P F+ FN YLT THLA EIN R T+TVLA+DN  M  + GK+  +  +K
Sbjct  24   AHNITKILAKHPEFSTFNHYLTLTHLAPEINRRTTITVLAIDNAAMSDILGKNPSIYTVK  83

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTV  520
            +++++H++LDY+  KK   +   T    T+FQ+TG A G  GF+N TD  G  V
Sbjct  84   NILSLHVLLDYFGAKKLHQITNGTALSATMFQATGSAPGSTGFVNITDQRGGKV  137



>ref|XP_006447810.1| hypothetical protein CICLE_v10015469mg [Citrus clementina]
 gb|ESR61050.1| hypothetical protein CICLE_v10015469mg [Citrus clementina]
Length=403

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P F+ FN YLT THLA EIN R T+TVLA+DN  M +L  K   V  ++
Sbjct  28   AHNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQLSVYTLR  87

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++ DY+  KK   +   T   +++FQ+TG A G  G++N TD  G  V  G+  
Sbjct  88   NVLSLHVLTDYFGSKKLHQVTNGTALTSSMFQATGSAPGSSGYVNITDLKGGKVGFGAED  147

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +    +  V +VA   Y+
Sbjct  148  NDGKLDATYVKSVAEFPYN  166



>ref|XP_006469451.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Citrus 
sinensis]
Length=403

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -2

Query  855  AFNVTTMLDKYPNFNNFNQYLTETHLAGEINSRGTVTVLAVDNGGMGALSGKSKDV--IK  682
            A N+T +L K+P F+ FN YLT THLA EIN R T+TVLA+DN  M +L  K   V  ++
Sbjct  28   AHNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQLSVYTLR  87

Query  681  SVMAVHIVLDYYDVkkfttlekkttrlttLFQSTGMASGDQGFLNATDTGGKTVMIGSAV  502
            +V+++H++ DY+  KK   +   T   +++FQ+TG A G  G++N TD  G  V  G+  
Sbjct  88   NVLSLHVLTDYFGSKKLHQVTNGTALTSSMFQATGSAPGSSGYVNITDLKGGKVGFGAED  147

Query  501  KNAPQGSNLVSAVAHEGYD  445
             +    +  V +VA   Y+
Sbjct  148  NDGKLDATYVKSVAEFPYN  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2220666113797