BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24494_g1_i1 len=1280 path=[1179:0-62 598:63-91 415:92-146
470:147-184 508:185-198 522:199-233 110:234-293 170:294-314
1495:315-348 623:349-364 639:365-450 4782:451-578 1753:579-604
1779:605-608 775:609-644 1818:645-887 2061:888-1279]

Length=1280
                                                                      Score     E

ref|XP_009624450.1|  PREDICTED: aldose 1-epimerase-like isoform X2      442   9e-150   
ref|XP_006338470.1|  PREDICTED: aldose 1-epimerase-like isoform X2      441   2e-149   
ref|XP_009779455.1|  PREDICTED: aldose 1-epimerase-like isoform X4      441   2e-149   
ref|XP_009593213.1|  PREDICTED: aldose 1-epimerase-like                 439   8e-149   
ref|XP_011098592.1|  PREDICTED: aldose 1-epimerase-like                 438   2e-148   
ref|XP_009624451.1|  PREDICTED: aldose 1-epimerase-like                 438   3e-148   
ref|XP_009624449.1|  PREDICTED: aldose 1-epimerase-like isoform X1      434   1e-146   
ref|XP_009779461.1|  PREDICTED: aldose 1-epimerase-like                 433   2e-146   
ref|XP_006338469.1|  PREDICTED: aldose 1-epimerase-like isoform X1      431   1e-145   
ref|XP_009347058.1|  PREDICTED: aldose 1-epimerase                      427   7e-144   
ref|XP_008341553.1|  PREDICTED: aldose 1-epimerase                      426   1e-143   
ref|XP_009779450.1|  PREDICTED: aldose 1-epimerase-like                 426   1e-143   
ref|XP_009779457.1|  PREDICTED: aldose 1-epimerase-like isoform X6      425   4e-143   
ref|XP_009779456.1|  PREDICTED: aldose 1-epimerase-like isoform X5      425   5e-143   
ref|XP_002282868.1|  PREDICTED: aldose 1-epimerase                      424   6e-143   Vitis vinifera
ref|XP_006338471.1|  PREDICTED: aldose 1-epimerase-like isoform X3      424   7e-143   
gb|AAL09398.1|AF307095_1  non-cell-autonomous protein pathway2          422   3e-142   Nicotiana tabacum [American tobacco]
ref|XP_009779459.1|  PREDICTED: aldose 1-epimerase-like isoform X8      422   4e-142   
ref|XP_006338467.1|  PREDICTED: aldose 1-epimerase-like                 422   5e-142   
ref|XP_004232231.2|  PREDICTED: aldose 1-epimerase-like                 425   7e-142   
ref|XP_004147466.1|  PREDICTED: aldose 1-epimerase-like                 419   6e-141   
gb|KGN59582.1|  hypothetical protein Csa_3G827250                       419   1e-140   
gb|AAL09397.1|AF307094_1  non-cell-autonomous protein pathway1          418   2e-140   Nicotiana tabacum [American tobacco]
ref|XP_004302346.1|  PREDICTED: aldose 1-epimerase-like                 418   2e-140   
ref|XP_009624447.1|  PREDICTED: aldose 1-epimerase-like                 418   2e-140   
ref|XP_002282831.1|  PREDICTED: aldose 1-epimerase                      415   2e-139   Vitis vinifera
ref|XP_010102873.1|  Aldose 1-epimerase                                 415   4e-139   
ref|XP_007216505.1|  hypothetical protein PRUPE_ppa024124mg             413   2e-138   
gb|AAB94619.1|  aldose-1-epimerase-like protein                         412   3e-138   Nicotiana tabacum [American tobacco]
ref|XP_009779458.1|  PREDICTED: aldose 1-epimerase-like isoform X7      412   5e-138   
ref|XP_008230742.1|  PREDICTED: aldose 1-epimerase-like                 412   7e-138   
ref|XP_008443423.1|  PREDICTED: aldose 1-epimerase                      412   9e-138   
emb|CBA10127.1|  non-cell-autonomous protein pathway                    410   1e-137   Nicotiana benthamiana
emb|CDP18771.1|  unnamed protein product                                410   2e-137   
ref|XP_009624446.1|  PREDICTED: aldose 1-epimerase-like                 410   2e-137   
gb|EYU34099.1|  hypothetical protein MIMGU_mgv1a008692mg                410   3e-137   
emb|CDP02212.1|  unnamed protein product                                408   1e-136   
ref|XP_003621162.1|  Aldose 1-epimerase                                 408   2e-136   
ref|XP_009779460.1|  PREDICTED: aldose 1-epimerase-like isoform X9      407   3e-136   
ref|XP_003534458.1|  PREDICTED: aldose 1-epimerase-like                 406   9e-136   
gb|KHN13632.1|  Aldose 1-epimerase                                      406   1e-135   
ref|XP_009624445.1|  PREDICTED: aldose 1-epimerase-like                 405   1e-135   
ref|XP_004232229.1|  PREDICTED: aldose 1-epimerase-like                 403   9e-135   
ref|XP_006338468.1|  PREDICTED: aldose 1-epimerase-like                 400   2e-133   
ref|XP_010242446.1|  PREDICTED: aldose 1-epimerase-like                 400   3e-133   
ref|XP_006482556.1|  PREDICTED: aldose 1-epimerase-like                 399   5e-133   
ref|XP_010256788.1|  PREDICTED: aldose 1-epimerase-like                 399   5e-133   
gb|KDO72518.1|  hypothetical protein CISIN_1g017992mg                   399   8e-133   
ref|XP_007139591.1|  hypothetical protein PHAVU_008G042600g             398   1e-132   
emb|CBI22179.3|  unnamed protein product                                429   3e-132   
ref|NP_001241992.1|  uncharacterized protein LOC100781853 precursor     397   5e-132   
ref|XP_006338472.1|  PREDICTED: aldose 1-epimerase-like                 394   3e-131   
ref|XP_011046256.1|  PREDICTED: aldose 1-epimerase-like                 394   4e-131   
ref|XP_006431103.1|  hypothetical protein CICLE_v10011989mg             394   1e-130   
ref|XP_011008939.1|  PREDICTED: aldose 1-epimerase-like                 394   2e-130   
ref|XP_006482555.1|  PREDICTED: aldose 1-epimerase-like                 392   4e-130   
ref|XP_004489156.1|  PREDICTED: aldose 1-epimerase-like                 391   6e-130   
ref|XP_006373311.1|  hypothetical protein POPTR_0017s11660g             390   8e-130   
ref|XP_002305327.1|  hypothetical protein POPTR_0004s13470g             390   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_007210522.1|  hypothetical protein PRUPE_ppa007822mg             389   4e-129   
gb|AFK41318.1|  unknown                                                 389   7e-129   
ref|XP_008453190.1|  PREDICTED: aldose 1-epimerase-like                 388   9e-129   
gb|KEH24989.1|  aldose 1-epimerase family protein                       386   9e-128   
gb|KHN13234.1|  Aldose 1-epimerase                                      385   1e-127   
ref|XP_003543750.1|  PREDICTED: aldose 1-epimerase-like                 385   2e-127   
ref|XP_008239819.1|  PREDICTED: aldose 1-epimerase                      384   3e-127   
gb|KHN45485.1|  Aldose 1-epimerase                                      384   3e-127   
ref|XP_010317286.1|  PREDICTED: aldose 1-epimerase-like                 385   3e-127   
gb|KDP45491.1|  hypothetical protein JCGZ_09740                         383   9e-127   
ref|XP_006384345.1|  hypothetical protein POPTR_0004s13470g             383   9e-127   
gb|KHG05985.1|  Aldose 1-epimerase                                      382   2e-126   
ref|XP_009615365.1|  PREDICTED: aldose 1-epimerase                      382   2e-126   
ref|NP_001241954.1|  uncharacterized protein LOC100803092 precursor     381   8e-126   
ref|XP_006377092.1|  hypothetical protein POPTR_0012s14420g             380   9e-126   
ref|XP_006344389.1|  PREDICTED: aldose 1-epimerase-like                 380   1e-125   
ref|XP_004138299.1|  PREDICTED: aldose 1-epimerase-like                 380   1e-125   
ref|XP_002323843.2|  hypothetical protein POPTR_0017s11650g             379   3e-125   Populus trichocarpa [western balsam poplar]
gb|KEH24988.1|  aldose 1-epimerase family protein                       380   3e-125   
ref|XP_010693333.1|  PREDICTED: aldose 1-epimerase                      379   5e-125   
ref|XP_004236201.1|  PREDICTED: aldose 1-epimerase                      378   7e-125   
ref|XP_007151211.1|  hypothetical protein PHAVU_004G027000g             378   9e-125   
ref|XP_011029977.1|  PREDICTED: aldose 1-epimerase-like                 375   7e-124   
ref|XP_004299386.1|  PREDICTED: aldose 1-epimerase-like                 374   4e-123   
ref|XP_002323842.1|  aldose 1-epimerase family protein                  373   5e-123   Populus trichocarpa [western balsam poplar]
ref|XP_009803676.1|  PREDICTED: aldose 1-epimerase                      373   7e-123   
ref|XP_010032358.1|  PREDICTED: aldose 1-epimerase-like                 374   7e-123   
ref|XP_009779451.1|  PREDICTED: aldose 1-epimerase-like isoform X1      376   2e-122   
ref|XP_009779453.1|  PREDICTED: aldose 1-epimerase-like isoform X3      375   2e-122   
ref|XP_011071623.1|  PREDICTED: aldose 1-epimerase                      372   2e-122   
ref|XP_011008940.1|  PREDICTED: aldose 1-epimerase-like                 372   2e-122   
ref|XP_009779452.1|  PREDICTED: aldose 1-epimerase-like isoform X2      375   3e-122   
ref|XP_006439628.1|  hypothetical protein CICLE_v10024457mg             371   3e-122   
gb|KDO76084.1|  hypothetical protein CISIN_1g043310mg                   370   6e-122   
ref|XP_008784468.1|  PREDICTED: aldose 1-epimerase-like                 370   6e-122   
ref|XP_009401394.1|  PREDICTED: aldose 1-epimerase-like                 370   7e-122   
ref|XP_010029392.1|  PREDICTED: aldose 1-epimerase-like                 370   1e-121   
ref|XP_006477524.1|  PREDICTED: aldose 1-epimerase-like                 370   1e-121   
ref|XP_010937062.1|  PREDICTED: aldose 1-epimerase-like                 366   2e-120   
ref|XP_007099714.1|  Galactose mutarotase-like superfamily protei...    368   1e-119   
gb|KDP45488.1|  hypothetical protein JCGZ_09737                         364   2e-119   
ref|XP_004173979.1|  PREDICTED: aldose 1-epimerase-like                 364   2e-119   
ref|XP_007037277.1|  Galactose mutarotase-like superfamily protein      367   3e-119   
ref|XP_002268039.1|  PREDICTED: aldose 1-epimerase                      363   4e-119   Vitis vinifera
gb|AAM61410.1|  aldose 1-epimerase-like protein                         363   4e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579891.1|  PREDICTED: aldose 1-epimerase-like                 363   5e-119   
ref|XP_010426233.1|  PREDICTED: aldose 1-epimerase-like                 363   6e-119   
ref|NP_190364.1|  putative aldose 1-epimerase                           362   9e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291372.1|  hypothetical protein CARUB_v10017512mg             361   2e-118   
ref|XP_002875866.1|  hypothetical protein ARALYDRAFT_906011             361   4e-118   
ref|XP_008453675.1|  PREDICTED: aldose 1-epimerase                      360   5e-118   
ref|XP_003579892.1|  PREDICTED: aldose 1-epimerase-like                 361   6e-118   
ref|XP_002318873.1|  aldose 1-epimerase family protein                  359   9e-118   Populus trichocarpa [western balsam poplar]
ref|NP_001169820.1|  hypothetical protein precursor                     360   1e-117   Zea mays [maize]
emb|CDY36929.1|  BnaA06g17140D                                          359   1e-117   
ref|XP_010916998.1|  PREDICTED: aldose 1-epimerase-like                 359   2e-117   
ref|XP_009149871.1|  PREDICTED: aldose 1-epimerase                      359   2e-117   
ref|XP_010503389.1|  PREDICTED: aldose 1-epimerase-like                 358   5e-117   
ref|XP_006404339.1|  hypothetical protein EUTSA_v10010502mg             357   7e-117   
ref|XP_008811569.1|  PREDICTED: aldose 1-epimerase-like                 357   1e-116   
gb|AFK38126.1|  unknown                                                 357   2e-116   
ref|XP_003575218.1|  PREDICTED: aldose 1-epimerase-like                 356   4e-116   
ref|XP_010547806.1|  PREDICTED: aldose 1-epimerase-like                 355   5e-116   
emb|CDY24155.1|  BnaC03g57220D                                          355   1e-115   
ref|XP_008784475.1|  PREDICTED: aldose 1-epimerase-like                 355   1e-115   
ref|XP_009414392.1|  PREDICTED: aldose 1-epimerase-like                 354   2e-115   
gb|KFK34079.1|  hypothetical protein AALP_AA5G099600                    354   2e-115   
dbj|BAJ86209.1|  predicted protein                                      354   3e-115   
ref|XP_002517486.1|  aldose-1-epimerase, putative                       353   3e-115   Ricinus communis
dbj|BAK04813.1|  predicted protein                                      352   1e-114   
ref|XP_002517487.1|  aldose-1-epimerase, putative                       351   2e-114   Ricinus communis
ref|XP_010256040.1|  PREDICTED: aldose 1-epimerase-like                 351   3e-114   
ref|NP_001137118.1|  aldose 1-epimerase precursor                       351   4e-114   Zea mays [maize]
gb|EYU35859.1|  hypothetical protein MIMGU_mgv1a008920mg                350   5e-114   
ref|NP_001047214.1|  Os02g0575800                                       350   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446606.1|  hypothetical protein SORBIDRAFT_06g018800          350   1e-113   Sorghum bicolor [broomcorn]
gb|ACG28451.1|  aldose 1-epimerase precursor                            349   2e-113   Zea mays [maize]
gb|EAY86398.1|  hypothetical protein OsI_07776                          349   2e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_004508757.1|  PREDICTED: aldose 1-epimerase-like isoform X1      348   3e-113   
ref|XP_007032473.1|  Galactose mutarotase-like superfamily protein      348   3e-113   
gb|EEE61117.1|  hypothetical protein OsJ_15041                          348   9e-113   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00680.1|  predicted protein                                      347   2e-112   
ref|XP_002511545.1|  aldose-1-epimerase, putative                       346   2e-112   Ricinus communis
ref|XP_002871651.1|  hypothetical protein ARALYDRAFT_488355             350   4e-112   
ref|XP_004952870.1|  PREDICTED: aldose 1-epimerase-like                 346   5e-112   
ref|XP_008644102.1|  PREDICTED: hypothetical protein isoform X1         347   7e-112   
ref|XP_010550628.1|  PREDICTED: aldose 1-epimerase-like                 344   1e-111   
ref|NP_001052977.1|  Os04g0458300                                       345   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452332.1|  hypothetical protein SORBIDRAFT_04g023830          343   7e-111   Sorghum bicolor [broomcorn]
gb|EPS71547.1|  hypothetical protein M569_03212                         341   9e-111   
ref|XP_009121605.1|  PREDICTED: aldose 1-epimerase isoform X1           347   1e-110   
emb|CAH67072.1|  OSIGBa0097P08.2                                        342   1e-110   Oryza sativa [red rice]
gb|AES91241.2|  aldose 1-epimerase family protein                       340   3e-110   
gb|KDP31227.1|  hypothetical protein JCGZ_11603                         340   3e-110   
ref|XP_006404338.1|  hypothetical protein EUTSA_v10010502mg             339   6e-110   
ref|XP_006287626.1|  hypothetical protein CARUB_v10000838mg             344   8e-110   
ref|XP_009131443.1|  PREDICTED: aldose 1-epimerase-like                 345   1e-109   
ref|XP_004508758.1|  PREDICTED: aldose 1-epimerase-like isoform X2      338   1e-109   
ref|XP_010524327.1|  PREDICTED: aldose 1-epimerase isoform X1           342   2e-109   
ref|XP_010453642.1|  PREDICTED: aldose 1-epimerase-like                 342   4e-109   
gb|KFK25751.1|  hypothetical protein AALP_AA8G154800                    342   2e-108   
ref|NP_197018.1|  aldose 1-epimerase-like protein                       340   3e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420168.1|  PREDICTED: aldose 1-epimerase-like                 340   5e-108   
ref|XP_004975838.1|  PREDICTED: aldose 1-epimerase-like                 335   5e-108   
ref|XP_010492338.1|  PREDICTED: aldose 1-epimerase-like                 339   9e-108   
ref|XP_003609044.1|  Aldose 1-epimerase-like protein                    333   9e-108   
emb|CDP12362.1|  unnamed protein product                                334   2e-107   
emb|CAN61059.1|  hypothetical protein VITISV_011619                     332   3e-107   Vitis vinifera
dbj|BAK01606.1|  predicted protein                                      332   3e-107   
dbj|BAK02841.1|  predicted protein                                      333   3e-107   
ref|XP_010930434.1|  PREDICTED: aldose 1-epimerase-like isoform X1      332   5e-107   
emb|CDP15260.1|  unnamed protein product                                331   1e-106   
emb|CAD40900.2|  OSJNBa0036B21.18                                       333   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121606.1|  PREDICTED: aldose 1-epimerase isoform X2           335   3e-106   
ref|XP_006400031.1|  hypothetical protein EUTSA_v10013324mg             335   3e-106   
ref|XP_003550776.1|  PREDICTED: aldose 1-epimerase-like                 330   3e-106   
ref|XP_002455882.1|  hypothetical protein SORBIDRAFT_03g026790          330   3e-106   Sorghum bicolor [broomcorn]
ref|XP_006827141.1|  hypothetical protein AMTR_s00010p00250550          330   5e-106   
ref|XP_007155325.1|  hypothetical protein PHAVU_003G191500g             328   2e-105   
emb|CBW45774.1|  ORW1943Ba0077G13.2                                     329   6e-105   
gb|KDO72516.1|  hypothetical protein CISIN_1g0479222mg                  323   1e-104   
ref|XP_004975839.1|  PREDICTED: aldose 1-epimerase-like                 326   3e-104   
gb|KDP33182.1|  hypothetical protein JCGZ_13447                         324   3e-104   
emb|CDX70595.1|  BnaC03g06790D                                          323   4e-104   
ref|XP_004975836.1|  PREDICTED: aldose 1-epimerase-like                 325   6e-104   
emb|CDX78613.1|  BnaA03g05250D                                          322   1e-103   
ref|XP_011001585.1|  PREDICTED: aldose 1-epimerase-like isoform X1      323   1e-103   
gb|ABK22097.1|  unknown                                                 323   2e-103   Picea sitchensis
ref|XP_011001586.1|  PREDICTED: aldose 1-epimerase-like isoform X2      323   2e-103   
ref|XP_006578581.1|  PREDICTED: aldose 1-epimerase-like                 322   5e-103   
ref|XP_010274745.1|  PREDICTED: aldose 1-epimerase-like                 319   3e-102   
emb|CDJ26298.1|  unnamed protein product                                320   4e-102   
ref|XP_006372578.1|  hypothetical protein POPTR_0017s02950g             320   5e-102   
ref|XP_007036806.1|  Galactose mutarotase-like superfamily protei...    318   7e-102   
ref|XP_006372579.1|  hypothetical protein POPTR_0017s02950g             319   7e-102   
ref|XP_003528185.2|  PREDICTED: aldose 1-epimerase-like                 318   2e-101   
ref|XP_009417229.1|  PREDICTED: aldose 1-epimerase-like                 317   2e-101   
ref|XP_006482094.1|  PREDICTED: aldose 1-epimerase-like                 317   4e-101   
gb|EAZ23543.1|  hypothetical protein OsJ_07241                          317   5e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573719.1|  PREDICTED: aldose 1-epimerase                      316   6e-101   
ref|XP_002282634.1|  PREDICTED: aldose 1-epimerase                      316   6e-101   Vitis vinifera
ref|XP_006430571.1|  hypothetical protein CICLE_v10012137mg             316   9e-101   
ref|XP_002467340.1|  hypothetical protein SORBIDRAFT_01g025920          315   1e-100   Sorghum bicolor [broomcorn]
gb|EAY77740.1|  hypothetical protein OsI_32784                          315   2e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002317867.1|  aldose 1-epimerase family protein                  315   2e-100   Populus trichocarpa [western balsam poplar]
ref|NP_001064192.1|  Os10g0155500                                       315   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010265811.1|  PREDICTED: aldose 1-epimerase-like                 315   2e-100   
ref|XP_002531177.1|  aldose-1-epimerase, putative                       314   2e-100   Ricinus communis
ref|XP_004984206.1|  PREDICTED: aldose 1-epimerase-like                 315   3e-100   
ref|XP_011039151.1|  PREDICTED: aldose 1-epimerase-like                 314   4e-100   
ref|XP_002466911.1|  hypothetical protein SORBIDRAFT_01g016500          317   7e-100   Sorghum bicolor [broomcorn]
ref|XP_006648778.1|  PREDICTED: aldose 1-epimerase-like                 313   9e-100   
ref|XP_006826839.1|  hypothetical protein AMTR_s00010p00093760          313   1e-99    
ref|XP_008669323.1|  PREDICTED: aldose 1-epimerase-like                 313   1e-99    
emb|CBI15585.3|  unnamed protein product                                312   1e-99    
ref|XP_009620755.1|  PREDICTED: aldose 1-epimerase                      312   1e-99    
tpg|DAA45585.1|  TPA: aldose 1-epimerase                                313   2e-99    
ref|XP_010918323.1|  PREDICTED: aldose 1-epimerase-like                 312   3e-99    
ref|XP_009405677.1|  PREDICTED: aldose 1-epimerase-like                 310   7e-99    
emb|CDO98338.1|  unnamed protein product                                310   8e-99    
gb|AAL75737.1|AC091724_10  Putative aldose 1-epimerase - like pro...    311   8e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975843.1|  PREDICTED: aldose 1-epimerase-like                 310   2e-98    
gb|EMT01730.1|  Aldose 1-epimerase                                      309   3e-98    
gb|EAZ30964.1|  hypothetical protein OsJ_15042                          310   4e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004983378.1|  PREDICTED: aldose 1-epimerase-like                 308   5e-98    
ref|XP_010034276.1|  PREDICTED: aldose 1-epimerase-like                 308   6e-98    
ref|XP_009766422.1|  PREDICTED: aldose 1-epimerase                      308   6e-98    
gb|EAY94387.1|  hypothetical protein OsI_16154                          309   8e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_002465201.1|  hypothetical protein SORBIDRAFT_01g033970          309   8e-98    Sorghum bicolor [broomcorn]
gb|EYU24186.1|  hypothetical protein MIMGU_mgv1a009569mg                308   1e-97    
ref|XP_006490787.1|  PREDICTED: aldose 1-epimerase-like                 307   2e-97    
gb|EMT28343.1|  Aldose 1-epimerase                                      307   2e-97    
ref|XP_003579893.1|  PREDICTED: aldose 1-epimerase-like                 308   2e-97    
gb|EMS45763.1|  Aldose 1-epimerase                                      307   2e-97    
gb|KHG22159.1|  Aldose 1-epimerase                                      306   3e-97    
ref|NP_001140553.1|  aldose 1-epimerase                                 306   3e-97    Zea mays [maize]
ref|XP_010679093.1|  PREDICTED: aldose 1-epimerase                      306   4e-97    
ref|XP_006652377.1|  PREDICTED: aldose 1-epimerase-like                 307   5e-97    
ref|XP_006661643.1|  PREDICTED: aldose 1-epimerase-like                 306   5e-97    
ref|XP_011073000.1|  PREDICTED: aldose 1-epimerase                      305   7e-97    
emb|CAD40901.2|  OSJNBa0036B21.19                                       306   7e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453661.1|  hypothetical protein SORBIDRAFT_04g010030          306   7e-97    Sorghum bicolor [broomcorn]
ref|XP_004982549.1|  PREDICTED: aldose 1-epimerase-like                 309   8e-97    
ref|XP_002453662.1|  hypothetical protein SORBIDRAFT_04g010040          306   9e-97    Sorghum bicolor [broomcorn]
gb|EAY97171.1|  hypothetical protein OsI_19092                          305   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_007037270.1|  Galactose mutarotase-like superfamily protein      307   1e-96    
gb|EYU33340.1|  hypothetical protein MIMGU_mgv1a009621mg                305   2e-96    
dbj|BAJ88499.1|  predicted protein                                      308   2e-96    
ref|XP_004235803.1|  PREDICTED: aldose 1-epimerase                      304   3e-96    
gb|ABK21947.1|  unknown                                                 305   6e-96    Picea sitchensis
ref|NP_001149545.1|  aldose 1-epimerase precursor                       304   6e-96    Zea mays [maize]
gb|ABK26409.1|  unknown                                                 305   7e-96    Picea sitchensis
dbj|BAC43284.1|  putative aldose 1-epimerase                            301   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001052979.1|  Os04g0458600                                       303   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137351.1|  PREDICTED: aldose 1-epimerase-like                 302   1e-95    
gb|ADE77915.1|  unknown                                                 304   1e-95    
gb|EMT00805.1|  Aldose 1-epimerase                                      303   2e-95    
ref|XP_006341518.1|  PREDICTED: aldose 1-epimerase-like                 300   6e-95    
ref|XP_010099722.1|  Aldose 1-epimerase                                 300   8e-95    
gb|EAY90251.1|  hypothetical protein OsI_11823                          301   8e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_002530475.1|  aldose-1-epimerase, putative                       300   9e-95    Ricinus communis
ref|NP_001050238.1|  Os03g0381000                                       300   5e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008453487.1|  PREDICTED: aldose 1-epimerase                      297   1e-93    
ref|XP_008803764.1|  PREDICTED: aldose 1-epimerase                      296   2e-93    
ref|XP_008374865.1|  PREDICTED: aldose 1-epimerase                      297   2e-93    
gb|KDP25982.1|  hypothetical protein JCGZ_22712                         297   2e-93    
ref|XP_009360073.1|  PREDICTED: aldose 1-epimerase-like                 296   2e-93    
ref|XP_006651555.1|  PREDICTED: uncharacterized protein LOC102719852    306   3e-93    
ref|XP_008240141.1|  PREDICTED: aldose 1-epimerase                      296   3e-93    
ref|XP_009356028.1|  PREDICTED: aldose 1-epimerase-like                 295   8e-93    
emb|CDX92179.1|  BnaA05g22280D                                          295   1e-92    
gb|EMT25696.1|  Aldose 1-epimerase                                      295   1e-92    
ref|XP_007209327.1|  hypothetical protein PRUPE_ppa008258mg             295   1e-92    
ref|XP_003619838.1|  Aldose 1-epimerase family protein expressed        295   1e-92    
ref|XP_002446607.1|  hypothetical protein SORBIDRAFT_06g018810          295   2e-92    Sorghum bicolor [broomcorn]
ref|XP_004975840.1|  PREDICTED: aldose 1-epimerase-like                 295   2e-92    
ref|XP_004299522.1|  PREDICTED: aldose 1-epimerase-like                 294   2e-92    
ref|XP_010465867.1|  PREDICTED: aldose 1-epimerase-like                 293   4e-92    
ref|NP_001130052.1|  hypothetical protein precursor                     294   4e-92    Zea mays [maize]
ref|XP_008393430.1|  PREDICTED: aldose 1-epimerase-like                 293   7e-92    
ref|XP_008644114.1|  PREDICTED: uncharacterized protein LOC100383...    296   9e-92    
gb|KDO50781.1|  hypothetical protein CISIN_1g021840mg                   291   1e-91    
gb|KDO47395.1|  hypothetical protein CISIN_1g019518mg                   292   1e-91    
ref|XP_010549060.1|  PREDICTED: aldose 1-epimerase                      291   3e-91    
ref|XP_010487703.1|  PREDICTED: aldose 1-epimerase-like                 291   4e-91    
ref|XP_009145951.1|  PREDICTED: aldose 1-epimerase                      290   8e-91    
ref|NP_566594.2|  putative aldose 1-epimerase                           290   9e-91    
ref|XP_010506176.1|  PREDICTED: aldose 1-epimerase-like                 290   9e-91    
ref|XP_001771667.1|  predicted protein                                  290   1e-90    
gb|KCW84113.1|  hypothetical protein EUGRSUZ_B00995                     288   3e-90    
ref|XP_006298977.1|  hypothetical protein CARUB_v10015102mg             288   4e-90    
emb|CDX95801.1|  BnaC05g35520D                                          288   5e-90    
gb|AAK64036.1|  putative aldose 1-epimerase                             287   5e-90    
gb|AFK38051.1|  unknown                                                 287   6e-90    
gb|AFK40570.1|  unknown                                                 286   2e-89    
ref|XP_007152681.1|  hypothetical protein PHAVU_004G150200g             286   2e-89    
ref|XP_002885235.1|  aldose 1-epimerase family protein                  286   2e-89    
ref|XP_009113609.1|  PREDICTED: aldose 1-epimerase-like                 286   3e-89    
ref|XP_003534140.1|  PREDICTED: aldose 1-epimerase                      285   4e-89    
ref|XP_003559722.1|  PREDICTED: aldose 1-epimerase-like isoform X1      289   5e-89    
gb|KFK39119.1|  hypothetical protein AALP_AA3G203500                    285   1e-88    
ref|XP_002964577.1|  hypothetical protein SELMODRAFT_230384             285   1e-88    
ref|XP_006406670.1|  hypothetical protein EUTSA_v10021070mg             284   2e-88    
ref|XP_002988820.1|  hypothetical protein SELMODRAFT_159754             285   2e-88    
ref|NP_001169236.1|  hypothetical protein precursor                     285   2e-88    
ref|XP_004975841.1|  PREDICTED: aldose 1-epimerase-like isoform X1      285   3e-88    
gb|KCW84110.1|  hypothetical protein EUGRSUZ_B00995                     283   3e-88    
emb|CDM64824.1|  aldose 1-epimerase                                     284   4e-88    
gb|KHN44634.1|  Aldose 1-epimerase                                      281   2e-87    
ref|XP_002446609.1|  hypothetical protein SORBIDRAFT_06g018830          282   2e-87    
ref|NP_001242054.1|  uncharacterized protein LOC100776238               281   2e-87    
ref|XP_006651441.1|  PREDICTED: aldose 1-epimerase-like                 279   2e-86    
ref|XP_004512748.1|  PREDICTED: aldose 1-epimerase-like                 279   2e-86    
ref|XP_002446608.1|  hypothetical protein SORBIDRAFT_06g018820          280   3e-86    
ref|XP_006431106.1|  hypothetical protein CICLE_v100120043mg            274   5e-86    
gb|EMS49868.1|  Aldose 1-epimerase                                      278   6e-86    
ref|WP_021188843.1|  hypothetical protein                               279   6e-86    
ref|XP_008666819.1|  PREDICTED: aldose 1-epimerase isoform X2           275   1e-85    
ref|XP_002989540.1|  hypothetical protein SELMODRAFT_129964             278   2e-85    
ref|XP_008666812.1|  PREDICTED: aldose 1-epimerase isoform X1           274   2e-85    
emb|CDX91954.1|  BnaC03g32560D                                          276   3e-84    
gb|EAZ08102.1|  hypothetical protein OsI_30367                          278   2e-83    
ref|NP_001062565.1|  Os09g0108600                                       269   2e-83    
ref|WP_014623924.1|  aldose epimerase                                   271   2e-83    
ref|WP_008981617.1|  aldose 1-epimerase                                 270   4e-83    
ref|XP_001696312.1|  aldose-1-epimerase                                 271   7e-83    
gb|AEQ94127.1|  putative aldose 1-epimerase                             268   7e-83    
emb|CDT30195.1|  Aldose 1-epimerase                                     270   1e-82    
emb|CDX74292.1|  BnaA03g27550D                                          272   1e-82    
gb|KHN30819.1|  Aldose 1-epimerase                                      267   2e-82    
ref|XP_009134623.1|  PREDICTED: aldose 1-epimerase                      272   2e-82    
ref|WP_013968960.1|  aldose 1-epimerase                                 268   3e-82    
ref|WP_038701005.1|  aldose epimerase                                   269   3e-82    
ref|WP_028071942.1|  aldose epimerase                                   269   3e-82    
ref|WP_025865487.1|  aldose epimerase                                   269   4e-82    
ref|WP_008184864.1|  galactose mutarotase family enzyme                 276   2e-81    
ref|WP_026445738.1|  aldose epimerase                                   266   4e-81    
gb|EPS66431.1|  aldose 1-epimerase family protein                       263   5e-81    
ref|WP_013313070.1|  aldose epimerase                                   265   1e-80    
ref|WP_022272649.1|  aldose 1-epimerase                                 264   1e-80    
ref|XP_006582882.1|  PREDICTED: uncharacterized protein LOC100776...    263   3e-80    
ref|XP_002945807.1|  hypothetical protein VOLCADRAFT_108842             264   5e-80    
ref|XP_002964269.1|  hypothetical protein SELMODRAFT_142651             259   1e-79    
ref|WP_039452666.1|  aldose epimerase                                   261   3e-79    
gb|KHN48675.1|  Aldose 1-epimerase                                      260   5e-79    
ref|WP_005339463.1|  aldose 1-epimerase                                 259   1e-78    
ref|WP_005333146.1|  aldose 1-epimerase                                 258   3e-78    
gb|EEC77395.1|  hypothetical protein OsI_16152                          259   3e-78    
ref|XP_002505458.1|  predicted protein                                  258   6e-78    
ref|WP_022278891.1|  aldose 1-epimerase                                 257   7e-78    
gb|KHN43629.1|  Aldose 1-epimerase                                      255   8e-78    
ref|WP_029731461.1|  aldose epimerase                                   256   1e-77    
ref|WP_026903455.1|  aldose epimerase                                   257   2e-77    
ref|WP_039479041.1|  aldose epimerase                                   256   2e-77    
ref|WP_004614852.1|  aldose 1-epimerase                                 255   3e-77    
gb|KFM22691.1|  Aldose 1-epimerase                                      255   4e-77    
ref|XP_005649176.1|  aldose 1-epimerase                                 254   5e-77    
ref|XP_010233225.1|  PREDICTED: aldose 1-epimerase-like isoform X2      252   7e-77    
ref|WP_020733607.1|  aldose 1-epimerase                                 254   9e-77    
gb|EMS49614.1|  Aldose 1-epimerase                                      253   9e-77    
ref|WP_026137299.1|  aldose epimerase                                   254   1e-76    
ref|WP_013762693.1|  aldose 1-epimerase                                 255   1e-76    
ref|XP_010863927.1|  PREDICTED: aldose 1-epimerase                      253   2e-76    
ref|WP_026967330.1|  aldose epimerase                                   254   2e-76    
ref|WP_033192588.1|  aldose epimerase                                   253   2e-76    
ref|WP_013634447.1|  aldose 1-epimerase                                 254   3e-76    
ref|WP_029285733.1|  aldose epimerase                                   254   3e-76    
ref|WP_021922902.1|  putative uncharacterized protein                   253   3e-76    
gb|ADC35793.1|  aldose 1-epimerase                                      253   3e-76    
ref|NP_001017024.2|  aldose 1-epimerase                                 252   4e-76    
ref|WP_039652883.1|  aldose epimerase                                   253   4e-76    
ref|WP_026474564.1|  aldose epimerase                                   253   4e-76    
ref|XP_006451602.1|  hypothetical protein CICLE_v10008981mg             251   5e-76    
ref|WP_026463540.1|  aldose epimerase                                   253   6e-76    
ref|WP_029279011.1|  aldose epimerase                                   253   7e-76    
ref|WP_010603464.1|  aldose 1-epimerase                                 253   7e-76    
ref|WP_007888203.1|  aldose 1-epimerase                                 253   7e-76    
ref|WP_006926540.1|  aldose 1-epimerase                                 253   1e-75    
ref|WP_035353421.1|  aldose epimerase                                   252   1e-75    
gb|EMT09272.1|  Aldose 1-epimerase                                      249   1e-75    
ref|WP_022479017.1|  aldose 1-epimerase                                 251   2e-75    
ref|WP_038239171.1|  aldose epimerase                                   252   2e-75    
ref|WP_016287961.1|  hypothetical protein                               250   2e-75    
ref|XP_004006060.1|  PREDICTED: aldose 1-epimerase                      250   3e-75    
ref|WP_022250341.1|  putative uncharacterized protein                   250   3e-75    
ref|WP_013931483.1|  aldose 1-epimerase                                 250   4e-75    
ref|WP_035072584.1|  aldose epimerase                                   251   4e-75    
gb|KEO74439.1|  aldose epimerase                                        251   4e-75    
gb|EMS48569.1|  Aldose 1-epimerase                                      248   4e-75    
ref|WP_008044105.1|  aldose 1-epimerase                                 251   5e-75    
ref|WP_014263859.1|  aldose 1-epimerase                                 250   5e-75    
ref|XP_002732394.1|  PREDICTED: aldose 1-epimerase-like                 249   5e-75    
ref|XP_008661291.1|  PREDICTED: hypothetical protein isoform X1         250   5e-75    
ref|WP_011943240.1|  MULTISPECIES: aldose 1-epimerase                   249   6e-75    
ref|WP_021929861.1|  aldose 1-epimerase                                 250   8e-75    
ref|XP_005960654.1|  PREDICTED: aldose 1-epimerase                      249   9e-75    
ref|XP_790746.3|  PREDICTED: aldose 1-epimerase-like                    248   1e-74    
ref|WP_013664322.1|  aldose 1-epimerase                                 250   1e-74    
ref|XP_007240424.1|  PREDICTED: aldose 1-epimerase                      248   1e-74    
ref|WP_009093872.1|  aldose 1-epimerase                                 249   1e-74    
ref|WP_031497495.1|  aldose epimerase                                   248   1e-74    
gb|AHG92044.1|  Aldose 1-epimerase                                      249   1e-74    
ref|XP_005893819.1|  PREDICTED: aldose 1-epimerase                      248   1e-74    
ref|WP_029747980.1|  aldose epimerase                                   248   1e-74    
gb|ELR57770.1|  Aldose 1-epimerase                                      248   2e-74    
ref|WP_028829517.1|  hypothetical protein                               248   2e-74    
ref|WP_008193754.1|  MULTISPECIES: aldose 1-epimerase                   248   2e-74    
gb|AHL35011.1|  aldose epimerase                                        249   2e-74    
ref|XP_004616151.1|  PREDICTED: aldose 1-epimerase                      248   2e-74    
gb|ACF81147.1|  unknown                                                 247   2e-74    
ref|WP_008198031.1|  aldose 1-epimerase                                 248   2e-74    
ref|WP_012896227.1|  aldose 1-epimerase                                 248   3e-74    
ref|WP_034257000.1|  aldose epimerase                                   248   3e-74    
ref|WP_007413761.1|  aldose 1-epimerase                                 249   3e-74    
emb|CDX69547.1|  BnaA10g18960D                                          249   3e-74    
ref|XP_006653480.1|  PREDICTED: aldose 1-epimerase-like                 246   3e-74    
ref|XP_002115030.1|  hypothetical protein TRIADDRAFT_28936              246   3e-74    
ref|WP_008033633.1|  aldose 1-epimerase                                 248   3e-74    
ref|XP_006071248.1|  PREDICTED: aldose 1-epimerase isoform X1           247   3e-74    
ref|WP_014339235.1|  aldose 1-epimerase                                 248   3e-74    
gb|AHZ68401.1|  aldose 1-epimerase                                      248   4e-74    
ref|WP_010527222.1|  aldose 1-epimerase                                 248   4e-74    
ref|WP_015918897.1|  aldose 1-epimerase                                 248   4e-74    
ref|WP_021861593.1|  putative uncharacterized protein                   247   4e-74    
ref|WP_008508962.1|  aldose 1-epimerase                                 248   4e-74    
ref|WP_016218482.1|  hypothetical protein                               247   5e-74    
ref|XP_010853886.1|  PREDICTED: aldose 1-epimerase                      246   5e-74    
gb|AHF13299.1|  aldose 1-epimerase                                      248   6e-74    
ref|WP_009035367.1|  aldose 1-epimerase                                 247   6e-74    
ref|XP_007943247.1|  PREDICTED: aldose 1-epimerase                      246   6e-74    
ref|XP_003700467.1|  PREDICTED: aldose 1-epimerase-like                 247   7e-74    
ref|XP_006755980.1|  PREDICTED: aldose 1-epimerase                      246   7e-74    
ref|WP_026835694.1|  aldose epimerase                                   246   8e-74    
ref|WP_004082991.1|  aldose 1-epimerase                                 246   1e-73    
ref|WP_034127276.1|  aldose epimerase                                   247   1e-73    
ref|WP_009490423.1|  galactose mutarotase-like enzyme                   246   1e-73    
ref|XP_794587.3|  PREDICTED: aldose 1-epimerase-like                    246   1e-73    
ref|WP_026386457.1|  aldose epimerase                                   247   1e-73    
ref|WP_015924930.1|  aldose 1-epimerase [                               246   1e-73    
ref|WP_024619236.1|  aldose epimerase                                   247   1e-73    
ref|XP_005686568.1|  PREDICTED: aldose 1-epimerase                      246   1e-73    
ref|WP_038323662.1|  hypothetical protein                               246   1e-73    
ref|WP_007654855.1|  MULTISPECIES: aldose 1-epimerase                   246   1e-73    
ref|WP_010173656.1|  aldose 1-epimerase                                 246   2e-73    
ref|WP_036238297.1|  galactose mutarotase                               245   2e-73    
ref|WP_014217007.1|  aldose 1-epimerase                                 246   2e-73    
ref|WP_003190562.1|  aldose 1-epimerase                                 246   2e-73    
ref|XP_007892559.1|  PREDICTED: aldose 1-epimerase                      245   2e-73    
ref|WP_006978345.1|  aldose 1-epimerase                                 245   2e-73    
ref|WP_023346377.1|  hypothetical protein                               244   2e-73    
ref|WP_012233602.1|  aldose 1-epimerase                                 247   2e-73    
ref|NP_001029967.1|  aldose 1-epimerase                                 245   2e-73    
ref|XP_004418183.1|  PREDICTED: aldose 1-epimerase                      245   2e-73    
ref|XP_005436814.1|  PREDICTED: aldose 1-epimerase                      245   3e-73    
ref|WP_003183022.1|  aldose 1-epimerase                                 246   3e-73    
ref|WP_018611424.1|  aldose 1-epimerase                                 246   3e-73    
ref|WP_032892291.1|  aldose epimerase                                   246   3e-73    
ref|WP_026625863.1|  aldose epimerase                                   246   3e-73    
gb|KHD90154.1|  aldose epimerase                                        246   3e-73    
ref|WP_018107995.1|  hypothetical protein                               246   3e-73    
ref|WP_021653970.1|  putative aldose 1-epimerase                        245   3e-73    
ref|WP_008616302.1|  aldose 1-epimerase                                 246   3e-73    
ref|WP_039108583.1|  aldose epimerase                                   246   3e-73    
ref|WP_014718076.1|  aldose 1-epimerase                                 246   3e-73    
ref|WP_027926062.1|  aldose epimerase                                   244   4e-73    
ref|WP_017480282.1|  aldose 1-epimerase                                 246   4e-73    
ref|WP_039589204.1|  aldose epimerase                                   246   4e-73    
ref|WP_038634458.1|  aldose epimerase                                   246   4e-73    
ref|WP_020303153.1|  MULTISPECIES: aldose 1-epimerase                   245   4e-73    
ref|WP_027422283.1|  aldose epimerase                                   244   4e-73    
ref|WP_018478674.1|  aldose 1-epimerase                                 246   4e-73    
ref|WP_019817327.1|  MULTISPECIES: aldose 1-epimerase                   245   5e-73    
ref|WP_013073698.1|  aldose 1-epimerase                                 246   5e-73    
ref|WP_038107707.1|  aldose epimerase                                   244   5e-73    
ref|WP_020148381.1|  hypothetical protein                               245   5e-73    
ref|WP_026392295.1|  aldose epimerase                                   245   5e-73    
ref|XP_010930440.1|  PREDICTED: aldose 1-epimerase-like isoform X2      242   6e-73    
ref|WP_036360957.1|  galactose mutarotase                               244   6e-73    
ref|XP_006745353.1|  PREDICTED: aldose 1-epimerase                      244   6e-73    
ref|XP_005864787.1|  PREDICTED: aldose 1-epimerase                      244   6e-73    
ref|WP_009050450.1|  aldose 1-epimerase                                 245   6e-73    
ref|XP_005232392.1|  PREDICTED: aldose 1-epimerase                      244   6e-73    
ref|WP_012842988.1|  aldose 1-epimerase                                 245   6e-73    
ref|WP_011994367.1|  aldose 1-epimerase                                 244   6e-73    
ref|XP_003758387.1|  PREDICTED: aldose 1-epimerase                      244   6e-73    
ref|WP_030043704.1|  aldose epimerase                                   244   7e-73    
ref|WP_022085092.1|  aldose 1-epimerase                                 244   7e-73    
ref|WP_019599697.1|  hypothetical protein                               244   7e-73    
ref|WP_007966636.1|  aldose 1-epimerase                                 245   7e-73    
ref|WP_030131542.1|  aldose epimerase                                   245   8e-73    
ref|NP_999571.1|  aldose 1-epimerase                                    243   8e-73    
ref|WP_025143610.1|  aldose epimerase                                   245   8e-73    
gb|AIZ65341.1|  aldose epimerase                                        245   8e-73    
gb|EMS48168.1|  Aldose 1-epimerase                                      242   1e-72    
ref|WP_028729616.1|  aldose epimerase                                   244   1e-72    
ref|XP_005042893.1|  PREDICTED: aldose 1-epimerase isoform X1           243   1e-72    
ref|WP_003200080.1|  MULTISPECIES: aldose 1-epimerase                   244   1e-72    
ref|XP_007116387.1|  PREDICTED: aldose 1-epimerase                      243   1e-72    
ref|WP_004064637.1|  hypothetical protein                               243   1e-72    
ref|WP_014266086.1|  aldose 1-epimerase                                 244   1e-72    
ref|WP_009045273.1|  aldose 1-epimerase                                 244   1e-72    



>ref|XP_009624450.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Nicotiana tomentosiformis]
Length=360

 Score =   442 bits (1136),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 225/358 (63%), Positives = 273/358 (76%), Gaps = 17/358 (5%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +CFFI   L    V G+    Y IKKGDFSV++TNYGAR+ S++LPDK+G + D+ LG
Sbjct  7     LLICFFILHLLAATNVRGRKIGIYEIKKGDFSVRITNYGARIISVLLPDKHGNIGDVALG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDTV EYE D T+FGA++GRVANRIGGAQFTLNG  YKL ANDG NTLHGGPKG S+V W
Sbjct  67    YDTVKEYENDTTSFGALLGRVANRIGGAQFTLNGTIYKLIANDGANTLHGGPKGFSRVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
              V K+E+      IT TY+S DG++GFPGDV+A VTY + E+PYKL V M AKALNK TP
Sbjct  127   NVNKYEQDGPYPHITLTYHSADGEEGFPGDVLASVTYAL-EDPYKLSVVMKAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH YWN+GGH+SG+ILS  +QIFA HITPVD +LIPTG+I  + NT +DFLKP++V
Sbjct  186   VNLAQHTYWNIGGHNSGDILSNVVQIFASHITPVDEHLIPTGEISPVKNTPYDFLKPREV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             G+Q++KLP    G+DINYA+D      T + K VA VYD++SG  M+++A+APGVQFYTA
Sbjct  246   GNQISKLPS---GYDINYALD-----STVEMKPVAIVYDKKSGRVMDLQASAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N L   KGKG  VY+ HAALC ETQGFPDAVNHPNFPSTIVTP + Y H +  TF + 
Sbjct  298   NSLIQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPSTIVTPGKAYVHKMLYTFSIM  354



>ref|XP_006338470.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Solanum tuberosum]
Length=357

 Score =   441 bits (1133),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/354 (63%), Positives = 267/354 (75%), Gaps = 14/354 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
             L +CFFI      +G     Y IKKGDFSVK+TNYGAR+ S++LPDKNGK+ D+VLGYDT
Sbjct  7     LLICFFILHLWAAAGHKIGIYEIKKGDFSVKVTNYGARIISVLLPDKNGKIGDVVLGYDT  66

Query  256   VMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVK  435
             + EY  D ++FGAIVGRVANRIGGA+FTLNG  YKL ANDG NT+HGGPKG   V WKV 
Sbjct  67    IGEYVNDTSSFGAIVGRVANRIGGARFTLNGTLYKLIANDGENTIHGGPKGFGHVVWKVS  126

Query  436   KHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
             K+++      IT TY+S DG+QGFPGD++  VTY +K NPYKL V M AKALNK TPVNL
Sbjct  127   KYKKDGPHPRITLTYHSTDGEQGFPGDLLVSVTYALK-NPYKLSVVMKAKALNKATPVNL  185

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             AQH+YWNLGGH+SGNILS  +QIFA HITPVD +LIPTG+I  + NT ++FLKP++VGSQ
Sbjct  186   AQHSYWNLGGHNSGNILSNVVQIFASHITPVDQSLIPTGEISPVKNTPYNFLKPREVGSQ  245

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
             + +L     G+DINY VD      T K K VA VYDE+SG  M+++A+APGVQFYTAN L
Sbjct  246   IKEL---QSGYDINYVVD-----STEKMKPVAIVYDEKSGRVMDVQASAPGVQFYTANSL  297

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
                KGKG  VY+ HAALC ETQGFPDAVNHPNFP TIVTP + Y H +  TF +
Sbjct  298   NQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPPTIVTPGKAYVHKMLYTFSI  350



>ref|XP_009779455.1| PREDICTED: aldose 1-epimerase-like isoform X4 [Nicotiana sylvestris]
Length=377

 Score =   441 bits (1135),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 276/364 (76%), Gaps = 17/364 (5%)
 Frame = +1

Query  55    MSIISAPLFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS   +PL +CFFI   S A  V G+    Y IKKGDFSVK+TNYGAR+ S++LPDK+G+
Sbjct  17    MSSKISPLLICFFILHLSAAASVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGR  76

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+ LGYDTV EYE D T+FGA++GRVANRIGGAQFTLNG  YKL ANDG NTLHGGP+
Sbjct  77    IDDVALGYDTVEEYENDTTSFGALLGRVANRIGGAQFTLNGTLYKLIANDGANTLHGGPE  136

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S+V W V K+E+      IT TY+S DG++GFPGDV+A VTY + E+PYKL V M AK
Sbjct  137   GFSRVVWNVSKYEQDGPYPHITLTYHSADGEEGFPGDVLASVTYAL-EDPYKLSVVMKAK  195

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALN  TPVNLAQH YWN+GGH+SG+ILS  +QIFA HITPVD +LIPTG+I  + NT +D
Sbjct  196   ALNMATPVNLAQHTYWNIGGHNSGDILSNVVQIFASHITPVDEHLIPTGEISPVKNTPYD  255

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP++VGSQ+ +L     G+DINYA+D      + + K VA V+D++SG  M+++A+AP
Sbjct  256   FLKPREVGSQINEL---QSGYDINYALD-----SSAEMKPVAIVHDKKSGRVMDLQASAP  307

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYTAN L   KGKG  VY+ HAALC ETQGFPDAVNHPNFPSTIV+P + Y H +  
Sbjct  308   GVQFYTANSLIQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPSTIVSPGKAYTHKMLY  366

Query  1114  TFRV  1125
             TF +
Sbjct  367   TFSI  370



>ref|XP_009593213.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=359

 Score =   439 bits (1129),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 224/357 (63%), Positives = 271/357 (76%), Gaps = 15/357 (4%)
 Frame = +1

Query  76    LFLCFFISF---ALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI     ALIV G+    Y IKKGDFSVK+TNYGAR+ S+++PDKNGK+ D+VLG
Sbjct  8     LLICLFILHLWSALIVRGRKIGIYEIKKGDFSVKITNYGARIISVLVPDKNGKIGDVVLG  67

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGAIVGRVANRIGGAQFTLNG  YKL AN+GNNTLHGGPKG S V W
Sbjct  68    YDTIKEYKNDTSYFGAIVGRVANRIGGAQFTLNGTLYKLIANNGNNTLHGGPKGFSHVVW  127

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV KHE       IT TY+S DG++GFPGD+   VTY +K+ PYKL V M AKALNK TP
Sbjct  128   KVSKHERHGSHPHITLTYHSGDGEEGFPGDLRVSVTYALKD-PYKLSVVMKAKALNKATP  186

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH+YWN+GGH+SG+ILS  +QIFA HITPVD +LIPTG+I+ + NT +DFLKP++V
Sbjct  187   VNLAQHSYWNIGGHNSGDILSNVIQIFASHITPVDEHLIPTGEIIPVKNTPYDFLKPRKV  246

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GSQM  + K   G+DINY +D      + K K VA VYD++SG  M ++A+APGVQFYTA
Sbjct  247   GSQM--INKHQNGYDINYVLD-----SSEKMKPVAIVYDKKSGRVMVVQASAPGVQFYTA  299

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             N + + KGK   VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H +   F +
Sbjct  300   NFVINKKGKDGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYVHKMLYMFSL  356



>ref|XP_011098592.1| PREDICTED: aldose 1-epimerase-like [Sesamum indicum]
Length=360

 Score =   438 bits (1127),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/365 (61%), Positives = 274/365 (75%), Gaps = 13/365 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFI-SFALIVSGQDNKF--YVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS IS  +  CF I +F +  +G +N    Y IKKGDFSVK+TNYGAR+ S++LPDKNGK
Sbjct  1     MSKIS--ILFCFIILAFGIFANGSENGLGIYEIKKGDFSVKVTNYGARIVSVVLPDKNGK  58

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYDT+ EY  D   FGAIVGRVANRIGGA+FTLNG  YKL+AN+GNNTLHGG K
Sbjct  59    LADVVLGYDTIKEYMNDTCYFGAIVGRVANRIGGAKFTLNGTLYKLDANEGNNTLHGGKK  118

Query  406   GISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S+V WKV KH        IT +Y+S DG++GFPGDV+A VTY + E PYKL V M AK
Sbjct  119   GFSEVAWKVTKHVKYGRSPYITLSYHSVDGEEGFPGDVLASVTYALIE-PYKLSVTMKAK  177

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             AL+K TPV+LAQH+YWNLGGH+SGN LS++LQ+FA HIT VD  LIPTG+I+ + +T +D
Sbjct  178   ALDKATPVSLAQHSYWNLGGHNSGNTLSDELQLFASHITLVDDKLIPTGKIVPVKSTPYD  237

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FL+P  +   + +LPKGS G+DINY VDG      +K K VA VY+++SG  M++ A AP
Sbjct  238   FLEPHVIKGPIKRLPKGSKGYDINYVVDGPKG---QKMKPVAIVYNKKSGRIMKLSANAP  294

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQ YT N++ DVKGKG  VY+SHAALCLETQGFPD+VNHPNFPS IV P + Y+H +  
Sbjct  295   GVQLYTGNYINDVKGKGGYVYQSHAALCLETQGFPDSVNHPNFPSEIVNPGKTYEHCMLF  354

Query  1114  TFRVQ  1128
             TF  +
Sbjct  355   TFSTK  359



>ref|XP_009624451.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   438 bits (1126),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 227/357 (64%), Positives = 270/357 (76%), Gaps = 17/357 (5%)
 Frame = +1

Query  76    LFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +CFFI     A  V  +    Y IKKGDFSVK+TNYGAR+ S++LPDK+GK+ D+VLG
Sbjct  7     LLICFFILHLCAAASVRERKIGIYEIKKGDFSVKVTNYGARIISVLLPDKDGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EYE D ++FGAIVGRVANRIGGAQFTLNG  YKL ANDGNNTLHGGPKG S V W
Sbjct  67    YDTIKEYENDTSSFGAIVGRVANRIGGAQFTLNGTLYKLIANDGNNTLHGGPKGFSHVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+E+      IT TY+S DG+QGFP D++  VTY +K+ PYKL V M AKALNK TP
Sbjct  127   KVSKYEKDGSHPHITLTYHSADGEQGFPSDLLVSVTYGLKD-PYKLSVVMKAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH YWN+GGH SG+ILS  +QIFA HITPVD +LIPTG+   + NT +DFLKP++V
Sbjct  186   VNLAQHTYWNIGGHTSGDILSNDIQIFASHITPVDQHLIPTGEFAPVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GSQ+ KL     G+DINYA+D      + K K VA VYD++SG  M+++A+APGVQFYTA
Sbjct  246   GSQINKL---QNGYDINYALD-----ISEKMKPVAIVYDKKSGRVMDLQASAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             N L   KGKG  VY+ HAALCLETQGFPDAVNHPNFPSTIVTP + Y H +  TF +
Sbjct  298   NSLIK-KGKGGYVYQPHAALCLETQGFPDAVNHPNFPSTIVTPGKNYVHKMLYTFSI  353



>ref|XP_009624449.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Nicotiana tomentosiformis]
Length=371

 Score =   434 bits (1116),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 225/369 (61%), Positives = 273/369 (74%), Gaps = 28/369 (8%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKN---------  219
             L +CFFI   L    V G+    Y IKKGDFSV++TNYGAR+ S++LPDK+         
Sbjct  7     LLICFFILHLLAATNVRGRKIGIYEIKKGDFSVRITNYGARIISVLLPDKHEISVTVSCS  66

Query  220   --GKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLH  393
               G + D+ LGYDTV EYE D T+FGA++GRVANRIGGAQFTLNG  YKL ANDG NTLH
Sbjct  67    VPGNIGDVALGYDTVKEYENDTTSFGALLGRVANRIGGAQFTLNGTIYKLIANDGANTLH  126

Query  394   GGPKGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVK  561
             GGPKG S+V W V K+E+      IT TY+S DG++GFPGDV+A VTY + E+PYKL V 
Sbjct  127   GGPKGFSRVVWNVNKYEQDGPYPHITLTYHSADGEEGFPGDVLASVTYAL-EDPYKLSVV  185

Query  562   MNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINN  741
             M AKALNK TPVNLAQH YWN+GGH+SG+ILS  +QIFA HITPVD +LIPTG+I  + N
Sbjct  186   MKAKALNKATPVNLAQHTYWNIGGHNSGDILSNVVQIFASHITPVDEHLIPTGEISPVKN  245

Query  742   TAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIK  921
             T +DFLKP++VG+Q++KLP    G+DINYA+D      T + K VA VYD++SG  M+++
Sbjct  246   TPYDFLKPREVGNQISKLPS---GYDINYALD-----STVEMKPVAIVYDKKSGRVMDLQ  297

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
             A+APGVQFYTAN L   KGKG  VY+ HAALC ETQGFPDAVNHPNFPSTIVTP + Y H
Sbjct  298   ASAPGVQFYTANSLIQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPSTIVTPGKAYVH  356

Query  1102  TLHITFRVQ  1128
              +  TF + 
Sbjct  357   KMLYTFSIM  365



>ref|XP_009779461.1| PREDICTED: aldose 1-epimerase-like [Nicotiana sylvestris]
Length=355

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 224/357 (63%), Positives = 269/357 (75%), Gaps = 17/357 (5%)
 Frame = +1

Query  76    LFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             LF+C FI     A  V G     Y IKKGDF+VK+TN+GARV S++LPDK+GK+ D+VLG
Sbjct  7     LFICLFILHLCAAASVRGHKIGIYEIKKGDFTVKVTNFGARVISVLLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EYE D ++FGAIVGRVANRIGGAQFTLNG  YKL ANDGNNT+HGGPKG S V W
Sbjct  67    YDTIKEYENDTSSFGAIVGRVANRIGGAQFTLNGTLYKLIANDGNNTIHGGPKGFSHVIW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+E+      IT TY+S DG+QGFPGD++  VTY +K+ PYKL V M  KALNK TP
Sbjct  127   KVSKYEKDGPHPHITLTYHSADGEQGFPGDLLVSVTYALKD-PYKLSVVMKGKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH YWN+GGH SGNILS  +QIFA  IT VD +LIPTG +  + NT +DFLKP++V
Sbjct  186   VNLAQHTYWNIGGHTSGNILSNVIQIFASQITLVDQHLIPTGALAPVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GSQ+ KL     G+DINYA+D  +++     K VA VYD++SG  M+++A+APGVQFYTA
Sbjct  246   GSQINKL---QNGYDINYALDSSENM-----KPVAIVYDKKSGRVMDLQASAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             N L   KGKG  VY+ HAALCLETQGFPDAVNHPNFPSTIVTP + Y H +  TF +
Sbjct  298   NSLIK-KGKGGYVYQPHAALCLETQGFPDAVNHPNFPSTIVTPGKSYIHKMLYTFSI  353



>ref|XP_006338469.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Solanum tuberosum]
Length=360

 Score =   431 bits (1109),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/357 (62%), Positives = 268/357 (75%), Gaps = 17/357 (5%)
 Frame = +1

Query  76    LFLCFFISFALIV---SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI     V   +GQ+   Y IKKGDFSVK+TNYGAR+ S+ LPDK+G+  D+VLG
Sbjct  7     LLICVFILHLWAVNSVTGQNVGVYEIKKGDFSVKVTNYGARIISVFLPDKHGETGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D T+FGA++GRVANRIGGAQFT+NG  YKL ANDG NTLHGG KG S+V W
Sbjct  67    YDTIEEYKNDTTSFGALLGRVANRIGGAQFTMNGTLYKLVANDGVNTLHGGIKGFSRVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
              V K+++      IT TY+S DG++GFPGD++  VTY +K NPYKL V M AKALNK TP
Sbjct  127   NVSKYQQDGPYPHITLTYHSADGEEGFPGDLLVSVTYALK-NPYKLSVVMKAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH+YWNLGGH+SGNILS  +QIFA HITPVD +LIPTG+I  + NT ++FLKP++V
Sbjct  186   VNLAQHSYWNLGGHNSGNILSNVVQIFASHITPVDQSLIPTGEISPVKNTPYNFLKPREV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GSQ+ +L     G+DINY VD      T K K VA VYDE+SG  M+++A+APGVQFYTA
Sbjct  246   GSQIKEL---QSGYDINYVVD-----STEKMKPVAIVYDEKSGRVMDVQASAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             N L   KGKG  VY+ HAALC ETQGFPDAVNHPNFP TIVTP + Y H +  TF +
Sbjct  298   NSLNQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPPTIVTPGKAYVHKMLYTFSI  353



>ref|XP_009347058.1| PREDICTED: aldose 1-epimerase [Pyrus x bretschneideri]
Length=369

 Score =   427 bits (1098),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 268/362 (74%), Gaps = 17/362 (5%)
 Frame = +1

Query  76    LFLCFFISFALIV---SGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
             + LCF +  A  +   SG ++K     Y +KKGD SVK TN+GA + SL+LPDKNGKL D
Sbjct  13    VLLCFIVLAAFAIANASGSESKERIGVYALKKGDLSVKFTNWGATIISLVLPDKNGKLAD  72

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
             +VLGYD+V EY  D +  G++VGRVANRIGGAQFTLNG HYKL AN+G N LHGG KG S
Sbjct  73    VVLGYDSVKEYTNDTSYIGSVVGRVANRIGGAQFTLNGTHYKLVANEGKNMLHGGKKGFS  132

Query  415   KVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALN  582
              V WKV KH+      SI FTY+S DG+QGFPGDV+A V+YT+  +  +L +KM AKALN
Sbjct  133   DVVWKVIKHKNEGHSPSIVFTYHSADGEQGFPGDVLATVSYTLTGD-NQLSIKMKAKALN  191

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             KPTPV+LAQH YWNLGGH+SG+ILS+ + IFA H TPVDS+LIPTG+I  +  T +DFLK
Sbjct  192   KPTPVSLAQHTYWNLGGHNSGDILSQDVTIFASHYTPVDSHLIPTGKIASVKGTPYDFLK  251

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P  VGS++ KLP    G+DINY +D    VG + +     V+D++SG  +E+   APG+Q
Sbjct  252   PNDVGSRINKLPS---GYDINYCLDS-SGVGNKLRPATV-VHDKKSGRVLELSTNAPGLQ  306

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFR  1122
             FYT+N L+DVKGKG  VYE HAALCLETQGFPD+VNHPNFPSTIVTP++PYKH +   F 
Sbjct  307   FYTSNFLKDVKGKGGFVYEPHAALCLETQGFPDSVNHPNFPSTIVTPKKPYKHFMLFKFS  366

Query  1123  VQ  1128
             ++
Sbjct  367   IK  368



>ref|XP_008341553.1| PREDICTED: aldose 1-epimerase [Malus domestica]
Length=367

 Score =   426 bits (1096),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 270/362 (75%), Gaps = 17/362 (5%)
 Frame = +1

Query  76    LFLCFFISFALIV---SGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
             + LCF +  A  +   SG ++K     Y +KKGD SVK TN+GA + SL+LPDKNGKL D
Sbjct  11    VLLCFIVLAAFAIANASGSESKERIGVYALKKGDLSVKFTNWGATIISLVLPDKNGKLAD  70

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
             +VLGYD+V EY  D +  G++VGRVANRIGGAQFTLNG HYKL AN+G N LHGG KG S
Sbjct  71    VVLGYDSVKEYTNDTSYIGSVVGRVANRIGGAQFTLNGTHYKLVANEGKNILHGGKKGFS  130

Query  415   KVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALN  582
              V WKV+K++      SI FTY+S DG+QGFPGDV+A V+YT+  +  +L +KM AKALN
Sbjct  131   DVVWKVRKYKNEGHSPSIAFTYHSADGEQGFPGDVLATVSYTLTGD-NQLSIKMKAKALN  189

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             KPTPV+LAQH YWNLGGH+SG++LS+ + IFA H TPVDS+LIPTG+I  +  T +DFLK
Sbjct  190   KPTPVSLAQHTYWNLGGHNSGDVLSQDVTIFASHYTPVDSHLIPTGKIASVKGTPYDFLK  249

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P  VGS++ KL   + G+DINY +D    VG  K +  A V+D++SG  +E+   APG+Q
Sbjct  250   PDAVGSRINKL---TSGYDINYCLDS-SGVG-NKLRPAAVVHDKKSGRVLELSTNAPGLQ  304

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFR  1122
             FYT+N L+DVKGKG  VYE HAALCLETQGFPD+VNHPNFPSTIVTP++PYKH +   F 
Sbjct  305   FYTSNSLKDVKGKGGFVYEPHAALCLETQGFPDSVNHPNFPSTIVTPKKPYKHFMLFKFS  364

Query  1123  VQ  1128
             ++
Sbjct  365   IK  366



>ref|XP_009779450.1| PREDICTED: aldose 1-epimerase-like [Nicotiana sylvestris]
Length=355

 Score =   426 bits (1094),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 221/362 (61%), Positives = 267/362 (74%), Gaps = 17/362 (5%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIV---SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS   + L +C FI     V   +G+    Y IKKGDFSVK+TNYGAR+ S+++PDKNGK
Sbjct  1     MSSKVSSLLICLFILHLWAVGSVTGRKIGIYEIKKGDFSVKVTNYGARIISVLVPDKNGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+VLGYDT+ EY+ D   FGAIVGRVANRIGGAQFTLNG  YKL AN+GNNTLHGGPK
Sbjct  61    IDDVVLGYDTIKEYKNDTNYFGAIVGRVANRIGGAQFTLNGTLYKLIANNGNNTLHGGPK  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV KHE       IT T+ S DG++GFPGD+   VTY +K+ PYKL V M AK
Sbjct  121   GFSHVVWKVSKHERHGSHPHITLTFRSADGEEGFPGDLRVSVTYALKD-PYKLSVVMKAK  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
               NK TPVNLAQH YWN+GGH+SG+ILS  +QIFA HITPVD +LIPTG+I  + NT +D
Sbjct  180   DRNKATPVNLAQHTYWNIGGHNSGDILSNVIQIFASHITPVDEHLIPTGEITSVKNTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP++VGS   ++ K   G+DINY +D      ++K K VA VYD++SG  M ++A+AP
Sbjct  240   FLKPRKVGS---RINKHQNGYDINYVLD-----SSKKMKPVAIVYDKKSGRVMLVQASAP  291

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQF+TAN L   KGKG  VY+ HAALCLETQGFPDAVNHPNFPSTIVTP++ Y H +  
Sbjct  292   GVQFFTANSLIK-KGKGGYVYQPHAALCLETQGFPDAVNHPNFPSTIVTPRKTYVHKMLY  350

Query  1114  TF  1119
             TF
Sbjct  351   TF  352



>ref|XP_009779457.1| PREDICTED: aldose 1-epimerase-like isoform X6 [Nicotiana sylvestris]
Length=357

 Score =   425 bits (1092),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 216/365 (59%), Positives = 271/365 (74%), Gaps = 16/365 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS   + L +C FI     A  V G+    Y IKKGDFSVK+TNYGA + S++LPDK+GK
Sbjct  1     MSSKISLLLICLFILHLCAAASVRGRKIGIYEIKKGDFSVKITNYGATIISVLLPDKHGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LHGG K
Sbjct  61    IGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLK  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G SKV WKV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V   A+
Sbjct  121   GFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVVFKAR  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNK TP+NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + NT +D
Sbjct  180   ALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKNTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP++VGS++ K+     G+DINYA+D      +RK K VA V+D++SG  M+IKATAP
Sbjct  240   FLKPRKVGSRIDKI---QNGYDINYALD-----SSRKMKPVAIVFDKKSGRVMDIKATAP  291

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYTAN + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H++  
Sbjct  292   GVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLHSVLY  351

Query  1114  TFRVQ  1128
             TF ++
Sbjct  352   TFSIK  356



>ref|XP_009779456.1| PREDICTED: aldose 1-epimerase-like isoform X5 [Nicotiana sylvestris]
Length=373

 Score =   425 bits (1093),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 216/365 (59%), Positives = 270/365 (74%), Gaps = 16/365 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS   +PL +CFFI   S A  V G+    Y IKKGDFSVK+TNYGAR+ S++LPDK+GK
Sbjct  17    MSSKISPLLICFFILHLSAAASVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGK  76

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPK
Sbjct  77    IGDVVLGYDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPK  136

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G SKV WKV K+ +      IT TYYS DG++GFPG V+A VTYT+K++ YKL V   AK
Sbjct  137   GFSKVVWKVSKYVKDGPWPYITLTYYSADGEEGFPGAVLASVTYTLKDS-YKLSVVFRAK  195

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNK TP+NL+ H YWN+GGHDSG++LS+ LQIF  HIT VD  LIPTG+I  + NT +D
Sbjct  196   ALNKATPINLSHHPYWNIGGHDSGDVLSQVLQIFGSHITLVDKQLIPTGEIAPVKNTPYD  255

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP++VGS++ KL     G+DINY +D      T K K V  VYD++SG  M+++A+AP
Sbjct  256   FLKPRKVGSRINKL---KNGYDINYVLD-----STEKMKPVGIVYDKKSGRVMDVQASAP  307

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYTAN + + KGKG  VY+ H+AL LET  FPDAVNHPNFPST+V P + Y H++  
Sbjct  308   GVQFYTANFVNNTKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTVVNPGEKYVHSVLY  367

Query  1114  TFRVQ  1128
             TF ++
Sbjct  368   TFSIK  372



>ref|XP_002282868.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
Length=359

 Score =   424 bits (1091),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 261/360 (73%), Gaps = 16/360 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSG-----QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             +F+CF        +G     +D   Y ++KGDFS K T +GA + S++LPDKNGKL D+V
Sbjct  6     VFVCFITLVFCFATGSVAKKEDGGIYELRKGDFSAKFTKWGAAIVSVVLPDKNGKLADVV  65

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LGYD+  EY+ D TNFGAIVGRVANRIGGAQFTLNG HYKL ANDG N LHGGPKG  KV
Sbjct  66    LGYDSTKEYKNDTTNFGAIVGRVANRIGGAQFTLNGTHYKLVANDGKNMLHGGPKGFGKV  125

Query  421   YWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKP  588
              W+V K+E+      I F+Y+S DG++GFPGD+IA VTY +  + Y+LIV M AKALNK 
Sbjct  126   AWRVSKYEKGGHSPYIMFSYHSLDGEEGFPGDLIATVTYMLVGD-YQLIVTMKAKALNKA  184

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVNLAQH YWNLGGH SG+ILS ++QIF  HITPVD  LIPTG+I+ +  T +DFLKP 
Sbjct  185   TPVNLAQHAYWNLGGHTSGDILSNEIQIFGSHITPVDKELIPTGKIVPVKGTPYDFLKPC  244

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              +GS++ KLP    GFDINY +   DD    K    A V+ ++SG  +E+   APG+QFY
Sbjct  245   TIGSKINKLPS---GFDINYVL---DDTAPNKVGLAAMVHHKKSGRMLELYTNAPGLQFY  298

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             T+N L+DVKGKG  VY++HAALCLETQGFPD+VNHPNFPS IVTP + Y H++   F ++
Sbjct  299   TSNSLKDVKGKGGFVYQAHAALCLETQGFPDSVNHPNFPSQIVTPGKSYHHSMLFKFSIR  358



>ref|XP_006338471.1| PREDICTED: aldose 1-epimerase-like isoform X3 [Solanum tuberosum]
Length=353

 Score =   424 bits (1089),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 216/355 (61%), Positives = 262/355 (74%), Gaps = 14/355 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
             L +CFFI      +G     Y IKKGDFSVK+TNYGAR+ S++LPDKNGK+ D+VLGYDT
Sbjct  7     LLICFFILHLWAAAGHKIGIYEIKKGDFSVKVTNYGARIISVLLPDKNGKIGDVVLGYDT  66

Query  256   VMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVK  435
             + EY  D ++FGAIVGRVANRIGGA+FTLNG  YKL ANDG NT+HGGPKG   V WKV 
Sbjct  67    IGEYVNDTSSFGAIVGRVANRIGGARFTLNGTLYKLIANDGENTIHGGPKGFGHVVWKVS  126

Query  436   KHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
             K+++      IT TY+S DG+QGFPG ++A VTY + E+PYKL V M AKALNK TPVNL
Sbjct  127   KYKKDGPHPRITLTYHSTDGEQGFPGVLLASVTYAL-EDPYKLSVVMKAKALNKATPVNL  185

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             AQH YWNLGGH+SG+ILS  +QIFA HITP+D + IPTG+I  + NT +DFLKP++VGSQ
Sbjct  186   AQHAYWNLGGHNSGDILSNDIQIFASHITPLDQHFIPTGKIAPVKNTPYDFLKPRKVGSQ  245

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
               KL     G+DINY +D      T K K  A V D++SG  M ++ TAP VQ YTAN L
Sbjct  246   FKKL---QNGYDINYPLD-----STEKLKPTAIVRDKKSGRVMSLQTTAPAVQLYTANTL  297

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
                KGKG  VY+ ++A+CLETQGFPDAVNHPNFPSTIVTP+ PY H +  TF ++
Sbjct  298   VK-KGKGGFVYQPYSAICLETQGFPDAVNHPNFPSTIVTPENPYFHKMLFTFSIK  351



>gb|AAL09398.1|AF307095_1 non-cell-autonomous protein pathway2 [Nicotiana tabacum]
Length=357

 Score =   422 bits (1086),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 215/365 (59%), Positives = 270/365 (74%), Gaps = 16/365 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS   + L +C FI     A  V G+    Y IKKGDFSVK+TNYGA + S++LPDK+GK
Sbjct  1     MSSKISLLLICLFILHLCAAASVRGRKIGIYEIKKGDFSVKITNYGATIISVLLPDKHGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LHGG K
Sbjct  61    IGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLK  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G SKV WKV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V   A+
Sbjct  121   GFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVVFKAR  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNK TP+NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + NT +D
Sbjct  180   ALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKNTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP++VGS++ K+     G+DINYA+D      +RK K VA V+D++SG  M+IKATAP
Sbjct  240   FLKPRKVGSRIDKI---QNGYDINYALD-----SSRKMKPVAIVFDKKSGRVMDIKATAP  291

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYTAN + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIV P + Y H++  
Sbjct  292   GVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVIPGKTYLHSVLY  351

Query  1114  TFRVQ  1128
             TF ++
Sbjct  352   TFSIK  356



>ref|XP_009779459.1| PREDICTED: aldose 1-epimerase-like isoform X8 [Nicotiana sylvestris]
Length=356

 Score =   422 bits (1085),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 213/358 (59%), Positives = 267/358 (75%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C  I   L+   V G     Y IKKGDFSVK+TNYGA + S++LPDK+GK+ D+VLG
Sbjct  7     LLVCLIIFHLLVAASVRGHKIGIYEIKKGDFSVKITNYGASIISVLLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LHGG KG SKV W
Sbjct  67    YDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFSKVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V   A+ALNK TP
Sbjct  127   KVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVVFKARALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + NT +DFLKP++V
Sbjct  186   INLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ K+     G+DINYA+D      +RK K VA V+D++SG  M+IKATAPGVQFYTA
Sbjct  246   GSRIDKI---QNGYDINYALD-----SSRKMKPVAIVFDKKSGRVMDIKATAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H++  TF ++
Sbjct  298   NFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLHSVLYTFSIK  355



>ref|XP_006338467.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=358

 Score =   422 bits (1084),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 268/359 (75%), Gaps = 17/359 (5%)
 Frame = +1

Query  76    LFLCFFISFALI----VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             L +C F    L+    V+G   + Y IKKGDFSVK+TNYGA + S++LPDKNGK+ D+VL
Sbjct  7     LLICLFFILHLLAADSVTGHKIEIYEIKKGDFSVKVTNYGATIISVLLPDKNGKIGDVVL  66

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GYDT+ EY  D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LHGG KG SKV 
Sbjct  67    GYDTIKEYRNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFSKVV  126

Query  424   WKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPT  591
             WKV+K+ +      IT TY+S DG++GFPGDV+  VTY +K++ Y L V   AKALNK T
Sbjct  127   WKVRKYVQDGPSPYITLTYHSADGEEGFPGDVVVSVTYALKDH-YNLSVVFKAKALNKAT  185

Query  592   PVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQ  771
             P+NL+ H YWN+GGH+SG++LS+ +QIFA HITP+D+  IPTG I  + NT +DFLKP++
Sbjct  186   PINLSHHPYWNIGGHNSGDVLSQVVQIFASHITPLDTQHIPTGIISPVKNTPYDFLKPRK  245

Query  772   VGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYT  951
             VGS++ K+     G+DINYA+D      T K K VA VYD++SG  M+IKATAPGVQFYT
Sbjct  246   VGSRIDKI---QNGYDINYALD-----STEKMKHVAIVYDKKSGREMDIKATAPGVQFYT  297

Query  952   ANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             AN + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H++  TF ++
Sbjct  298   ANWVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKSYVHSVLYTFTIK  356



>ref|XP_004232231.2| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=464

 Score =   425 bits (1093),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 267/358 (75%), Gaps = 17/358 (5%)
 Frame = +1

Query  76    LFLCFFISF---ALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI     A+ V+ Q    Y IKKGDFSVK+TNYGAR+ S+ LPDK+G + D+VLG
Sbjct  111   LLICLFILHLWAAVSVTEQKIGVYEIKKGDFSVKITNYGARIISVFLPDKHGVIGDVVLG  170

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT  EY+ D T+FGA++GRVANRIGGAQFTLNG  YKL ANDG NTLHGG  G S+V W
Sbjct  171   YDTTEEYKNDTTSFGALLGRVANRIGGAQFTLNGTLYKLVANDGANTLHGGINGFSRVVW  230

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
              V K+++      IT TY+S DG++GFPGD++  VTY +K+ PYKL V M A+ALNK TP
Sbjct  231   NVSKYQQDGPYPHITLTYHSVDGEEGFPGDLLVSVTYALKD-PYKLSVVMKAEALNKATP  289

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH+YWNLGGH+SG+ILS  +QIFA HITPVD +LIPTG+I  I NT +DFLKP++V
Sbjct  290   VNLAQHSYWNLGGHNSGDILSNVVQIFASHITPVDQSLIPTGKISPIKNTPYDFLKPREV  349

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GSQ+ +L     G+DINY +D      T K K VA VYDE+SG  M+++A+APGVQFYTA
Sbjct  350   GSQIKEL---QSGYDINYVLD-----STEKMKPVAIVYDEKSGRVMDVQASAPGVQFYTA  401

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N L   KGKG  VY+ HAALC ETQGFPDA+NHPNFPSTIVTP + Y H +  TF + 
Sbjct  402   NSLNQ-KGKGGYVYQPHAALCFETQGFPDAMNHPNFPSTIVTPGKAYIHKMLYTFSIM  458


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  76   LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
            L +CFFI      +G     Y IKKGDFSVK+TNYGAR+ S++LPDKNGK+ DIVLGYDT
Sbjct  7    LLICFFILHLWAATGHKIGIYEIKKGDFSVKVTNYGARIISVLLPDKNGKIGDIVLGYDT  66

Query  256  VMEY  267
            + EY
Sbjct  67   IGEY  70



>ref|XP_004147466.1| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
 ref|XP_004167479.1| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
Length=360

 Score =   419 bits (1077),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 267/366 (73%), Gaps = 20/366 (5%)
 Frame = +1

Query  70    APLFLCFFISFALIVSGQDNKF--------YVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             A LFL  F   AL V G  N +        + +K+GDFSVK TN+GA + SL++PDK+GK
Sbjct  2     AKLFLALFCVIALAVFGFANGYEKKGEIGIFELKRGDFSVKFTNWGATIVSLLVPDKHGK  61

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYD++ EY+ D T FG+IVGRVANRIGGA+FTL+G+ YKL AN+GNNTLHGG +
Sbjct  62    LDDVVLGYDSIQEYQNDTTYFGSIVGRVANRIGGAKFTLDGVLYKLIANEGNNTLHGGTR  121

Query  406   GISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNA  570
             G S V WKV K+++      I F+Y S DG++GFPGD++   TYT I +N  KL   MNA
Sbjct  122   GFSDVVWKVTKYQKDGRSPQIVFSYRSFDGEEGFPGDLLVTATYTLIAKNQLKLT--MNA  179

Query  571   KALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
             KALNKPTPVNLAQH YWNLGGH+SG+ILS  LQIF   IT VD NLIPTG++  +  T F
Sbjct  180   KALNKPTPVNLAQHTYWNLGGHNSGDILSNHLQIFGSRITVVDHNLIPTGKLEPVKGTPF  239

Query  751   DFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATA  930
             DFLKP+ VGS++ KLPK   G+DINYA+D  D  G  K K  A V+D++SG  +E+    
Sbjct  240   DFLKPRTVGSRINKLPK---GYDINYALD--DGTGEHKLKKAAVVHDKKSGRMLELSTNV  294

Query  931   PGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
             PGVQFYT N+++DVKGKG  VY++HAALCLETQGFPDAVNH NFPSTIVTP++PY H + 
Sbjct  295   PGVQFYTGNYIKDVKGKGGFVYQAHAALCLETQGFPDAVNHHNFPSTIVTPKKPYNHIML  354

Query  1111  ITFRVQ  1128
               F  +
Sbjct  355   FKFSTK  360



>gb|KGN59582.1| hypothetical protein Csa_3G827250 [Cucumis sativus]
Length=383

 Score =   419 bits (1078),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 267/366 (73%), Gaps = 20/366 (5%)
 Frame = +1

Query  70    APLFLCFFISFALIVSGQDNKF--------YVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             A LFL  F   AL V G  N +        + +K+GDFSVK TN+GA + SL++PDK+GK
Sbjct  25    AKLFLALFCVIALAVFGFANGYEKKGEIGIFELKRGDFSVKFTNWGATIVSLLVPDKHGK  84

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYD++ EY+ D T FG+IVGRVANRIGGA+FTL+G+ YKL AN+GNNTLHGG +
Sbjct  85    LDDVVLGYDSIQEYQNDTTYFGSIVGRVANRIGGAKFTLDGVLYKLIANEGNNTLHGGTR  144

Query  406   GISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNA  570
             G S V WKV K+++      I F+Y S DG++GFPGD++   TYT I +N  KL   MNA
Sbjct  145   GFSDVVWKVTKYQKDGRSPQIVFSYRSFDGEEGFPGDLLVTATYTLIAKNQLKLT--MNA  202

Query  571   KALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
             KALNKPTPVNLAQH YWNLGGH+SG+ILS  LQIF   IT VD NLIPTG++  +  T F
Sbjct  203   KALNKPTPVNLAQHTYWNLGGHNSGDILSNHLQIFGSRITVVDHNLIPTGKLEPVKGTPF  262

Query  751   DFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATA  930
             DFLKP+ VGS++ KLPK   G+DINYA+D  D  G  K K  A V+D++SG  +E+    
Sbjct  263   DFLKPRTVGSRINKLPK---GYDINYALD--DGTGEHKLKKAAVVHDKKSGRMLELSTNV  317

Query  931   PGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
             PGVQFYT N+++DVKGKG  VY++HAALCLETQGFPDAVNH NFPSTIVTP++PY H + 
Sbjct  318   PGVQFYTGNYIKDVKGKGGFVYQAHAALCLETQGFPDAVNHHNFPSTIVTPKKPYNHIML  377

Query  1111  ITFRVQ  1128
               F  +
Sbjct  378   FKFSTK  383



>gb|AAL09397.1|AF307094_1 non-cell-autonomous protein pathway1 [Nicotiana tabacum]
Length=357

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 266/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI     A  V G+    Y IKKGDFSVK+TNYGA + S+ LPDK+GK+ D+VLG
Sbjct  7     LLICLFILHLCAAASVRGRKIGIYEIKKGDFSVKITNYGASIISVFLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LHGG KG SKV W
Sbjct  67    YDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFSKVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V   A+ALNK TP
Sbjct  127   KVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVVFKARALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH++G++LS+ LQI+A HITP+D+  IPTG+I  + NT +DFLKP +V
Sbjct  186   INLSHHPYWNIGGHNTGDVLSQVLQIYASHITPLDNQHIPTGEISPVKNTPYDFLKPHKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ K+     G+DINYA+D      ++K K VA VYD++SG  M+IKATAPGVQFYTA
Sbjct  246   GSRINKI---QNGYDINYALD-----SSKKMKPVAIVYDKKSGRVMDIKATAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP +   H++  TF ++
Sbjct  298   NFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTNVHSVLYTFSIK  355



>ref|XP_004302346.1| PREDICTED: aldose 1-epimerase-like [Fragaria vesca subsp. vesca]
Length=365

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 260/362 (72%), Gaps = 20/362 (6%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK----------FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             + LC  I+  L+ SG  N            Y +KKGD SVK TN+GA + SLILPDKNGK
Sbjct  6     VLLCLVITI-LVASGFANGSGYEPKEKIGVYELKKGDLSVKFTNWGATIISLILPDKNGK  64

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYD+V EY+ D +  GAIVGRVANRIGGAQFTLNG HYKL AN+G N LHGG +
Sbjct  65    LADVVLGYDSVNEYKNDTSYIGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNILHGGLR  124

Query  406   GISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKVKK++      SI FTY+S DG+QGFPGDVI  VTYT+  +  +L +KM AK
Sbjct  125   GFSDVVWKVKKYKNGGHTPSIAFTYHSADGEQGFPGDVIVTVTYTLLGDK-QLSIKMKAK  183

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVNLAQH YWNLGGH+SGNILS+ +QIF   IT VD  LIPTG+   +  T +D
Sbjct  184   ALNKPTPVNLAQHTYWNLGGHNSGNILSQHVQIFGSKITLVDKGLIPTGKFASVKGTPYD  243

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKPQ VGS++ KL K + G+D+NY +DG       K K  A V+D +SG  +E+   AP
Sbjct  244   FLKPQVVGSRIDKL-KATKGYDVNYVLDG---PAGNKLKRAAVVHDSKSGRMLELSTNAP  299

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFYT+N+LQDVKGKG  VY+  AALCLETQGFPDAVNHPNFPSTIVTP + YKH +  
Sbjct  300   GMQFYTSNYLQDVKGKGGCVYQPRAALCLETQGFPDAVNHPNFPSTIVTPTKSYKHYMLF  359

Query  1114  TF  1119
              F
Sbjct  360   KF  361



>ref|XP_009624447.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
 ref|XP_009624448.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=357

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 265/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI     A  V G+    Y IKKGDFSVK+TNYGA + S+ LPDK+GK+ D+VLG
Sbjct  7     LLICLFILHLCAAASVRGRKIGIYEIKKGDFSVKITNYGASIISVFLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LHGG KG SKV W
Sbjct  67    YDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFSKVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V   A+ALNK TP
Sbjct  127   KVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVVFKARALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH++G++LS+ LQI+A HITP+D   IPTG+I  + NT +DFLKP +V
Sbjct  186   INLSHHPYWNIGGHNTGDVLSQVLQIYASHITPLDKQHIPTGEISPVKNTPYDFLKPHKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ K+     G+DINYA+D      ++K K VA VYD++SG  M+IKATAPGVQFYTA
Sbjct  246   GSRINKI---QNGYDINYALD-----SSKKMKPVAIVYDKKSGRVMDIKATAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP +   H++  TF ++
Sbjct  298   NFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTNVHSVLYTFSIK  355



>ref|XP_002282831.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
 emb|CBI22174.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   415 bits (1067),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 260/360 (72%), Gaps = 16/360 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSG-----QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             +F+CF        +G     +D   Y ++KGDFS K T +GA + S++LPDKNGKL D+V
Sbjct  6     VFVCFITLVFCFATGSVAKKEDGGIYELRKGDFSAKFTKWGAAIVSVVLPDKNGKLADVV  65

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LGYD+  EY+ D TNFGAIVGRVANRIGGAQFTLNG HYKL AN+G N LHGGPKG  KV
Sbjct  66    LGYDSAKEYKNDTTNFGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNMLHGGPKGFGKV  125

Query  421   YWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKP  588
              W+V K+++      I F+Y+S DG++GFPGD+IA VTY +  + Y+LIV M AKALNK 
Sbjct  126   AWRVSKYKKGGHSPYIMFSYHSLDGEEGFPGDLIATVTYMLVGD-YQLIVTMKAKALNKA  184

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVNLAQH YWNLGGH SG+ILS ++QIF  HITPVD  LIPTG+I+ +  T +DFLKP 
Sbjct  185   TPVNLAQHAYWNLGGHTSGDILSNEIQIFGSHITPVDKELIPTGKIVPVKGTPYDFLKPC  244

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              +GS++ KLP    GF+INY +   DD    K    A V+ ++SG  +E+   APG+QFY
Sbjct  245   TIGSKINKLPS---GFNINYVL---DDTAPNKVGLAAMVHHKKSGRMLELYTNAPGLQFY  298

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             T+N L+D KGKG  VY++HAALCLET+GFPD+VNHPNFPS IVTP + Y H++   F ++
Sbjct  299   TSNFLKDEKGKGGFVYQAHAALCLETEGFPDSVNHPNFPSQIVTPGKSYHHSMLFKFSIR  358



>ref|XP_010102873.1| Aldose 1-epimerase [Morus notabilis]
 gb|EXB94289.1| Aldose 1-epimerase [Morus notabilis]
Length=364

 Score =   415 bits (1066),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/363 (57%), Positives = 262/363 (72%), Gaps = 18/363 (5%)
 Frame = +1

Query  76    LFLCFFI---SFALIV-----SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
             + LCF I     ++++     + Q+   Y +KKGDFSV  TN+GA + SL+LPD+ GKL 
Sbjct  6     VLLCFIILAIGSSMVMPNVSSAKQEVHTYELKKGDFSVNFTNWGASIISLVLPDRYGKLA  65

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+VLGYD++ EY  D +  GA+VGR ANRIGGAQFTL G HY + AN+G NTLHGG +G 
Sbjct  66    DVVLGYDSLKEYMNDSSYIGAVVGRFANRIGGAQFTLEGKHYSVVANEGKNTLHGGKRGF  125

Query  412   SKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
             S V WKVKK++      SI FTY+S DG++GFPGD++  V YT+  +  +L VKM AKAL
Sbjct  126   SDVVWKVKKYDNEGDAPSIVFTYHSSDGEEGFPGDLLVSVKYTLFGDK-RLKVKMEAKAL  184

Query  580   NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFL  759
             NKPTPVNLAQH YWNLGGH+SG+ILS K++IFA HIT VDS LIPTG+   +  T +DFL
Sbjct  185   NKPTPVNLAQHTYWNLGGHNSGDILSNKIKIFASHITVVDSQLIPTGKFAPVKGTPYDFL  244

Query  760   KPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGV  939
             KP  VGS++ KLPK   G+DINY +DG      +K K VA VYD +SG  + +  +APGV
Sbjct  245   KPHLVGSRIKKLPK---GYDINYVLDG--PASDKKLKRVAVVYDSKSGRSLALSTSAPGV  299

Query  940   QFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             QFY+ N L+DVKGKG AVYE+HA LCLETQGFPDAVNHP+FPSTIV+P +PY H +   F
Sbjct  300   QFYSGNFLKDVKGKGGAVYEAHAGLCLETQGFPDAVNHPDFPSTIVSPGKPYNHVMLFKF  359

Query  1120  RVQ  1128
               +
Sbjct  360   STK  362



>ref|XP_007216505.1| hypothetical protein PRUPE_ppa024124mg [Prunus persica]
 gb|EMJ17704.1| hypothetical protein PRUPE_ppa024124mg [Prunus persica]
Length=366

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 211/365 (58%), Positives = 262/365 (72%), Gaps = 23/365 (6%)
 Frame = +1

Query  82    LCFFISFALI-------VSGQDNK-----FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             +C  + F L+       VSG + K      Y +KKGD SVK TN+GA + SL+ PDKNGK
Sbjct  4     ICVLLCFILLAASGFANVSGSEPKEKKVGIYELKKGDLSVKFTNWGATIISLVFPDKNGK  63

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYDT+ EY  D +  GAIVGRVANRIGGAQFTLNG HYKL AN+G N LHGG  
Sbjct  64    LADVVLGYDTIKEYTNDTSYIGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNVLHGGLI  123

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV+K++       I FTY+S DG++GFPGD++  V+YT+  +  +L VKM AK
Sbjct  124   GFSDVVWKVQKYQNEGDAPHIVFTYHSADGEEGFPGDLLVTVSYTLLGDK-QLSVKMKAK  182

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVNLAQH YWNLGGH+ G++LS+ ++IFA  IT VDS+LIPTG+   +  T +D
Sbjct  183   ALNKPTPVNLAQHTYWNLGGHNCGDVLSQYIKIFASQITLVDSHLIPTGKFASVKGTPYD  242

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP+ VGS++ KL   + G+DINY +DG       K K  A VYD++SG  +E+   AP
Sbjct  243   FLKPKAVGSRINKL---ASGYDINYVLDG---GAGNKLKPAAVVYDKKSGRVLELSTNAP  296

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFYT+N L+DVKGKG  VYE HAALCLETQGFPDAVNHPNFPSTIVTP++PYKH +  
Sbjct  297   GLQFYTSNFLKDVKGKGGFVYEPHAALCLETQGFPDAVNHPNFPSTIVTPKKPYKHNMLF  356

Query  1114  TFRVQ  1128
              F  +
Sbjct  357   KFSTK  361



>gb|AAB94619.1| aldose-1-epimerase-like protein [Nicotiana tabacum]
Length=356

 Score =   412 bits (1059),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 210/358 (59%), Positives = 262/358 (73%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI   L+   V G     Y IKKGDFSVK+TNYG  + S++LPDK+GK+ D+VLG
Sbjct  7     LLVCLFIFHLLVAASVRGHKIGIYEIKKGDFSVKITNYGTSIISVLLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPKG SKV W
Sbjct  67    YDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+ +      IT TYYS DG++GFPG V+A VTYT+K++ YKL V   AKALNK TP
Sbjct  127   KVSKYVKDGPCPYITLTYYSADGEEGFPGAVLASVTYTLKDS-YKLSVVFRAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGHDSG++LS+ LQIF  HIT VD  LIPTG+I  I NT +DFLKP++V
Sbjct  186   INLSHHPYWNIGGHDSGDVLSQVLQIFGSHITLVDKQLIPTGEIAPIKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ KL     G+DINY +D      T K K V  VYD++SG  M+++A++PGVQFYTA
Sbjct  246   GSRINKL---KNGYDINYVLD-----STEKMKPVGIVYDKKSGRVMDVQASSPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + + KGKG  VY+ H+AL LET  FPDAVNHPNFPSTIV P + Y H++  TF ++
Sbjct  298   NFVNNTKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTIVNPGEKYVHSVLYTFSIK  355



>ref|XP_009779458.1| PREDICTED: aldose 1-epimerase-like isoform X7 [Nicotiana sylvestris]
Length=356

 Score =   412 bits (1058),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 262/358 (73%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C  I   L+   V G     Y IKKGDFSVK+TNYGA + S++LPDK+GK+ D+VLG
Sbjct  7     LLVCLIIFHLLVAASVRGHKIGIYEIKKGDFSVKITNYGASIISVLLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPKG SKV W
Sbjct  67    YDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+ +      IT TYYS DG++GFPG V+A VTYT+K++ YKL V   AKALNK TP
Sbjct  127   KVSKYVKDGPWPYITLTYYSADGEEGFPGAVLASVTYTLKDS-YKLSVVFRAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGHDSG++LS+ LQIF  HIT VD  LIPTG+I  + NT +DFLKP++V
Sbjct  186   INLSHHPYWNIGGHDSGDVLSQVLQIFGSHITLVDKQLIPTGEIAPVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ KL     G+DINY +D      T K K V  VYD++SG  M+++A+APGVQFYTA
Sbjct  246   GSRINKL---KNGYDINYVLD-----STEKMKPVGIVYDKKSGRVMDVQASAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + + KGKG  VY+ H+AL LET  FPDAVNHPNFPST+V P + Y H++  TF ++
Sbjct  298   NFVNNTKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTVVNPGEKYVHSVLYTFSIK  355



>ref|XP_008230742.1| PREDICTED: aldose 1-epimerase-like [Prunus mume]
Length=366

 Score =   412 bits (1058),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 211/365 (58%), Positives = 262/365 (72%), Gaps = 23/365 (6%)
 Frame = +1

Query  82    LCFFISFALI-------VSGQDNK-----FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             +C  + F L+       VSG + K      Y +KKGD SVK TN+GA + SL+ PDKNGK
Sbjct  4     ICVLLCFILLAASGFANVSGSEPKEKKVGIYELKKGDLSVKFTNWGATIISLVFPDKNGK  63

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYDT+ EY  D +  GAIVGRVANRIGGAQFTLNG HYKL AN+G N LHGG  
Sbjct  64    LADVVLGYDTIKEYTNDTSYIGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNILHGGLI  123

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV+K++       I FTY+S DG++GFPGD++  V+YT+  +  +L VKM AK
Sbjct  124   GFSDVVWKVQKYQNEGDAPHIVFTYHSADGEEGFPGDLLVTVSYTLLGDK-QLSVKMKAK  182

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVNLAQH YWNLGGH+SG++LS+ ++IFA  IT VDS+LIPTG+   +  T +D
Sbjct  183   ALNKPTPVNLAQHTYWNLGGHNSGDVLSQYIKIFASQITLVDSHLIPTGKFASVKGTPYD  242

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLK + VGS++ KL   + G+DINY +DG       K K  A VYD++SG  +E+   AP
Sbjct  243   FLKSKAVGSRINKL---ASGYDINYVLDG---GAGNKLKPAAVVYDKKSGRVLELSTNAP  296

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFYT+N L+DVKGKG  VYE HAALCLETQGFPDAVNHPNFPSTIVTP++PYKH +  
Sbjct  297   GLQFYTSNSLKDVKGKGGFVYEPHAALCLETQGFPDAVNHPNFPSTIVTPKKPYKHNMLF  356

Query  1114  TFRVQ  1128
              F  +
Sbjct  357   KFSTK  361



>ref|XP_008443423.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=383

 Score =   412 bits (1059),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 209/365 (57%), Positives = 264/365 (72%), Gaps = 18/365 (5%)
 Frame = +1

Query  70    APLFLCFFISFALIVSGQDNKF--------YVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             A  FL  F   AL V G  N +        + +K+GDFSVK TN+GA + SL++PDK+GK
Sbjct  25    AKFFLALFCVVALAVFGFANGYEKKGEIGIFELKRGDFSVKFTNWGATIVSLLVPDKHGK  84

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYD++ EY+ D   FG+IVGRVANRIGGA+FTL+G+ YKL AN+GNNTLHGG +
Sbjct  85    LDDVVLGYDSIQEYQNDTAYFGSIVGRVANRIGGAKFTLDGVLYKLIANEGNNTLHGGTR  144

Query  406   GISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV K+++      I F+Y S DG++GFPGD++   TYT+  N  +L + M+AK
Sbjct  145   GFSDVVWKVTKYQKDGSSPQIVFSYRSFDGEEGFPGDLLVTATYTLIANN-QLKLTMHAK  203

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVNLAQH YWNLGGH+SG+ILS  LQIF   IT VD NLIPTG++  +  T FD
Sbjct  204   ALNKPTPVNLAQHTYWNLGGHNSGDILSNHLQIFGSRITVVDHNLIPTGKLEPVKGTPFD  263

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP+ VGS++ KLPK   G+DINYA+D  D     K K  A V+D++SG  +E+    P
Sbjct  264   FLKPRMVGSRINKLPK---GYDINYALD--DGTREHKLKKAAVVHDKKSGRMLELSTNVP  318

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQ YT N+++DVKGKG  VY++HAALCLETQGFPDAVNH NFPSTIVTP++PYKH +  
Sbjct  319   GVQLYTGNYIKDVKGKGGFVYQAHAALCLETQGFPDAVNHHNFPSTIVTPKKPYKHIMLF  378

Query  1114  TFRVQ  1128
              F  +
Sbjct  379   KFSTK  383



>emb|CBA10127.1| non-cell-autonomous protein pathway [Nicotiana benthamiana]
Length=357

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 264/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVS---GQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI     VS   G+      IKKGDFSVK+TNYGA + S+ LPDK+GK+ D+VLG
Sbjct  8     LLICLFILHLCAVSSVRGRKIGICEIKKGDFSVKITNYGATIISVFLPDKHGKIGDVVLG  67

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNG  +KL AN+G N LHGG KG SKV W
Sbjct  68    YDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTLFKLVANEGVNMLHGGLKGFSKVVW  127

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+        IT TYY+ DG++GFPGDV+A VTY +K+ PYKL V   A++LNK TP
Sbjct  128   KVSKYVRHGPSPYITLTYYNADGEEGFPGDVLASVTYALKD-PYKLSVVFKARSLNKATP  186

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + NT +DFLKP +V
Sbjct  187   INLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKNTPYDFLKPHKV  246

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ K+     G+DINYA+D      ++K K VA VYD++SG  M I+ATAPGVQFYTA
Sbjct  247   GSRIDKI---QNGYDINYALD-----SSKKMKPVAIVYDKKSGRVMNIQATAPGVQFYTA  298

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H++  TF ++
Sbjct  299   NFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLHSVLYTFSIK  356



>emb|CDP18771.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/366 (57%), Positives = 267/366 (73%), Gaps = 13/366 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKL  228
             MS +S  L L     F ++V+G +++   Y +KKGDFS+K+TN+GAR+ SL+LPDKNGK 
Sbjct  1     MSKLSFLLCLILATIFVVVVNGSESEVGIYELKKGDFSLKVTNFGARIISLVLPDKNGKP  60

Query  229   TDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKG  408
             TD+VLGYD+V EY  D   FGAIVGRV NRIGGAQFTLNG+HYKL+AN+  N LHGG KG
Sbjct  61    TDVVLGYDSVKEYLNDTQYFGAIVGRVVNRIGGAQFTLNGVHYKLDANEKPNMLHGGRKG  120

Query  409   ISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKA  576
              S + W V+K+ +      I  +YYS DG++GFPG+++  VTY + E PYKL V M A+A
Sbjct  121   FSLLTWNVEKYVKDRANPFIVLSYYSPDGEEGFPGNLLVRVTYALLE-PYKLSVIMEAEA  179

Query  577   LNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDF  756
             LNK TPVNLAQH+YWNLGGH+SG++LS+K+QIF  H TP ++ LIPTG+IL +  T +DF
Sbjct  180   LNKATPVNLAQHSYWNLGGHNSGDVLSDKVQIFGLHYTPANNQLIPTGEILPVKGTPYDF  239

Query  757   LKPQQVGSQMAKLPKGSG--GFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATA  930
             LKP ++ SQM  LP G    G+++NYA+D   D    K K  A  Y +++GIGM I  +A
Sbjct  240   LKPHKIQSQMKGLPSGGAPSGYNVNYALDEGKD---HKLKLAAIAYSKKTGIGMMISTSA  296

Query  931   PGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
             PG+QFYTAN+L +V GKG  VY+SHAA C ETQGFPDAVNHPNFPSTIV P   Y H + 
Sbjct  297   PGLQFYTANYL-NVTGKGGYVYQSHAAYCFETQGFPDAVNHPNFPSTIVNPGDLYVHNML  355

Query  1111  ITFRVQ  1128
             + F+++
Sbjct  356   VEFKIK  361



>ref|XP_009624446.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 261/358 (73%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L +C FI   L    V G     Y IKKGDFSVK+TNYGA + S++LPDK+GK+ D+VLG
Sbjct  7     LLVCLFIFHLLAAASVRGHKIGIYEIKKGDFSVKITNYGATIISVLLPDKHGKIGDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPKG SKV W
Sbjct  67    YDTIQEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+ + S    IT TYYS DG++GFPG V+A VTY +K+ PYKL V   AKALNK TP
Sbjct  127   KVSKYVKDSPSPYITLTYYSADGEEGFPGAVLASVTYALKD-PYKLSVVFRAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH+SG++LS+ LQIF  HIT VD  LIPTG+I  + NT +DFLKP++V
Sbjct  186   INLSHHPYWNIGGHNSGDVLSQVLQIFGSHITLVDKQLIPTGEIAPVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
              S++ KL     G+DINY +D        K K V  VYD++SG  M+++A+APGVQFYTA
Sbjct  246   RSRINKL---KNGYDINYVLD-----SNEKMKPVGIVYDKKSGRVMDVQASAPGVQFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + ++KGKG  VY+ H+AL LET  FPDAVNHPNFPSTIV P + Y H++  TF ++
Sbjct  298   NGVNNIKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTIVNPGEKYVHSVLYTFSIK  355



>gb|EYU34099.1| hypothetical protein MIMGU_mgv1a008692mg [Erythranthe guttata]
Length=365

 Score =   410 bits (1053),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/358 (59%), Positives = 263/358 (73%), Gaps = 11/358 (3%)
 Frame = +1

Query  76    LFLCFFISFALIV---SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             L  CF I     V   +G     Y IKKGDFSVK+TNYGAR+ S++LPDKNGKL D+VLG
Sbjct  11    LISCFVIVLGFGVVFGNGDGLNIYEIKKGDFSVKITNYGARIVSVVLPDKNGKLADVVLG  70

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ +Y  D   FGAIVGRV NRIGGA+FTLNG  YKL+AN+G + LHGG KG S+V W
Sbjct  71    YDTIKDYMNDTCYFGAIVGRVGNRIGGAKFTLNGTVYKLDANEGTSMLHGGKKGFSQVAW  130

Query  427   KVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KVK H ++    SIT TY+S DG++GFPGDV+  VTY I E PYKL VKM AKA  K TP
Sbjct  131   KVKNHVKNGPSPSITLTYHSVDGEEGFPGDVLTSVTYAIIE-PYKLSVKMKAKASKKATP  189

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             VNLAQH+YWNLGGH++GNILS++LQIFA HITPVD  LIPTG+ + +  T +DFL+P+ +
Sbjct  190   VNLAQHSYWNLGGHNTGNILSDELQIFASHITPVDKKLIPTGKFVSVKATPYDFLEPRVI  249

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
                + +LP GS G+DINY VDG + +   K K +A VY+++SG  M++ A  PGVQ YT 
Sbjct  250   KGPIKELPNGSRGYDINYVVDGRNGL---KMKPIAVVYNKKSGRVMKLSANTPGVQLYTG  306

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N++ DV+GK   VY+ HAALCLETQGFPD+VNHPNFPS IV P + Y+H +  TF ++
Sbjct  307   NYINDVRGKNGYVYKPHAALCLETQGFPDSVNHPNFPSQIVYPGKSYRHYMMFTFSIK  364



>emb|CDP02212.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/350 (57%), Positives = 263/350 (75%), Gaps = 11/350 (3%)
 Frame = +1

Query  97    SFALIVSGQDN--KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYE  270
             +F ++V+G ++  + Y +KKGDFS+K+TN+GAR+ S++LPDKNGK  DIVLGYD+V +Y 
Sbjct  16    TFRVVVNGSESGLEIYELKKGDFSLKVTNFGARIMSVVLPDKNGKPADIVLGYDSVKDYL  75

Query  271   QDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES  450
              D   FGA+VGRVANRIGGAQFTLNG+HYKL+AN+  N LHGG KG S++ WKV+++ + 
Sbjct  76    NDTAYFGAVVGRVANRIGGAQFTLNGVHYKLDANEKQNMLHGGKKGFSQLIWKVEEYVKD  135

Query  451   S----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNY  618
                  I F YYS DG++GFPG+++  V+Y + E PYKL V M A+ALNK TPVNLAQH+Y
Sbjct  136   DANPFIVFAYYSLDGEEGFPGNLLVRVSYALLE-PYKLRVIMEAEALNKATPVNLAQHSY  194

Query  619   WNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLP  798
             WNLGGH+SG++LS+++QIFA H TPV++ LIPTG+I  +  T +DFLKP  +GSQ+ +LP
Sbjct  195   WNLGGHNSGDVLSDEVQIFASHFTPVNNQLIPTGKISPVKGTPYDFLKPHTIGSQINQLP  254

Query  799   KGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKG  978
                 GFDINYA+DG  D     K  V   + +++GIGM+I  +APG+QFYTANHL+DV G
Sbjct  255   S---GFDINYALDGGGDEDNDMKVAVI-AHSKKTGIGMKISTSAPGLQFYTANHLKDVTG  310

Query  979   KGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             K   VY++HAA C ETQGFPD+VNHPNFPS IV P   Y H +   F+ +
Sbjct  311   KSGYVYQAHAAYCFETQGFPDSVNHPNFPSQIVNPGDVYTHYILYEFKTK  360



>ref|XP_003621162.1| Aldose 1-epimerase [Medicago truncatula]
 gb|AES77380.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=362

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 262/359 (73%), Gaps = 13/359 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             L LC  I     V+G D K     + +KKG  S+K+TN+GA + SL+LPDKNGKL DIVL
Sbjct  7     LLLCLLIVAFGFVNGSDEKEKVGIFELKKGGLSLKVTNWGASIVSLVLPDKNGKLADIVL  66

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GYD++ EY  D T FGA VGRVANRIGGAQF LNG HYKL AN+GNNTLHGG +G S V 
Sbjct  67    GYDSIKEYTNDSTYFGATVGRVANRIGGAQFNLNGKHYKLVANEGNNTLHGGSRGFSDVI  126

Query  424   WKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPT  591
             WKVK++++     S+TFTY+S DG++GFPGD++A V+Y I     +L++ M AKALNKPT
Sbjct  127   WKVKRYQKEGPSPSVTFTYHSFDGEEGFPGDLLATVSY-ILTGKNQLVIIMKAKALNKPT  185

Query  592   PVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQ  771
             PVNLA H YWN+GG +SGNIL+E +QIF    T VD  LIPTG+   +  TA+DFLKPQ 
Sbjct  186   PVNLANHAYWNIGGQNSGNILNEVIQIFGSKTTIVDDKLIPTGKFASVKGTAYDFLKPQI  245

Query  772   VGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYT  951
             +GS++++L +   G+DINY +DG      +K K  AKV+D++SG  +E+   APG+QFYT
Sbjct  246   IGSRISQLAQHK-GYDINYVLDGEKG---KKIKLAAKVHDKKSGRILELYTNAPGLQFYT  301

Query  952   ANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
              N+++DVKGK   VY++HA LCLE+Q FPD+VNHPNFPSTIVTP++PYKH +   F  +
Sbjct  302   GNYIKDVKGKSGYVYKAHAGLCLESQAFPDSVNHPNFPSTIVTPEKPYKHYMLFKFSTK  360



>ref|XP_009779460.1| PREDICTED: aldose 1-epimerase-like isoform X9 [Nicotiana sylvestris]
Length=356

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 264/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISF---ALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             + +CFFI     A  V G+    Y IKKGDFSVK+TNYGAR+ S++LPDK+GK+ D+V G
Sbjct  7     VLICFFILHLWAATSVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGKIGDVVSG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YD + EY+ D   FGA++GRV NRIGGAQFTLNG  YKL  N+GNNT+HGGPKG S V W
Sbjct  67    YDAIEEYKNDTRYFGALLGRVVNRIGGAQFTLNGTLYKLIPNEGNNTIHGGPKGFSYVVW  126

Query  427   KVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+ +      IT TY+S DG++GFPGDV+A VT+ +K+ PYKL V   AKALNK TP
Sbjct  127   KVSKYVQDGPCPCITLTYHSADGEEGFPGDVLASVTFALKD-PYKLSVVFRAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH+SG++LS+ +QIFA +ITPVD  LIPTG+I  + NT +DFLKP++V
Sbjct  186   INLSHHPYWNIGGHNSGDVLSQVVQIFASNITPVDEQLIPTGEIAPVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ K+ +   G+D NY +D        K K VA VYD++SG  M+IKATAP V FYTA
Sbjct  246   GSRIDKIDR---GYDRNYVLD-----SNEKMKPVAIVYDKKSGRVMDIKATAPCVHFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + DVKGKG  VY+ H++L LETQG+PDAVNHPNFPSTIV P + Y H++  TF ++
Sbjct  298   NWVIDVKGKGGYVYQPHSSLSLETQGYPDAVNHPNFPSTIVNPGKTYTHSVLYTFSIK  355



>ref|XP_003534458.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
 gb|KHN11594.1| Aldose 1-epimerase [Glycine soja]
Length=371

 Score =   406 bits (1044),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 268/372 (72%), Gaps = 22/372 (6%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNKFYVIKK----------GDFSVKLTNYGARVASLI  204
             M+ I   L LC  I+ +   SG  N F V KK          GD S+K+TN+GA + SL+
Sbjct  1     MTKIFFVLLLCLIIAAS---SGFVNCFDVEKKEKIGIFELNKGDLSLKVTNWGASILSLV  57

Query  205   LPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNN  384
             +PDKNGKL+D+VLGYD+V +Y  D T FGA VGRVANRIGGAQFTLNGIHYKL AN+GNN
Sbjct  58    IPDKNGKLSDVVLGYDSVKDYTNDTTYFGATVGRVANRIGGAQFTLNGIHYKLVANEGNN  117

Query  385   TLHGGPKGISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKL  552
             TLHGG +G S V WKVK++++     SITF+Y+S DG+QGFPGD++  V+Y I     +L
Sbjct  118   TLHGGARGFSDVLWKVKRYQKEGPSPSITFSYHSIDGEQGFPGDLLVTVSY-ILTGKNQL  176

Query  553   IVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILL  732
             ++ M  K LNKPTPVNLA H YWNLGGH+SGNIL+E +QIF   ITPVDS LIPTG+   
Sbjct  177   VILMKGKTLNKPTPVNLANHAYWNLGGHNSGNILNEVVQIFGSKITPVDSKLIPTGKFAS  236

Query  733   INNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGM  912
             +  TA+DFLKPQ VGS++ +L + + G+DINY +DG      +K K  A V D++SG  +
Sbjct  237   VKGTAYDFLKPQTVGSRINQLAE-TKGYDINYVLDGEKG---QKIKLAAIVQDKKSGRVL  292

Query  913   EIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQP  1092
             E+   APG+QFYT N+++D+KGKG  VY+SH+ LCLE+Q FPD+VN PNFPSTIVTP++P
Sbjct  293   ELFTNAPGLQFYTGNYVKDLKGKGGYVYQSHSGLCLESQAFPDSVNQPNFPSTIVTPEKP  352

Query  1093  YKHTLHITFRVQ  1128
             YKH +   F  +
Sbjct  353   YKHYMLFKFSTK  364



>gb|KHN13632.1| Aldose 1-epimerase [Glycine soja]
Length=371

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 267/369 (72%), Gaps = 16/369 (4%)
 Frame = +1

Query  55    MSIISAPLFLCF-------FISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPD  213
             M+ I   L LC        F++ + +   +    + +KKGD S+++TN+GA + SL++PD
Sbjct  1     MTKIFFVLLLCLIIASSSGFVNCSDVEKEEKIGIFELKKGDLSLRVTNWGASILSLVIPD  60

Query  214   KNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLH  393
             KNGKL D+VLGYD+V +Y  D T FGA VGRVANRIGGAQFTLNGI+YKL AN+GNNTLH
Sbjct  61    KNGKLGDVVLGYDSVKDYSNDTTYFGATVGRVANRIGGAQFTLNGIYYKLVANEGNNTLH  120

Query  394   GGPKGISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVK  561
             GG +G S V WKVK++++     SITF+Y+S DG+QGFPGD++  V+Y I     +L++ 
Sbjct  121   GGARGFSDVLWKVKRYQKEGPSPSITFSYHSADGEQGFPGDLLVTVSY-ILTGKNQLVIL  179

Query  562   MNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINN  741
             M  KALNKPTPVNLA H YWNLGGH+SGNIL+E +QIF   ITPVD+ LIPTG+   +  
Sbjct  180   MKGKALNKPTPVNLANHAYWNLGGHNSGNILNEVVQIFGSKITPVDNKLIPTGKFASVKG  239

Query  742   TAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIK  921
             TA+DFLKPQ VGS++ +L  G+ G+DINY +DG      +K K  A V D++SG  +E+ 
Sbjct  240   TAYDFLKPQTVGSRINQLA-GTKGYDINYVIDGEKG---QKIKLAAIVQDKKSGRVLELF  295

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
               APG+QFYT N+++D+KGKG  VY +HA LCLE+Q FPD+VNHPNFPSTIVT ++PYKH
Sbjct  296   TNAPGLQFYTGNYIKDLKGKGGYVYNAHAGLCLESQAFPDSVNHPNFPSTIVTQEKPYKH  355

Query  1102  TLHITFRVQ  1128
              +   F  +
Sbjct  356   YMLFKFSTK  364



>ref|XP_009624445.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/358 (57%), Positives = 263/358 (73%), Gaps = 16/358 (4%)
 Frame = +1

Query  76    LFLCFFISF---ALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             + +C FI     A  V+G+    Y IKKGD SVK+TNYGAR+ S++LPDK+GK+ D+V G
Sbjct  7     VLICLFILHLWAATSVTGRKIGIYEIKKGDLSVKITNYGARIISVLLPDKHGKIGDVVSG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             YDT+ EY+ D   FGA++GRV NRIGGAQFTLNG  YKL  N+GNNT+HGGPKG S V W
Sbjct  67    YDTIEEYKNDTRYFGALLGRVVNRIGGAQFTLNGTLYKLVPNEGNNTIHGGPKGFSYVVW  126

Query  427   KVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV K+ +      IT TY+S DG++GFPGDV+A VTY +K+ PYKL V   AKALNK TP
Sbjct  127   KVSKYVQDGLCPCITLTYHSADGEEGFPGDVLASVTYALKD-PYKLSVVFKAKALNKATP  185

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWN+GGH+SG++LS+ +QIF+ HITPVD  LIPTG+I  + NT +DFLKP++V
Sbjct  186   INLSHHPYWNIGGHNSGDVLSQVVQIFSSHITPVDEQLIPTGEIARVKNTPYDFLKPRKV  245

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ K+ +   G+D NY +D        K K VA VYD++SG  M+I+ATAP V FYTA
Sbjct  246   GSRIDKIDR---GYDRNYVLD-----SNEKMKPVAIVYDKKSGRVMDIQATAPCVHFYTA  297

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             N + DVKGKG  VY+ H++L LETQG+PDAVNHPNFPSTIV   + Y H++  TF ++
Sbjct  298   NWVIDVKGKGGYVYQPHSSLSLETQGYPDAVNHPNFPSTIVNSGKTYAHSVLYTFSIK  355



>ref|XP_004232229.1| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=355

 Score =   403 bits (1036),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 253/355 (71%), Gaps = 13/355 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
             LF+C FI   L  +      Y +KKGDF+VK+T+YGAR+ S++LPDKNGK+ D+VLGYDT
Sbjct  9     LFICLFIFHLLFAASVKIGIYELKKGDFAVKITDYGARIISVLLPDKNGKIDDVVLGYDT  68

Query  256   VMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVK  435
             + EY  D + FGA VGRVANRIGGAQFTLNG HYKL  N+G N LHGG KG SKV WKV 
Sbjct  69    IDEYLNDTSYFGATVGRVANRIGGAQFTLNGTHYKLVPNEGKNMLHGGTKGFSKVVWKVS  128

Query  436   KH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
             K+        IT TY+S DG++GFPG V+A VT+ +K+ PYKL V   AKALNK TP+NL
Sbjct  129   KYVRYGPSPYITLTYFSADGEEGFPGAVLASVTFALKD-PYKLSVVFKAKALNKATPINL  187

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             + H YWN+GGH SGNILS  +QIF  HIT VD  LIPTG+I  + NT +DFLKP  VGS+
Sbjct  188   SHHPYWNIGGHTSGNILSNVIQIFGSHITLVDKELIPTGEIAPVKNTPYDFLKPHTVGSR  247

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
             + KL     G+DINYA+D      + K K V +VYD++SG  M +KA+APGVQFYT+N  
Sbjct  248   IKKL---QNGYDINYALD-----SSAKMKPVGRVYDKKSGRVMSVKASAPGVQFYTSNWD  299

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +  KGKG  +Y  HAAL LET  FPDAVNHPNFPS+IV P + Y H++  TF ++
Sbjct  300   KSKKGKGGFMYPPHAALALETLVFPDAVNHPNFPSSIVNPGERYVHSVLYTFSIK  354



>ref|XP_006338468.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=355

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/355 (57%), Positives = 252/355 (71%), Gaps = 13/355 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
             LF+C FI   L  +      Y +KKGDFS+K+T+YGA + S++LPDKNGK+ D+VLGYDT
Sbjct  9     LFICLFIFHLLFAASVKIGIYELKKGDFSIKITDYGATIISVLLPDKNGKIDDVVLGYDT  68

Query  256   VMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVK  435
             + EY  D + FGA +GRVANRIGGAQFTLNG HYKL  N+G N +HGGPKG SKV WKV 
Sbjct  69    IKEYLNDTSYFGATLGRVANRIGGAQFTLNGTHYKLVPNEGKNMIHGGPKGFSKVVWKVS  128

Query  436   KHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
             K+ +      IT TY+S DG++GFPG V+A VT+ +K+ PYKL V   AKALNK TP+NL
Sbjct  129   KYVQDGPSPYITLTYFSADGEEGFPGAVLASVTFALKD-PYKLSVVFKAKALNKATPINL  187

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             + H YWN+GGH SG+ILS  +QIF  HIT VD  LIPTG+I  + NT +DFLKP  VGS+
Sbjct  188   SHHPYWNIGGHTSGDILSNVIQIFGSHITLVDKELIPTGEIAPVKNTPYDFLKPHTVGSR  247

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
             + KL     G+DINYA+D      T K K V  VYD++SG  M +KA+APGVQFYT+N  
Sbjct  248   INKL---QNGYDINYALD-----STAKMKPVGVVYDKKSGRMMNVKASAPGVQFYTSNWD  299

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +  KGKG  +Y  HAAL LET  FPDAVNHPNFPS+IV P   Y H++  TF ++
Sbjct  300   KSKKGKGGFMYPPHAALALETLVFPDAVNHPNFPSSIVNPGDRYVHSVLYTFSIK  354



>ref|XP_010242446.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=364

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 256/358 (72%), Gaps = 17/358 (5%)
 Frame = +1

Query  79    FLCF-FISFALIVSGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
              LCF F++FAL+     N+     Y IKKG+F V LTN+GAR+ S++LPDK G L DIVL
Sbjct  7     LLCFIFVAFALLHVSSANEANVGIYQIKKGNFYVNLTNWGARITSIVLPDKQGNLGDIVL  66

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GYDT+ EY+ D + FGAIVGRVANRI GAQFTLN   Y L ANDG NTLHGG KG S V 
Sbjct  67    GYDTLDEYKTDTSYFGAIVGRVANRIKGAQFTLNDTTYNLVANDGKNTLHGGQKGFSDVV  126

Query  424   WKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIK-ENPYKLIVKMNAKALNKP  588
             W+VKKH  +S    + F Y S DG+QGFPG VI  V Y I  EN  +L V M AKALNK 
Sbjct  127   WQVKKHSPASHCPYVRFHYQSADGEQGFPGKVIVSVNYMITVEN--QLSVTMKAKALNKA  184

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVNLAQH YWNLGGH+SG+ILSE LQIFA   TPVDS LIPTG+I  +  T +DF +PQ
Sbjct  185   TPVNLAQHTYWNLGGHNSGDILSETLQIFASQYTPVDSELIPTGEIAPVKGTPYDFGEPQ  244

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              VGS++ +LP    G+DINY VD   + G R  K  A + D +SG  ME++ +APG+Q Y
Sbjct  245   TVGSRIDQLPN---GYDINYVVDA--EGGPRTMKKAAILSDSKSGRVMELRTSAPGLQLY  299

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFR  1122
             TA+ L+D+KGK  AVY+ HA LCLETQGFPD+++HP+FPS I+TP++ YKH +  TF+
Sbjct  300   TADKLKDIKGKNGAVYKPHAGLCLETQGFPDSLHHPDFPSQIITPKKTYKHFILYTFK  357



>ref|XP_006482556.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=362

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 208/363 (57%), Positives = 259/363 (71%), Gaps = 19/363 (5%)
 Frame = +1

Query  64    ISAPLFLCF--FISFALIVSGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             + + L LCF   ++F  +V G         Y +KKG+FSVKLTN+GA + S++LPDKNGK
Sbjct  1     MRSSLVLCFVVLVAFGFVVHGSVASNAVGVYDLKKGNFSVKLTNWGATLISVVLPDKNGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+ LGYD+V +Y+ D +  GA VGRVANRIGGAQFTL+GIHYKL AN+G N LHGG  
Sbjct  61    LIDVALGYDSVNDYKNDSSYIGATVGRVANRIGGAQFTLDGIHYKLVANEGKNMLHGGKI  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV+K++       I F Y S DG+QGFPGD+   V YT+  +  +L V M AK
Sbjct  121   GFSDVVWKVEKYQNEGHAPHIIFAYRSYDGEQGFPGDLSVTVGYTLVGDK-QLRVTMKAK  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNK TPVNLAQH YWNLGGH+SG+ILSE++QIFA + TPVDS LIPTG I+ +  T +D
Sbjct  180   ALNKATPVNLAQHTYWNLGGHNSGDILSEEIQIFASYFTPVDSQLIPTGHIVSVKGTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP  VGS++ KLP    G+DINY ++        K K VA V+D++SGI M++    P
Sbjct  240   FLKPHIVGSRIDKLPH---GYDINYVLEAGSG---NKMKKVAVVHDKKSGIVMKLTTNQP  293

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYTAN L++VKGKG  VY+ HAALCLETQ FPD+VNHPNFPSTIV P + YKH  H+
Sbjct  294   GVQFYTANSLKNVKGKGGFVYQPHAALCLETQAFPDSVNHPNFPSTIVNPGETYKH--HM  351

Query  1114  TFR  1122
              F+
Sbjct  352   VFK  354



>ref|XP_010256788.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=359

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 251/341 (74%), Gaps = 9/341 (3%)
 Frame = +1

Query  109   IVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF  288
             I S    K Y IKKG+FSVKLTN+GA + S+++PDKNGKL DIVLGYDT+  Y+ D + F
Sbjct  20    ISSAHGVKVYEIKKGNFSVKLTNWGATILSVVVPDKNGKLDDIVLGYDTLEAYKNDTSYF  79

Query  289   GAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSI  456
             GAIVGRVANRIG AQFTLNG  YKL AN+G NTLHGG +G S V WKV ++        +
Sbjct  80    GAIVGRVANRIGRAQFTLNGTTYKLVANEGKNTLHGGVRGFSDVLWKVIRYVPEGHSPHV  139

Query  457   TFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGH  636
             TF Y S DGDQGFPG+++  V+YTI +    L V M AKA++K TPVNLAQH YWNLGGH
Sbjct  140   TFVYRSPDGDQGFPGNLLTTVSYTI-DGEETLSVTMTAKAMDKATPVNLAQHTYWNLGGH  198

Query  637   DSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGF  816
              SG+ILSE +QIF   IT +DS LIPTG+I  +  T +DF++P+ VGS++ +L   S G+
Sbjct  199   KSGDILSETVQIFGSQITLLDSQLIPTGKIAPVKGTPYDFMQPRTVGSRIKQL---SNGY  255

Query  817   DINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVY  996
             DINY +D  D+VG  + K  A VYD RSG  ME++ +APGVQFYTAN+L+D KGK  AVY
Sbjct  256   DINYVLD-VDEVGDDQLKKAATVYDSRSGRMMELRTSAPGVQFYTANNLKDTKGKDGAVY  314

Query  997   ESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             ++HA LCLET GFPD+VNHPNFPSTIV P + Y+H +  TF
Sbjct  315   KAHAGLCLETGGFPDSVNHPNFPSTIVVPGKLYQHLMLYTF  355



>gb|KDO72518.1| hypothetical protein CISIN_1g017992mg [Citrus sinensis]
Length=362

 Score =   399 bits (1024),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 206/363 (57%), Positives = 259/363 (71%), Gaps = 19/363 (5%)
 Frame = +1

Query  64    ISAPLFLCF--FISFALIVSGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             + + L LCF   ++F  +V G         Y +KKG+FSVKLTN+GA + S++LPDK+GK
Sbjct  1     MRSSLVLCFVVLVAFGFVVHGSVASNAVGVYDLKKGNFSVKLTNWGATLISVVLPDKHGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+ LGYD+V +Y+ D +  GA VGRVANRIGGAQFTL+GIHYKL AN+G N LHGG  
Sbjct  61    LIDVALGYDSVNDYKNDSSYIGATVGRVANRIGGAQFTLDGIHYKLVANEGKNMLHGGKI  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV+K++       + F Y+S DG+QGFPGD+   V YT+  +  +L V M AK
Sbjct  121   GFSDVVWKVEKYQNEGHAPHVIFAYHSYDGEQGFPGDLSVTVGYTLVGDK-QLRVTMKAK  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNK TPVNLAQH YWNLGGH+SG+ILSE++QIFA + TPVDS LIPTG I+ +  T +D
Sbjct  180   ALNKATPVNLAQHTYWNLGGHNSGDILSEEIQIFASYFTPVDSQLIPTGHIVSVKGTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP  VG ++ KLP    G+DINY ++        K K VA V+D++SGI M++    P
Sbjct  240   FLKPHTVGGRIDKLPH---GYDINYVLEAGSG---NKMKKVAVVHDKKSGIVMKLTTNQP  293

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYTAN L+DVKGKG  VY+ HAALCLETQ FPD+VNHPNFPSTIV P + YKH  H+
Sbjct  294   GVQFYTANSLKDVKGKGGFVYQPHAALCLETQAFPDSVNHPNFPSTIVNPGETYKH--HM  351

Query  1114  TFR  1122
              F+
Sbjct  352   VFK  354



>ref|XP_007139591.1| hypothetical protein PHAVU_008G042600g [Phaseolus vulgaris]
 gb|ESW11585.1| hypothetical protein PHAVU_008G042600g [Phaseolus vulgaris]
Length=364

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 262/360 (73%), Gaps = 14/360 (4%)
 Frame = +1

Query  76    LFLCFFIS---FA--LIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             L LC  ++   FA   +V  ++ + + +KKG+ S+K+TN+GA + SL+LPD+NGKL D+V
Sbjct  7     LLLCLILAASGFANCSVVEKENIRIFQLKKGELSLKVTNWGASIVSLLLPDRNGKLGDVV  66

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LGYD+V +Y  D T FGA VGRVANRIGGAQFTLNG HYKL AN+GNNTLHGG +G S V
Sbjct  67    LGYDSVKDYTSDSTYFGATVGRVANRIGGAQFTLNGTHYKLVANEGNNTLHGGSRGFSDV  126

Query  421   YWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKP  588
              WKV+++++     SITF+Y+S DG++GFPGD+I  V+Y I     +L++ M  KALNKP
Sbjct  127   LWKVERYQKEGPSPSITFSYHSVDGEEGFPGDLIVTVSY-ILTGKNQLVILMKGKALNKP  185

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVNLA H YWNLGG +SGNIL+E +QIF   IT VDS LIPTG+   +  TA+DFLKP 
Sbjct  186   TPVNLANHAYWNLGGQNSGNILNEVVQIFGSKITVVDSKLIPTGKFGYVKGTAYDFLKPH  245

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              +GS++ +L + + G+DINY +D       +K+K  A V D++SG  ME+   APG+QFY
Sbjct  246   TIGSRINQLAE-TKGYDINYVLDVEKG---KKRKLAAIVQDKKSGRVMELYTNAPGLQFY  301

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             T N+++ VKGKG  VY +HA LCLETQ FPD+VN PNFPSTIVTP++PYKH +   F  +
Sbjct  302   TGNYVKHVKGKGGYVYNAHAGLCLETQAFPDSVNRPNFPSTIVTPEKPYKHYMLYKFSTK  361



>emb|CBI22179.3| unnamed protein product [Vitis vinifera]
Length=1699

 Score =   429 bits (1102),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/361 (58%), Positives = 262/361 (73%), Gaps = 16/361 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSG-----QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             +F+CF        +G     +D   Y ++KGDFS K T +GA + S++LPDKNGKL D+V
Sbjct  6     VFVCFITLVFCFATGSVAKKEDGGIYELRKGDFSAKFTKWGAAIVSVVLPDKNGKLADVV  65

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LGYD+  EY+ D TNFGAIVGRVANRIGGAQFTLNG HYKL ANDG N LHGGPKG  KV
Sbjct  66    LGYDSTKEYKNDTTNFGAIVGRVANRIGGAQFTLNGTHYKLVANDGKNMLHGGPKGFGKV  125

Query  421   YWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKP  588
              W+V K+E+      I F+Y+S DG++GFPGD+IA VTY +  + Y+LIV M AKALNK 
Sbjct  126   AWRVSKYEKGGHSPYIMFSYHSLDGEEGFPGDLIATVTYMLVGD-YQLIVTMKAKALNKA  184

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVNLAQH YWNLGGH SG+ILS ++QIF  HITPVD  LIPTG+I+ +  T +DFLKP 
Sbjct  185   TPVNLAQHAYWNLGGHTSGDILSNEIQIFGSHITPVDKELIPTGKIVPVKGTPYDFLKPC  244

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              +GS++ KLP    GFDINY +   DD    K    A V+ ++SG  +E+   APG+QFY
Sbjct  245   TIGSKINKLPS---GFDINYVL---DDTAPNKVGLAAMVHHKKSGRMLELYTNAPGLQFY  298

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             T+N L+DVKGKG  VY++HAALCLETQGFPD+VNHPNFPS IVTP + Y H++   F ++
Sbjct  299   TSNSLKDVKGKGGFVYQAHAALCLETQGFPDSVNHPNFPSQIVTPGKSYHHSMLFKFSIR  358

Query  1129  V  1131
             +
Sbjct  359   M  359



>ref|NP_001241992.1| uncharacterized protein LOC100781853 precursor [Glycine max]
 gb|ACU17623.1| unknown [Glycine max]
Length=371

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 263/369 (71%), Gaps = 16/369 (4%)
 Frame = +1

Query  55    MSIISAPLFLCF-------FISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPD  213
             M+ I   L LC        F++ + +   +    +  KKGD  +++TN+GA + SL++PD
Sbjct  1     MTKIFFVLLLCLIIASSSGFVNCSDVEKEEKIGIFEPKKGDLPLRVTNWGASILSLVIPD  60

Query  214   KNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLH  393
             KNGKL D+VLGYD+V +Y  D T FGA VGRVANRIGGAQFTLNGI+YKL AN+GNNTLH
Sbjct  61    KNGKLGDVVLGYDSVKDYSNDTTYFGATVGRVANRIGGAQFTLNGIYYKLVANEGNNTLH  120

Query  394   GGPKGISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVK  561
             GG +G S V W+VK++++     SITF Y+S DG+QGFPGD++  V+Y I     +L++ 
Sbjct  121   GGARGFSDVLWEVKRYQKEGPSPSITFRYHSVDGEQGFPGDLLVTVSY-ILTGKNQLVIL  179

Query  562   MNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINN  741
             M  KALNKPTPVNLA H YWNLGGH+SGNIL+E +QI    ITPVD+ LIPTG+   +  
Sbjct  180   MKGKALNKPTPVNLANHAYWNLGGHNSGNILNEVVQILGSKITPVDNKLIPTGKFASVKG  239

Query  742   TAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIK  921
             TA+DFLKPQ VGS++ +L  G+ G+DINY +DG      +K K  A V D++SG  +E+ 
Sbjct  240   TAYDFLKPQTVGSRINQLA-GTKGYDINYVIDGEKG---QKIKLAAIVQDKKSGRVLELF  295

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
               APG+QFYT N+++D+KGKG  VY +HA LCLE+Q FPD+VNHPNFPSTIVT ++PYKH
Sbjct  296   TNAPGLQFYTGNYIKDLKGKGGYVYNAHAGLCLESQAFPDSVNHPNFPSTIVTQEKPYKH  355

Query  1102  TLHITFRVQ  1128
              +   F  +
Sbjct  356   YMLFKFSTK  364



>ref|XP_006338472.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=357

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 203/365 (56%), Positives = 261/365 (72%), Gaps = 16/365 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             MS     + +C FI   L    V+G     Y IKKGDFSVK+TNYGAR+ S+ LPDKNGK
Sbjct  1     MSSKVISVLICLFIFHLLAAGSVAGCKIGVYEIKKGDFSVKITNYGARIISVFLPDKNGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+VLGYDTV EY  +   FGA++GRV NRIGGAQFTLNG  YKL  N+GNNT+HGGPK
Sbjct  61    IDDVVLGYDTVKEYINETRYFGALLGRVVNRIGGAQFTLNGTLYKLVPNEGNNTIHGGPK  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV ++ +      IT TY+S +G++GFPGDV+  VTY +K+ PYKL V+  AK
Sbjct  121   GFSFVVWKVSEYVQDGPCPHITLTYHSAEGEEGFPGDVVVSVTYALKD-PYKLSVEFKAK  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             +LNK TP+NL+ H YWNL GH SG++LS+ +QI+A HIT VD  LIPTG+I  + NT +D
Sbjct  180   SLNKATPINLSHHPYWNLRGHKSGDVLSQVVQIYASHITLVDEQLIPTGEISPVKNTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKP++VGS++ K+     G+D NY +D        K K VA VYD++SG  M+I+A+AP
Sbjct  240   FLKPRKVGSRIDKV---QIGYDRNYVLD-----SNEKMKAVAIVYDKKSGRVMDIQASAP  291

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
              V FYT+N + +VKGKG  VY+ H+AL LETQG+PDAVNHPNFPSTIV P + Y H++  
Sbjct  292   CVHFYTSNWIINVKGKGGFVYQPHSALSLETQGYPDAVNHPNFPSTIVNPGKTYAHSVLY  351

Query  1114  TFRVQ  1128
             TF ++
Sbjct  352   TFSIK  356



>ref|XP_011046256.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
 ref|XP_011046257.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=358

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 211/358 (59%), Positives = 249/358 (70%), Gaps = 18/358 (5%)
 Frame = +1

Query  76    LFLCF--FISFALIVSGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDI  237
             + LCF   + F     G   K     Y +KKG+FS+KLTNYGA + SL+LPDK GKL DI
Sbjct  6     VLLCFSLLLIFGFPAIGSATKEEIGMYELKKGNFSMKLTNYGAHIISLLLPDKYGKLADI  65

Query  238   VLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISK  417
             VLGYDT+ EY+ D +NFGA VGRVANRI GAQFTLNG  YKL ANDG NTLHGGPKG SK
Sbjct  66    VLGYDTIKEYKNDSSNFGATVGRVANRIAGAQFTLNGTLYKLVANDGKNTLHGGPKGFSK  125

Query  418   VYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNK  585
             V WKVKK+        I F Y+S DG++GFPGD+   V Y +  +  KL + M AKAL K
Sbjct  126   VVWKVKKYSPEGRKPFIVFAYHSFDGEEGFPGDLHVIVGYKLLGDN-KLRITMKAKALKK  184

Query  586   PTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKP  765
              TPVNL  H YWNLGGH+SG+ILSE++QIFA H TPVDS LIPTG+I+ +  T +DFLKP
Sbjct  185   ATPVNLVNHAYWNLGGHNSGDILSEEIQIFASHYTPVDSELIPTGEIVTVKGTPYDFLKP  244

Query  766   QQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQF  945
               +GS++ KL   + G+DINYA+DG    G  K K  A V+D++SG  MEI    PGVQF
Sbjct  245   NTIGSKINKL---TNGYDINYALDG---SGNDKLKKAAIVHDKKSGRMMEILTNQPGVQF  298

Query  946   YTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             YT+N L   KGKG  VYE H ALCLETQGFPD+VN PNFPS IV P   YKH + I F
Sbjct  299   YTSNTLYQ-KGKGGFVYEPHGALCLETQGFPDSVNQPNFPSQIVNPGTYYKHQMLIKF  355



>ref|XP_006431103.1| hypothetical protein CICLE_v10011989mg [Citrus clementina]
 gb|ESR44343.1| hypothetical protein CICLE_v10011989mg [Citrus clementina]
Length=373

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 259/373 (69%), Gaps = 28/373 (8%)
 Frame = +1

Query  76    LFLCF--FISFALIVSG----------------QDNKFYVIKKGDFSVKLTNYGARVASL  201
             L LCF   ++   IV+G                ++ KFY +KKGDFSVK TN+GA + S+
Sbjct  6     LSLCFVALVAIGFIVNGSVADEDKKNECDKNNSEEVKFYELKKGDFSVKFTNWGATIVSV  65

Query  202   ILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGN  381
              LPDK+GK+ D+VLGYD+V +Y+ D T FG++VGRVANRIGGAQFTL+G HYKL AN+ +
Sbjct  66    FLPDKDGKVDDVVLGYDSVDDYKNDTTYFGSVVGRVANRIGGAQFTLDGTHYKLVANEKS  125

Query  382   NTLHGGPKGISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYK  549
             N LHGGPKG S V WKVK +E       I F+Y+S DG++GFPGD+   V+Y++     +
Sbjct  126   NMLHGGPKGFSDVIWKVKTYENEGPTPKIVFSYHSTDGEEGFPGDLDVTVSYSLTSEK-E  184

Query  550   LIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQIL  729
             L VKM AKA NK TPVNLAQH+YWNLGGH SG+ILS+++QIFA   TPVD  LIPTG+I 
Sbjct  185   LSVKMKAKARNKATPVNLAQHSYWNLGGHSSGDILSQEVQIFASSYTPVDDQLIPTGKIE  244

Query  730   LINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIG  909
              +  T +DFL+P  +GS + KLP   GG+DINY +D  D   T +K  VA V+D++SG  
Sbjct  245   TVEGTPYDFLQPHAIGSSIDKLP---GGYDINYVLDKDDSSKTMRK--VAIVHDKKSGRV  299

Query  910   MEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQ  1089
             ME+ A  PGVQ+YT   +++V GKG  VY+ HA LCLETQ FPD+VNHPNFP+TIV P +
Sbjct  300   MELLADQPGVQYYTGGQIKEVTGKGGFVYKKHAGLCLETQAFPDSVNHPNFPNTIVYPGE  359

Query  1090  PYKHTLHITFRVQ  1128
              YKH +   F  +
Sbjct  360   KYKHHMLYKFSTK  372



>ref|XP_011008939.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=404

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/368 (56%), Positives = 256/368 (70%), Gaps = 26/368 (7%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQ---------DNKFYVIKKGDFSVKLTNYGARVASLIL  207
             MS  SA    CF I   L++SG          +   Y +KKG+ S+KLTNYGAR+ SL+L
Sbjct  47    MSKFSA--LFCFII---LVISGCACIDSAMGGEIGIYELKKGNLSMKLTNYGARIISLVL  101

Query  208   PDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNT  387
             PDKNGKL D+ LG+DT+ E+    + FGA VGRVANRI  AQFTLNG  YKL AN GNNT
Sbjct  102   PDKNGKLGDVALGFDTIEEFMNASSPFGATVGRVANRISNAQFTLNGTVYKLPANSGNNT  161

Query  388   LHGGPKGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLI  555
             +HGGP G SKV WKVKK+        I F Y+S DG+QGFPGD++   +YT+  +  +L 
Sbjct  162   IHGGPIGFSKVVWKVKKYSPDGLVPYIVFAYHSFDGEQGFPGDLLVKTSYTLLGDN-QLC  220

Query  556   VKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLI  735
             + M AKA NK TPVNL  H +WNLGGH+SG+ILSEK+QIFA   TPVDS LIPTG+I+ +
Sbjct  221   ITMEAKARNKATPVNLVNHAFWNLGGHNSGDILSEKIQIFASRYTPVDSKLIPTGKIVTV  280

Query  736   NNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGME  915
               T +DFLKP  +GS++ +LPK   G+DINYA+DG    G +K +  A V+DE+SG  ME
Sbjct  281   KETPYDFLKPNTIGSRINELPK---GYDINYALDG---SGNKKLRKAAIVHDEKSGRAME  334

Query  916   IKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPY  1095
             I    PGVQF+T+N L +VKGKG  +Y+ H ALCLETQGFPD+VNHPNFPS IV P +PY
Sbjct  335   ILTNQPGVQFFTSNSL-NVKGKGGFMYKRHGALCLETQGFPDSVNHPNFPSQIVNPGKPY  393

Query  1096  KHTLHITF  1119
             KH +   F
Sbjct  394   KHYMLFKF  401



>ref|XP_006482555.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=373

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 261/373 (70%), Gaps = 28/373 (8%)
 Frame = +1

Query  76    LFLCF--FISFALIVSG----------------QDNKFYVIKKGDFSVKLTNYGARVASL  201
             L LCF   ++   IV+G                ++ KFY +KKGDFSVK TN+GA + S+
Sbjct  6     LSLCFVALVAIGFIVNGSVADEDKKNECDKNNSEEVKFYELKKGDFSVKFTNWGATIVSV  65

Query  202   ILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGN  381
              LPDK+GK+ D+VLGYD+V +Y+ D T FG++VGRVANRIGGAQFTL+G HYKL AN+ +
Sbjct  66    FLPDKDGKVDDVVLGYDSVDDYKNDTTYFGSVVGRVANRIGGAQFTLDGTHYKLVANEKS  125

Query  382   NTLHGGPKGISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYK  549
             N LHGGPKG S V WKVK +E       I F+Y+S DG++GFPGD+   V+Y++     +
Sbjct  126   NMLHGGPKGFSDVIWKVKTYENEGPTPKIVFSYHSTDGEEGFPGDLDVTVSYSLTGEK-E  184

Query  550   LIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQIL  729
             L VKM AKA NK TPVNLAQH+YWNLGGH+SG+ILS+++QIFA   TPVD  LIPTG+I 
Sbjct  185   LSVKMKAKARNKATPVNLAQHSYWNLGGHNSGDILSQEVQIFASSYTPVDDQLIPTGKIE  244

Query  730   LINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIG  909
              +  T +DFL+P  +GS + KLP    G+DINY +D   D  ++K + VA V+D++SG  
Sbjct  245   TVEGTPYDFLQPHAIGSSIDKLPV---GYDINYVLD--KDDSSKKMRKVAIVHDKKSGRV  299

Query  910   MEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQ  1089
             ME+ A  PGVQ+YT   +++V+GKG  VY+ HA LCLETQ FPD+VNHPNFP+TIV P +
Sbjct  300   MELLADQPGVQYYTGGQIKEVRGKGGFVYKKHAGLCLETQAFPDSVNHPNFPNTIVYPGE  359

Query  1090  PYKHTLHITFRVQ  1128
              YKH +   F  +
Sbjct  360   KYKHHMLYKFSTK  372



>ref|XP_004489156.1| PREDICTED: aldose 1-epimerase-like [Cicer arietinum]
Length=364

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 253/344 (74%), Gaps = 9/344 (3%)
 Frame = +1

Query  109   IVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF  288
             +V  +    + +KKGD S+K+TN+GA + SL++PDKNGKL D+VLGYD+V EY  D T F
Sbjct  24    LVEKEKIGIFELKKGDISLKVTNWGASIMSLVIPDKNGKLGDVVLGYDSVKEYTNDSTYF  83

Query  289   GAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES----SI  456
             GA VGRVANRIGGAQFTLN  HYKL AN+GNNTLHGG +G S V WKVK+++      ++
Sbjct  84    GATVGRVANRIGGAQFTLNRHHYKLVANEGNNTLHGGSRGFSDVIWKVKRYQREGPSPTV  143

Query  457   TFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGH  636
             TFTY+S DG++GFPGD++A V+Y I     +L++ M AKALNKPTPVNLA H YWN+G  
Sbjct  144   TFTYHSFDGEEGFPGDLLATVSY-ILTGKNQLVIIMKAKALNKPTPVNLANHAYWNIGNQ  202

Query  637   DSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGF  816
             +SGNIL+E +QIF   IT VD+ LIPTG    +  T +DFLKPQ +G+++ +L K + G+
Sbjct  203   NSGNILNEVIQIFGSKITIVDNKLIPTGTFASVKGTPYDFLKPQIIGTRINQLAK-TKGY  261

Query  817   DINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVY  996
             DINY +DG      +  K  AKV+D++SG  +E+   APG+QFYT N++ DVKGK   VY
Sbjct  262   DINYVLDGEKG---KNIKLAAKVFDKKSGRTLELYTNAPGLQFYTGNYIMDVKGKNGHVY  318

Query  997   ESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             ++HA LCLE+Q FPD+VNHP+FPSTIVTP++PYKH +   F  +
Sbjct  319   QAHAGLCLESQAFPDSVNHPDFPSTIVTPEKPYKHYMLFKFSAK  362



>ref|XP_006373311.1| hypothetical protein POPTR_0017s11660g [Populus trichocarpa]
 gb|ERP51108.1| hypothetical protein POPTR_0017s11660g [Populus trichocarpa]
Length=358

 Score =   390 bits (1003),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 201/360 (56%), Positives = 252/360 (70%), Gaps = 24/360 (7%)
 Frame = +1

Query  79    FLCFFISFALIVSGQ---------DNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
               CF I   L++SG          +   Y +KKG+ S+KLTNYGAR+ SL+LPDKNGKL 
Sbjct  7     LFCFII---LVISGCACIDSAMGGEIGIYELKKGNLSMKLTNYGARIISLVLPDKNGKLG  63

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+ LG+DT+ E+    + FGA VGRVANRI  AQFTLNG  YKL AN GNNT+HGGP G 
Sbjct  64    DVALGFDTIEEFMNASSPFGATVGRVANRISNAQFTLNGTVYKLPANSGNNTIHGGPIGF  123

Query  412   SKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
             SKV WKVKK+        I F Y+S DG+QGFPGD++   +YT+  +  +L + M AKA 
Sbjct  124   SKVVWKVKKYSPDGLVPYIVFAYHSFDGEQGFPGDLLVETSYTLLGD-NQLCITMEAKAR  182

Query  580   NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFL  759
             NK TPVNL  H +WNLGGH+SG+ILSEK+QIFA   TPVDS LIPTG+I+ +  T +DFL
Sbjct  183   NKATPVNLVNHAFWNLGGHNSGDILSEKIQIFASRYTPVDSKLIPTGKIVTVKETPYDFL  242

Query  760   KPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGV  939
             KP  +GS++ +LPK   G+DINYA+DG    G +K +  A V+DE+SG  MEI    PGV
Sbjct  243   KPNTIGSKINELPK---GYDINYALDG---SGNKKLRKAAIVHDEKSGRAMEILTNQPGV  296

Query  940   QFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             QF+T+N L +VKGKG  +Y+ H ALCLETQGFPD+VNHPNFPS IV P +PY+H +   F
Sbjct  297   QFFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHPNFPSQIVNPGKPYQHYMLFKF  355



>ref|XP_002305327.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
 gb|EEE85838.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
Length=358

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/360 (58%), Positives = 251/360 (70%), Gaps = 22/360 (6%)
 Frame = +1

Query  82    LCFFISFALIV----------SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
              C  + F+L++          + ++   Y +KKG+FSVKLTNYGA + SL+LPDK GK+ 
Sbjct  4     FCVLLCFSLLLIFGFPAIGSATKEEIGMYELKKGNFSVKLTNYGAHIISLLLPDKYGKVA  63

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             DIVLGYDT+ EY+ D +NFGA VGRVANRI GAQFTLNG  YKL AN+G N LHGG KG 
Sbjct  64    DIVLGYDTIKEYKNDSSNFGATVGRVANRIAGAQFTLNGTLYKLVANEGKNMLHGGRKGF  123

Query  412   SKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
             S V WKVKK+        I F Y+S DG++GFPGD+   V Y +  +  KL + M AKAL
Sbjct  124   STVVWKVKKYSPEGRTPCIVFAYHSFDGEEGFPGDLHVIVGYKLLGDN-KLRITMKAKAL  182

Query  580   NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFL  759
             NK TPVNL  H YWNLGGH+SG+ILSE++QIFA H TPVDS LIPTG+I+ +  T +DFL
Sbjct  183   NKATPVNLVNHAYWNLGGHNSGDILSEEIQIFASHYTPVDSQLIPTGEIVTVKGTPYDFL  242

Query  760   KPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGV  939
             KP  +GS++ KL   + G+DINYA+DG    G  K K VA V D++SG  MEI    PGV
Sbjct  243   KPNTIGSKINKL---TNGYDINYALDG---SGNDKLKKVAIVRDKKSGRMMEILTNQPGV  296

Query  940   QFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             QFYT+N L   KGKG  VYE +AALCLETQGFPD+VNHPNFPS IV P   YKH + I F
Sbjct  297   QFYTSNTLYQ-KGKGGFVYEPYAALCLETQGFPDSVNHPNFPSQIVNPGTYYKHQMLIKF  355



>ref|XP_007210522.1| hypothetical protein PRUPE_ppa007822mg [Prunus persica]
 gb|EMJ11721.1| hypothetical protein PRUPE_ppa007822mg [Prunus persica]
Length=354

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 247/352 (70%), Gaps = 11/352 (3%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK---FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             +F CF +   +    + N+    Y +KKGDFSVKLTNYGA V S++LPDKNGKL D+VL 
Sbjct  7     MFWCFLLLPLVFYCSEANQKVGIYELKKGDFSVKLTNYGATVLSVVLPDKNGKLDDVVLA  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             ++++ +Y  D   FGAIVGRVANRIG AQF+LNG+HYKL AN+G NTLHGG KG S V W
Sbjct  67    FESLKDYSNDSVYFGAIVGRVANRIGSAQFSLNGVHYKLVANEGKNTLHGGLKGFSDVVW  126

Query  427   KVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
              VK + E+S ITFTY S DG+QGFPGD++  VTY + E   KL +KM AKALNK TPVNL
Sbjct  127   TVKSYIEDSHITFTYNSLDGEQGFPGDLVVSVTYMLVETN-KLAIKMEAKALNKATPVNL  185

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             A H YWNL GH+SG+ILS  LQ+F  +ITPV+  LIPTG+I  +  T +DFL+PQ++GS+
Sbjct  186   AHHTYWNLRGHNSGDILSHHLQLFGSNITPVNDQLIPTGEIAPVKGTPYDFLEPQEIGSK  245

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
             + +LP    G+DINY +D       RK   +    D  SG  +E+    PG+QFYT+N L
Sbjct  246   INELPD---GYDINYVLDPSSYKHLRKAVVLR---DSVSGRKLELWTNMPGLQFYTSNKL  299

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              +VKGK   VYE HAA+CLETQGFPDAVNHPNFPS IV P + Y H +   F
Sbjct  300   DNVKGKDGFVYEKHAAVCLETQGFPDAVNHPNFPSQIVKPGETYLHVMVYRF  351



>gb|AFK41318.1| unknown [Lotus japonicus]
Length=372

 Score =   389 bits (999),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/363 (54%), Positives = 262/363 (72%), Gaps = 17/363 (5%)
 Frame = +1

Query  76    LFLCF-FISFALIVSGQDNK------FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
             + LC  F++ +  V+G   K       + +KKGD S+K++N+GA + SL+LPDK+GKL D
Sbjct  7     VLLCLLFLAASGFVNGSAKKEKDHVRLFELKKGDLSLKVSNWGATLVSLVLPDKHGKLGD  66

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
             +VLGYD++ +Y  D T FG   GRVANRIGGAQFTLNGIHYKL AN+GNNTLHGGP+G S
Sbjct  67    VVLGYDSLKQYTNDSTYFGTTAGRVANRIGGAQFTLNGIHYKLIANEGNNTLHGGPRGFS  126

Query  415   KVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTI-KENPYKLIVKMNAKAL  579
              V WKV+++    ++  ITF+Y+S DG++GFPGD++  V+Y +  +N   +I  M AKAL
Sbjct  127   DVLWKVERYVKEGDKPRITFSYHSFDGEEGFPGDLLVTVSYILGSKNSLSII--MKAKAL  184

Query  580   NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFL  759
             NKPTPVNL  H YWNLG H+SGNIL E +QIF   IT +DS+LIPTG+I  +  T +DFL
Sbjct  185   NKPTPVNLINHAYWNLGNHNSGNILGEVVQIFGSRITVLDSHLIPTGEIASVKGTPYDFL  244

Query  760   KPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGV  939
             KPQ VG+++ +LPK + G+DINY +DG    G    K  A V D++SG  M++   APG+
Sbjct  245   KPQVVGARINQLPK-TNGYDINYVLDGGKSKGLI--KLAAIVMDKKSGRVMKLFTNAPGL  301

Query  940   QFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             QFYTAN +++ KGKG  VY+  A LCLE+Q FPD+VNHPNFPS+IVTP++PYKH + + F
Sbjct  302   QFYTANKVKNEKGKGGFVYQPRAGLCLESQVFPDSVNHPNFPSSIVTPEKPYKHVMLLKF  361

Query  1120  RVQ  1128
               +
Sbjct  362   STK  364



>ref|XP_008453190.1| PREDICTED: aldose 1-epimerase-like [Cucumis melo]
Length=353

 Score =   388 bits (996),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 249/352 (71%), Gaps = 9/352 (3%)
 Frame = +1

Query  73    PLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYD  252
             PL     +S     +G D   Y +++G+FS+KLTNYGA + SLILPDKNGK  D+VL + 
Sbjct  6     PLIFLLVVSVIGFSNGNDVGIYELRRGNFSIKLTNYGATILSLILPDKNGKWDDVVLSFP  65

Query  253   TVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV  432
             +V ++  D T FG IVGRVANRIGGAQF +NG+ YKL  NDG N LHGG KG   V WK+
Sbjct  66    SVDDFRNDTTYFGNIVGRVANRIGGAQFGINGVFYKLTPNDGRNLLHGGKKGFGDVIWKM  125

Query  433   KKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQ  609
             + + ++S ITFTY S DG+QGFPGD+   VTY   E   KL VKM AK+LNK TPVN+AQ
Sbjct  126   ESYVKDSHITFTYDSFDGEQGFPGDLPVSVTYMFIETN-KLGVKMQAKSLNKATPVNIAQ  184

Query  610   HNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMA  789
             H+YWNL GH SG+ILS K+++FA  ITPVDS LIPTG+I+ +  T FDF  P+++GSQ+ 
Sbjct  185   HSYWNLDGHSSGDILSHKIKLFASSITPVDSELIPTGKIIPVAKTPFDFTTPREIGSQI-  243

Query  790   KLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQD  969
                K +GG+DINY V   DD G+   K VA+V  ++SG  ME+ +  PGVQFYT N L++
Sbjct  244   ---KSAGGYDINYVV---DDTGSEHLKKVAEVTGKKSGRKMELWSNQPGVQFYTGNQLKE  297

Query  970   VKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             VKGK  AVY+ +A LCLETQGFPD+VNHPNFPS IV P + Y+H +   F V
Sbjct  298   VKGKDGAVYKQYAGLCLETQGFPDSVNHPNFPSQIVNPGESYEHVMVYRFTV  349



>gb|KEH24989.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=375

 Score =   386 bits (991),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/366 (53%), Positives = 255/366 (70%), Gaps = 17/366 (5%)
 Frame = +1

Query  76    LFLCF-FISFALIVSGQDNK---------FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             + LC  F++F+  V+G  NK          + +KKGD ++K+TN+GA + SL+LPDKNGK
Sbjct  6     MLLCLLFLAFSGFVNGSMNKKEKNHDDIKLFELKKGDLTLKVTNWGATLVSLVLPDKNGK  65

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLGYDT   Y  D + FGA VGRVANRIGGAQFTLNG HYKL AN+GNNTLHGG +
Sbjct  66    LGDIVLGYDTPKAYTNDTSYFGATVGRVANRIGGAQFTLNGTHYKLIANEGNNTLHGGTR  125

Query  406   GISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV+++    ++  I F+Y+S DG+QGFPGD+   V+Y + +N   +I  M AK
Sbjct  126   GFSDVLWKVERYVREGDQPLIKFSYHSFDGEQGFPGDLKVTVSYILGKNSLTII--MQAK  183

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVNL  H YWNLG H+SGNIL E +QIF    TP+D NLIPTG+   +  T +D
Sbjct  184   ALNKPTPVNLVNHAYWNLGNHNSGNILDEVVQIFGSKFTPIDKNLIPTGKFSSVKGTPYD  243

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKPQ VG+++ +LPK + G+DINY ++          K  A V D++SG  M++   AP
Sbjct  244   FLKPQIVGTRINQLPK-TNGYDINYVLNKGKLEKKEGLKVAAIVMDKKSGRVMKLSTNAP  302

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFY+AN +++ KGKG  VY+  +ALCLE+Q FPD+VNHP FPSTIVT ++PYKH + +
Sbjct  303   GLQFYSANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPKFPSTIVTKEKPYKHVMLL  362

Query  1114  TFRVQV  1131
              F   V
Sbjct  363   KFSTNV  368



>gb|KHN13234.1| Aldose 1-epimerase [Glycine soja]
Length=367

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 247/338 (73%), Gaps = 10/338 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             + + +KKGDFS+K+TN+GA + S+ILPDKNGKL DIVLGYD+   Y  D + FGA VGRV
Sbjct  29    RLFELKKGDFSIKVTNWGATLVSVILPDKNGKLGDIVLGYDSPKAYTNDTSYFGATVGRV  88

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSR  477
             ANRIGGAQFTLNGIHYKL AN+GNNTLH GPK  S V WKV ++    E+  ITF+Y+S 
Sbjct  89    ANRIGGAQFTLNGIHYKLVANEGNNTLHSGPKAFSDVLWKVTRYIKDGEKPRITFSYHSY  148

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG+ GFPGD++  V+Y + +N  ++I  M AKALNKPTPVN+  H YWNLG H+SGNIL 
Sbjct  149   DGEGGFPGDLLVTVSYILGKNSLRII--MKAKALNKPTPVNMVNHAYWNLGNHNSGNILD  206

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E +QIF   +T  D +LIPTGQ   +  T +DFL+P  VG ++ +LPK + G+DINY +D
Sbjct  207   EVVQIFGSQVTLFDDHLIPTGQYASVKGTPYDFLEPHIVGERINQLPK-TNGYDINYVLD  265

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G      ++ K  A V D++SG  M++   APG+QFYTAN +++ KGKG  VY+  +ALC
Sbjct  266   GEKG---KEIKLAAIVVDKKSGRVMKLFTNAPGLQFYTANFVKNEKGKGGFVYQPRSALC  322

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQV  1131
             LE+Q FPD+VNHPNFPSTIVT ++PYKH L + F  +V
Sbjct  323   LESQAFPDSVNHPNFPSTIVTTEKPYKHVLLLKFSTKV  360



>ref|XP_003543750.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=367

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 247/338 (73%), Gaps = 10/338 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             + + +KKGDFS+K+TN+GA + S+ILPDKNGKL DIVLGYD+   Y  D + FGA VGRV
Sbjct  29    RLFELKKGDFSIKVTNWGATLVSVILPDKNGKLGDIVLGYDSPKAYTNDTSYFGATVGRV  88

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSR  477
             ANRIGGAQFTLNGIHYKL AN+GNNTLH GPK  S V WKV ++    E+  ITF+Y+S 
Sbjct  89    ANRIGGAQFTLNGIHYKLVANEGNNTLHSGPKAFSDVLWKVTRYIKDGEKPRITFSYHSY  148

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG+ GFPGD++  V+Y + +N  ++I  M AKALNKPTPVN+  H YWNLG H+SGNIL 
Sbjct  149   DGEGGFPGDLLVTVSYILGKNSLRII--MKAKALNKPTPVNMVNHAYWNLGNHNSGNILD  206

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E +QIF   +T  D +LIPTGQ   +  T +DFL+P  VG ++ +LPK + G+DINY +D
Sbjct  207   EVVQIFGSQVTLFDDHLIPTGQYASVKGTPYDFLEPHIVGERINQLPK-TNGYDINYVLD  265

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G      ++ K  A V D++SG  M++   APG+QFYTAN +++ KGKG  VY+  +ALC
Sbjct  266   GEKG---KEIKLAAIVVDKKSGRVMKLFTNAPGLQFYTANFVKNEKGKGGFVYQPRSALC  322

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQV  1131
             LE+Q FPD+VNHPNFPSTIVT ++PYKH L + F  +V
Sbjct  323   LESQAFPDSVNHPNFPSTIVTTEKPYKHVLLLKFSTKV  360



>ref|XP_008239819.1| PREDICTED: aldose 1-epimerase [Prunus mume]
Length=366

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 250/361 (69%), Gaps = 12/361 (3%)
 Frame = +1

Query  49    NIMSIISAPLFLCFFISFALIVSGQDNK---FYVIKKGDFSVKLTNYGARVASLILPDKN  219
             N M  IS  +F CF +   +    + N+    Y +KKGDFSVKLTNYGA V S++LPDKN
Sbjct  11    NTMPKISI-MFWCFLLLPLVFYCSEANQKVGIYELKKGDFSVKLTNYGATVLSVVLPDKN  69

Query  220   GKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGG  399
             GKL D+VL ++++ +Y  D   FGAIVGRVANRIG AQF+LNG+HYKL AN+G NTLHGG
Sbjct  70    GKLDDVVLAFESLKDYSNDSVYFGAIVGRVANRIGSAQFSLNGVHYKLVANEGKNTLHGG  129

Query  400   PKGISKVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKA  576
              KG S V W VK + E+S ITFTY S DG+QGFPGD++  VTY + E   KL +KM AKA
Sbjct  130   LKGFSDVVWTVKSYIEDSHITFTYNSLDGEQGFPGDLVVSVTYMLVETN-KLAIKMEAKA  188

Query  577   LNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDF  756
             LNK TPVNLA H YWNL GH+SG+ILS  LQ+F  +ITPV+  LIPTG+I  +  T +DF
Sbjct  189   LNKATPVNLAHHTYWNLRGHNSGDILSHHLQLFGSNITPVNDQLIPTGEIAPVKGTPYDF  248

Query  757   LKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPG  936
             L+ Q++GS++ +LP    G+DINY +D       RK   +    D  SG  +E+    PG
Sbjct  249   LEAQEIGSKINELPD---GYDINYVLDPSSYKHLRKAVVLR---DSVSGRKLELWTNMPG  302

Query  937   VQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHIT  1116
             +QFYT+N L +VKGK   VY+ HAA+CLETQGFPDAVNHPNFPS +V P + Y H +   
Sbjct  303   LQFYTSNKLDNVKGKDGFVYKKHAAVCLETQGFPDAVNHPNFPSQVVKPGETYLHVMVYR  362

Query  1117  F  1119
             F
Sbjct  363   F  363



>gb|KHN45485.1| Aldose 1-epimerase [Glycine soja]
Length=368

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 255/361 (71%), Gaps = 14/361 (4%)
 Frame = +1

Query  76    LFLCF-FISFALIVSGQDNK----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             + LC  F++ +  V G   K     + +KKGDFS+K+TN+GA + S+ILPDKNGKL DIV
Sbjct  6     VLLCLLFLASSGFVHGSSKKDHIRLFELKKGDFSIKVTNWGATLVSVILPDKNGKLGDIV  65

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LGYD+   Y  D + FGA VGRVANRIGGAQFTLNGIHYKL AN+GNNTLH GPK  S V
Sbjct  66    LGYDSPKAYTNDTSYFGATVGRVANRIGGAQFTLNGIHYKLVANEGNNTLHSGPKAFSDV  125

Query  421   YWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKP  588
              WKV ++    ++  ITF+Y+S DG+ GFPGD++  V+Y + +N   +I+K  AKALNKP
Sbjct  126   LWKVTRYIKDDDKPRITFSYHSYDGEGGFPGDLLVTVSYILGKNSLSIIMK--AKALNKP  183

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVN+  H YWNLG H+SGNIL E +QIF   +T  D NLIPTGQ   +  T  DFL+P 
Sbjct  184   TPVNMVNHAYWNLGNHNSGNILDEVVQIFGSQVTLFDDNLIPTGQYASVRGTPNDFLEPH  243

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              VG ++ +LPK + G++INY +DG  + G  + K  A   D++SG  M++   APG+QFY
Sbjct  244   IVGERINQLPK-TNGYNINYVLDG--EKGNAEIKLAAIAVDKKSGRVMKLFTNAPGLQFY  300

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             TAN +++ KGKG  VY+  +ALCLE+Q FPD+VNHPNFPSTIVTP +PYKH + + F  +
Sbjct  301   TANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTPDKPYKHVMLLKFSTK  360

Query  1129  V  1131
             V
Sbjct  361   V  361



>ref|XP_010317286.1| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=390

 Score =   385 bits (989),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 265/374 (71%), Gaps = 21/374 (6%)
 Frame = +1

Query  76    LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             + +C FI   L    V+G +   Y IK GDFSVK+TNYGAR+ S+ LPDKNGK+ D+VLG
Sbjct  8     VLICLFIFHLLAAGSVAGCEIGVYEIKNGDFSVKITNYGARIISVFLPDKNGKIDDVVLG  67

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             Y TV EY  +   FGA++GRV NRI GAQFTLNG  YKL  N+GNNT+HGGPKG S V W
Sbjct  68    YYTVKEYINETRYFGALLGRVVNRISGAQFTLNGTLYKLVPNEGNNTIHGGPKGFSFVVW  127

Query  427   KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTP  594
             KV ++ +      IT TY+S DG++GFPGDV+  VTY +K+ PYKL V+  AK+LNK TP
Sbjct  128   KVSEYVQDGPCPHITLTYHSTDGEEGFPGDVLVSVTYALKD-PYKLSVEFKAKSLNKATP  186

Query  595   VNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQV  774
             +NL+ H YWNL GH+SG++LS+ +QI+A HITPVD  LIPTG+I  + NT ++FLKP++V
Sbjct  187   INLSHHPYWNLRGHNSGDVLSQVVQIYASHITPVDEQLIPTGEISPVKNTPYNFLKPRKV  246

Query  775   GSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTA  954
             GS++ ++     G+D NY +D       +K K VA VYD++SG  M I+ATAP V FYTA
Sbjct  247   GSRIDEV---QIGYDRNYVLD-----SNKKMKPVAIVYDKKSGRVMNIQATAPCVHFYTA  298

Query  955   NHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQV*  1134
             N + +VKGKG  VY+  +AL LETQG+PDAVNHPNFPSTIV P + Y H++ + F  Q  
Sbjct  299   NWIINVKGKGGFVYQPRSALSLETQGYPDAVNHPNFPSTIVNPGKTYAHSV-VYFLHQ--  355

Query  1135  GCLIEVSRSLSTTL  1176
                I+++R L  TL
Sbjct  356   --KIDLARILLITL  367



>gb|KDP45491.1| hypothetical protein JCGZ_09740 [Jatropha curcas]
Length=364

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 200/368 (54%), Positives = 254/368 (69%), Gaps = 17/368 (5%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSG----QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNG  222
             M+     +  C  I+F  I++G    +    Y +KKG+ S+K+TNYGA + SL LPDK+G
Sbjct  1     MAKFCGLVCFCIVIAFGFIINGCIAEEKIGIYELKKGNLSIKVTNYGAHIISLFLPDKHG  60

Query  223   KLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGP  402
             KL D++LGYDT+ EY  D ++FGA +GRVANRI GAQFTLNG  YKL  N+G NTLHGGP
Sbjct  61    KLDDVLLGYDTIKEYLNDTSSFGATIGRVANRIAGAQFTLNGTLYKLIPNEGKNTLHGGP  120

Query  403   KGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIK-ENPYKLIVKMN  567
             KG SKV WKVKK++       I FTY+S DG+QGFPGD++    YT+  EN  +L + M 
Sbjct  121   KGFSKVVWKVKKYQPEGDAPHIIFTYHSFDGEQGFPGDLLVTTAYTLHGEN--QLSITMK  178

Query  568   AKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTA  747
             AKALNKPTPVNL  H YWNLGGH+SG+ILSE++QIF    TP++S LIPTG+I  +  T 
Sbjct  179   AKALNKPTPVNLVNHAYWNLGGHNSGDILSEEIQIFGSKYTPLNSELIPTGEIASVKGTP  238

Query  748   FDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIK  921
             +DFLKP  +GS++ KLP    G+DINYA+D         K  K  A VYD+++G  + + 
Sbjct  239   YDFLKPYIIGSKIRKLPN---GYDINYALDDKKTGRGSSKVLKKAAIVYDKKTGRALHLF  295

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
                PGVQFYT+N L   KGKG  VY+  AALCLETQG+PDAV+HPNFPSTIV P + YKH
Sbjct  296   TNQPGVQFYTSNTLTQ-KGKGGYVYKPFAALCLETQGYPDAVHHPNFPSTIVYPGKAYKH  354

Query  1102  TLHITFRV  1125
              + I F +
Sbjct  355   YMLIKFSI  362



>ref|XP_006384345.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
 gb|ERP62142.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
Length=367

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 251/369 (68%), Gaps = 31/369 (8%)
 Frame = +1

Query  82    LCFFISFALIV----------SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
              C  + F+L++          + ++   Y +KKG+FSVKLTNYGA + SL+LPDK GK+ 
Sbjct  4     FCVLLCFSLLLIFGFPAIGSATKEEIGMYELKKGNFSVKLTNYGAHIISLLLPDKYGKVA  63

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             DIVLGYDT+ EY+ D +NFGA VGRVANRI GAQFTLNG  YKL AN+G N LHGG KG 
Sbjct  64    DIVLGYDTIKEYKNDSSNFGATVGRVANRIAGAQFTLNGTLYKLVANEGKNMLHGGRKGF  123

Query  412   SKVYWKVKKHEES----SITFTYYSRDGDQ---------GFPGDVIAHVTYTIKENPYKL  552
             S V WKVKK+        I F Y+S DG++         GFPGD+   V Y +  +  KL
Sbjct  124   STVVWKVKKYSPEGRTPCIVFAYHSFDGEEVMNTFFIYTGFPGDLHVIVGYKLLGDN-KL  182

Query  553   IVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILL  732
              + M AKALNK TPVNL  H YWNLGGH+SG+ILSE++QIFA H TPVDS LIPTG+I+ 
Sbjct  183   RITMKAKALNKATPVNLVNHAYWNLGGHNSGDILSEEIQIFASHYTPVDSQLIPTGEIVT  242

Query  733   INNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGM  912
             +  T +DFLKP  +GS++ KL   + G+DINYA+DG    G  K K VA V D++SG  M
Sbjct  243   VKGTPYDFLKPNTIGSKINKL---TNGYDINYALDG---SGNDKLKKVAIVRDKKSGRMM  296

Query  913   EIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQP  1092
             EI    PGVQFYT+N L   KGKG  VYE +AALCLETQGFPD+VNHPNFPS IV P   
Sbjct  297   EILTNQPGVQFYTSNTLYQ-KGKGGFVYEPYAALCLETQGFPDSVNHPNFPSQIVNPGTY  355

Query  1093  YKHTLHITF  1119
             YKH + I F
Sbjct  356   YKHQMLIKF  364



>gb|KHG05985.1| Aldose 1-epimerase [Gossypium arboreum]
Length=359

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 206/366 (56%), Positives = 252/366 (69%), Gaps = 16/366 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSG----QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNG  222
             M+ +S  LF  F I  + I++G    +    Y +KKGD SVK TN+GA + S+ LPDK G
Sbjct  1     MAKVSLLLFSLFIIVASAIINGSAAVEKVGIYELKKGDLSVKFTNWGATIVSVFLPDKYG  60

Query  223   KLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGP  402
             K+ DIVLGYD+V +Y+ D +  G+IVGRVANRIGGAQFTLNG+HYKL  N+G N LHGGP
Sbjct  61    KMGDIVLGYDSVNDYKNDTSYIGSIVGRVANRIGGAQFTLNGVHYKLIPNEGKNMLHGGP  120

Query  403   KGISKVYWKVKKHEES----SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNA  570
              G S V WKV K+++     SI F Y S DG++GFPG +   VTYT+     +L V+M A
Sbjct  121   IGFSDVVWKVNKYKKDGYSPSIVFAYDSYDGEEGFPGALRVTVTYTLYPGN-RLTVRMKA  179

Query  571   KALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
             KALNK TPVNLAQH YWNLG H+SG+ILSE++QIFA H TPVDS LIPTG+   +  T +
Sbjct  180   KALNKATPVNLAQHTYWNLGNHNSGDILSEQVQIFASHYTPVDSQLIPTGKFAAVKGTPY  239

Query  751   DFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATA  930
             DFLKP  VGS++ KL     G+DINY +DG D     K K  A V D++SG  ME+    
Sbjct  240   DFLKPHTVGSRINKL---ENGYDINYVIDGVDG----KLKKAAVVKDKKSGRVMELFTNQ  292

Query  931   PGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
              GVQFYTAN L+DVKGK   VYE H ALCLETQ FPD+VNHPNFPSTIV P + YKH + 
Sbjct  293   AGVQFYTANSLKDVKGKDGYVYEPHGALCLETQAFPDSVNHPNFPSTIVYPGKEYKHVMV  352

Query  1111  ITFRVQ  1128
               F + 
Sbjct  353   FKFSIS  358



>ref|XP_009615365.1| PREDICTED: aldose 1-epimerase [Nicotiana tomentosiformis]
Length=353

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 247/354 (70%), Gaps = 14/354 (4%)
 Frame = +1

Query  76    LFLCFFISFALI----VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             L  CF +   ++     + ++ K Y +KKGDFSVK+TNYGA V S+ILPDKNG L D+VL
Sbjct  6     LLYCFALIILILGNPCTAEEEIKVYELKKGDFSVKITNYGATVLSVILPDKNGNLDDVVL  65

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GY+++ +Y+ D T FG ++GRVANRIGGA+F LNG+ YKL AND  NTLHGG KG S V 
Sbjct  66    GYNSIEDYKNDTTYFGGLIGRVANRIGGAKFELNGVEYKLPANDHGNTLHGGSKGFSDVI  125

Query  424   WKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPV  597
             W V+ ++E S +T TY S DG+QGFPGD+   VTY  I  N  KL +KM AK LNK TPV
Sbjct  126   WTVEDYQEDSHLTLTYNSFDGEQGFPGDLSVKVTYMFIGTN--KLAIKMQAKPLNKATPV  183

Query  598   NLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVG  777
             NLA H YWNLGGH SGNI S  +Q+F   ITPV+  LIPTGQI  +  TA+DFLKP+ +G
Sbjct  184   NLASHTYWNLGGHTSGNIFSHTIQLFGSKITPVNDKLIPTGQITPVEGTAYDFLKPRTIG  243

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
             S+ + +P   GG+DINY +D  +    +  + VA V + +SG  ME+    PGVQFYT+N
Sbjct  244   SKFSDIP---GGYDINYVLDNTEG---KHLQRVAIVQESKSGRKMELWTNKPGVQFYTSN  297

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              L++ KGKG  VY  +AALCLETQGFPD+VNHPNFPS IV P + YKH +   F
Sbjct  298   MLENAKGKGGFVYSKYAALCLETQGFPDSVNHPNFPSQIVNPGETYKHIMVYRF  351



>ref|NP_001241954.1| uncharacterized protein LOC100803092 precursor [Glycine max]
 gb|ACU21056.1| unknown [Glycine max]
Length=368

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 197/366 (54%), Positives = 257/366 (70%), Gaps = 12/366 (3%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALI--VSGQDN-KFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             M+ I   L L F  S   +   S +D+ + + +KKGDFS+K+TN+GA + S+ILPDKNGK
Sbjct  1     MTKIFVLLCLLFLASSGFVHGPSKKDHIRLFELKKGDFSIKVTNWGATLVSVILPDKNGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLGYD+   Y  D + FGA VGRVANRIGGAQFTLNGIHYKL AN+GNNTLH GPK
Sbjct  61    LGDIVLGYDSPKAYTNDTSYFGATVGRVANRIGGAQFTLNGIHYKLVANEGNNTLHSGPK  120

Query  406   GISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
               S V WKV ++    ++  ITF+Y+S DG+ GFPGD++  V+Y + +N   +I+K  AK
Sbjct  121   AFSDVLWKVTRYIKDDDKPRITFSYHSYDGEGGFPGDLLVTVSYILGKNSLSIIMK--AK  178

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVN+  H YWNLG H+SGNIL E +QIF   +T  D NLIPTGQ   +  T  D
Sbjct  179   ALNKPTPVNMVNHAYWNLGNHNSGNILDEVVQIFGSQVTLFDDNLIPTGQYASVRGTPND  238

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FL+P  VG ++ +LPK + G++INY +DG  + G  + K  A   D++SG  M++   AP
Sbjct  239   FLEPHIVGERINQLPK-TNGYNINYVLDG--EKGNAEIKLAAIAVDKKSGRVMKLFTNAP  295

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFYTAN +++ KGKG  VY+  +ALCLE+Q FPD+VNHPNFPSTIVTP +P KH + +
Sbjct  296   GLQFYTANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTPDKPCKHVMLL  355

Query  1114  TFRVQV  1131
              F  +V
Sbjct  356   KFSTKV  361



>ref|XP_006377092.1| hypothetical protein POPTR_0012s14420g [Populus trichocarpa]
 gb|ERP54889.1| hypothetical protein POPTR_0012s14420g [Populus trichocarpa]
Length=355

 Score =   380 bits (976),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 241/347 (69%), Gaps = 7/347 (2%)
 Frame = +1

Query  79    FLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTV  258
              + FF +  +    +D   Y +K GDFSVKLTNYGA V S+ILPDKNGKL DIVLG+D+V
Sbjct  13    LILFFANDDVEAVNEDIGIYELKMGDFSVKLTNYGATVISVILPDKNGKLDDIVLGFDSV  72

Query  259   MEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKK  438
              +Y+ D T FGAIVGRVANRIG AQFTL+G  YKL  NDG N LHGGPKG S+V W V  
Sbjct  73    DDYKNDTTYFGAIVGRVANRIGRAQFTLDGTDYKLVPNDGRNMLHGGPKGFSEVIWGVGS  132

Query  439   HEESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNY  618
             H+++ + FTYYS DG++GFPGDV   VTY + E   KL+VKM A  LNK TPVNLA H Y
Sbjct  133   HDDNHVKFTYYSFDGEEGFPGDVAVSVTYMLVETN-KLVVKMRAMPLNKRTPVNLALHAY  191

Query  619   WNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLP  798
             WNLGGH SG+ILS  +Q+ A  ITPVD  LIPTG+I+ + +T +DF KP+++GS   +LP
Sbjct  192   WNLGGHSSGDILSHTIQLLASEITPVDEELIPTGEIVAVEDTPYDFHKPREIGSMFTQLP  251

Query  799   KGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKG  978
                 G+DINY +   D+V     K VA V +  SG  +E+    PGVQFYT+N L +VKG
Sbjct  252   D---GYDINYVL---DNVNPGHLKKVAVVQEGVSGRKLELWTNQPGVQFYTSNMLDNVKG  305

Query  979   KGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             KG  VY  +A +CLETQGFPDAVNHP FPS IV P   Y++ +   F
Sbjct  306   KGGFVYTQYAGICLETQGFPDAVNHPRFPSQIVNPGDIYENIMIYRF  352



>ref|XP_006344389.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=355

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 241/334 (72%), Gaps = 8/334 (2%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             ++ K Y +KKGDFSVK+TNYGA V S+ILPDKNGKL D+VLGYD++ +Y+ D T FG ++
Sbjct  26    EEVKVYELKKGDFSVKITNYGATVLSVILPDKNGKLDDVVLGYDSIDDYKNDTTYFGGLI  85

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSR  477
             GRVANRIGGA+F LNG+ YKL AND  NTLHGG KG S V W V+  EE S +T TY S 
Sbjct  86    GRVANRIGGAKFELNGVEYKLPANDHGNTLHGGSKGFSSVIWTVEDFEEDSHLTLTYNSF  145

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG+QGFPG++   VTY   E   KL + M AK  NK TPVNLA H+YWNLGGH+SG+ILS
Sbjct  146   DGEQGFPGNLSVEVTYMFIETN-KLALIMQAKPHNKATPVNLASHSYWNLGGHNSGDILS  204

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             + +QIF   ITPV+  LIP G+I  +  T FDFL+P+ +GS+++++P   GG+DINY +D
Sbjct  205   QTIQIFGSKITPVNDKLIPNGEITPVKGTGFDFLQPRTIGSKLSEIP---GGYDINYVLD  261

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               +    R+   VA V + +SG  ME+    PGVQFYT+N L +VKGKG  VY  +AALC
Sbjct  262   NTEGKHLRR---VAIVQESKSGRKMELWTNKPGVQFYTSNMLDNVKGKGGFVYSKYAALC  318

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFPD+VNHPNFPS IV P + YKH +   F
Sbjct  319   LETQGFPDSVNHPNFPSQIVNPGKTYKHIMVYRF  352



>ref|XP_004138299.1| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
 ref|XP_004155064.1| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
 gb|KGN63659.1| hypothetical protein Csa_1G009630 [Cucumis sativus]
Length=354

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 249/356 (70%), Gaps = 9/356 (3%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
             M+ +  PL     ++     +G D   Y +++G+ S+KLTNYGA + S+ILPDKNGKL D
Sbjct  1     MAKVLLPLIFLLVVAAIGFSNGNDVGIYELRRGNVSIKLTNYGATILSVILPDKNGKLDD  60

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
             +VL + ++ ++  D T FG IVGRVANRIGGA+F +NG+ YKL  NDG N LHGG KG  
Sbjct  61    VVLSFPSIDDFRNDTTYFGNIVGRVANRIGGAKFGINGVFYKLIPNDGRNLLHGGKKGFG  120

Query  415   KVYWKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPT  591
              V WKV+ + + + I FTY S DG+QGFPGD+   VTY   E   KL VKM A++LNKPT
Sbjct  121   DVIWKVESYVKGNHIIFTYDSFDGEQGFPGDLQVSVTYMFLETN-KLGVKMQAESLNKPT  179

Query  592   PVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQ  771
             PVNLAQH+YWNL GH SGNILS K+++FA  ITPVDS LIPTG+I  +  T FDF  P++
Sbjct  180   PVNLAQHSYWNLDGHSSGNILSHKIKLFASSITPVDSELIPTGKITPVARTPFDFTTPRE  239

Query  772   VGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYT  951
             +GSQ+    K +GG+DINY V   DD G+   K VA+V  ++SG  ME+ +  PGVQFYT
Sbjct  240   IGSQI----KSAGGYDINYVV---DDTGSGHLKKVAEVTGKKSGRKMELWSNQPGVQFYT  292

Query  952   ANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              N L++VKGK  AVY+ +A LCLETQGFPD+VNHPNFPS IV P + Y+H +   F
Sbjct  293   GNQLKEVKGKDGAVYKQYAGLCLETQGFPDSVNHPNFPSQIVNPGESYEHVMVYRF  348



>ref|XP_002323843.2| hypothetical protein POPTR_0017s11650g [Populus trichocarpa]
 gb|EEF03976.2| hypothetical protein POPTR_0017s11650g [Populus trichocarpa]
Length=358

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 247/359 (69%), Gaps = 24/359 (7%)
 Frame = +1

Query  82    LCFFISFALIVSGQ---------DNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
              CF I   L++SG          +   Y +KKG+ S+KLTNYGAR+ SL+LPDKNGKL D
Sbjct  8     FCFII---LVISGCACIDSAMGGEIGIYELKKGNLSMKLTNYGARIISLVLPDKNGKLGD  64

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
             + LG+DT+ E+    + FGA VGRVANRI  AQFTLNG  YKL AN GNNT+HGGP G S
Sbjct  65    VALGFDTIEEFMNASSPFGATVGRVANRISNAQFTLNGTVYKLPANSGNNTIHGGPIGFS  124

Query  415   KVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALN  582
             KV WKVKK+        I F Y+S DG+QGFPGD++   +YT+  +  +L + M AKALN
Sbjct  125   KVVWKVKKYSPDGPVPHIVFAYHSFDGEQGFPGDLLVKTSYTLLGD-NQLCITMEAKALN  183

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             K TPV L  H +WNLGGH+SG+ILSEK+QIFA    PVDS LIPTG+I+ +  T +DFLK
Sbjct  184   KATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYLPVDSTLIPTGEIVTVKETPYDFLK  243

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P  +GS++ +LPK   G+D NYA+DG    G +K +  A V+DE+SG  MEI    PGVQ
Sbjct  244   PNTIGSRINELPK---GYDTNYALDG---SGNKKLRKAAIVHDEKSGRAMEILTNQPGVQ  297

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              +T+N L +VKGKG  +Y+ H AL LETQGFPD+VN PNFPS IV P +PYKH +   F
Sbjct  298   LFTSNTL-NVKGKGGFMYKPHGALSLETQGFPDSVNRPNFPSQIVNPGKPYKHYMLFKF  355



>gb|KEH24988.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=375

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 255/366 (70%), Gaps = 17/366 (5%)
 Frame = +1

Query  76    LFLCF-FISFALIVSGQDNK---------FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             + LC  F++F+  V+G  NK          + +KKGD ++K+TN+GA + SL+LPDKNG 
Sbjct  6     MLLCLLFLAFSGFVNGSMNKKEKNHDDIKLFELKKGDLTLKVTNWGATLVSLVLPDKNGN  65

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLGYDT   Y  D + FGA VGRVANRIGGAQFTLNG+ YKL AN+GNNTLHGGP+
Sbjct  66    LGDIVLGYDTPKAYTNDTSYFGATVGRVANRIGGAQFTLNGVRYKLIANEGNNTLHGGPR  125

Query  406   GISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V WKV+K+    ++  I F Y+S DG++GFPGD+   V+Y +++N   +I  M AK
Sbjct  126   GFSDVLWKVEKYVREGDQPLIKFGYHSFDGEEGFPGDLKVTVSYILRKNSLTII--MQAK  183

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             ALNKPTPVNL  H YWNLG H+SGNIL E +QIF    TP D+NLIPTG+   +  T  D
Sbjct  184   ALNKPTPVNLVNHAYWNLGNHNSGNILDEVVQIFGSKFTPFDNNLIPTGKFSSVKGTPND  243

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FLKPQ VG+++ +L K + G+++NY ++          K  A V D++SG  M++   AP
Sbjct  244   FLKPQIVGARINQLQK-TNGYNVNYVLNKGKLENKEGLKVAAIVMDKKSGRVMKLSTNAP  302

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFY+AN +++ KGKG  VY+  +ALCLE+Q FPD+VNHPNFPSTIVT ++PYKH + +
Sbjct  303   GLQFYSANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTKEKPYKHVMLL  362

Query  1114  TFRVQV  1131
              F  +V
Sbjct  363   KFSTKV  368



>ref|XP_010693333.1| PREDICTED: aldose 1-epimerase [Beta vulgaris subsp. vulgaris]
Length=380

 Score =   379 bits (974),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 201/339 (59%), Positives = 239/339 (71%), Gaps = 14/339 (4%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             Q+   Y +K G+ SVKLTNYGA V S+I+PDK GKL D+VLGYD+  EY  D T FGAIV
Sbjct  46    QEIGVYELKNGNVSVKLTNYGATVISVIVPDKYGKLADVVLGYDSAKEYVNDTTYFGAIV  105

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS----ITFTY  468
             GRVANRI GAQ+T N  HYKL AN+G N LHGGPKG S+V WKV ++   +    I F+Y
Sbjct  106   GRVANRIAGAQYTYNEKHYKLIANEGKNILHGGPKGFSRVIWKVDRYSPKAHYPHIKFSY  165

Query  469   YSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGN  648
             +S DG+QGFPG +   V Y I +  + L+V M AK LNKPTPVNLAQH YWNLGGH SGN
Sbjct  166   FSFDGEQGFPGKLKVTVIYKIIKGNH-LLVTMRAKPLNKPTPVNLAQHTYWNLGGHTSGN  224

Query  649   ILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINY  828
             IL+ ++QIFA  ITPVD NLIPTG+   +  T FDFLKP  VGS + KLPK   G+DINY
Sbjct  225   ILAHEVQIFASQITPVDKNLIPTGKFEQVKGTPFDFLKPHTVGSTINKLPK---GYDINY  281

Query  829   AVDGYDDVGTRKKKT--VAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
              VDGY    TR      VA V +++SG  ME+ A  PGVQFYT+N L +  GKG  VY  
Sbjct  282   VVDGYK---TRHAAVTPVAVVKEKKSGRVMELWANKPGVQFYTSNTL-NTTGKGGHVYGP  337

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             HAALCLETQGFPDAVNHPNFPS +V+P + Y+H +   F
Sbjct  338   HAALCLETQGFPDAVNHPNFPSVMVSPGETYEHYMLFKF  376



>ref|XP_004236201.1| PREDICTED: aldose 1-epimerase [Solanum lycopersicum]
Length=355

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 240/334 (72%), Gaps = 8/334 (2%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             ++ K Y +KKGDFSVK+TNYGA V S+ILPDKNGKL D+VLGYD++ +Y+ D T FG ++
Sbjct  26    EEIKVYELKKGDFSVKITNYGATVLSVILPDKNGKLDDVVLGYDSIDDYKNDTTYFGGLI  85

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSR  477
             GRVANRIGGA+F LNG+ Y L AND  NTLHGG KG S V W V+  EE S +T TY S 
Sbjct  86    GRVANRIGGAKFELNGVEYILPANDHGNTLHGGSKGFSSVIWTVEDFEEDSHLTLTYDSF  145

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG+QGFPG+V   VTY   E   KL + M AK  NK TPVNLA H+YWNLGGH+SG+ILS
Sbjct  146   DGEQGFPGNVSVEVTYMFIETN-KLALIMQAKPHNKATPVNLASHSYWNLGGHNSGDILS  204

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             + +QIF   ITPV+  LIP G+I  +  T FDFL+P+ +GS+++++P   GG+DINY +D
Sbjct  205   QTIQIFGSKITPVNDKLIPNGEITPVKGTGFDFLQPRTIGSKLSEIP---GGYDINYVLD  261

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               +    R+   VA V + +SG  ME+    PGVQFYT+N L +VKGKG  VY  +AALC
Sbjct  262   NTEGKHLRR---VAIVEESKSGRKMELWTNKPGVQFYTSNMLDNVKGKGGFVYSKYAALC  318

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFPD+VNHPNFPS IV P + YKH +   F
Sbjct  319   LETQGFPDSVNHPNFPSQIVNPGETYKHIMVYRF  352



>ref|XP_007151211.1| hypothetical protein PHAVU_004G027000g [Phaseolus vulgaris]
 gb|ESW23205.1| hypothetical protein PHAVU_004G027000g [Phaseolus vulgaris]
Length=368

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 250/361 (69%), Gaps = 15/361 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK-----FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             L    F++ +  V G   K      + +KK D S+K+TN+GA + SLILPDKNG L DIV
Sbjct  7     LLSLLFLATSGFVHGSHKKKDHIRLFELKKDDLSIKVTNWGATLVSLILPDKNGVLGDIV  66

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LGYD+   Y  D + FGA VGRV NRIGGAQFTLNGIHYKL AN+GNNTLH GPK  S V
Sbjct  67    LGYDSPKAYTNDSSYFGATVGRVGNRIGGAQFTLNGIHYKLVANEGNNTLHAGPKAFSDV  126

Query  421   YWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKP  588
              W V+K+    +   +TF+Y+S DG+ GFPGD+I  V+Y + +N  +++  M AKALNKP
Sbjct  127   LWTVEKYIKDGDRPRVTFSYHSFDGEGGFPGDLIVSVSYILGKNSLRIV--MKAKALNKP  184

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TPVNL  H YWNLG H+SGNIL E +QIF   +T +D +LIPTG+   +  T +DFL+P 
Sbjct  185   TPVNLLNHAYWNLGNHNSGNILDEVVQIFGSQVTLLDDHLIPTGKFASVKGTPYDFLEPH  244

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
              VG ++ +LPK + G+DINY +DG      ++ K  A V D++SG  M++   APG+QFY
Sbjct  245   IVGERINQLPK-TNGYDINYVLDG---AKGKEIKLGAIVVDKKSGRVMKVFTNAPGLQFY  300

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             TAN +++ KGKG  VY+  +ALCLE+Q FPD+VNHPNFPSTIVTPQ PYKH L + F  +
Sbjct  301   TANFVKNEKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTPQNPYKHVLLLKFSTK  360

Query  1129  V  1131
             +
Sbjct  361   I  361



>ref|XP_011029977.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=354

 Score =   375 bits (964),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 244/354 (69%), Gaps = 9/354 (3%)
 Frame = +1

Query  61    IISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIV  240
             + S  ++L  F +  +    +D   Y +K GDFSVKLTNYGA V S+ILPDKNGKL DIV
Sbjct  6     LFSCFVYLILFFANDVEAVNEDIGIYELKMGDFSVKLTNYGATVISVILPDKNGKLDDIV  65

Query  241   LGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKV  420
             LG+D+V +Y+ D T FGAIVGRVANRIG AQFTL+G  YKL  NDG N LHGG KG S+V
Sbjct  66    LGFDSVDDYKNDTTYFGAIVGRVANRIGRAQFTLDGTDYKLVPNDGRNMLHGGLKGFSEV  125

Query  421   YWKVKKHEESSITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPV  597
              W V  H+++ +TFTY S DG++GFPGDV   VTY  +K N  KL VKM A  LNK TPV
Sbjct  126   IWGVGSHDDNHVTFTYNSFDGEEGFPGDVAVSVTYMLVKTN--KLAVKMRAMPLNKRTPV  183

Query  598   NLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVG  777
             NLA H YWNLGGH SG+ILS  +Q+ A  ITPVD  LIPTG+I+ + +T +DF KP+++G
Sbjct  184   NLALHAYWNLGGHSSGDILSHTIQLLASEITPVDEELIPTGEIVAVKDTPYDFHKPREIG  243

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
             S   +LP    G+DINY +   D+V +   K VA V +  SG  +E+    PGVQFYT+N
Sbjct  244   SMFTQLPD---GYDINYVL---DNVNSGHLKKVAVVQEGVSGRKLELWTNQPGVQFYTSN  297

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              L +VKGKG  VY  +A +CLETQGFPDAVNHP FPS IV P   Y++ +   F
Sbjct  298   MLDNVKGKGGFVYAKYAGICLETQGFPDAVNHPRFPSQIVNPGDIYENIMIYRF  351



>ref|XP_004299386.1| PREDICTED: aldose 1-epimerase-like [Fragaria vesca subsp. vesca]
Length=380

 Score =   374 bits (961),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 198/356 (56%), Positives = 246/356 (69%), Gaps = 15/356 (4%)
 Frame = +1

Query  76    LFLCFFISFALIVS---GQDNK---FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDI  237
             L+ CF     LI++     D K    Y +KKG+ SVKLTNYGA V S++LPDKNGKL D+
Sbjct  29    LYWCFLFLLPLILNFSEANDEKVGDIYELKKGNISVKLTNYGATVLSVVLPDKNGKLDDV  88

Query  238   VLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNAND-GNNTLHGGPKGIS  414
             VLG++ + +Y  D   FGA VGRVANRIG A+FTLNG HYKL AND G NTLHGG KG S
Sbjct  89    VLGFEALKDYTNDSVYFGATVGRVANRIGRAEFTLNGNHYKLVANDHGKNTLHGGSKGFS  148

Query  415   KVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPT  591
              V W VK+H E+S ITFTY SRDG++GFPGD+   VTY    +   L +KM AKAL K T
Sbjct  149   DVLWTVKRHIEDSHITFTYDSRDGEEGFPGDLSVSVTYMFVGHDV-LAIKMEAKALTKVT  207

Query  592   PVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQ  771
             PVNLA H YWNL GH+SG+ILS K+ IF  +ITPV+  LIPTG I  +  TA+DFL+P++
Sbjct  208   PVNLAHHTYWNLRGHNSGDILSHKIHIFGSNITPVNDELIPTGDIAPVKGTAYDFLEPRE  267

Query  772   VGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYT  951
             +GS++ +LP    G+DINY +D       RK    A ++D  SG  ME+    PG+QFYT
Sbjct  268   IGSRINELPD---GYDINYIMDPSSPDHLRK---AAVLHDSVSGRKMELWTNQPGLQFYT  321

Query  952   ANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             +N L DVKGKG  VY+ +AA+CLETQGFPD+VNHPNFPS I+ P   Y H++   F
Sbjct  322   SNMLNDVKGKGGFVYKKYAAVCLETQGFPDSVNHPNFPSQILNPGDTYMHSMVYRF  377



>ref|XP_002323842.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEF03975.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=359

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 252/363 (69%), Gaps = 15/363 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             M+ ++  L  C    F  +      +    Y +K+GD S+K TN+GA + S +LPDKNGK
Sbjct  1     MAKVTVLLCFCILAVFGSVNAHTGKEKVGIYELKRGDMSLKFTNWGATLVSFVLPDKNGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLGYDT+ +Y+ D T FGAIVGRVANRI GAQF LNG  YKL  N+G N LHGGPK
Sbjct  61    LIDIVLGYDTIKQYKNDTTYFGAIVGRVANRIKGAQFKLNGHTYKLVPNEGKNMLHGGPK  120

Query  406   GISKVYWKVKKHE----ESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G + V W+V K++    +  I F+Y+S DG++GFPG+++  V YT+  +  ++ V M AK
Sbjct  121   GYADVVWEVTKYQNKGHKPHIVFSYHSFDGEEGFPGEILVTVRYTLLADN-QVTVVMKAK  179

Query  574   AL-NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
              + NK TPVN+A H YWNLGGH+SG+ILSEK+QIFA + TPVD++LIPTG+I  +  T F
Sbjct  180   NIGNKATPVNIANHAYWNLGGHNSGDILSEKIQIFASNYTPVDNDLIPTGKIEAVKGTPF  239

Query  751   DFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATA  930
             DFLKP+ +GS+  +LPK   G+DINYA+DG      RK    A + DE+SGI ME+   A
Sbjct  240   DFLKPEAIGSRTRQLPK---GYDINYALDGVHGGKIRK---AAVLQDEKSGIEMELSTNA  293

Query  931   PGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
             PG+QFYT N ++DVKGK   VY++HAALCLETQ +PD VN P+FP +IV P++ YKH + 
Sbjct  294   PGLQFYTGNMIKDVKGKAGFVYKAHAALCLETQWYPDYVNQPDFPQSIVEPRKNYKHVML  353

Query  1111  ITF  1119
               F
Sbjct  354   YKF  356



>ref|XP_009803676.1| PREDICTED: aldose 1-epimerase [Nicotiana sylvestris]
Length=353

 Score =   373 bits (957),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 244/354 (69%), Gaps = 14/354 (4%)
 Frame = +1

Query  76    LFLCFFISFALI----VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             L  CF +   ++     + ++ K Y +KKGDFSVK+TNYGA V S++LPDKNGKL D+VL
Sbjct  6     LLYCFALVILILGNICRAEEEIKVYELKKGDFSVKITNYGATVLSVVLPDKNGKLDDVVL  65

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GY+++ +Y+ D T FG ++GRVANRIGGA+F LNG+ YKL AND  NTLHGG KG S V 
Sbjct  66    GYNSIDDYKNDTTYFGGLIGRVANRIGGAKFELNGVEYKLPANDHGNTLHGGSKGFSDVI  125

Query  424   WKVKKHE-ESSITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPV  597
             W V+ ++ +S +T TY S DG+QGFPGD+   V Y  I  N  KL + M A  LN  TPV
Sbjct  126   WTVEDYQADSHLTLTYKSFDGEQGFPGDLSVKVKYMFIGTN--KLAINMQATPLNIATPV  183

Query  598   NLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVG  777
             NLA H YWNLGGH SGNI S  +Q+F   +TPVD  LIPTGQI  +  TA+DFLKP+ +G
Sbjct  184   NLASHTYWNLGGHTSGNIFSHTIQLFGSKMTPVDDKLIPTGQITPVEGTAYDFLKPRTIG  243

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
             S+ + +P   GG+DINY +D  +    +K   VA V + +SG  ME+    PGVQFYT+N
Sbjct  244   SKFSDIP---GGYDINYVLDNTEGKHLQK---VAIVQESKSGRKMELWTNKPGVQFYTSN  297

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              L++ KGKG  VY  +AALCLETQGFPD+VNHPNFPS IV P + YKH +   F
Sbjct  298   MLENAKGKGGFVYSKYAALCLETQGFPDSVNHPNFPSQIVNPGETYKHIMVYRF  351



>ref|XP_010032358.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW51761.1| hypothetical protein EUGRSUZ_J01219 [Eucalyptus grandis]
Length=382

 Score =   374 bits (960),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 243/336 (72%), Gaps = 11/336 (3%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ S++LTN+GA + SL+LPDKNGKL D++LG+D+V +Y+ D   FG++VGRVA
Sbjct  53    IYELKKGNISLRLTNWGATIMSLLLPDKNGKLDDVILGFDSVNDYKNDSAYFGSVVGRVA  112

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES----SITFTYYSRD  480
             NRI  AQFTLNG  YKL  N+G N LHGGPKG S V WKV ++++      I F+Y+S +
Sbjct  113   NRIANAQFTLNGTRYKLTPNEGKNMLHGGPKGFSDVVWKVTRYQKDGHTPRIVFSYFSHN  172

Query  481   GDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSE  660
             G++GFPGD+   V+YTI  + + L + M AKALNK TPVNLAQH YWNLGG + GNILSE
Sbjct  173   GEEGFPGDLQVSVSYTILGDNH-LSISMKAKALNKATPVNLAQHTYWNLGGQNRGNILSE  231

Query  661   KLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG  840
             ++QIFA  ITP DS LIPTG+I+ +  T +DFL+P+ VGS++ KLP    G+DINY +  
Sbjct  232   EVQIFASQITPCDSQLIPTGKIIPVKGTPYDFLEPRTVGSRINKLPN---GYDINYVL--  286

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
              D   + K    A V D++SG  +E+    PGVQFYT+N ++++KGKG  VY+ HAALCL
Sbjct  287   -DSAQSTKLHRAAIVRDKKSGRVLELVTNQPGVQFYTSNMIKEIKGKGGFVYKKHAALCL  345

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             ETQ +PD+V+HPNFPS IV P + Y+H +   F V+
Sbjct  346   ETQKYPDSVHHPNFPSEIVYPGKSYEHVMLFKFTVE  381



>ref|XP_009779451.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 235/309 (76%), Gaps = 13/309 (4%)
 Frame = +1

Query  214   KNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLH  393
             + GK+ D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LH
Sbjct  167   EEGKIGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLH  226

Query  394   GGPKGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVK  561
             GG KG SKV WKV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V 
Sbjct  227   GGLKGFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVV  285

Query  562   MNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINN  741
               A+ALNK TP+NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + N
Sbjct  286   FKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKN  345

Query  742   TAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIK  921
             T +DFLKP++VGS++ K+     G+DINYA+D      +RK K VA V+D++SG  M+IK
Sbjct  346   TPYDFLKPRKVGSRIDKI---QNGYDINYALDS-----SRKMKPVAIVFDKKSGRVMDIK  397

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
             ATAPGVQFYTAN + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H
Sbjct  398   ATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLH  457

Query  1102  TLHITFRVQ  1128
             ++  TF ++
Sbjct  458   SVLYTFSIK  466


 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 122/168 (73%), Gaps = 8/168 (5%)
 Frame = +1

Query  55   MSIISAPLFLCFFI---SFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
            MS   +PL +CFFI   S A  V G+    Y IKKGDFSVK+TNYGAR+ S++LPDK+GK
Sbjct  17   MSSKISPLLICFFILHLSAAASVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGK  76

Query  226  LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
            + D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPK
Sbjct  77   IGDVVLGYDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPK  136

Query  406  GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKE  537
            G SKV WKV K+ +      IT TYYS DG++G  GDV+     TIKE
Sbjct  137  GFSKVVWKVSKYVKDGPWPYITLTYYSADGEEGKIGDVVLGYD-TIKE  183



>ref|XP_009779453.1| PREDICTED: aldose 1-epimerase-like isoform X3 [Nicotiana sylvestris]
Length=450

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 235/309 (76%), Gaps = 13/309 (4%)
 Frame = +1

Query  214   KNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLH  393
             + GK+ D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LH
Sbjct  150   EEGKIGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLH  209

Query  394   GGPKGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVK  561
             GG KG SKV WKV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V 
Sbjct  210   GGLKGFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVV  268

Query  562   MNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINN  741
               A+ALNK TP+NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + N
Sbjct  269   FKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKN  328

Query  742   TAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIK  921
             T +DFLKP++VGS++ K+     G+DINYA+D      +RK K VA V+D++SG  M+IK
Sbjct  329   TPYDFLKPRKVGSRIDKI---QNGYDINYALDS-----SRKMKPVAIVFDKKSGRVMDIK  380

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
             ATAPGVQFYTAN + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H
Sbjct  381   ATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLH  440

Query  1102  TLHITFRVQ  1128
             ++  TF ++
Sbjct  441   SVLYTFSIK  449


 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 115/161 (71%), Gaps = 8/161 (5%)
 Frame = +1

Query  76   LFLCFFISF---ALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
            + +CFFI     A  V G+    Y IKKGDFSVK+TNYGAR+ S++LPDK+GK+ D+V G
Sbjct  7    VLICFFILHLWAATSVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGKIGDVVSG  66

Query  247  YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
            YD + EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPKG SKV W
Sbjct  67   YDAIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427  KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKE  537
            KV K+ +      IT TYYS DG++G  GDV+     TIKE
Sbjct  127  KVSKYVKDGPWPYITLTYYSADGEEGKIGDVVLGYD-TIKE  166



>ref|XP_011071623.1| PREDICTED: aldose 1-epimerase [Sesamum indicum]
Length=353

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/353 (55%), Positives = 245/353 (69%), Gaps = 9/353 (3%)
 Frame = +1

Query  70    APLFLCFFIS-FALIVSGQDN-KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             A L LC  I+ FAL     +    Y +++GDFSVK+TNYGA V S++LPD+NGKL D+VL
Sbjct  4     AYLCLCVLITAFALSCEAAEKIGIYELQRGDFSVKITNYGATVLSVVLPDRNGKLDDVVL  63

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GY ++ EY+ D T FGAIVGRVANRIGGA+FTLNG  Y L AND  NTLHGG  G S V 
Sbjct  64    GYGSIDEYKNDTTYFGAIVGRVANRIGGAKFTLNGKLYNLPANDHGNTLHGGTIGFSDVV  123

Query  424   WKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVN  600
             W V+ + + S +T TY+S DG+QGFPGD+   VTY + +   KL +KM AK+LNKPTPVN
Sbjct  124   WTVESYVKNSHLTLTYHSHDGEQGFPGDLSVMVTYMLIDTN-KLGIKMQAKSLNKPTPVN  182

Query  601   LAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGS  780
             LA H YWNLGGH SG+ILS  +++ A  ITPVD  LIPTG+I  +  T +DFL+ +++GS
Sbjct  183   LASHTYWNLGGHTSGDILSHTIRLQASRITPVDDKLIPTGEISPVKGTPYDFLERRKIGS  242

Query  781   QMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANH  960
             +  +LP    G+DINY +D   D   +    VA V++E+SG  ME+    PGVQFYT+N 
Sbjct  243   KFTELPD---GYDINYVLDRTGD--GKHFMKVATVHEEKSGRKMELWTNQPGVQFYTSNM  297

Query  961   LQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             L D  GKG  VY+ HAA CLETQGFPD+VNHPNFPS I+ P   Y+H +   F
Sbjct  298   LPDTVGKGGFVYKKHAAFCLETQGFPDSVNHPNFPSQILLPGVEYRHVMVYRF  350



>ref|XP_011008940.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=359

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/364 (53%), Positives = 253/364 (70%), Gaps = 17/364 (5%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNK---FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             M+ ++  L  C    F  + +  +      Y +K+GD S+K TN+GA + S +LPDKNGK
Sbjct  1     MAKVTVLLCFCVLAVFGSVKAHTEKGKVGIYELKRGDMSLKFTNWGATLVSFVLPDKNGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLGYDT+ +Y+ D T FGAIVGRVANRI GAQF LNG  YKL  N+G N LHGGPK
Sbjct  61    LIDIVLGYDTINQYKNDTTYFGAIVGRVANRIKGAQFKLNGHTYKLVPNEGKNMLHGGPK  120

Query  406   GISKVYWKVKKHE----ESSITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNA  570
             G + V W+V K++    +  I F+Y+S DG++GFPG+++  V YT + EN  ++ V M A
Sbjct  121   GYADVVWEVTKYQNKGHKPHIVFSYHSFDGEEGFPGEILVTVRYTLLAEN--QVTVVMKA  178

Query  571   KAL-NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTA  747
             K + NK TPVN+A H YWNLGGH+ G ILSEK+QIFA + TPVDS+LIPTG+I  +  T 
Sbjct  179   KNIGNKATPVNIANHAYWNLGGHNRGGILSEKIQIFASNYTPVDSDLIPTGKIEAVKGTP  238

Query  748   FDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKAT  927
             FDFLKP+ +GS+  +LPK   G+DINYA+DG      RK    A ++DE+SGI ME+   
Sbjct  239   FDFLKPKAIGSRTKQLPK---GYDINYALDGVHGGKIRK---AAVLHDEKSGIEMELSTN  292

Query  928   APGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTL  1107
             APG+QFYT N ++DVKGK   VY++HAALCLETQ +PD +N P+FP +IV P++ YKH +
Sbjct  293   APGLQFYTGNMIKDVKGKDGFVYKAHAALCLETQWYPDYLNQPDFPQSIVEPRKNYKHVM  352

Query  1108  HITF  1119
                F
Sbjct  353   LYKF  356



>ref|XP_009779452.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Nicotiana sylvestris]
Length=450

 Score =   375 bits (962),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 235/309 (76%), Gaps = 13/309 (4%)
 Frame = +1

Query  214   KNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLH  393
             + GK+ D+VLGYDT+ EY+ D + FGA +GRVANRIGGAQFTLNG HYKL AN+G N LH
Sbjct  150   EEGKIGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLH  209

Query  394   GGPKGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVK  561
             GG KG SKV WKV K+        IT TYYS DG++GFPGDV+  VTY +K+ PYKL V 
Sbjct  210   GGLKGFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKD-PYKLSVV  268

Query  562   MNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINN  741
               A+ALNK TP+NL+ H YWN+GGH+SG++LS+ LQI+A HITP+D   IPTG+I  + N
Sbjct  269   FKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEISPVKN  328

Query  742   TAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIK  921
             T +DFLKP++VGS++ K+     G+DINYA+D      +RK K VA V+D++SG  M+IK
Sbjct  329   TPYDFLKPRKVGSRIDKI---QNGYDINYALDS-----SRKMKPVAIVFDKKSGRVMDIK  380

Query  922   ATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKH  1101
             ATAPGVQFYTAN + + KGKG  VY+ H+ALCLETQGFPDAVNHPNFPSTIVTP + Y H
Sbjct  381   ATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLH  440

Query  1102  TLHITFRVQ  1128
             ++  TF ++
Sbjct  441   SVLYTFSIK  449


 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 114/161 (71%), Gaps = 8/161 (5%)
 Frame = +1

Query  76   LFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
            L +C  I   L+   V G     Y IKKGDFSVK+TNYGA + S++LPDK+GK+ D+VLG
Sbjct  7    LLVCLIIFHLLVAASVRGHKIGIYEIKKGDFSVKITNYGASIISVLLPDKHGKIGDVVLG  66

Query  247  YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
            YDT+ EY+ D + FGA +GRVANRIGGAQFTLNGIHYKL  N+G N LHGGPKG SKV W
Sbjct  67   YDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427  KVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKE  537
            KV K+ +      IT TYYS DG++G  GDV+     TIKE
Sbjct  127  KVSKYVKDGPWPYITLTYYSADGEEGKIGDVVLGYD-TIKE  166



>ref|XP_006439628.1| hypothetical protein CICLE_v10024457mg [Citrus clementina]
 gb|ESR52868.1| hypothetical protein CICLE_v10024457mg [Citrus clementina]
Length=359

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 242/359 (67%), Gaps = 19/359 (5%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK---------FYVIKKGDFSVKLTNYGARVASLILPDKNGKL  228
             L  C+FI   L  + +  +          Y +K+GD S+K TNYGA + S ++PDKNGKL
Sbjct  6     LVFCYFIVLVLFFTNKKCQATESCEAVGVYKLKRGDLSLKFTNYGATMLSAVIPDKNGKL  65

Query  229   TDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKG  408
              DIVLG+D+V +Y+ D+T FGAIVGRVANRI  AQF+LNG  Y+L  NDG+N LHGGP+G
Sbjct  66    ADIVLGFDSVKDYKTDNTYFGAIVGRVANRISRAQFSLNGTRYQLINNDGDNMLHGGPRG  125

Query  409   ISKVYWKVKKHE-ESSITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALN  582
              S+V WKVK HE  S ITFTY S +G+QGFPGD+   VTY  + EN   L+VKM AK L 
Sbjct  126   FSEVIWKVKSHEVNSHITFTYNSLEGEQGFPGDLAVSVTYMFVGEN--NLVVKMKAKPLE  183

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             K TPVNLA H YWNLGGH SG+I S KLQ+F  H+TPV+  LIPTG+I  +  T +DFL+
Sbjct  184   KATPVNLALHTYWNLGGHSSGDIFSHKLQLFGSHVTPVNDRLIPTGKITPVTGTPYDFLQ  243

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P+++GS+  +LP    G+DINY +   D+      K VA V +  SG  ME+    PGVQ
Sbjct  244   PREIGSKFKELPD---GYDINYVL---DNPNPEHLKKVAVVSESVSGRKMELWTNKPGVQ  297

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FYT+N L  VKGK   VY ++A  CLETQGFPD+VN+PNFPS +V P + Y H +   F
Sbjct  298   FYTSNMLGKVKGKDGFVYSNYAGFCLETQGFPDSVNNPNFPSQVVNPGETYNHVMVYRF  356



>gb|KDO76084.1| hypothetical protein CISIN_1g043310mg [Citrus sinensis]
Length=359

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 241/359 (67%), Gaps = 19/359 (5%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK---------FYVIKKGDFSVKLTNYGARVASLILPDKNGKL  228
             L  C+FI   L  + +  +          Y +K+GD S+K TNYGA + S ++PDKNGKL
Sbjct  6     LVFCYFIVLVLFFTNKKCQATESCEAVGVYKLKRGDLSLKFTNYGATMLSAVIPDKNGKL  65

Query  229   TDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKG  408
              DIVLG+D+V +Y+ D+T FGAIVGRVANRI  AQFTLNG  Y+L  NDG+N LHGGP+G
Sbjct  66    ADIVLGFDSVKDYKTDNTYFGAIVGRVANRISRAQFTLNGTRYQLINNDGDNMLHGGPRG  125

Query  409   ISKVYWKVKKHE-ESSITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALN  582
              S+V WKVK HE  S ITFTY S +G+QGFPGD+   VTY  + EN   L+VKM AK L 
Sbjct  126   FSEVIWKVKSHEVNSHITFTYNSLEGEQGFPGDLAVSVTYMFVGEN--NLVVKMKAKPLE  183

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             K TPVNLA H YWNLGGH SG+I S KLQ+F  H+TPV+  LIPTG+I  +  T +DFL+
Sbjct  184   KATPVNLALHTYWNLGGHSSGDIFSHKLQLFGSHVTPVNDRLIPTGKITPVTGTPYDFLQ  243

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P+++GS+  +LP    G+DINY +   D+      K VA V +  SG  ME+    PGVQ
Sbjct  244   PREIGSKFKELPD---GYDINYVL---DNPNPEHLKKVAVVSESVSGRKMELWTNKPGVQ  297

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FYT+N L  V GK   VY ++A  CLETQGFPD+VN+PNFPS +V P + Y H +   F
Sbjct  298   FYTSNMLGKVMGKDGFVYSNYAGFCLETQGFPDSVNNPNFPSQVVNPGETYNHVMVYRF  356



>ref|XP_008784468.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=358

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 237/333 (71%), Gaps = 11/333 (3%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +KKGDFSVK+TN+GA + S++LPD  G L D+VLG+D +  Y  +   FGA+VGRV 
Sbjct  31    FYELKKGDFSVKVTNWGATIVSIVLPDSKGNLADVVLGFDGLGPYINNSAYFGALVGRVG  90

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDG  483
             NRI GA+F LNG  Y+L ANDGNN+LHGG +G S V W VK+    E   IT  Y+S DG
Sbjct  91    NRISGARFVLNGKAYRLYANDGNNSLHGGHRGFSHVIWTVKEKVDGEFPYITLYYHSFDG  150

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+   VTY I    Y+L V M+AK++NK TPVNL QH YWNLGGH+SG ILS  
Sbjct  151   EQGFPGDLDVSVTYKI-SGAYELSVTMDAKSVNKATPVNLLQHTYWNLGGHNSGTILSNT  209

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD-G  840
             +QIFA H+TP DS+LIPTG+I+ ++ T +DFLKP  VGS++ +L   +GG+DINY +D  
Sbjct  210   VQIFASHVTPSDSHLIPTGEIVSVSGTPYDFLKPMIVGSRINEL---TGGYDINYVLDLP  266

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
              D  G RK   VA V D  SG   E+ +  PGVQFYT+N L+DVKGKG  VY  HAALCL
Sbjct  267   MDSHGMRK---VAVVKDGGSGRAFELWSNQPGVQFYTSNSLKDVKGKGGFVYGQHAALCL  323

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             ETQGFPDAVNHPNFPS IV P + YKH +   F
Sbjct  324   ETQGFPDAVNHPNFPSQIVNPGEVYKHYMLFKF  356



>ref|XP_009401394.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=360

 Score =   370 bits (951),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 200/364 (55%), Positives = 248/364 (68%), Gaps = 18/364 (5%)
 Frame = +1

Query  64    ISAPLFLCF--FISFALI---VSGQDNK---FYVIKKGDFSVKLTNYGARVASLILPDKN  219
             ++ P FL F  F++ AL+    S    K   FY +KKGDFSVK+TN+GA + S++LPD  
Sbjct  1     MAKPPFLPFLLFVASALLSTSCSAAPRKKVAFYELKKGDFSVKVTNWGAIITSVVLPDSK  60

Query  220   GKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGG  399
             G L D+VLGYD +  Y  +  NFGA+VGRVANRI GA+F LNG  Y+L+ N GNNTLHGG
Sbjct  61    GNLGDVVLGYDGLGPYINNSANFGAVVGRVANRISGARFVLNGKVYRLSKNSGNNTLHGG  120

Query  400   PKGISKVYWKVKKH---EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNA  570
              +G S V W VK+    E   IT  Y+S DG+QGFPG +   VTY I   PY+L + M A
Sbjct  121   HRGFSHVIWTVKEKVDGEFPYITLYYHSFDGEQGFPGALDVFVTYKISA-PYELSIAMCA  179

Query  571   KALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
             K+LNK TPVNLAQH+YWNLGGH SG ILS  +QIF+  ITPVD+NLIP G I+ ++ T +
Sbjct  180   KSLNKATPVNLAQHSYWNLGGHGSGTILSNMVQIFSSKITPVDANLIPIGTIVPVSGTPY  239

Query  751   DFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYD-ERSGIGMEIKAT  927
             DFLKP  VGS++ KL   SGG+DINY +D    +G+   + VA V D + SG   E+ A 
Sbjct  240   DFLKPTTVGSRIDKL---SGGYDINYVLD--QPIGSNGMRKVAVVKDGDGSGRAFELWAN  294

Query  928   APGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTL  1107
              PGVQFYT N L +VKGKG  +Y  HA LCLETQGFPD+VNHPNFPS IV P + YKH +
Sbjct  295   QPGVQFYTGNFLNNVKGKGGQIYGKHAGLCLETQGFPDSVNHPNFPSQIVNPGKDYKHNM  354

Query  1108  HITF  1119
                F
Sbjct  355   LFKF  358



>ref|XP_010029392.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW83563.1| hypothetical protein EUGRSUZ_B00459 [Eucalyptus grandis]
Length=356

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/329 (57%), Positives = 238/329 (72%), Gaps = 8/329 (2%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++ G F+ + TNYGA + SL+LPD+NGKL D+VLG+D++  Y+ D T FGA+VGRVAN
Sbjct  32    YELRSGYFTAQFTNYGATMLSLVLPDRNGKLDDVVLGFDSLKGYKNDTTYFGAVVGRVAN  91

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE-ESSITFTYYSRDGDQG  492
             RI GAQFTLNG  YKL ANDGNNTLHGG KG + V W+V  ++ ES +TFTY S +G+QG
Sbjct  92    RIAGAQFTLNGTAYKLVANDGNNTLHGGSKGFADVIWRVHSYDTESHVTFTYDSFNGEQG  151

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPGD+  +VTY +     KL VK+ AKAL+K TPVNLA H YWNL G +SGNILS ++Q+
Sbjct  152   FPGDLSVYVTYMLIGTD-KLGVKLEAKALDKSTPVNLALHTYWNLAGQNSGNILSHEIQL  210

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             FA  ITPVDS LIPTG+I  I  + +DFL+P  +GSQ+ ++P   GG+DINY +   DD 
Sbjct  211   FASKITPVDSALIPTGEIRDIRRSPYDFLEPHTIGSQINEVP---GGYDINYVL---DDT  264

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
             G++  K VA V D  SG  +E+ +  PGVQFYT+N +  V GKG  VY  +A LCLETQG
Sbjct  265   GSKHLKKVAIVQDNHSGRKLELWSNQPGVQFYTSNMIDHVVGKGGFVYTKYAGLCLETQG  324

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FPDAVNHPNFPS IV P Q Y++ +   F
Sbjct  325   FPDAVNHPNFPSQIVNPGQHYENVMVFRF  353



>ref|XP_006477524.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=359

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 240/359 (67%), Gaps = 19/359 (5%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNK---------FYVIKKGDFSVKLTNYGARVASLILPDKNGKL  228
             L  C+FI   L ++    +          Y +K+GD S+K TNYGA + S ++PDK GKL
Sbjct  6     LVFCYFIVLVLFLTNNKCQATESCEAVGVYKLKRGDLSLKFTNYGATMLSAVIPDKYGKL  65

Query  229   TDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKG  408
              DIVLG+D+V +Y+ D+T FGAIVGRVANRI  AQFTLNG  Y+L  NDG+N LHGGP+G
Sbjct  66    ADIVLGFDSVKDYKTDNTYFGAIVGRVANRISRAQFTLNGTRYQLINNDGDNMLHGGPRG  125

Query  409   ISKVYWKVKKHE-ESSITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALN  582
              S+V WKVK HE  S ITFTY S +G+QGFPGD+   VTY  + EN   L+VKM AK L 
Sbjct  126   FSEVIWKVKSHEVNSHITFTYNSLEGEQGFPGDLAVSVTYMFVGEN--NLVVKMKAKPLE  183

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             K TPVNLA H YWNLGGH SG+I S KLQ+F  H+TPVD  LIPTG+I  +  T +DFL+
Sbjct  184   KATPVNLALHTYWNLGGHSSGDIFSHKLQLFGSHVTPVDDRLIPTGKITPVTGTPYDFLQ  243

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P+++GS+  +LP    G+DINY +   D+      K VA V +  SG  ME+    PGVQ
Sbjct  244   PREIGSKFKELPD---GYDINYVL---DNPNPEHLKKVAVVSESVSGRKMELWTNKPGVQ  297

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FYT+N L  V GK   VY ++A  CLETQGFPD+VN+PNFPS +V P + Y H +   F
Sbjct  298   FYTSNMLGKVMGKDGFVYSNYAGFCLETQGFPDSVNNPNFPSQVVNPGETYNHVMVYRF  356



>ref|XP_010937062.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=358

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 234/333 (70%), Gaps = 11/333 (3%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +KKGDF VK+TN+GA + S++LPD  G L D+VLG+D +  Y  +   FGA+VGRV 
Sbjct  31    FYELKKGDFCVKVTNWGATIVSVVLPDSKGNLADVVLGFDGLGPYINNSAYFGALVGRVG  90

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDG  483
             NRI GA+F LNG  Y+L ANDGNN+LHGG +G S V W VK+    E   IT  Y+S DG
Sbjct  91    NRISGARFVLNGKAYRLYANDGNNSLHGGHRGFSHVIWTVKEKVDGEFPYITLYYHSFDG  150

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+  +VTY I    Y+L V M+AK  NK TPVNL QH YWNLGGH+SG ILS  
Sbjct  151   EQGFPGDLDVYVTYKI-SGAYELSVAMDAKPGNKATPVNLLQHTYWNLGGHNSGTILSNT  209

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG-  840
             +QIFA H+TP DS+LIPTG+I  ++ T +DFLKP  VGS++ +L   +GG+DINY +D  
Sbjct  210   VQIFASHVTPTDSHLIPTGEIRSVSGTPYDFLKPMIVGSRINEL---TGGYDINYVLDSP  266

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
              D  G RK   VA V D  SG   E+ +  PGVQFYT+N L+DVKGKG  VY  HAALCL
Sbjct  267   MDGHGMRK---VAVVKDGGSGRAFELWSNQPGVQFYTSNFLKDVKGKGGFVYGQHAALCL  323

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             ETQGFPDAVNHPNFPS IV P + YKH +   F
Sbjct  324   ETQGFPDAVNHPNFPSIIVNPGEVYKHYMLFKF  356



>ref|XP_007099714.1| Galactose mutarotase-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY20329.1| Galactose mutarotase-like superfamily protein, putative [Theobroma 
cacao]
Length=438

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 234/334 (70%), Gaps = 12/334 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +KKGD SVK TN+GA +  ++LPDK GKL DI LGYD+V EY  D +  G+IVGRVAN
Sbjct  111   YELKKGDLSVKFTNWGATIVQVVLPDKYGKLGDIALGYDSVQEYMNDTSYVGSIVGRVAN  170

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES----SITFTYYSRDG  483
             RI GAQFTL G+HYKL  N+G N LHGGP G S V WKV+K+++     SI F Y S DG
Sbjct  171   RIAGAQFTLKGVHYKLIPNEGKNMLHGGPIGFSDVVWKVEKYKKDGHAPSIVFAYDSYDG  230

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPG +   V YT+     KL V M A ALNK TPVNLAQH YWNLG H+SG+ILSE+
Sbjct  231   EQGFPGALKVTVAYTLLPGN-KLTVTMKANALNKATPVNLAQHTYWNLGNHNSGDILSEE  289

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +QIFA   TPVDS LIPTG+   +  T +DFLK   VGS++ KLP    G+DINY +DG 
Sbjct  290   VQIFASQYTPVDSQLIPTGEFASVKGTPYDFLKSHTVGSRINKLPS---GYDINYVLDG-  345

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
                   K K VA V D++SG  ME+    PGVQFYTAN L+DVKGKG  VY+ H ALCLE
Sbjct  346   ---APGKIKKVAVVKDKKSGRVMELLTNQPGVQFYTANFLKDVKGKGGYVYQPHGALCLE  402

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             TQGFPD+VNHPNFPSTI+ P + YKH +   F +
Sbjct  403   TQGFPDSVNHPNFPSTIIYPGKEYKHIMLFKFSI  436



>gb|KDP45488.1| hypothetical protein JCGZ_09737 [Jatropha curcas]
Length=357

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/354 (55%), Positives = 246/354 (69%), Gaps = 20/354 (6%)
 Frame = +1

Query  94    ISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQ  273
             I+F    +    +F+ +KKG+ ++KLTN+GA + SLI+PDK GK  D+VLGYDT+ EYE+
Sbjct  9     IAFEFASTNAKAEFFELKKGNITLKLTNWGATIVSLIIPDKTGKPVDVVLGYDTIAEYEK  68

Query  274   DDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES-  450
             D   FGA VGRVANRIGGAQF LNG  YKL AN+G NT+HGGPKG SKV WK  K+++  
Sbjct  69    DTEYFGATVGRVANRIGGAQFKLNGKVYKLVANEGKNTIHGGPKGFSKVLWKAIKNKKDG  128

Query  451   ---SITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALN-KPTPVNLAQHN  615
                SI+F Y S DGDQGFPG + A VTY+ I +N + +I  M AK+L+ KPTPV+LAQH 
Sbjct  129   PTPSISFAYNSPDGDQGFPGAIRATVTYSIIADNQFSII--MKAKSLDKKPTPVSLAQHT  186

Query  616   YWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDF------LKPQQVG  777
             YWNL GH+SG+IL+ KLQI     T VD++LIPTGQIL    TA+DF      LKP  VG
Sbjct  187   YWNLAGHNSGDILNSKLQIKGQFYTVVDNDLIPTGQILYARGTAYDFTEEYYELKP--VG  244

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
              ++  LP    G+D+NY +D Y D  T   + VA + DE++GI M++ + APG+QFYTAN
Sbjct  245   KRITLLPN---GYDVNYVLDAYTDAKT-PMRMVANLQDEKTGIRMDLNSNAPGLQFYTAN  300

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              L DVKGKG AVY+ HA LCLETQ +PD  NHP FP +IV   + Y+H +   F
Sbjct  301   KLNDVKGKGGAVYKKHAGLCLETQWYPDFPNHPTFPQSIVEGGKVYRHEMMFNF  354



>ref|XP_004173979.1| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
 gb|KGN46963.1| hypothetical protein Csa_6G153465 [Cucumis sativus]
Length=358

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 246/365 (67%), Gaps = 14/365 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             M + S    +   IS   +   +  Q+   Y +KKG+FSVK TNYGA + S+++PDK G 
Sbjct  1     MGMFSTLFQVILIISIGRVNGCICNQNIGVYELKKGNFSVKFTNYGASIISIVVPDKYGN  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLG+DT  +Y +   NFGAIVGRVANRI  AQF LNG  Y+L  NDGNNT+HGG +
Sbjct  61    LDDIVLGFDTTQDYVRRRGNFGAIVGRVANRISNAQFILNGTLYRLEPNDGNNTIHGGSR  120

Query  406   GISKVYWKVK----KHEESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G S V W+V     +     I FTY S +G++GFPGD+IA V+Y +     +L V+M A 
Sbjct  121   GFSHVIWEVNTKSTQDPNPQIHFTYRSFNGEEGFPGDLIATVSYYLLSET-QLAVEMKAI  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             AL++PTPVNLAQH YWNLGGH+S +ILS ++QIF   ITPVD+++IPTG+I+ +  T +D
Sbjct  180   ALDQPTPVNLAQHAYWNLGGHNSEDILSHQIQIFGSRITPVDTHMIPTGEIMPVQGTPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FL P+ +G  M KLP    GFDI Y +DG   +  R+ +  A + + +SG  +E+   A 
Sbjct  240   FLTPKIIGDNMKKLPN---GFDIYYVLDG---LKGRENRKAATLRERKSGRVLELWTNAD  293

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFYT N L+++ GKG  VYE+HA LC+ETQGFPDAVNHPNFPS IVT + PY+H++  
Sbjct  294   GLQFYTGNWLRNLTGKGGFVYEAHAGLCMETQGFPDAVNHPNFPSHIVTKESPYEHSMLF  353

Query  1114  TFRVQ  1128
              F  +
Sbjct  354   KFSTE  358



>ref|XP_007037277.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY21778.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=455

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 232/329 (71%), Gaps = 8/329 (2%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +KKGDF    TNYGA + SL+LPDK GKL DIVLGYD+V +Y+ D T FGAIVGRVAN
Sbjct  131   YELKKGDFFANFTNYGAVMLSLVLPDKTGKLDDIVLGYDSVEDYKNDTTYFGAIVGRVAN  190

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGDQG  492
             RI GA+FT+NG+ YKL AN+G NTLHGG KG + V W V+ +++ S +TFTYYS DG+QG
Sbjct  191   RIKGAEFTINGVSYKLVANEGKNTLHGGSKGFADVIWHVRNYKQDSHVTFTYYSFDGEQG  250

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPG++   VTY I     KL VKM AK LNK TPVNLA H YWNLGGH SG+ILS  LQ+
Sbjct  251   FPGNLQVSVTYMII-GTNKLGVKMEAKPLNKATPVNLALHTYWNLGGHSSGDILSHTLQL  309

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             F   ITPVD  LIPTG+I  +  T +DFL+P ++GS + +LP    G+D+NY +D     
Sbjct  310   FGSSITPVDDELIPTGKIDPVQGTPYDFLQPHEIGSMLDQLPH---GYDVNYVLDKSSPQ  366

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
               RK   VA V++ +SG  ME+    PGVQ YT+N L+  KGK   VY ++A LCLETQG
Sbjct  367   HLRK---VAVVHESKSGRKMELWTNKPGVQVYTSNMLKSEKGKDGFVYSTYAGLCLETQG  423

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FPD+VNHPNFPS IV P + YKH +   F
Sbjct  424   FPDSVNHPNFPSQIVNPGETYKHFMVFRF  452



>ref|XP_002268039.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
 emb|CBI15252.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 243/355 (68%), Gaps = 13/355 (4%)
 Frame = +1

Query  82    LCFFISFALIVS-----GQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             LC F+  A  ++       +   Y +K+G+FSVKLTNYGA V S+ILPD+NGKL D+VLG
Sbjct  7     LCCFLLLAFAIAKVSEASSEIGVYELKRGNFSVKLTNYGATVVSVILPDRNGKLDDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             +D+V +Y+ D T FGAIVGRVANRI GAQFTLNG  YKL  N+G N LHGGPKG S V W
Sbjct  67    FDSVEDYKNDTTYFGAIVGRVANRIKGAQFTLNGKKYKLVPNEGKNMLHGGPKGFSDVIW  126

Query  427   KVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
              V+ ++++S +TF Y+S DG++GFPGD+   VTY   +   KL++KM  + LNK TPVNL
Sbjct  127   HVQSYDKNSHVTFVYHSFDGEEGFPGDLHVSVTYMFFQTN-KLVIKMTGRPLNKATPVNL  185

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             A H+YWNLGGH SG++ S ++Q+FA  ITPVD  LIPTG+IL +  T +DFL   ++ ++
Sbjct  186   ASHSYWNLGGHSSGDVFSHQVQLFADKITPVDDELIPTGKILPVEGTPYDFLNIHEIKTR  245

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
               +LP    G+DINY +   + VG       A VY+ +SG  ME+    PG+QFYT+N L
Sbjct  246   FHELPS---GYDINYVL---NYVGNEHFHKAAVVYESKSGRKMELWTNQPGLQFYTSNML  299

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
               VKGKG   Y ++  +CLETQGFPDAVNHP+FPS IV P + Y+H +   F  +
Sbjct  300   GTVKGKGGVTYNNYDGICLETQGFPDAVNHPDFPSQIVNPGEIYEHFMVYRFTAK  354



>gb|AAM61410.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
Length=358

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 194/354 (55%), Positives = 247/354 (70%), Gaps = 13/354 (4%)
 Frame = +1

Query  64    ISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             +S  + L   ++++L    +  K Y + +G  SV  TNYGA + SL+LPD++GK  D+VL
Sbjct  13    VSVLMVLLCSVNYSLC---EKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVVL  69

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             G+DTV  Y+ D T FGAIVGRVANRIGGA+F LNG  YK + N+G+NTLHGG KG S V 
Sbjct  70    GFDTVDGYKNDTTYFGAIVGRVANRIGGAKFKLNGHLYKTDPNEGHNTLHGGSKGFSDVI  129

Query  424   WKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPV  597
             W V+K+  +S ITFTY S DG++GFPG+V   VTY  I EN  KL VKM AK LNKPTP+
Sbjct  130   WSVQKYVPTSHITFTYDSFDGEEGFPGNVTVKVTYMLIGEN--KLGVKMEAKPLNKPTPI  187

Query  598   NLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVG  777
             NLA H YWNL  H+SGNILS K+Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++G
Sbjct  188   NLALHTYWNLHSHNSGNILSHKIQLLAGKITPVDDKLIPTGEITSIAGTPYDFLEPREIG  247

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
             S++ +LP   GG+DINY +DG   +G   +KT A V +E +G  ME+    PGVQFYT+N
Sbjct  248   SRIHELP---GGYDINYVIDG--PIGKHLRKT-AVVTEEVTGRKMELWTNQPGVQFYTSN  301

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              ++ V GKG AVYE +  LCLETQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  302   MMKRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  355



>ref|XP_003579891.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=363

 Score =   363 bits (932),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/360 (51%), Positives = 242/360 (67%), Gaps = 10/360 (3%)
 Frame = +1

Query  58    SIISAPLFLCFFISFALIVSGQDNKFYVIK--KGDFSVKLTNYGARVASLILPDKNGKLT  231
             +++     LC  ++     +G+   FY +K  KGDFS+K+TN+GA + S+++PD  G L 
Sbjct  5     AVLPIAFLLCLALAGGADAAGKAVGFYELKNKKGDFSIKVTNWGAALVSVVVPDCKGNLD  64

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+VLGYDTV  Y     +FGA VGRVANRI  ++F L+G  Y+L  NDGNN++HGG +G 
Sbjct  65    DVVLGYDTVAAYVNGSGSFGATVGRVANRIANSRFVLDGKAYRLFRNDGNNSIHGGHRGF  124

Query  412   SKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
              KV W VK++    +   ITF Y+S DG+QGFPGD+  +VTY +  +PY L ++M+A AL
Sbjct  125   GKVIWTVKEYVRDGDSPYITFFYHSFDGEQGFPGDLDVYVTYQL-SSPYVLSIRMHATAL  183

Query  580   NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFL  759
             +K TPVNLA H YWNLGGH SG++L  +LQ+ A   TP+D + IPTGQI  ++ T +DFL
Sbjct  184   SKATPVNLANHAYWNLGGHGSGDVLKHELQLLASRYTPLDKSKIPTGQIAAVSGTMYDFL  243

Query  760   KPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGV  939
              P+ VG  M  +P G GG+DINYAVDG D    R+   VA+V D  SG  ME+ A  PGV
Sbjct  244   APKPVGKHMEIVPGGGGGYDINYAVDGEDQYAMRR---VARVRDPASGRAMEVWANQPGV  300

Query  940   QFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             Q YT+N + + KGK   VY+ + ALCLETQ +PDAVNHP FPS+IV P Q YKH + I F
Sbjct  301   QLYTSNWVINEKGKAGKVYQQYGALCLETQAYPDAVNHPEFPSSIVRPGQAYKHDMEIKF  360



>ref|XP_010426233.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=360

 Score =   363 bits (932),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 245/349 (70%), Gaps = 11/349 (3%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
             + LC  + ++L    +  K Y + +G+FSV  TNYGA + SL+LPD++GK  D+VLG+D+
Sbjct  19    VLLCCCVDYSL--CEKKIKTYKLTRGNFSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDS  76

Query  256   VMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVK  435
             +  Y+ D T FGAIVGRVANRIGGAQF LNG  YK + NDG NTLHGG KG S V W V+
Sbjct  77    LDSYKNDTTYFGAIVGRVANRIGGAQFKLNGQLYKTSPNDGYNTLHGGTKGFSDVIWSVQ  136

Query  436   KHEESS-ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQH  612
              +  +S ITF Y S DG++GFPG+V   VTY I +N   L VKM AK LNKPTP+NLA H
Sbjct  137   SYVPTSHITFKYNSFDGEEGFPGNVTVKVTYMIGKN--ILGVKMEAKPLNKPTPINLALH  194

Query  613   NYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAK  792
              YWNL GH+SG+ILS K+Q+ A  ITPVD  LIPTG+I  IN T +DFL+P+++GS++ +
Sbjct  195   TYWNLHGHNSGDILSHKIQLLADKITPVDDTLIPTGEITSINGTPYDFLEPREIGSRIHE  254

Query  793   LPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDV  972
             LP   GG+DINY +DG   +G   +KT A V ++ +G  ME+    PGVQFYT+N L+ V
Sbjct  255   LP---GGYDINYIIDG--PIGKHLRKT-AVVTEDITGRKMELWTNQPGVQFYTSNMLKRV  308

Query  973   KGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              GKG AVY  +  LCLETQGFPD+VNH NFP+ IV+P + Y H +   F
Sbjct  309   VGKGKAVYGKYGGLCLETQGFPDSVNHKNFPTQIVSPGETYLHVMLFRF  357



>ref|NP_190364.1| putative aldose 1-epimerase [Arabidopsis thaliana]
 emb|CAB41863.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|AAL36040.1| AT3g47800/T23J7_130 [Arabidopsis thaliana]
 gb|AAO42757.1| At3g47800/T23J7_130 [Arabidopsis thaliana]
 dbj|BAE99082.1| aldose 1-epimerase - like protein [Arabidopsis thaliana]
 gb|AEE78330.1| putative aldose 1-epimerase [Arabidopsis thaliana]
Length=358

 Score =   362 bits (930),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 193/354 (55%), Positives = 246/354 (69%), Gaps = 13/354 (4%)
 Frame = +1

Query  64    ISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             +S  + L   ++++L    +  K Y + +G  SV  TNYGA + SL+LPD++GK  D+VL
Sbjct  13    VSVLMVLLCSVNYSLC---EKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVVL  69

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             G+DTV  Y+ D T FGAIVGRVANRIGGA+F LNG  YK + N+G NTLHGG KG S V 
Sbjct  70    GFDTVDGYKNDTTYFGAIVGRVANRIGGAKFKLNGHLYKTDPNEGRNTLHGGSKGFSDVI  129

Query  424   WKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPV  597
             W V+K+  +S ITFTY S DG++GFPG+V   VTY  I EN  KL VKM AK LNKPTP+
Sbjct  130   WSVQKYVPTSHITFTYDSFDGEEGFPGNVTVKVTYMLIGEN--KLGVKMEAKPLNKPTPI  187

Query  598   NLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVG  777
             NLA H YWNL  H+SGNILS K+Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++G
Sbjct  188   NLALHTYWNLHSHNSGNILSHKIQLLAGKITPVDDKLIPTGEITSITGTPYDFLEPREIG  247

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
             S++ +LP   GG+DINY +DG   +G   +KT A V ++ +G  ME+    PGVQFYT+N
Sbjct  248   SRIHELP---GGYDINYVIDG--PIGKHLRKT-AVVTEQVTGRKMELWTNQPGVQFYTSN  301

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              ++ V GKG AVYE +  LCLETQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  302   MMKRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  355



>ref|XP_006291372.1| hypothetical protein CARUB_v10017512mg [Capsella rubella]
 gb|EOA24270.1| hypothetical protein CARUB_v10017512mg [Capsella rubella]
Length=358

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 249/357 (70%), Gaps = 11/357 (3%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
             ++++S  + +         VS +  K Y + +G  SV  TNYGA + SL+LPD++GK  D
Sbjct  8     LNVLSVSVLMVLLSCVDYSVS-EKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDD  66

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
             +VLG+DTV  Y+ D T FGAIVGRVANRIGGA+F LNG  +K + N+G+NTLHGG KG S
Sbjct  67    VVLGFDTVDAYKNDTTYFGAIVGRVANRIGGAKFKLNGQFFKTDPNEGHNTLHGGTKGFS  126

Query  415   KVYWKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKP  588
              V W V+ ++ +S ITFTY S DG++GFPGDV   VTY  I EN  KL VKM AK LNKP
Sbjct  127   DVIWSVRNYDPTSHITFTYDSFDGEEGFPGDVTVKVTYMLIGEN--KLGVKMEAKPLNKP  184

Query  589   TPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ  768
             TP+NLA H YWNL GH+SG+ILS K+Q+FA  ITPVD  LIPTG+I  I+ T +DFL+P+
Sbjct  185   TPINLALHTYWNLRGHNSGDILSHKIQLFAGKITPVDDKLIPTGEITSISGTPYDFLEPR  244

Query  769   QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFY  948
             ++G+++ +LP   GG+DINY +DG   +G   +K  A V ++ +G  ME+    PGVQFY
Sbjct  245   RIGARIHELP---GGYDINYVIDG--QIGKHLRK-AAVVTEDVTGRKMELWTNQPGVQFY  298

Query  949   TANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             T+N ++ V GKG+AVY  +  LCLETQGFPD+VNH NFP+ IV P + Y H +   F
Sbjct  299   TSNMMKRVVGKGNAVYGKYGGLCLETQGFPDSVNHKNFPTQIVNPGESYLHVMLFRF  355



>ref|XP_002875866.1| hypothetical protein ARALYDRAFT_906011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52125.1| hypothetical protein ARALYDRAFT_906011 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 245/354 (69%), Gaps = 13/354 (4%)
 Frame = +1

Query  64    ISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             +S  + L   ++++L    +  K Y + +G  SV  TNYGA + SL+LPD++GK  D+VL
Sbjct  13    VSVLMVLLCCVNYSLC---EKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVVL  69

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             G+DTV  Y+ D T FGAIVGRVANRIGGA+F LNG  YK + N+G+NTLHGG KG S V 
Sbjct  70    GFDTVDGYKNDTTYFGAIVGRVANRIGGAKFKLNGQLYKTDPNEGHNTLHGGTKGFSDVI  129

Query  424   WKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPV  597
             W V+ +  +S ITFTY S DG++GFPG+V   VTY  I EN  KL VKM AK LNKPTP+
Sbjct  130   WSVQNYVPTSHITFTYNSFDGEEGFPGNVTVKVTYMLIGEN--KLGVKMEAKPLNKPTPI  187

Query  598   NLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVG  777
             NLA H YWNL  H+SG+ILS K+Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++G
Sbjct  188   NLALHTYWNLHSHNSGDILSHKIQLLAGKITPVDDKLIPTGEITSITGTPYDFLEPREIG  247

Query  778   SQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTAN  957
             S++ +LP   GG+DINY +DG   +G   +KT A V +E +G  ME+    PGVQFYT+N
Sbjct  248   SRIHELP---GGYDINYVIDG--PIGKHLRKT-AVVTEEVTGRKMELWTNQPGVQFYTSN  301

Query  958   HLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              +  V GKG AVYE +  LCLETQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  302   MMTRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  355



>ref|XP_008453675.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=337

 Score =   360 bits (923),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 241/359 (67%), Gaps = 24/359 (7%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTD  234
             M+ I  P+FL    +     +G +   + +K+GDFS++LTNYGA + S+ILPDKN     
Sbjct  1     MAKILPPIFLLVVATIGF-SNGHEVGIFELKRGDFSIQLTNYGATILSVILPDKN-----  54

Query  235   IVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGIS  414
                       ++ D T FG IVGRVANRIGGAQF +NG+ +KL  N+G N LHGG +G  
Sbjct  55    ---------VWQNDTTYFGNIVGRVANRIGGAQFGINGVFHKLIPNNGRNLLHGGKRGFG  105

Query  415   KVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPT  591
              V WKVK + + S ITFTY S DG+QGFPGD+   VTY I E   KL +KM AK++NKPT
Sbjct  106   DVIWKVKSYVKNSHITFTYDSFDGEQGFPGDLPVSVTYMIIET-NKLGIKMEAKSINKPT  164

Query  592   PVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQ  771
             PVNLAQH YWNL GH SGNILS K+++FA  ITPVD+ LIPTG+I  +  T +DF  P++
Sbjct  165   PVNLAQHAYWNLDGHSSGNILSHKIKLFASSITPVDNELIPTGEITPVAGTPYDFTTPRE  224

Query  772   VGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYT  951
             + SQ+    K +GG+DINY VD   D G+   K VA+V  ++SG  ME+ +  PGVQFYT
Sbjct  225   IRSQI----KSAGGYDINYVVD---DTGSEHLKKVAEVTGKKSGRKMELWSNQPGVQFYT  277

Query  952   ANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             AN L  VKGK  AVYE+HA LCLETQGFPDA+NHPNFPS IV P + Y H +   F V 
Sbjct  278   ANKLNGVKGKDGAVYENHAGLCLETQGFPDALNHPNFPSQIVNPGESYVHVMVYRFTVH  336



>ref|XP_003579892.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=367

 Score =   361 bits (926),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 240/370 (65%), Gaps = 20/370 (5%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDNKF---YVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             M+ +   + LC  + FA   S    K    Y ++KGDFSVK+TN+GA V S++ PD  G 
Sbjct  1     MARVPLLVALCL-VCFASGASAAGRKMVGVYELRKGDFSVKVTNWGATVTSVVFPDSKGN  59

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYDT+ EY    + FGA+VGRVANR+  A+F L+G  Y L ANDG N LHGG +
Sbjct  60    LGDVVLGYDTIAEYVNGSSYFGALVGRVANRVAKARFVLDGKVYNLYANDGKNALHGGHR  119

Query  406   GISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G SKV W VK++    +   IT  Y+S DG+QGFPGD+  +VTY +  +PY L V+MNA 
Sbjct  120   GFSKVIWTVKEYVAGGDSPHITLYYHSFDGEQGFPGDLDVYVTYEL-SSPYVLRVRMNAT  178

Query  574   ALNKPTPVNLAQHNYWNLGGHDSG-NILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
             AL+K TPVNLAQH YWNLGG  SG ++L   +Q+FA H TPVD  LIPTGQ+  +  T +
Sbjct  179   ALDKATPVNLAQHTYWNLGGQGSGRDVLGHTVQLFAAHYTPVDGTLIPTGQLAPVAGTPY  238

Query  751   DFLKPQQVGSQMAKLPKGSG------GFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGM  912
             D   P  VG+++ ++  GS       GFDINYAVDG D    R  + VA V D  SG  M
Sbjct  239   DLRTPTAVGARVRQVSGGSSNGSAVYGFDINYAVDGED---ARALRKVAVVRDGASGRAM  295

Query  913   EIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTP-QQ  1089
             E+ A  PGVQFYT N L+DVKGKG AVY  + ALCLETQGFPDAVN P FPS IV P Q 
Sbjct  296   ELWADQPGVQFYTGNFLKDVKGKGGAVYGQYGALCLETQGFPDAVNQPGFPSQIVRPGQA  355

Query  1090  PYKHTLHITF  1119
              YKH +   F
Sbjct  356   AYKHDMVFKF  365



>ref|XP_002318873.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEE97093.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=345

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 233/347 (67%), Gaps = 17/347 (5%)
 Frame = +1

Query  79    FLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTV  258
              + FF +  +    +D   Y +K GDFSVKLTNYGA V S+ILPDKNGKL DIVLG+D+V
Sbjct  13    LILFFANDDVEAVNEDIGIYELKMGDFSVKLTNYGATVISVILPDKNGKLDDIVLGFDSV  72

Query  259   MEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKK  438
              +Y+ D T FGAIVGRVANRIG AQFTL+G  YKL  NDG N LHGGPKG S+V W V  
Sbjct  73    DDYKNDTTYFGAIVGRVANRIGRAQFTLDGTDYKLVPNDGRNMLHGGPKGFSEVIWGVGS  132

Query  439   HEESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNY  618
             H+++ + FTYYS DG++GFPGDV   VTY + E   KL+VKM A  LNK TPVNLA H Y
Sbjct  133   HDDNHVKFTYYSFDGEEGFPGDVAVSVTYMLVETN-KLVVKMRAMPLNKRTPVNLALHAY  191

Query  619   WNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLP  798
             WNLGGH SG+ILS  +Q+ A  ITPVD  LIPTG+I+ + +T +DF KP+++GS   +LP
Sbjct  192   WNLGGHSSGDILSHTIQLLASEITPVDEELIPTGEIVAVEDTPYDFHKPREIGSMFTQLP  251

Query  799   KGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKG  978
                 G+DINY +   D+V     K VA V +  SG  +E+    PGVQFYT+        
Sbjct  252   D---GYDINYVL---DNVNPGHLKKVAVVQEGVSGRKLELWTNQPGVQFYTSGF------  299

Query  979   KGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
                 VY  +A +CLETQGFPDAVNHP FPS IV P   Y++ +   F
Sbjct  300   ----VYTQYAGICLETQGFPDAVNHPRFPSQIVNPGDIYENIMIYRF  342



>ref|NP_001169820.1| hypothetical protein precursor [Zea mays]
 gb|ACN34992.1| unknown [Zea mays]
 gb|AFW71980.1| hypothetical protein ZEAMMB73_754437 [Zea mays]
Length=381

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 241/367 (66%), Gaps = 26/367 (7%)
 Frame = +1

Query  79    FLCFFISFALIVSGQDNK-----------FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
              LC  ++ A+  SG +N             + ++ GDFSVK+TN+GA + S+ILPD  G 
Sbjct  18    LLC--LAVAVCFSGGENAAAAAWTRKIVGVHELRVGDFSVKVTNWGATLMSVILPDSKGN  75

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L D+VLGYDTV EY      FG ++GRVANR+ GA+FTL+G  Y+L  NDGNN+LHGG +
Sbjct  76    LGDVVLGYDTVAEYVNGTAYFGGLIGRVANRVAGARFTLDGKAYRLYRNDGNNSLHGGHR  135

Query  406   GISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G SKV W VK+H    +   IT  Y+S DG+QGFPGD+  +VTY +   PY L V+MNA 
Sbjct  136   GFSKVVWTVKEHVGGGDSPYITLYYHSFDGEQGFPGDLDVYVTYRLSR-PYVLSVRMNAT  194

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             A ++ TPVNLA H YWNLGGH SG +L E +Q+FA   TPVD+ L+PTG +  +  T +D
Sbjct  195   ARSRATPVNLAHHAYWNLGGHGSGPVLGETVQLFASRYTPVDAALVPTGALAPVAGTPYD  254

Query  754   FLKPQQVGSQMAKL-PK----GSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEI  918
             F  P  VG+++A L P+    G  G+D NYAVDG     +   + VA+V+D  +G  ME+
Sbjct  255   FRAPAPVGARLADLRPRRGTGGVAGYDTNYAVDG---AASPSLRPVARVWDGATGRAMEL  311

Query  919   KATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYK  1098
              A  PGVQFYT+N L  V+GKG +VY  +AALCLETQGFPDAVNHP+FPS IV P + Y 
Sbjct  312   WADQPGVQFYTSNGLAGVRGKGGSVYRRYAALCLETQGFPDAVNHPSFPSQIVRPGKVYS  371

Query  1099  HTLHITF  1119
             H +   F
Sbjct  372   HDMLFKF  378



>emb|CDY36929.1| BnaA06g17140D [Brassica napus]
Length=357

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 238/332 (72%), Gaps = 10/332 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             K Y + +G  SV  TNYGA + SL+LPD++GK  D+VLG+DTV  Y+ D T FGAIVGRV
Sbjct  31    KTYKLTRGKLSVTFTNYGAVMISLLLPDRHGKQDDVVLGFDTVDAYKNDTTYFGAIVGRV  90

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGD  486
             ANRIGGA+F LNG  YK + N+G+NTLHGG KG   V W V+ +  +S ITF Y+S DG+
Sbjct  91    ANRIGGAKFELNGQLYKTDPNEGHNTLHGGTKGFGDVIWSVENYVPTSHITFIYHSFDGE  150

Query  487   QGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +GFPG+V   VTY  I EN  KL +KM AK LNKPTP+NLA H YWNL GH+SG+ILS K
Sbjct  151   EGFPGNVTVKVTYMLIGEN--KLALKMEAKPLNKPTPINLALHTYWNLHGHNSGDILSHK  208

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++GS++ +LP   GG+DINY +DG 
Sbjct  209   IQLLAKKITPVDEELIPTGEITSIKGTPYDFLEPREIGSRIHELP---GGYDINYVIDGI  265

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
               VG   +KT A V ++ +G  ME+    PGVQFYT+N L+ V GKG+AVY+ +A LCLE
Sbjct  266   --VGKHLRKT-AVVSEKVTGRKMELWTNQPGVQFYTSNLLKSVVGKGNAVYKKYAGLCLE  322

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             TQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  323   TQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  354



>ref|XP_010916998.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
 ref|XP_010916999.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
 ref|XP_010917000.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=358

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 228/335 (68%), Gaps = 11/335 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K+GDFSVK+TN+GA + S+ILPD  GKL D+VLGYD +  Y  D T FGA+VGRVAN
Sbjct  31    YELKRGDFSVKVTNWGATILSVILPDSKGKLNDVVLGYDKIGSYVNDTTYFGALVGRVAN  90

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDGD  486
             RI  A+F++NG  YKL  NDGNNTLHGG +G ++V W VK+    E   ITF Y+S DG+
Sbjct  91    RIADARFSINGTVYKLIRNDGNNTLHGGHRGFNRVIWTVKEKVDGEFPYITFYYHSFDGE  150

Query  487   QGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKL  666
             QGFPGD+   VTY I  + Y   V M A   NKPTPVNLAQH YWNLGGHDSG IL   +
Sbjct  151   QGFPGDLDVFVTYKIDYD-YVFSVSMRAVPRNKPTPVNLAQHTYWNLGGHDSGTILKHSV  209

Query  667   QIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYD  846
             QIFA H TPVD NLIPTG+I  +  T +DF KP    S++ +LP   GG+DINY +D   
Sbjct  210   QIFASHFTPVDKNLIPTGKIAPVEGTPYDFRKPMTSASRIDQLP---GGYDINYVLDSPT  266

Query  847   DV-GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
             DV G RK   VA V D  SG  +E+ A  PGVQFYT N L+D KGKG   Y+ H  LCLE
Sbjct  267   DVQGVRK---VAIVEDCESGRVLELWANQPGVQFYTGNFLKDEKGKGGHHYKQHDGLCLE  323

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             TQ FPDAVNHPNFP  + +P + YKH +   F ++
Sbjct  324   TQDFPDAVNHPNFPREVYSPGEVYKHYMLYKFALK  358



>ref|XP_009149871.1| PREDICTED: aldose 1-epimerase [Brassica rapa]
Length=357

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 237/332 (71%), Gaps = 10/332 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             K Y + +G  SV  TNYGA + SL+LPD++GK  D+VLG+DTV  Y+ D T FGAIVGRV
Sbjct  31    KTYKLTRGKLSVTFTNYGAVMISLLLPDRHGKQDDVVLGFDTVDAYKNDTTYFGAIVGRV  90

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGD  486
             ANRIGGA+F LNG  YK + N+G+NTLHGG KG   V W V+ +  +S ITF Y+S DG+
Sbjct  91    ANRIGGAKFELNGQLYKTDPNEGHNTLHGGTKGFGDVIWSVENYVPTSHITFIYHSFDGE  150

Query  487   QGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +GFPG+V   VTY  I EN  KL +KM AK LNKPTP+NLA H YWNL GH+SG+ILS K
Sbjct  151   EGFPGNVTVKVTYMLIGEN--KLALKMEAKPLNKPTPINLALHTYWNLHGHNSGDILSHK  208

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++GS++ +LP   GG+DINY +DG 
Sbjct  209   IQLLAKKITPVDEELIPTGEITSIKGTPYDFLEPREIGSRIQELP---GGYDINYVIDGI  265

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
               VG   +KT A V ++ +G  ME+    PGVQFYT+N L  V GKG+AVY+ +A LCLE
Sbjct  266   --VGKHLRKT-AVVSEKVTGRKMELWTNQPGVQFYTSNLLTSVVGKGNAVYKKYAGLCLE  322

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             TQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  323   TQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  354



>ref|XP_010503389.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=360

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 242/349 (69%), Gaps = 11/349 (3%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDT  255
             + LC  + ++L    +  K Y + +G+FSV  TNYGA + SL+LPD++GK  D+VLG+D+
Sbjct  19    VLLCCCVDYSL--CEKKIKTYKLTRGNFSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDS  76

Query  256   VMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVK  435
             +  Y+ D T FGAIVGRVANRIGGAQF LNG  YK + NDG NTLHGG KG S V W V+
Sbjct  77    LDSYKNDTTYFGAIVGRVANRIGGAQFKLNGQLYKTSPNDGYNTLHGGTKGFSDVIWSVQ  136

Query  436   KHEESS-ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQH  612
              +  +S ITF Y S DG++GFPG+V   VTY I +N   L VKM AK LNKPTP+NLA H
Sbjct  137   SYVPTSHITFKYDSFDGEEGFPGNVTVKVTYMIGKN--ILGVKMEAKPLNKPTPINLALH  194

Query  613   NYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAK  792
              YWNL  H+SG+ILS K+Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++GS++ +
Sbjct  195   TYWNLRSHNSGDILSHKIQLLADKITPVDDTLIPTGEITSIAGTPYDFLEPREIGSRIHE  254

Query  793   LPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDV  972
             LP   GG+DINY +DG   +G   +KT A V ++ +G  ME+    PGVQFYT+N L+ V
Sbjct  255   LP---GGYDINYIIDG--PIGKHLRKT-AVVTEDVTGRKMELWTNQPGVQFYTSNMLKRV  308

Query  973   KGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              GKG AVY  +  LCLETQGFPD+VNH NFP+ IV P + Y H +   F
Sbjct  309   VGKGKAVYGKYGGLCLETQGFPDSVNHKNFPTQIVNPGETYLHVMLFRF  357



>ref|XP_006404339.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
 gb|ESQ45792.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
Length=350

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 184/330 (56%), Positives = 233/330 (71%), Gaps = 10/330 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y + +G+ SV  TNYGA + SL+LPD++GK  D+VLG+DTV  Y+ D T FGAIVGRVAN
Sbjct  26    YKLTRGNLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTVDGYKNDTTYFGAIVGRVAN  85

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGDQG  492
             RIGGA+F LNG  YK + N+G+NTLHGG KG S V W V+ +  +S ITF Y S DG++G
Sbjct  86    RIGGAEFELNGQMYKTDPNEGHNTLHGGAKGFSDVIWSVENYVPTSHITFKYDSFDGEEG  145

Query  493   FPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             FPG+V   VTY  I EN  KL VKM AK +NKPTP+NLA H YWNL  H+SG+ILS K+Q
Sbjct  146   FPGNVTVKVTYMLIGEN--KLAVKMEAKPINKPTPINLALHTYWNLHSHNSGDILSHKIQ  203

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             + A  ITPVD  LIPTG+I  I  T +DFL+P+++GS++ +LP   GG+DINY +DG   
Sbjct  204   LLAGKITPVDKKLIPTGEITAIEGTPYDFLEPREIGSRIDELP---GGYDINYVIDG---  257

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
             +  +  +  A V +E +G  ME+ +  PGVQFYT+N L  V GK  AVY+ HA LCLETQ
Sbjct  258   IAGKHLRKTAIVSEESTGRKMELWSNQPGVQFYTSNLLTRVAGKERAVYKKHAGLCLETQ  317

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFPD+VNH NFPS IV P + Y H +   F
Sbjct  318   GFPDSVNHNNFPSQIVNPGESYLHVMLFRF  347



>ref|XP_008811569.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=358

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 229/335 (68%), Gaps = 11/335 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K+GDFSVK+TN+GA + S+ILPD  GKL D+VLGYD +  Y  + T FGA+VGRVAN
Sbjct  31    YELKRGDFSVKVTNWGATIISVILPDSKGKLNDVVLGYDKIGSYVNETTYFGALVGRVAN  90

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDGD  486
             RI  A+F++NG  YKL  NDGNNTLHGG +G ++V W V++    E   ITF Y+S DG+
Sbjct  91    RIADARFSINGTVYKLFPNDGNNTLHGGHRGFNQVIWTVRERVDGEFPYITFYYHSFDGE  150

Query  487   QGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKL  666
             QGFPGD+   VTY I  + Y L V M A   NKPTPVNLAQH+YWNLGGHDSG IL   +
Sbjct  151   QGFPGDLDVFVTYKIDYD-YVLSVSMRAVPRNKPTPVNLAQHSYWNLGGHDSGTILKHSV  209

Query  667   QIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYD  846
             QIFA HITPVD NLIPTG+I  +  T +DF +P  V S++  +P   GG+DINY +D   
Sbjct  210   QIFASHITPVDKNLIPTGEIEPVAGTPYDFREPMTVASRIDHVP---GGYDINYVLDAPT  266

Query  847   DV-GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
             DV G RK   VA V D  SG  +E+    PGVQFYT N L+D KGKG   Y+ H  LCLE
Sbjct  267   DVQGVRK---VAIVEDCESGRVLELWTNQPGVQFYTGNFLKDEKGKGGHYYKQHDGLCLE  323

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             TQ FPDAVNHP FP  I +P + YKH +   F V+
Sbjct  324   TQNFPDAVNHPQFPREIYSPGEVYKHYMLYKFSVK  358



>gb|AFK38126.1| unknown [Lotus japonicus]
Length=354

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 236/353 (67%), Gaps = 12/353 (3%)
 Frame = +1

Query  76    LFLCFFISFALIVSGQ--DNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVL  243
             L   F +   ++   Q  DNK  FY +KKG+F + LTNYGA V S+I+PDK+G L DI L
Sbjct  6     LVSSFLLGLLVLSQAQANDNKIGFYELKKGNFRLNLTNYGATVVSVIVPDKHGNLADIAL  65

Query  244   GYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVY  423
             GYDTV  Y+ D   FGA+VGRVANRIG AQFTL+G  YKL AND +NTLHGGP G   V 
Sbjct  66    GYDTVDGYKNDGVYFGALVGRVANRIGNAQFTLDGKTYKLPANDKDNTLHGGPTGFGDVV  125

Query  424   WKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVN  600
             W VK H E+S ITFTY+S D +QGFPG +   VTY I     KL V+M A  ++KPTPVN
Sbjct  126   WTVKTHKEDSHITFTYHSFDNEQGFPGQLEVSVTYMIIGTN-KLGVRMIATPVDKPTPVN  184

Query  601   LAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGS  780
             LAQH YWNL GHDSG+ILS  +QIF   ITPVD  LIPTG+   +  T +DFL+P++VGS
Sbjct  185   LAQHTYWNLRGHDSGDILSHTVQIFGSKITPVDDELIPTGEFQEVKGTPYDFLEPKEVGS  244

Query  781   QMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANH  960
             Q+  LP   G +D+NY +D       RK   VA V D   G  +E+ +  PGVQ+YT+  
Sbjct  245   QIHDLP---GLYDVNYVLDPSSPQHLRK---VAIVKDNVFGRKLELWSNQPGVQYYTSGM  298

Query  961   LQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             L+D KGKG A Y  ++ + LETQGFPD+VNHPNFPS IV P Q YKH +   F
Sbjct  299   LKDTKGKGGATYHQYSGIALETQGFPDSVNHPNFPSMIVRPGQTYKHYMVYRF  351



>ref|XP_003575218.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=378

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 244/374 (65%), Gaps = 31/374 (8%)
 Frame = +1

Query  79    FLCFFISFALIV----------SGQDNKF---YVIKKGDFSVKLTNYGARVASLILPDKN  219
              L F +++ L+           +G+  K    Y +KKGDFS+K+TN+GA + S+ILPD  
Sbjct  7     LLRFVLAWCLVALALSGGGTDAAGEKRKMVGVYELKKGDFSIKVTNWGATLMSVILPDSR  66

Query  220   GKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGG  399
             G L D+VLGYDTV EY      FG ++GRVANRI  A+FTL+G  ++L  NDGNNTLHGG
Sbjct  67    GNLADVVLGYDTVAEYVNGSAYFGGLIGRVANRIADARFTLDGKAHRLFPNDGNNTLHGG  126

Query  400   PKGISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMN  567
              +G SKV W VK+H +      IT  Y S DG+QGFPGD+  +VTY I   P+ L V+MN
Sbjct  127   HRGFSKVVWTVKEHVDGGDYPFITLFYRSFDGEQGFPGDLDVYVTYEI-SGPHALSVRMN  185

Query  568   AKALNKPTPVNLAQHNYWNLGGHDSG--NILSEKLQIFAYHITPVD-SNLIPTGQILLIN  738
             A AL+K TPVNLA H YWNLGGH SG  +IL E+L++FA   TP D + LIPTG +  + 
Sbjct  186   ATALSKATPVNLAHHAYWNLGGHGSGAKSILGEELRLFASRYTPADAATLIPTGALAPVA  245

Query  739   NTAFDFLKPQQVGSQMAKLPK----GS-GGFDINYAVDG-YDDVGTRKKKTVAKVYDERS  900
              T +DF +P  VGS+MA L +    GS  GFD NYAVDG   ++G  ++  VA V D  S
Sbjct  246   GTPYDFRRPASVGSRMAALLRRYHGGSVAGFDTNYAVDGAASELGGMRR--VAVVRDGAS  303

Query  901   GIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVT  1080
             G  ME+ A  PGVQFYT N L  V+GKG  VY  + ALCLETQGFPDAVNHPNFPS IV 
Sbjct  304   GRAMELWADQPGVQFYTGNGLSGVRGKGGQVYARYGALCLETQGFPDAVNHPNFPSQIVR  363

Query  1081  PQQPYKHTLHITFR  1122
             P Q Y H  H+ F+
Sbjct  364   PGQVYSH--HMLFK  375



>ref|XP_010547806.1| PREDICTED: aldose 1-epimerase-like [Tarenaya hassleriana]
Length=357

 Score =   355 bits (912),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/329 (57%), Positives = 230/329 (70%), Gaps = 9/329 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K+GDFSVK TNYGA + SL+ PDKNGK+ D+VLG+D+   Y+ D T FGAIVGRVAN
Sbjct  34    YELKRGDFSVKFTNYGAVMISLLTPDKNGKVDDVVLGFDSPDGYKNDTTYFGAIVGRVAN  93

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE-ESSITFTYYSRDGDQG  492
             RIGGA+F LNG  +KL  NDG NTLHGG KG S V WKV+ ++ +S ITFTY S DG++G
Sbjct  94    RIGGAKFMLNGHLHKLAPNDGKNTLHGGKKGFSDVVWKVQSYKPDSHITFTYDSFDGEEG  153

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPGDV   VTY + E   KL VKM AK L+KPTP+NLA H YWNL G  SG+ILS  +Q+
Sbjct  154   FPGDVSVKVTYMLMETN-KLGVKMEAKPLSKPTPINLALHTYWNLKGQSSGDILSHDIQL  212

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             FA HITPVD  LIPTG+I  +  T +DFL  + +GS++ +LP   GG+DINY +DG  + 
Sbjct  213   FASHITPVDDQLIPTGKISAVAGTPYDFLGSRPIGSRIDELP---GGYDINYVIDG--ES  267

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
             G  ++  V  V +  SG  ME+ +   GVQFYT+N L  V+GKG  VY  +  LCLETQG
Sbjct  268   GHLRRTAV--VTESVSGRRMELWSNQVGVQFYTSNMLTSVRGKGGYVYSKYGGLCLETQG  325

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FPD+VNH NFPS IV P   Y H +   F
Sbjct  326   FPDSVNHENFPSQIVNPGDTYLHVMVFRF  354



>emb|CDY24155.1| BnaC03g57220D [Brassica napus]
Length=359

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 234/332 (70%), Gaps = 10/332 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             K Y + +G  SV  TNYGA + SL+LPD++GK  D+VLG+DTV  Y+ D T FGAIVGRV
Sbjct  33    KTYKLTRGKLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTVDAYKNDTTYFGAIVGRV  92

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGD  486
             ANRIGGA+F LNG  YK + N+G+NTLHGG KG   V W V+ +  +S ITF Y S DG+
Sbjct  93    ANRIGGAKFELNGQLYKTDPNEGHNTLHGGTKGFGDVTWSVENYVPTSHITFIYQSFDGE  152

Query  487   QGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +GFPG+V   VTY  I EN  KL +KM  K LNKPTP+NLA H YWNL GH+SG+ILS K
Sbjct  153   EGFPGNVTVKVTYMLIGEN--KLALKMEGKPLNKPTPINLALHTYWNLHGHNSGDILSHK  210

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +Q+ A  ITPVD  LIPTG+I  I  T +DFL+P+++GS++ +LP   GG+DINY +DG 
Sbjct  211   IQLLAKKITPVDEELIPTGEITSIEGTPYDFLEPREIGSRIHELP---GGYDINYVIDGI  267

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
               VG   +K  A V ++ +G  ME+    PGVQFYT+N L  V GKG+AVY+ +A LCLE
Sbjct  268   --VGKHLRK-AAVVSEKVTGRKMELWTNQPGVQFYTSNLLTSVVGKGNAVYKKYAGLCLE  324

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             TQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  325   TQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  356



>ref|XP_008784475.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=364

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 187/339 (55%), Positives = 233/339 (69%), Gaps = 17/339 (5%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +KKGDFSVK+TN+GA + S++LPD  G L D+VLG+D +  Y  +   FGA+VGRV 
Sbjct  31    FYELKKGDFSVKVTNWGATIVSVVLPDSKGNLADVVLGFDGLGPYINNSAYFGALVGRVG  90

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDG  483
             NRI GA+F L+G  Y+L ANDGNN+LHGG +G S V W VK+    E   IT  Y+S DG
Sbjct  91    NRISGARFVLDGKAYRLYANDGNNSLHGGHRGFSHVIWTVKEKVDGEFPYITLYYHSFDG  150

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+   VTY I    Y+L V M+AK++NK TPVNL QH YWNLGGH+SG ILS  
Sbjct  151   EQGFPGDLDVSVTYKI-SGAYELSVTMDAKSVNKATPVNLLQHTYWNLGGHNSGTILSNT  209

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +QIFA H+TP DS+ IPTG+I+ ++ T +DFLKP  VGS++ ++   +GG++INY V G 
Sbjct  210   VQIFASHVTPSDSHFIPTGEIVSVSGTPYDFLKPMIVGSRINEI---TGGYNINYDVKGK  266

Query  844   DDV-------GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
                       G RK   VA V D  SG   E+ +  PGVQFYT+N L+DVKGKG  VY  
Sbjct  267   GGFVYGQHAHGMRK---VAVVKDGGSGRAFELWSNQPGVQFYTSNSLKDVKGKGGFVYGQ  323

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             HAALCLETQGF DAVNHPNFPS IV   + YKH +   F
Sbjct  324   HAALCLETQGFADAVNHPNFPSQIVNAGEVYKHYMLFKF  362



>ref|XP_009414392.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=361

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 232/333 (70%), Gaps = 12/333 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +++G+FSVK+TN+GA + S++LPD  GK+ DI LGYD +  Y  D TNFGA+VGRVAN
Sbjct  33    YELRRGEFSVKVTNWGATITSVVLPDSKGKVADIALGYDGIRPYTNDTTNFGALVGRVAN  92

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDGD  486
             RI  A+FTLNG  Y L  NDGNNTLHGGPKG  +V W VK     E   IT  Y S DG+
Sbjct  93    RIANARFTLNGRTYHLLPNDGNNTLHGGPKGFGRVIWTVKDKVDGEYPYITLYYRSVDGE  152

Query  487   QGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKL  666
             QGFPGD+  +VTY I ++ + L V M+A  L KPTP+NLAQH YWNLGGH+SG+IL +++
Sbjct  153   QGFPGDLDVYVTYKIDDD-FVLSVIMHAVPLTKPTPINLAQHTYWNLGGHESGSILEDRI  211

Query  667   QIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYD  846
             +IFA HITPV+  LIPTG+I  ++ T FDF +P ++GS++ ++P   GG+DINY +    
Sbjct  212   KIFASHITPVNDQLIPTGEIRSVSGTPFDFREPAKIGSKIGRVP---GGYDINYVLSSPA  268

Query  847   DV-GTRKKKTVAKVYDER-SGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
             DV G RK   VA V D R SG  +E+ A  PGVQFYT N L+  +GK    Y+ H  LCL
Sbjct  269   DVQGVRK---VAVVEDGRGSGRVLELWANQPGVQFYTGNFLKHERGKNGHYYKIHDGLCL  325

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             ETQGFPD+VNHP FP+ I +P Q YKH +   F
Sbjct  326   ETQGFPDSVNHPKFPNQIYSPGQVYKHFMQFKF  358



>gb|KFK34079.1| hypothetical protein AALP_AA5G099600 [Arabis alpina]
Length=359

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 232/332 (70%), Gaps = 10/332 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             K Y + +G+ SV  TNYGA + SL+LPD++GK  D+VLG+D+V  Y+ D T FGAIVGRV
Sbjct  33    KTYTLTRGNLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDSVDGYKNDTTYFGAIVGRV  92

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGD  486
             ANRIGGAQF LNG  YK + N+G NTLHGG KG S V W V+ +   S ITF Y S DG+
Sbjct  93    ANRIGGAQFELNGQTYKTDPNEGQNTLHGGTKGFSDVIWSVQNYVPNSHITFKYDSFDGE  152

Query  487   QGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +GFPG+V   VTY  I +N  KL +KM AK LNKPTP+NLA H YWNL  H+SG++LS K
Sbjct  153   EGFPGNVTVKVTYMLIGQN--KLALKMEAKPLNKPTPINLALHTYWNLHSHNSGDVLSHK  210

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +Q+ A  ITPVD  LIPTG+I  I+ T +DFL+P+ +GS++ +LP   GG+DINY +DG 
Sbjct  211   IQLHAGKITPVDEKLIPTGEITPIHGTPYDFLEPRSIGSRIKELP---GGYDINYVIDG-  266

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
                G   +KT A V +E +G  ME+    PGVQFYT+N +  V GKG AVYE +  LCLE
Sbjct  267   -TAGKHLRKT-AVVSEEVTGRKMELWTNQPGVQFYTSNMMTRVVGKGKAVYEKYGGLCLE  324

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             TQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  325   TQGFPDSVNHKNFPSQIVNPGESYLHVMLFRF  356



>dbj|BAJ86209.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92102.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 223/333 (67%), Gaps = 9/333 (3%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KKGDFS+K+TN+GA + S I+PD  G L D+VLGYDT  EY +   +FGA VGRVANRI 
Sbjct  38    KKGDFSIKVTNWGAALVSAIVPDSKGHLADVVLGYDTAAEYMRGSASFGATVGRVANRIA  97

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
              A+F L+G  Y L  NDGNNT+HGGPKG  KV W VK H    +   ITF Y+S DG+QG
Sbjct  98    NARFVLDGKTYHLLRNDGNNTIHGGPKGFGKVIWMVKDHVSHGDSPYITFYYHSLDGEQG  157

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPG +  +V Y +    Y L ++MN  A NK TPVNLA H YWNL GH SG+IL  +LQ+
Sbjct  158   FPGALDVYVKYQLSRQ-YDLSIRMNVTARNKATPVNLANHAYWNLAGHGSGDILKHELQM  216

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             FA H TPVD ++IPTG++  +  T +DF +   VG+ M  +P G GG+D+NYAVDG  + 
Sbjct  217   FASHYTPVDGSMIPTGEVAPVAGTMYDFGRRIPVGTNMKIVPGGGGGYDMNYAVDGQQNA  276

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
                  + VA+V + +SG  +E+ A  PGVQFYTA+ L + KGK   VY  + ALCLETQ 
Sbjct  277   ----MRPVARVREPKSGRALELWANQPGVQFYTASWLINEKGKAGKVYGQYGALCLETQA  332

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQV  1131
             +PDAVNHPNFPS+IV P Q YKH +   F  Q 
Sbjct  333   YPDAVNHPNFPSSIVRPGQVYKHDMVFRFSYQA  365



>ref|XP_002517486.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF45028.1| aldose-1-epimerase, putative [Ricinus communis]
Length=359

 Score =   353 bits (906),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 242/363 (67%), Gaps = 15/363 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALIVSGQDN-KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
             M  IS     C  ++F      ++  +FY +KKG+ S+KLTN+GA + S ++PDK GK  
Sbjct  1     MGKISFLFCFCILVAFGFANGAEEKVEFYELKKGNISMKLTNWGASIVSFVIPDKTGKPI  60

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+VLGYDT+ EY+ D T FGA+VGRVANRIGGA+F LNG  YKL ANDG N LHGG KG 
Sbjct  61    DVVLGYDTIKEYQTDSTYFGAVVGRVANRIGGAEFKLNGKTYKLPANDGKNMLHGGAKGY  120

Query  412   SKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
             S V WKV K++ S     I FT+ S DG++GFPG +   VTYT+  +  +L V M AK L
Sbjct  121   SDVVWKVTKYKNSGNAPFIVFTHRSSDGEEGFPGALRVVVTYTLLADG-QLSVFMKAKGL  179

Query  580   -NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDF  756
              +K +PV+LAQH YWNL GH+SGNIL  K++IF    T VD NL+PTGQ+L    TA+DF
Sbjct  180   DDKVSPVSLAQHTYWNLAGHNSGNILEAKVRIFGQFYTAVDENLVPTGQLLYARGTAYDF  239

Query  757   LKPQ--QVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATA  930
              +P+   VG ++  LPK   G+DINY +D ++     K + VA V D +SG+ ME+   A
Sbjct  240   TEPELKPVGKRIDLLPK---GYDINYVLDDFE---PNKIRQVAIVEDVKSGVRMELATDA  293

Query  931   PGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
             PG+QFYT N + +VKGKG  VY++HA LCLETQ +PD VNHP FP ++V   + YKH + 
Sbjct  294   PGLQFYTGNMISNVKGKGGVVYQAHAGLCLETQWYPDFVNHPAFPQSLVQQGKVYKHHML  353

Query  1111  ITF  1119
               F
Sbjct  354   FNF  356



>dbj|BAK04813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 234/362 (65%), Gaps = 13/362 (4%)
 Frame = +1

Query  52    IMSIISAPLFLCFFISFALIVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
             ++ ++ A  F+   +        +    Y +KKGDFS+K+TN+GA + S+ILPD  G L 
Sbjct  7     LLVVVLAACFVALGLPGGAAAERKIVGIYELKKGDFSIKVTNWGATLMSVILPDSRGNLG  66

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D++LGYDTV EY      FG ++GRVANRI  A+FTL+G  Y+L  NDGNNTLHGG +G 
Sbjct  67    DVILGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKSYRLFPNDGNNTLHGGHRGF  126

Query  412   SKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
              KV W V++H        IT  Y+S DG+QGFPGDV  HVTY I    + L V+MNA A 
Sbjct  127   DKVVWTVEEHLAGGRSPFITLYYHSFDGEQGFPGDVDVHVTYQITGR-HALSVRMNATAR  185

Query  580   NKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFL  759
              K TPVNLA H YWNLGG  SG++L +K+++FA   TPV + LIPTG++  +  T +DF 
Sbjct  186   GKATPVNLAHHAYWNLGGDGSGSVLGQKVRLFASRYTPVGAALIPTGRLAPVAGTPYDFR  245

Query  760   KPQQVGSQMAK-LPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPG  936
             +P  VG+++   L +G  G+DINY VD     G R  + VA V D  SG  ME+ A  PG
Sbjct  246   RPAAVGARIGGLLSRGVAGYDINYVVD-----GGRGLRRVAAVRDGASGRAMELWADQPG  300

Query  937   VQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHIT  1116
             VQFYTAN L  V+GKG  VY  + ALCLETQGFP+AVN P+FPS IV P + Y+H  H+ 
Sbjct  301   VQFYTANGLSGVRGKGGKVYGRYGALCLETQGFPNAVNEPSFPSQIVRPGEVYRH--HML  358

Query  1117  FR  1122
             FR
Sbjct  359   FR  360



>ref|XP_002517487.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF45029.1| aldose-1-epimerase, putative [Ricinus communis]
Length=357

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 251/362 (69%), Gaps = 15/362 (4%)
 Frame = +1

Query  55    MSIISAPLFLCFFISFALI---VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             M+     ++L   ++F  I   ++ +    Y +KKG+ ++KLTNYGARV S+ LPDK GK
Sbjct  1     MAEFCVLVWLSILLAFGFINGSLAEEKIGVYELKKGNITLKLTNYGARVISVYLPDKYGK  60

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             + D+VLGYD++ EY  D ++FGA VGRVANRI GAQFTLNG  YKL  N+G N LHGG K
Sbjct  61    VDDVVLGYDSIDEYLNDTSSFGATVGRVANRIAGAQFTLNGTTYKLVPNEGKNMLHGGRK  120

Query  406   GISKVYWKVKKHEESS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             G SKV WKVKK++++     IT TY S DG++GFPG++   + YT+ EN  +L + M AK
Sbjct  121   GFSKVVWKVKKYKQAGHTPHITLTYRSFDGEEGFPGNLRVTLAYTLLENN-QLSITMKAK  179

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
             A  K TPVNLA H YWNLGG  SG+ILS+++QIFA   TP+DS LIPTGQI+ +  T +D
Sbjct  180   AQKKSTPVNLANHAYWNLGGQSSGDILSQEIQIFASRYTPLDSQLIPTGQIVSVKATPYD  239

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             FL P  +GS++ +LPK   G+DINYA+D        K K  A V+D+++G  ME+    P
Sbjct  240   FLNPATIGSKINQLPK---GYDINYALDA---SAHNKMKKTAIVHDKKTGRVMELFTNQP  293

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             G+QFYT+N L+  KGKG  VY+ HAALCLETQG+PDAVNHPNFPS IV P + YKH +  
Sbjct  294   GLQFYTSNTLEK-KGKGGFVYKPHAALCLETQGYPDAVNHPNFPSVIVNPGKSYKHYMLF  352

Query  1114  TF  1119
              F
Sbjct  353   KF  354



>ref|XP_010256040.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=358

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 230/333 (69%), Gaps = 11/333 (3%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +K G+ S+K+TNYGA + S+I PDK G++ D+ LG+  + +Y  D   FG +VGRVA
Sbjct  30    FYDLKDGEISLKVTNYGATILSVIFPDKYGEMADVALGFQKIGDYTNDTIYFGGLVGRVA  89

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS----ITFTYYSRD  480
             NRI GAQFTLNG  YK+ AN+GNNTLHGG +G S V+W V+K++       IT +Y S D
Sbjct  90    NRIAGAQFTLNGHKYKVVANEGNNTLHGGHRGFSDVFWTVRKYKPHGSSPYITLSYRSFD  149

Query  481   GDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSE  660
             G+QGFPGD+   VTY I     KL V M A+ALNK TPVNLAQH YWNL GH+SG++L +
Sbjct  150   GEQGFPGDLDVSVTYKI-VGWNKLAVFMKARALNKATPVNLAQHTYWNLAGHNSGDVLGQ  208

Query  661   KLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG  840
              +QIF  HITPVD  LIPTG+I  +  T +DF +   VG ++ +LP    G+DINY +DG
Sbjct  209   HVQIFGSHITPVDKELIPTGKIAPVKGTPYDFREKHTVGCRIDQLPN---GYDINYVLDG  265

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
                   +K    A V+D +SG  +E+   APG+QFYT N L+DVKGK  A+Y+ H+ +CL
Sbjct  266   KPHHFLKK---AAMVHDPKSGRMLELWTNAPGLQFYTGNMLKDVKGKDGAIYKVHSGICL  322

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             ETQGFPD+VNHPNFPS IVTP + YKH +   F
Sbjct  323   ETQGFPDSVNHPNFPSQIVTPGKLYKHYMLFKF  355



>ref|NP_001137118.1| aldose 1-epimerase precursor [Zea mays]
 gb|ACF83300.1| unknown [Zea mays]
 tpg|DAA37476.1| TPA: aldose 1-epimerase [Zea mays]
Length=363

 Score =   351 bits (900),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 224/335 (67%), Gaps = 12/335 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K GDFSV +TN+GA + S++LPD  G   D+VLGYDT+  Y    + FGA+VGRVAN
Sbjct  32    YELKAGDFSVGVTNWGATITSVVLPDSKGDFADVVLGYDTIGGYVSGKSYFGALVGRVAN  91

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI  A+F L+G  Y L  NDGNNTLHGG +G S+V W VK+     +   IT  Y+S DG
Sbjct  92    RIANARFVLDGKAYHLFKNDGNNTLHGGHRGFSQVVWTVKEFVGGGDSPYITLYYHSFDG  151

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+  +VTY +   PY L V MNA A+NK TPVNLAQH YWNLGG  SG++L   
Sbjct  152   EQGFPGDLDVYVTYQLAA-PYVLRVHMNATAVNKATPVNLAQHTYWNLGGQGSGDVLRNT  210

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG---GFDINYAV  834
             +Q+FA   TPV   LIPTG +  +  T +DFL P  VGS++ ++  G     G+D NYAV
Sbjct  211   VQLFASRYTPVGGGLIPTGAVAPVAGTPYDFLAPAAVGSRIRQVSGGKAGVYGYDTNYAV  270

Query  835   DGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
             DG  + G  +K  VA V D  SG  +E+ A  PGVQFYT N LQDVKGKG  VY+ + AL
Sbjct  271   DG--EPGALRK--VAVVRDGASGRALELWANQPGVQFYTGNFLQDVKGKGGKVYQQYGAL  326

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             CLETQGFPDAVNHPNFPS IV P Q YKH +   F
Sbjct  327   CLETQGFPDAVNHPNFPSQIVRPGQVYKHDMVFKF  361



>gb|EYU35859.1| hypothetical protein MIMGU_mgv1a008920mg [Erythranthe guttata]
Length=358

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 190/359 (53%), Positives = 237/359 (66%), Gaps = 14/359 (4%)
 Frame = +1

Query  70    APLFLCFFI--SFALIV------SGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
             A   LCF +  +FALI+      S Q+   Y +++G FSVK+TNYGA V SL++PD+NGK
Sbjct  2     AKSLLCFSLIAAFALILNVCIASSDQEIGIYHLQRGKFSVKITNYGATVLSLLVPDRNGK  61

Query  226   LTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPK  405
             L DIVLGY ++ +Y+ D T FGA++GRVANRIGGA+FTLNG  YKL AND  NTLHGG K
Sbjct  62    LDDIVLGYGSIDDYKNDTTYFGALIGRVANRIGGAKFTLNGRVYKLPANDHGNTLHGGSK  121

Query  406   GISKVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALN  582
             G S V W VK+H + S +T TY S DG+QGFPG +   VTY      +KL +KM A  L 
Sbjct  122   GFSDVIWTVKEHVKRSHLTLTYLSHDGEQGFPGKLAVTVTYMFI-GKHKLAIKMEATPLT  180

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             KPTPVNLA H YWNLGGH+SG+I S  +Q+ A  ITPV+  LIPTG++  +  T +DFL 
Sbjct  181   KPTPVNLASHTYWNLGGHNSGDIFSHTIQLLASKITPVNDKLIPTGKLSPVEGTPYDFLH  240

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P+ +GS+  +LP    G+DINY +D          K  A V  E+SG  ME+     GVQ
Sbjct  241   PRTIGSKFNELPD---GYDINYVLDRPSGPIHHFTK-AAVVQHEKSGRKMELWTNQIGVQ  296

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FYT+N L D  GKG  VY+ HAA+ LETQGFPD+VNHPNFPS IV     Y H +   F
Sbjct  297   FYTSNMLNDTVGKGGFVYKKHAAIALETQGFPDSVNHPNFPSQIVDVGDKYVHAMVYRF  355



>ref|NP_001047214.1| Os02g0575800 [Oryza sativa Japonica Group]
 dbj|BAD34245.1| putative non-cell-autonomous protein pathway2; plasmodesmal receptor 
[Oryza sativa Japonica Group]
 dbj|BAD33358.1| putative non-cell-autonomous protein pathway2; plasmodesmal receptor 
[Oryza sativa Japonica Group]
 dbj|BAF09128.1| Os02g0575800 [Oryza sativa Japonica Group]
 dbj|BAG98815.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 239/367 (65%), Gaps = 22/367 (6%)
 Frame = +1

Query  82    LCFFISFALIVSGQDNK----------FYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
             L F    AL +SG+ N            Y +KKGDFS+++TN+GA + S+ILPD  G L 
Sbjct  11    LAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGATIMSVILPDSKGNLA  70

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+VLGYDTV EY      FG ++GRVANRI  A+FTL+G  Y+L  NDGNN+LHGG +G 
Sbjct  71    DVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYRLFRNDGNNSLHGGHRGF  130

Query  412   SKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
             SKV W VK+H    +   IT  Y+S DG+QGFPGD+   VTY +   PY L V+MNA A 
Sbjct  131   SKVIWTVKEHVAGGDSPRITLYYHSFDGEQGFPGDLDVFVTYELPR-PYVLAVRMNATAR  189

Query  580   NKPTPVNLAQHNYWNLGGHDSG--NILSEKLQIFAYHITPVD-SNLIPTGQILLINNTAF  750
              K TPVNLA H YWNL G  SG  ++L+E ++I A   TPVD + LIPTG++  +  T +
Sbjct  190   GKATPVNLAHHAYWNLAGEGSGAASVLAETVRIHASRYTPVDAATLIPTGRVAPVAGTPY  249

Query  751   DFLKPQQVGSQM--AKLPKGS-GGFDINYAVDGYDDVGTRKK-KTVAKVYDERSGIGMEI  918
             DFL    VG+++  A +P G+  G+D NYAVDG    G R++ + VA+V D  +G  ME+
Sbjct  250   DFLAGAPVGARIVGAAVPGGAVSGYDTNYAVDGAAADGERRRLRPVAEVRDGATGRAMEV  309

Query  919   KATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYK  1098
              A  PGVQFYT+N L  V+GKG  VY  + ALCLETQGFPDAVNHP+FPS IV P Q Y+
Sbjct  310   WADQPGVQFYTSNGLAGVRGKGGRVYGRYGALCLETQGFPDAVNHPSFPSQIVRPGQVYE  369

Query  1099  HTLHITF  1119
             H +   F
Sbjct  370   HNMVFKF  376



>ref|XP_002446606.1| hypothetical protein SORBIDRAFT_06g018800 [Sorghum bicolor]
 gb|EES10934.1| hypothetical protein SORBIDRAFT_06g018800 [Sorghum bicolor]
Length=373

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 227/335 (68%), Gaps = 8/335 (2%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K GDFSV +TN+GA + S++LPD  G L D+VLGYDT+  Y    + FGA+VGRVAN
Sbjct  38    YELKAGDFSVSVTNWGATITSVVLPDSKGNLADVVLGYDTIGGYVSGKSYFGALVGRVAN  97

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI  A+F L+G  Y L  NDGNNTLHGG +G S+V W VK+     +   IT  Y+S DG
Sbjct  98    RIAYARFVLDGKAYHLFKNDGNNTLHGGHRGFSQVIWTVKEFVAGGDSPYITLYYHSFDG  157

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+  +VTY +  +PY+L V MNA A NK TPVNLAQH YWNLGG  SG++L   
Sbjct  158   EQGFPGDLDVYVTYELA-SPYELRVHMNATAANKATPVNLAQHTYWNLGGEGSGDVLHNT  216

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGG---FDINYAV  834
             +Q+FA   TPVDS LIPTG +  +  T +DFL P  VG+++ ++  G  G   +D NYAV
Sbjct  217   VQLFASRYTPVDSALIPTGVVAPVAGTPYDFLAPTPVGARIRQVSGGKAGIYGYDTNYAV  276

Query  835   DGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
             DG D       + VA V D +SG  ME+ A  PGVQFYT N LQDV+GKG  VY  + AL
Sbjct  277   DGDDAGAGAALRKVAVVRDGKSGRAMELWANQPGVQFYTGNFLQDVEGKGGKVYGQYGAL  336

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             CLETQGFPDAVNHP+FPS IV+P Q YKH +   F
Sbjct  337   CLETQGFPDAVNHPSFPSQIVSPGQVYKHDMVFKF  371



>gb|ACG28451.1| aldose 1-epimerase precursor [Zea mays]
Length=364

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 224/335 (67%), Gaps = 12/335 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K GDFSV +TN+GA + S++LPD  G   D+VLGYDT+  Y    + FGA+VGRVAN
Sbjct  33    YELKAGDFSVGVTNWGATITSVVLPDSKGDFADVVLGYDTIGGYVSGKSYFGALVGRVAN  92

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI  A+F L+G  Y L  NDGNNTLHGG +G S+V W VK+     +   IT  Y+S DG
Sbjct  93    RIANARFVLDGKAYHLFKNDGNNTLHGGHRGFSQVVWTVKEFVGGGDSPYITLYYHSFDG  152

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+  +VTY +   PY L V MNA A+NK TPVNLAQH YWNLGG  SG++L   
Sbjct  153   EQGFPGDLDVYVTYQLAA-PYVLRVHMNATAVNKATPVNLAQHTYWNLGGQGSGDVLRNT  211

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG---GFDINYAV  834
             +Q+FA   TPV   LIPTG +  +  T +DFL P  VGS++ ++  G     G+D NYAV
Sbjct  212   VQLFASRYTPVGGGLIPTGAVAPVAGTPYDFLAPAAVGSRIRQVSGGKAGVYGYDTNYAV  271

Query  835   DGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
             DG  + G  +K  VA V D  SG  +E+ A  PGVQFYT N LQDVKGKG  VY+ + AL
Sbjct  272   DG--EPGALRK--VAVVRDGASGRALELWANQPGVQFYTGNFLQDVKGKGGKVYQQYGAL  327

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             CLETQGFPDAVNHP+FPS IV P Q YKH +   F
Sbjct  328   CLETQGFPDAVNHPDFPSQIVRPGQVYKHDMVFKF  362



>gb|EAY86398.1| hypothetical protein OsI_07776 [Oryza sativa Indica Group]
Length=378

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 240/367 (65%), Gaps = 22/367 (6%)
 Frame = +1

Query  82    LCFFISFALIVSGQDNK----------FYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
             L F    AL +SG+ N            Y +KKGDFS+++TN+GA + S+ILPD  G L 
Sbjct  11    LAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGAILMSVILPDSKGNLA  70

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+VLGYDTV EY      FG ++GRVANRI  A+FTL+G  Y+L  NDGNN+LHGG +G 
Sbjct  71    DVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYQLFRNDGNNSLHGGHRGF  130

Query  412   SKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL  579
             SKV W VK+H    +   IT  Y+S DG+QGFPGD+  +VTY +   PY L V+MNA A 
Sbjct  131   SKVIWTVKEHVAGGDSPRITLYYHSFDGEQGFPGDLDVYVTYELPR-PYVLAVRMNATAR  189

Query  580   NKPTPVNLAQHNYWNLGGHDSG--NILSEKLQIFAYHITPVD-SNLIPTGQILLINNTAF  750
              K TPVNLA H YWNL G  SG  ++L+E ++I A   TPVD + LIPTG++  +  T +
Sbjct  190   GKATPVNLAHHAYWNLAGEGSGAASVLAETVRIHASRYTPVDAATLIPTGRVAPVAGTPY  249

Query  751   DFLKPQQVGSQM--AKLPKGS-GGFDINYAVDGYDDVGTRKK-KTVAKVYDERSGIGMEI  918
             DFL    VG+++  A +P G+  G+D NYAVDG    G R++ + VA+V D  +G  ME+
Sbjct  250   DFLAGAPVGARIVGAAVPGGAVSGYDTNYAVDGAAADGERRRLRPVAEVRDGATGRAMEV  309

Query  919   KATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYK  1098
              A  PGVQFYT+N L  V+GKG  VY  + ALCLETQGFPDAVNHP+FPS IV P Q Y+
Sbjct  310   WADQPGVQFYTSNGLAGVRGKGGRVYGRYGALCLETQGFPDAVNHPSFPSQIVRPGQVYE  369

Query  1099  HTLHITF  1119
             H +   F
Sbjct  370   HNMVFKF  376



>ref|XP_004508757.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Cicer arietinum]
Length=353

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/330 (56%), Positives = 229/330 (69%), Gaps = 8/330 (2%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +K+G+  + LTNYGA V S+I+PDK+G L D+VLGYD++  YE D   FGA++GRVA
Sbjct  28    FYELKRGNMRLNLTNYGATVISVIVPDKHGNLADVVLGYDSINSYENDTCYFGALIGRVA  87

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGDQ  489
             NRIGGAQFTL+G  YKL  ND  NTLHGG KG S V W VK H E++ ITFTY S D +Q
Sbjct  88    NRIGGAQFTLDGKTYKLPVNDHGNTLHGGTKGFSDVIWTVKSHREDNHITFTYDSFDNEQ  147

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             GFPG +   VTY +      L VKM AK ++K TPVNLAQH YWNL GH+SG+ILS  +Q
Sbjct  148   GFPGKLEVSVTYMLFGRNL-LGVKMIAKPIDKATPVNLAQHTYWNLRGHNSGDILSHIVQ  206

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             IF  +ITPVD+NLIPTG++  + NT +DFLKP++VGSQ+ +LP   G +DINY +D    
Sbjct  207   IFGSNITPVDNNLIPTGKVQSVQNTPYDFLKPKKVGSQINELP---GLYDINYVLDKNSQ  263

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
                 K   VA V D  SG  ME+ +   GVQ+YT+  L D KGKG  +Y  HA + LETQ
Sbjct  264   NHLSK---VAMVRDPVSGRKMELWSNQLGVQYYTSGMLGDTKGKGGVIYHKHAGIALETQ  320

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             G+PD+VNHPNFPS IV P + YKH +   F
Sbjct  321   GYPDSVNHPNFPSQIVHPGETYKHYMVYRF  350



>ref|XP_007032473.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY03399.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=364

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 237/334 (71%), Gaps = 12/334 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +K GD SVK TN+GA + S++LPDKNGKL DI LGY++V EY  D T FGA+VGRVAN
Sbjct  37    YELKNGDMSVKFTNWGATIISVVLPDKNGKLGDIALGYESVKEYMNDTTYFGALVGRVAN  96

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS----ITFTYYSRDG  483
             RIGGA+F+LNG  YKL AN+G N LHGGPKG   V WKVKK+++      I F Y S DG
Sbjct  97    RIGGAKFSLNGTQYKLVANEGKNMLHGGPKGFGDVVWKVKKYKKDGPAPYILFAYDSYDG  156

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             ++GFPG +   V YT+     KL V M AK + K TPVNLAQH YWNLG HDSG+ILSE+
Sbjct  157   EEGFPGALKVTVAYTLLAK-NKLSVTMKAKVVKKYTPVNLAQHTYWNLGNHDSGDILSEE  215

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +QIFA   TPVDS LIPTG++  +  T +DFLK Q +GS++ +LPK   G+DINYA+DG 
Sbjct  216   IQIFASLYTPVDSQLIPTGKLEPVKGTPYDFLKLQTIGSRIKELPK---GYDINYALDGT  272

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
                  +          ++SG  M++ A  PGVQFYT N +++VKGKG  VY++HAALCLE
Sbjct  273   PGKMKKVAVVKD----KKSGRVMKLFANQPGVQFYTGNMIRNVKGKGGFVYKAHAALCLE  328

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             TQGFPD+VNHPNFPS IVTP++ Y+H +   F +
Sbjct  329   TQGFPDSVNHPNFPSQIVTPKKLYEHNMLFKFSI  362



>gb|EEE61117.1| hypothetical protein OsJ_15041 [Oryza sativa Japonica Group]
Length=380

 Score =   348 bits (892),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 184/342 (54%), Positives = 224/342 (65%), Gaps = 15/342 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFS+++TN+GA + S++LPD  GKL D+VLGYDT+ EY    T FGA+VGRVAN
Sbjct  38    YELRKGDFSIRVTNWGAVIMSVVLPDSRGKLDDVVLGYDTIAEYVNSSTYFGALVGRVAN  97

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI  A+F L+G  Y L  NDG NTLHGG +G S V W VK+H    +   IT  Y+S DG
Sbjct  98    RIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLYYHSFDG  157

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPG +  +VTY +   PY L V MNA A  K TPVNLAQH+YWNLGG  SG+IL   
Sbjct  158   EQGFPGALDVYVTYQL-SGPYVLSVHMNATAAGKATPVNLAQHSYWNLGGTGSGDILGNT  216

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG-------GFDI  822
             +Q+FA   TPVD+ LIPTGQ+  +  T +D   P  VG+++  +  G         GFD 
Sbjct  217   VQLFASRYTPVDAELIPTGQVAPVTGTPYDLRAPTPVGARVHLVTGGLSKTGATIYGFDT  276

Query  823   NYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHL-QDVKGKGSAV  993
             NYAVDG DDV       + VA V D +SG  +E+ A  PGVQFYT N L  DVKGKG   
Sbjct  277   NYAVDGGDDVDAHAHALRRVAVVRDGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKA  336

Query  994   YESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             Y  + ALCLETQGFPDAVNHPNFPS IV P Q YKH +   F
Sbjct  337   YGQYGALCLETQGFPDAVNHPNFPSVIVRPGQVYKHEMVYKF  378



>dbj|BAK00680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/339 (53%), Positives = 223/339 (66%), Gaps = 16/339 (5%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFS K+TN+GA V S++ PD  G L D+VLGYDT+ EY    + FGA+VGRVAN
Sbjct  37    YELRKGDFSAKVTNWGATVTSVVFPDSKGNLGDVVLGYDTIAEYVNGSSYFGALVGRVAN  96

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             R+  A+F L+G  Y L ANDG N LHGG +G SKV W VK++    +   IT  Y+S DG
Sbjct  97    RVAKARFVLDGKVYHLYANDGKNALHGGHRGFSKVIWTVKEYVSGGDSPHITLYYHSFDG  156

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPG +  +VTY +  +PY L V+MNA AL+K TPVNLAQH YWNLGGH SG++L   
Sbjct  157   EQGFPGALDVYVTYEL-SSPYVLSVRMNATALDKATPVNLAQHTYWNLGGHGSGDVLGNT  215

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG------GFDIN  825
             +Q+ A   TPVD+ LIPTGQ+  +  T +D   P  VG  + ++  GS       G+D+N
Sbjct  216   VQLLASRYTPVDATLIPTGQLAPVAGTPYDLRAPTAVGEHLRQVVGGSSGGSTVYGYDMN  275

Query  826   YAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESH  1005
             Y VDG      R  + VA V D  SG  +E+ A  PGVQFYT N L+DVKGKG   Y  +
Sbjct  276   YVVDG----DARALRKVAAVRDGASGRALELWADQPGVQFYTGNFLKDVKGKGGETYGQY  331

Query  1006  AALCLETQGFPDAVNHPNFPSTIVTP-QQPYKHTLHITF  1119
             AALCLETQGFPDAVNHP FPS IV P +  YKH +   F
Sbjct  332   AALCLETQGFPDAVNHPEFPSQIVRPGEAAYKHDMVFKF  370



>ref|XP_002511545.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF52147.1| aldose-1-epimerase, putative [Ricinus communis]
Length=364

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 238/358 (66%), Gaps = 19/358 (5%)
 Frame = +1

Query  82    LCFFISFALIVSGQDNK----------FYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
              C  +  AL+V+   N            Y +K+GDFS+K TN+GA + S ILPDK+G L 
Sbjct  11    FCCVLLVALLVADNYNGCRAGGTEEVGVYELKRGDFSIKFTNFGASMISAILPDKHGNLA  70

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGN-NTLHGGPKG  408
             D+VLG+D+V  Y+ D T FG IVGRVANRIG AQFTL+GI YKL  ND   N LHGGPKG
Sbjct  71    DVVLGFDSVDAYKNDTTYFGNIVGRVANRIGKAQFTLDGILYKLVPNDNKVNILHGGPKG  130

Query  409   ISKVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNK  585
              S+V W V  + ++S ITFTY S DG+QGFPGD+   VTY+I     +L VKM AK  +K
Sbjct  131   FSEVVWSVYSYRKDSHITFTYESFDGEQGFPGDLSVSVTYSII-GTNRLGVKMIAKPKDK  189

Query  586   PTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKP  765
             PTPVN+A H YWNLGGH+SG+I S  +QIF   ITPVD +LIPTG+I  +  T +DFL+P
Sbjct  190   PTPVNIALHTYWNLGGHNSGDIFSHTIQIFGSKITPVDKDLIPTGEIKSMEGTPYDFLQP  249

Query  766   QQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQF  945
             + +GS+  +LP    G+D+NY +    D+     K  A V D  SG  ME+    PG+QF
Sbjct  250   RTIGSRFKELPD---GYDMNYVL---QDLNPGHLKKAAVVKDSVSGRTMELWTNKPGLQF  303

Query  946   YTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             YT+N L +V+GK  AVY+ +A + LETQGFPD+VNHPNFPS IV P + Y+H +   F
Sbjct  304   YTSNMLDNVEGKDGAVYKRYAGIALETQGFPDSVNHPNFPSQIVNPGETYEHIMVYRF  361



>ref|XP_002871651.1| hypothetical protein ARALYDRAFT_488355 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47910.1| hypothetical protein ARALYDRAFT_488355 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 227/336 (68%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ ++K TN+GA + SL  PDKNGK+ DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  156   LYELKKGNLTIKFTNWGASIMSLHFPDKNGKMDDIVLGYDSVKSYKTDKVYFGATVGRVA  215

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG A+F LNG  YK +ANDG NTLHGG KG   V W V KH    ++  I FTY S D
Sbjct  216   NRIGNAKFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVAKHKYDGKKPHIVFTYTSPD  275

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG++   VTY  +K+N  +L V M AK ++K TPVNLA H+YWNLGGH+SG+ILS
Sbjct  276   GDQGFPGELNVTVTYKLVKDN--ELSVVMEAKPIDKATPVNLAHHSYWNLGGHNSGDILS  333

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTG+I  +  TA+DFL+ + +   M  L     G+DINY +D
Sbjct  334   EEIQILGSSYTPVDGELIPTGKITPVKGTAYDFLQLRPIKDNMKDLKT---GYDINYCLD  390

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G      +K + + ++ D++SG  ME+    PG+QFYT   L+D+KGK  AVY++   LC
Sbjct  391   GK----AKKMRKIVELVDKKSGRKMELSGNQPGLQFYTGGMLKDIKGKNGAVYQAFGGLC  446

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PDA+NHP FPS IV P + YKHT+   F +
Sbjct  447   LETQSYPDALNHPKFPSQIVEPGKKYKHTMLFKFSI  482



>ref|XP_004952870.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=378

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 229/334 (69%), Gaps = 9/334 (3%)
 Frame = +1

Query  142   IKKGD-FSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANR  318
             +K+GD FS+K+TN+GA + S+ILPD  G L D+VLGYDTV EY      FG ++GRVANR
Sbjct  44    LKRGDDFSIKVTNWGATLMSVILPDSKGNLDDVVLGYDTVAEYVNGTAYFGGLIGRVANR  103

Query  319   IGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGD  486
             + GA+FTL+G  Y+L  NDGNN+LHGG +G SKV W V +H    +   I+  Y+S DG+
Sbjct  104   VAGARFTLDGKAYRLYPNDGNNSLHGGHRGFSKVIWTVMEHVGGGDSPYISLYYHSFDGE  163

Query  487   QGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKL  666
             QGFPGD+  +VTY +   P+ L V+MNA A    TPVNLA H YWNLGGH SG +L E +
Sbjct  164   QGFPGDLDVYVTYRLSP-PHVLSVRMNATARGSATPVNLAHHAYWNLGGHGSGPVLGETV  222

Query  667   QIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINYAVDGY  843
             Q+ A   TPVD+ LIPTG +  +  T +DF  P  VG+++A+L +G   G+D NYAVDG 
Sbjct  223   QLLASRYTPVDAALIPTGALAPVAGTPYDFRAPAPVGARLAELLRGGVAGYDTNYAVDGA  282

Query  844   DDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             DD GT     + VA+V D  +G  ME+ A  PGVQFYTAN L  V+GKG +VYE + ALC
Sbjct  283   DDSGTAATSLRPVARVRDGATGRAMELWADQPGVQFYTANGLGGVRGKGGSVYERYGALC  342

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             +ETQGFPDAVNHP FPS IV P Q YKH +   F
Sbjct  343   METQGFPDAVNHPGFPSQIVRPGQVYKHDMVFKF  376



>ref|XP_008644102.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=409

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 242/395 (61%), Gaps = 54/395 (14%)
 Frame = +1

Query  79    FLCFFISFALIVSGQDNK-----------FYVIKKGDFSVKLTNYGARVASLILPDKNGK  225
              LC  ++ A+  SG +N             + ++ GDFSVK+TN+GA + S+ILPD  G 
Sbjct  18    LLC--LAVAVCFSGGENAAAAAWTRKIVGVHELRVGDFSVKVTNWGATLMSVILPDSKGN  75

Query  226   LTDIVLGYDTVMEY----------------------------EQDDTNFGAIVGRVANRI  321
             L D+VLGYDTV EY                            +     FG ++GRVANR+
Sbjct  76    LGDVVLGYDTVAEYVVRSIVSAQHIRCVPETESLKLCRTETVQNGTAYFGGLIGRVANRV  135

Query  322   GGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQ  489
              GA+FTL+G  Y+L  NDGNN+LHGG +G SKV W VK+H    +   IT  Y+S DG+Q
Sbjct  136   AGARFTLDGKAYRLYRNDGNNSLHGGHRGFSKVVWTVKEHVGGGDSPYITLYYHSFDGEQ  195

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             GFPGD+  +VTY +   PY L V+MNA A ++ TPVNLA H YWNLGGH SG +L E +Q
Sbjct  196   GFPGDLDVYVTYRLSR-PYVLSVRMNATARSRATPVNLAHHAYWNLGGHGSGPVLGETVQ  254

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKL-PK----GSGGFDINYAV  834
             +FA   TPVD+ L+PTG +  +  T +DF  P  VG+++A L P+    G  G+D NYAV
Sbjct  255   LFASRYTPVDAALVPTGALAPVAGTPYDFRAPAPVGARLADLRPRRGTGGVAGYDTNYAV  314

Query  835   DGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
             DG     +   + VA+V+D  +G  ME+ A  PGVQFYT+N L  V+GKG +VY  +AAL
Sbjct  315   DG---AASPSLRPVARVWDGATGRAMELWADQPGVQFYTSNGLAGVRGKGGSVYRRYAAL  371

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             CLETQGFPDAVNHP+FPS IV P + Y H +   F
Sbjct  372   CLETQGFPDAVNHPSFPSQIVRPGKVYSHDMLFKF  406



>ref|XP_010550628.1| PREDICTED: aldose 1-epimerase-like [Tarenaya hassleriana]
Length=356

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/339 (54%), Positives = 229/339 (68%), Gaps = 8/339 (2%)
 Frame = +1

Query  112   VSGQDNKF--YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN  285
              S +D K   Y +K+GDFSVK TNYGA + SL++PDK+GK+ D+VLG+D+V  Y+ D T 
Sbjct  20    CSEEDRKIGIYELKRGDFSVKFTNYGAVMISLLIPDKHGKVDDVVLGFDSVDSYKNDTTY  79

Query  286   FGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE-ESSITF  462
             FGAIVGRVANRIGGA+F L G  YKL  N+G NTLHGG KG S V W V+ ++ +S +TF
Sbjct  80    FGAIVGRVANRIGGAKFELEGHLYKLVPNEGRNTLHGGKKGFSDVIWTVRSYKPDSHVTF  139

Query  463   TYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDS  642
             TY+S DG++GFPGDV   VTY I     +L VKM AK LNK TP++LA H YWNL G +S
Sbjct  140   TYHSFDGEEGFPGDVEVKVTYMIM-GTNELGVKMEAKPLNKATPIDLALHTYWNLKGQNS  198

Query  643   GNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDI  822
             G+ILS  +Q+FA HITPVD +LIPTG I  +  T +DFL P  +G ++ +LP   GG+DI
Sbjct  199   GDILSHDVQLFASHITPVDVHLIPTGHISPVAGTPYDFLSPIPIGRRIHQLP---GGYDI  255

Query  823   NYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
             NY +      G    +  A V +  SG  ME+     GVQFYT+N L  V+GKG  VY  
Sbjct  256   NYVISS-GGSGEHLLRRTAVVSESVSGRRMELWTNQVGVQFYTSNMLTSVRGKGGFVYRK  314

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             +  LCLETQGFPD+VNH NFPS IV P + Y H +   F
Sbjct  315   YGGLCLETQGFPDSVNHENFPSQIVKPGEIYLHVMVFRF  353



>ref|NP_001052977.1| Os04g0458300 [Oryza sativa Japonica Group]
 dbj|BAF14891.1| Os04g0458300 [Oryza sativa Japonica Group]
Length=380

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/342 (54%), Positives = 222/342 (65%), Gaps = 15/342 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFS+++TN+GA + S++LPD  GKL D+VLGYDT+ EY    T FGA+VGRVAN
Sbjct  38    YELRKGDFSIRVTNWGAVIMSVVLPDSRGKLDDVVLGYDTIAEYVNSSTYFGALVGRVAN  97

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI  A+F L+G  Y L  NDG NTLHGG +G S V W VK+H    +   IT  Y+S DG
Sbjct  98    RIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLYYHSFDG  157

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPG +  +VTY +   PY L V MNA A  K TPVNLAQH+YWNLGG  SG+IL   
Sbjct  158   EQGFPGALDVYVTYQL-SGPYVLSVHMNATAAGKATPVNLAQHSYWNLGGTGSGDILGNT  216

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG-------GFDI  822
             +Q+FA   TPVD+ LIPTGQ+  +  T  D   P  VG+++  +  G         GFD 
Sbjct  217   VQLFASRYTPVDAELIPTGQVAPVTGTPCDLRAPTPVGARVHLVTGGLSKTGATIYGFDT  276

Query  823   NYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHL-QDVKGKGSAV  993
             NYAVDG DDV       + V  V D +SG  +E+ A  PGVQFYT N L  DVKGKG   
Sbjct  277   NYAVDGGDDVDAHAHALRRVTVVRDGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKA  336

Query  994   YESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             Y  + ALCLETQGFPDAVNHPNFPS IV P Q YKH +   F
Sbjct  337   YGQYGALCLETQGFPDAVNHPNFPSVIVRPGQVYKHEMVYKF  378



>ref|XP_002452332.1| hypothetical protein SORBIDRAFT_04g023830 [Sorghum bicolor]
 gb|EES05308.1| hypothetical protein SORBIDRAFT_04g023830 [Sorghum bicolor]
Length=394

 Score =   343 bits (881),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 228/338 (67%), Gaps = 13/338 (4%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRI  321
             ++ GDFS+K+TN+GA + S+ILPD  G L D+VLGYDTV EY      FG ++GRVANRI
Sbjct  55    LRMGDFSIKVTNWGATLMSVILPDSKGNLGDVVLGYDTVAEYVNGSAYFGGLIGRVANRI  114

Query  322   GGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQ  489
              GA+F L+G  Y+L  NDGNN+LHGG +G SKV W VK+H    +   IT  Y+S DG+Q
Sbjct  115   AGARFVLDGKAYRLYRNDGNNSLHGGHRGFSKVIWTVKEHVGGGDSPYITLYYHSFDGEQ  174

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKAL---NKPTPVNLAQHNYWNLGGHDSGNILSE  660
             GFPGD+  +VTY +  +PY L V+MNA A    ++ TPVNLA H YWNLGGH SG IL E
Sbjct  175   GFPGDLDVYVTYRL-SSPYALSVRMNATAAESRSRATPVNLAHHAYWNLGGHGSGPILGE  233

Query  661   KLQIFAYHITPVD-SNLIPTGQILLINNTAFDFLKPQQVGSQM-AKLPKGSGGFDINYAV  834
              +Q+FA   TPVD + LIPTG +  +  T +DF  P  VG+++   LP G  G+D NYAV
Sbjct  234   TVQLFASRYTPVDAATLIPTGALAPVAGTPYDFRAPAPVGARLQPDLPHGLAGYDTNYAV  293

Query  835   DGYDDVGTRKK---KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESH  1005
             D  DD         + VA+V+D  +G  ME+ A  PGVQFYT+N L  V+GKG +VY  +
Sbjct  294   DHDDDDDDGAAPPLRPVARVWDGATGRAMELWADQPGVQFYTSNGLAGVRGKGGSVYGRY  353

Query  1006  AALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              ALCLETQGFPDAVNHP+FPS IV P Q YKH +   F
Sbjct  354   GALCLETQGFPDAVNHPSFPSQIVRPGQVYKHDMVFKF  391



>gb|EPS71547.1| hypothetical protein M569_03212, partial [Genlisea aurea]
Length=329

 Score =   341 bits (874),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 223/329 (68%), Gaps = 6/329 (2%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y + +GDFS K+TNYGA V S++ PDKNG+L D+VLG+ TV  Y+ D T FGAIVGRVAN
Sbjct  4     YELGRGDFSAKITNYGATVVSIVFPDKNGELGDVVLGFPTVDGYKNDTTYFGAIVGRVAN  63

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGDQG  492
             RI GA+F+LNG  Y L AND  NTLHGG  G S V W V++H E+S +  +Y S DGDQG
Sbjct  64    RIAGAKFSLNGTVYHLPANDHGNTLHGGRIGFSDVVWNVEEHVEDSHLVLSYDSFDGDQG  123

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPG++   VTY +     +L +KM AK LN  TP+NLA H YWNLGGH SG+I S  LQ+
Sbjct  124   FPGEISVTVTYLLIGTD-RLAIKMQAKPLNMATPINLASHIYWNLGGHSSGDIFSHTLQL  182

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             FA  ITP D +LIPTG++  ++ T FDF +P+ +GS  +++P   GG+D+NYAVD  +  
Sbjct  183   FASEITPTDDDLIPTGELRRVDRTPFDFRQPRTIGSHFSQVP---GGYDVNYAVDESEPK  239

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
                  K VA   +  +G  +E+ +  PGVQFY+ N +   KGK  AVY+ +A  CLETQG
Sbjct  240   FQHLSK-VAAAREPETGRKLELWSNQPGVQFYSGNMIPATKGKDGAVYDKYAGFCLETQG  298

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FPD+VNHP FPS +V+P + Y H +   F
Sbjct  299   FPDSVNHPRFPSQVVSPGEDYLHVMVFRF  327



>ref|XP_009121605.1| PREDICTED: aldose 1-epimerase isoform X1 [Brassica rapa]
Length=500

 Score =   347 bits (889),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KK + +VK TN+GA + SL  PDKNGK  DIVLGYD+V  YE D   FGA VGRVA
Sbjct  172   LYELKKENLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVESYETDKVYFGATVGRVA  231

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG A F LNG  YK  ANDG NTLHGG KG   V W V KH    ++  I FTY S D
Sbjct  232   NRIGKAHFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIVFTYTSPD  291

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG++I  VTY  +K+N  KL V M AKA +K TPVNLA H YWNLGGH+SG+ILS
Sbjct  292   GDQGFPGELIVTVTYKLVKDN--KLSVVMEAKAKDKATPVNLAHHTYWNLGGHNSGDILS  349

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTG+I  +  T +DFL+P+ +   M  L     G+DINY +D
Sbjct  350   EEIQILGSSYTPVDGELIPTGKISPVKRTPYDFLQPRPIKDNMKDL---KTGYDINYCLD  406

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G  D    K + + ++ D++SG  ME+ A  PG+QFYT   L+D+KGK   VY++ A LC
Sbjct  407   GKAD----KMRKIVELVDKKSGRKMELSANQPGLQFYTGGMLKDIKGKNGTVYQAFAGLC  462

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PD+VN+P FPS IV P + YKH +   F +
Sbjct  463   LETQSYPDSVNNPKFPSQIVEPGKNYKHNMLFKFSI  498



>emb|CAH67072.1| OSIGBa0097P08.2 [Oryza sativa Indica Group]
Length=380

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 222/342 (65%), Gaps = 15/342 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFS+++TN GA + S++LPD  GK  D+VLGYDT+ EY    T FGA+VGRVAN
Sbjct  38    YELRKGDFSIRVTNGGAVIMSVVLPDSRGKWDDVVLGYDTIAEYVNSSTYFGALVGRVAN  97

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI  A+F L+G  Y L  NDG NTLHGG +G S V W VK+H    +   IT  Y+S DG
Sbjct  98    RIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLYYHSFDG  157

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPG +  +VTY +   PY L V MNA A  K TPVNLAQH+YWNLGG  +G+IL   
Sbjct  158   EQGFPGALDVYVTYQL-SGPYVLSVHMNATAAGKATPVNLAQHSYWNLGGTGNGDILGNT  216

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG-------GFDI  822
             +Q+FA   TPVD+ LIPTGQ+  +  T +D   P  VG+++  +  G         GFD 
Sbjct  217   VQLFASRYTPVDAELIPTGQVAPVTGTPYDLRAPTPVGARVHLVTGGLSKTGATIYGFDT  276

Query  823   NYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHL-QDVKGKGSAV  993
             NYAVDG DDV       + VA V D +SG  +E+ A  PGVQFYT N L  DVKGKG   
Sbjct  277   NYAVDGGDDVDAHAHALRRVAVVRDGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKA  336

Query  994   YESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             Y  + ALCLETQGFPDAVNHPNFPS IV P Q YKH +   F
Sbjct  337   YGQYGALCLETQGFPDAVNHPNFPSVIVRPGQVYKHEMVYKF  378



>gb|AES91241.2| aldose 1-epimerase family protein [Medicago truncatula]
Length=340

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 221/330 (67%), Gaps = 26/330 (8%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +KKG   V LTNYGA + ++ +PDK+GK+ D+VLGYD++ +YE D   FG ++GRVA
Sbjct  33    FYELKKGSMRVNLTNYGASIVAVYVPDKHGKVADVVLGYDSIEQYETDGVYFGGLIGRVA  92

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGDQ  489
             NRIGGAQFTL+G  YKL AND  NTLHGG KG     WKVK H ++S +TFTY S DG+Q
Sbjct  93    NRIGGAQFTLDGKTYKLPANDHGNTLHGGQKGFGDNVWKVKIHKDDSHVTFTYESFDGEQ  152

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             GFPG +   VTY + E    L VKM AK +NKPTPVNLAQH YWNLGGH+SG+IL+  +Q
Sbjct  153   GFPGKLDVSVTYMLLEKNI-LGVKMTAKPVNKPTPVNLAQHAYWNLGGHNSGDILNHSVQ  211

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             IF   ITPVD  LIPTG++  + NT +DFLKP+QVGSQ+  LP   G +DINYA+     
Sbjct  212   IFGSSITPVDDKLIPTGKLESVKNTPYDFLKPKQVGSQINDLP---GLYDINYAI-----  263

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
                          DER    ME+ +   G+Q+YT+  L D KGK  A Y  +  + LETQ
Sbjct  264   -------------DERK---MELWSNQVGLQYYTSGMLTDTKGKDGATYHKYGGIALETQ  307

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFPD+VN PNFPS IV P + YKH +   F
Sbjct  308   GFPDSVNKPNFPSQIVKPGETYKHIMVYRF  337



>gb|KDP31227.1| hypothetical protein JCGZ_11603 [Jatropha curcas]
Length=352

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 241/359 (67%), Gaps = 29/359 (8%)
 Frame = +1

Query  82    LCFFISFALIVS---------GQDNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKL  228
              C F+  AL+ S           +NK   Y +K+G+FSVK TN+GA + S++LPDKNG  
Sbjct  7     FCCFLLVALLFSNNNGCEAADSSENKAEIYELKRGNFSVKFTNFGATMLSIVLPDKNGLH  66

Query  229   TDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKG  408
               + LG++       D T FG+IVGRVANRIG +QFTLNG  YKL  N+G N+LHGGPKG
Sbjct  67    FSLSLGFN-------DTTYFGSIVGRVANRIGKSQFTLNGTVYKLVPNNGKNSLHGGPKG  119

Query  409   ISKVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIAHVTY-TIKENPYKLIVKMNAKALN  582
              S+V WKV  + ++S ITFTY S DG++G+PGD+   VTY  I  N  K+ VKM AK LN
Sbjct  120   FSEVLWKVYSYNKDSHITFTYDSFDGEEGYPGDLSVSVTYFVIGTN--KIAVKMVAKPLN  177

Query  583   KPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLK  762
             K TPVNLA H Y+NL GH+SG+ILS K+Q+FA  ITPVDS LIPTG+I  +  T FDFL+
Sbjct  178   KATPVNLALHTYFNLAGHNSGDILSHKIQLFAPEITPVDSELIPTGKITPVKGTPFDFLE  237

Query  763   PQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQ  942
             P+++GS++ ++P    G+DINY +   +D+ +   K  A V ++ SG  +E+    PGVQ
Sbjct  238   PREIGSRIKEVP----GYDINYVL---EDLKSGHLKRAAIVKEDVSGRKLELWTNQPGVQ  290

Query  943   FYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FYT+N L DVKGK   +Y+  A  CLETQGFPD+VNHPNFPS IV P + Y H +   F
Sbjct  291   FYTSNMLHDVKGKDGFIYQKFAGFCLETQGFPDSVNHPNFPSQIVNPGETYMHIMVYRF  349



>ref|XP_006404338.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
 gb|ESQ45791.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
Length=343

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 227/330 (69%), Gaps = 17/330 (5%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y + +G+ SV  TNYGA + SL+LPD++GK  D+VLG+DTV  Y+ D T FGAIVGRVAN
Sbjct  26    YKLTRGNLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTVDGYKNDTTYFGAIVGRVAN  85

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGDQG  492
             RIGGA+F LNG  YK + N+G+NTLHGG KG S V W V+ +  +S ITF Y S DG++ 
Sbjct  86    RIGGAEFELNGQMYKTDPNEGHNTLHGGAKGFSDVIWSVENYVPTSHITFKYDSFDGEE-  144

Query  493   FPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
                     VTY  I EN  KL VKM AK +NKPTP+NLA H YWNL  H+SG+ILS K+Q
Sbjct  145   ------VKVTYMLIGEN--KLAVKMEAKPINKPTPINLALHTYWNLHSHNSGDILSHKIQ  196

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             + A  ITPVD  LIPTG+I  I  T +DFL+P+++GS++ +LP   GG+DINY +DG   
Sbjct  197   LLAGKITPVDKKLIPTGEITAIEGTPYDFLEPREIGSRIDELP---GGYDINYVIDG---  250

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
             +  +  +  A V +E +G  ME+ +  PGVQFYT+N L  V GK  AVY+ HA LCLETQ
Sbjct  251   IAGKHLRKTAIVSEESTGRKMELWSNQPGVQFYTSNLLTRVAGKERAVYKKHAGLCLETQ  310

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFPD+VNH NFPS IV P + Y H +   F
Sbjct  311   GFPDSVNHNNFPSQIVNPGESYLHVMLFRF  340



>ref|XP_006287626.1| hypothetical protein CARUB_v10000838mg [Capsella rubella]
 gb|EOA20524.1| hypothetical protein CARUB_v10000838mg [Capsella rubella]
Length=484

 Score =   344 bits (882),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 224/335 (67%), Gaps = 12/335 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ ++K TN+GA + SL  PDKNGK+ DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  156   LYELKKGNITIKFTNWGASIMSLNFPDKNGKIGDIVLGYDSVKSYQTDKVYFGATVGRVA  215

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG AQF LNG  YK +ANDG NTLHGG KG   V W V KH    ++  I FTY S D
Sbjct  216   NRIGKAQFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIVFTYTSPD  275

Query  481   GDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSE  660
             GDQGFPG++   VTYT+ ++  +L V M AK  +K TPVNLA H YWNLGGH++G+ILSE
Sbjct  276   GDQGFPGELNVTVTYTLDKDN-ELSVVMEAKTKDKATPVNLAHHTYWNLGGHNAGDILSE  334

Query  661   KLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG  840
             ++QI     TPVD  LIPTGQI  +  T +DFL+ + +   +  L     G+DINY +DG
Sbjct  335   EIQILGSSYTPVDGELIPTGQISPVKGTPYDFLQLRPIKDNIKDLKT---GYDINYCLDG  391

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
               D    K + +  + D++SG  ME+    PG+QFYT   L+D+KGK  AVY+++  LCL
Sbjct  392   KAD----KMRKIVDLVDKKSGRKMELTGNQPGLQFYTGEMLKDIKGKNGAVYQAYGGLCL  447

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             ETQ +PDA+N+P FPS IV P + YKHT+   F +
Sbjct  448   ETQSYPDALNYPKFPSQIVEPGKKYKHTMLFKFSI  482



>ref|XP_009131443.1| PREDICTED: aldose 1-epimerase-like [Brassica rapa]
Length=535

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 226/336 (67%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ ++KLTN+GA + SL  PDKNGK  DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  207   LYELKKGNITIKLTNWGASIMSLHFPDKNGKAGDIVLGYDSVKSYKTDKVYFGATVGRVA  266

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG AQF LNG  YK  ANDG NTLHGG KG   V W VKKH    ++  I FTY S D
Sbjct  267   NRIGKAQFKLNGKEYKTTANDGKNTLHGGKKGFGDVVWGVKKHKYDGKKPHIVFTYTSPD  326

Query  481   GDQGFPGDVIAHVTYTI-KENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG+V   VTY + KEN  +L V M AK  +K TP+NLA H+YWNLGGH++G+ILS
Sbjct  327   GDQGFPGEVNVTVTYKLDKEN--ELSVVMEAKPKDKATPINLAHHSYWNLGGHNAGDILS  384

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTG+I  +  T++DFL+ + +   M  L     G+DINY +D
Sbjct  385   EEIQILGSSYTPVDGELIPTGEISPVKGTSYDFLQLRPIKDNMKDL---KAGYDINYCLD  441

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G  D    K + + ++ D++SG  ME+    PG+QFYT   L+D+KGK    Y++ A LC
Sbjct  442   GKAD----KMRKIVELIDKKSGRKMELSGNQPGLQFYTGGMLKDIKGKNGTTYQAFAGLC  497

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQG+P++VN+P FPS IV P + YKHT+   F +
Sbjct  498   LETQGYPNSVNNPKFPSQIVEPGKTYKHTMLFKFSI  533



>ref|XP_004508758.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Cicer arietinum]
Length=318

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 222/322 (69%), Gaps = 8/322 (2%)
 Frame = +1

Query  157   FSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQF  336
               + LTNYGA V S+I+PDK+G L D+VLGYD++  YE D   FGA++GRVANRIGGAQF
Sbjct  1     MRLNLTNYGATVISVIVPDKHGNLADVVLGYDSINSYENDTCYFGALIGRVANRIGGAQF  60

Query  337   TLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGDQGFPGDVIA  513
             TL+G  YKL  ND  NTLHGG KG S V W VK H E++ ITFTY S D +QGFPG +  
Sbjct  61    TLDGKTYKLPVNDHGNTLHGGTKGFSDVIWTVKSHREDNHITFTYDSFDNEQGFPGKLEV  120

Query  514   HVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITP  693
              VTY +      L VKM AK ++K TPVNLAQH YWNL GH+SG+ILS  +QIF  +ITP
Sbjct  121   SVTYMLFGRNL-LGVKMIAKPIDKATPVNLAQHTYWNLRGHNSGDILSHIVQIFGSNITP  179

Query  694   VDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKT  873
             VD+NLIPTG++  + NT +DFLKP++VGSQ+ +LP   G +DINY +D        K   
Sbjct  180   VDNNLIPTGKVQSVQNTPYDFLKPKKVGSQINELP---GLYDINYVLDKNSQNHLSK---  233

Query  874   VAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNH  1053
             VA V D  SG  ME+ +   GVQ+YT+  L D KGKG  +Y  HA + LETQG+PD+VNH
Sbjct  234   VAMVRDPVSGRKMELWSNQLGVQYYTSGMLGDTKGKGGVIYHKHAGIALETQGYPDSVNH  293

Query  1054  PNFPSTIVTPQQPYKHTLHITF  1119
             PNFPS IV P + YKH +   F
Sbjct  294   PNFPSQIVHPGETYKHYMVYRF  315



>ref|XP_010524327.1| PREDICTED: aldose 1-epimerase isoform X1 [Tarenaya hassleriana]
 ref|XP_010524328.1| PREDICTED: aldose 1-epimerase isoform X2 [Tarenaya hassleriana]
Length=451

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/339 (52%), Positives = 226/339 (67%), Gaps = 12/339 (4%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             +D   Y +KKG+ +VK TN+GA + SLILPDK+GK+ DIVLGYD+V +Y  D   FGA V
Sbjct  119   KDAGTYELKKGNMTVKFTNWGASIMSLILPDKHGKMGDIVLGYDSVKDYMNDTVYFGATV  178

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS----ITFTY  468
             GRVANRIG A+F LNG  YK  AN+G NTLHGG +G   V W V K         I FTY
Sbjct  179   GRVANRIGKARFKLNGKTYKTVANEGKNTLHGGKRGFGDVVWSVTKRRFDGNTPFIVFTY  238

Query  469   YSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGN  648
              S DGDQGFPG++   VTY +     +L V+M AK  +K TPVNLA H YWNLGGHDSG+
Sbjct  239   TSPDGDQGFPGELRVKVTYKL-VGTNELRVEMEAKPKDKATPVNLAHHTYWNLGGHDSGD  297

Query  649   ILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINY  828
             ILSE+++I     TPVD  LIPTG+ L +  T FDFL    +  ++ KL K   G+DIN 
Sbjct  298   ILSEQIRILGSRYTPVDGQLIPTGKTLPVQGTPFDFLHLHPIKDKIKKLNK---GYDINI  354

Query  829   AVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
              ++G      ++ + V ++ D+RSG  ME+ A  PG+QFYT   L++VKGK  AVY+++A
Sbjct  355   CLEGK----AKRIRKVVELVDKRSGRKMELSANQPGLQFYTGGQLKNVKGKNGAVYKAYA  410

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
              LCLETQG+PD+VN+ NFPS IV P + YKH +H  F +
Sbjct  411   GLCLETQGYPDSVNYKNFPSQIVQPGKTYKHVMHFKFSI  449



>ref|XP_010453642.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=489

 Score =   342 bits (878),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 222/336 (66%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ +VK TN+GA + SL  PDKNGK+ DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  161   LYELKKGNLTVKFTNWGASIMSLHFPDKNGKIDDIVLGYDSVKSYKTDKVYFGATVGRVA  220

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG AQF LNG  YK +ANDG NTLHGG KG   V W V KH    +   I FTY S D
Sbjct  221   NRIGNAQFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVSKHKYDGKSPHIVFTYTSPD  280

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG++ A VTY  +K+N  +L V M AK  +K TPVNLA H YWNLGGH++G+ILS
Sbjct  281   GDQGFPGELNATVTYKLVKDN--ELSVVMEAKPKDKATPVNLAHHTYWNLGGHNAGDILS  338

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTGQI  +  T +DFL+ + +   M  L     G+DINY +D
Sbjct  339   EEIQILGSSYTPVDGELIPTGQISPVKGTPYDFLQLRPIKDNMKDLKT---GYDINYCLD  395

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G       K + + ++ D +SG  ME+    PG+QFYT   L+D+KGK  AV +++  LC
Sbjct  396   GQ----ANKMRKIVELVDRKSGRKMELSGNQPGLQFYTGGMLKDIKGKNGAVNQAYGGLC  451

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PDA+N+P FPS IV P + YKHT+   F +
Sbjct  452   LETQSYPDALNYPKFPSQIVEPGKNYKHTMLFKFSI  487



>gb|KFK25751.1| hypothetical protein AALP_AA8G154800 [Arabis alpina]
Length=539

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 223/335 (67%), Gaps = 14/335 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +KKG+ +VK TN+GA + SL  PDKNGK  DIVLGYD++  Y+ D   FGA VGRVAN
Sbjct  212   YELKKGNLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSIKSYKTDKVYFGATVGRVAN  271

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE----ESSITFTYYSRDG  483
             RIG AQF L+G  YK +ANDG NTLHGG KG   V W V KH+    +  I FTY S DG
Sbjct  272   RIGKAQFKLDGKEYKTSANDGKNTLHGGMKGFGDVVWAVSKHQYDGKKPHIVFTYTSPDG  331

Query  484   DQGFPGDVIAHVTYTI-KENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSE  660
             DQGFPG++   VTY I K+N  +L V M AK  +K TPVNLA H+YWNLGGH++G+ILSE
Sbjct  332   DQGFPGELNVTVTYKIVKDN--ELSVVMEAKPKDKATPVNLAHHSYWNLGGHNAGDILSE  389

Query  661   KLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG  840
             ++QI     TPVD  LIPTGQI  +  T +DFL+ + +   M  L     G+DINY +DG
Sbjct  390   EIQILGSSYTPVDGELIPTGQISPVKGTPYDFLQLRPIKDNMKDLKT---GYDINYCLDG  446

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
                    K + + ++ D++SG  ME+    PG+QFYT   L+D+KGK   VY++ A LCL
Sbjct  447   K----AEKMRKIVELVDKKSGRKMELSGDQPGLQFYTGGMLKDIKGKNGTVYKAFAGLCL  502

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             ETQ +PDA+NHP FPS IV P + YKHT+   F +
Sbjct  503   ETQSYPDALNHPKFPSQIVEPGKKYKHTMLFKFSI  537



>ref|NP_197018.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 emb|CAB89324.1| putative aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|ABE66157.1| aldose 1-epimerase family protein [Arabidopsis thaliana]
 gb|AED92121.1| aldose 1-epimerase [Arabidopsis thaliana]
Length=490

 Score =   340 bits (872),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ +VK TN+GA + SL  PDKNGK+ DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  162   LYELKKGNLTVKFTNWGASIISLHFPDKNGKMDDIVLGYDSVKTYKTDKVYFGATVGRVA  221

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE----ESSITFTYYSRD  480
             NRIG  +F LNG  YK + NDG NTLHGG KG   V W V KH+    +  I FT+ S D
Sbjct  222   NRIGKGKFKLNGKEYKTSVNDGKNTLHGGKKGFGDVVWAVAKHQYDGKKPHIVFTHTSPD  281

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG++   VTY  +K+N  +L V M AK  +K TPVNLA H+YWNLGGH+SG+ILS
Sbjct  282   GDQGFPGELSVTVTYKLVKDN--ELSVVMEAKPKDKATPVNLAHHSYWNLGGHNSGDILS  339

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTG+I  +  TA+DFL+ + +   M  L     G+DINY +D
Sbjct  340   EEIQILGSGYTPVDGELIPTGKINPVKGTAYDFLQLRPIKDNMKDLKT---GYDINYCLD  396

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G      +K + + ++ D++SG  ME+     G+QFYT   L+DVKGK  AVY++   LC
Sbjct  397   GK----AKKMRKIVELVDKKSGRKMELSGNQAGLQFYTGGMLKDVKGKNGAVYQAFGGLC  452

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PDA+NHP FPS IV P + YKHT+   F +
Sbjct  453   LETQSYPDALNHPKFPSQIVEPGKKYKHTMLFKFSI  488



>ref|XP_010420168.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=489

 Score =   340 bits (871),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ +VK TN+GA + SL  PDKNGK+ DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  161   LYELKKGNLTVKFTNWGASIMSLHFPDKNGKIDDIVLGYDSVKSYKTDKVYFGATVGRVA  220

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG AQF LNG  YK +ANDG NTLHGG KG   V W V KH    +   I FTY S D
Sbjct  221   NRIGKAQFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVAKHKYDGKSPHIVFTYTSPD  280

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG++ A VTY  +K+N  +L V M AK  +K TPVNLA H YWNLGGH++G+ILS
Sbjct  281   GDQGFPGELNATVTYKLVKDN--ELSVVMEAKPNDKATPVNLAHHTYWNLGGHNAGDILS  338

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTGQI  +  T +DFL+ + +   M  L     G+DINY +D
Sbjct  339   EEIQILGSSYTPVDGELIPTGQISPVKGTPYDFLQLRPIKDNMKDLKT---GYDINYCLD  395

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G       + + + ++ D++SG  ME+    PG+QFYT   L+D+KGK  AV +++  LC
Sbjct  396   GQ----ANQMRKIVELVDKKSGRKMELSGNQPGLQFYTGGMLKDIKGKNGAVNQAYGGLC  451

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PDA+N+P FPS IV P + YKHT+   F +
Sbjct  452   LETQSYPDALNYPKFPSQIVEPGKNYKHTMLFKFSI  487



>ref|XP_004975838.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=359

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 223/330 (68%), Gaps = 12/330 (4%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KKGDFS+K+TN+GA + S+I+PD  G L D+VLGYDT+ EY    + FG +VGRVANRI 
Sbjct  36    KKGDFSIKVTNWGATLMSVIVPDSKGNLADVVLGYDTLAEYVDASSAFGTVVGRVANRIA  95

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
                F L+G    LN  DG   LHGG KG ++V W VK++    +   IT  Y+S DG+QG
Sbjct  96    NGSFVLDGKTIHLN-KDGTTVLHGGLKGFNRVIWTVKEYVPRGDSPYITLYYHSFDGEQG  154

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPGD+  +VTY +   PY+L  +MNA ALNK TPVNLA H YWN+GGH SG++L + +Q+
Sbjct  155   FPGDLDVYVTYQL-SCPYQLSARMNATALNKATPVNLANHAYWNVGGHGSGDVLGQVIQV  213

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLP-KGSGGFDINYAVDGYDD  849
             FA   TPVD N+IPTG++  ++ T +D   P  +G+++  +   G  GFDINYAVDG   
Sbjct  214   FASRYTPVDRNMIPTGEVAPVSGTPYDLRAPTPLGTRIGLVSGAGMAGFDINYAVDG--G  271

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
              G RK   VA+++D +SG  +E+ A  PGVQ YT+N L +V GKG  VY  + A+CLETQ
Sbjct  272   GGFRK---VARLWDPQSGRVLELWADQPGVQLYTSNWLGNVTGKGGEVYGQYGAVCLETQ  328

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFPDAVNHPNFPS IV P Q Y+H +   F
Sbjct  329   GFPDAVNHPNFPSQIVRPGQAYRHDMLFKF  358



>ref|XP_010492338.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=508

 Score =   339 bits (870),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ +VK TN+GA + SL  PDKNGK+ DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  180   LYELKKGNLTVKFTNWGASIMSLHFPDKNGKIDDIVLGYDSVKTYKTDKVYFGATVGRVA  239

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG A F LNG  YK +ANDG NTLHGG KG   V W V KH    +   I FTY S D
Sbjct  240   NRIGKAHFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVSKHKYDGKSPHIVFTYTSPD  299

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             GDQGFPG++ A VTY  +K+N  +L V M AK  +K TPVNLA H+YWNLGGH++G+ILS
Sbjct  300   GDQGFPGELNATVTYKLVKDN--ELSVVMEAKPKDKATPVNLAHHSYWNLGGHNAGDILS  357

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTG+I  +  T +DFL+ + +   +  L     G+DINY +D
Sbjct  358   EEIQILGSSYTPVDGELIPTGKISPVKGTPYDFLQLRPIKDNIKDLKT---GYDINYCLD  414

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G       K + + ++ D++SG  ME+    PG+QFYT   L+D+KGK   VY+++  LC
Sbjct  415   GE----ANKMRKIVELVDKKSGRKMELSGDQPGLQFYTGGMLKDIKGKNGTVYQAYGGLC  470

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PD++NHP FPS IV P + YKHT+   F +
Sbjct  471   LETQSYPDSLNHPKFPSQIVEPGKKYKHTMLFKFSI  506



>ref|XP_003609044.1| Aldose 1-epimerase-like protein [Medicago truncatula]
Length=337

 Score =   333 bits (855),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 218/330 (66%), Gaps = 29/330 (9%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +KKG   V LTNYGA + ++ +PDK+GK+ D+VLGYD++ +YE D   FG ++GRVA
Sbjct  33    FYELKKGSMRVNLTNYGASIVAVYVPDKHGKVADVVLGYDSIEQYETDGVYFGGLIGRVA  92

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGDQ  489
             NRIGGAQFTL+G  YKL AND  NTLHGG KG     WKVK H ++S +TFTY S DG+Q
Sbjct  93    NRIGGAQFTLDGKTYKLPANDHGNTLHGGQKGFGDNVWKVKIHKDDSHVTFTYESFDGEQ  152

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             GFPG +   VTY + E    L VKM AK +NKPTPVNLAQH YWNLGGH+SG+IL+  +Q
Sbjct  153   GFPGKLDVSVTYMLLEKNI-LGVKMTAKPVNKPTPVNLAQHAYWNLGGHNSGDILNHSVQ  211

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             IF   ITPVD  LIPTG++  + NT +DFLKP+QVGSQ+  LP   G +DINY       
Sbjct  212   IFGSSITPVDDKLIPTGKLESVKNTPYDFLKPKQVGSQINDLP---GLYDINY-------  261

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
                           ER    ME+ +   G+Q+YT+  L D KGK  A Y  +  + LETQ
Sbjct  262   --------------ERK---MELWSNQVGLQYYTSGMLTDTKGKDGATYHKYGGIALETQ  304

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFPD+VN PNFPS IV P + YKH +   F
Sbjct  305   GFPDSVNKPNFPSQIVKPGETYKHIMVYRF  334



>emb|CDP12362.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/365 (49%), Positives = 234/365 (64%), Gaps = 16/365 (4%)
 Frame = +1

Query  52    IMSIISAPLFLCFFISFALIVSGQ------DN--KFYVIKKGDFSVKLTNYGARVASLIL  207
             + S  S+ ++    I   L+ S        DN    Y +  G  S+K+TNYGA + S+ +
Sbjct  1     MASKASSMVYFFVLIGLTLLFSNNVYATDYDNYINVYELTNGKISIKVTNYGATLLSVTV  60

Query  208   PDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNT  387
             PD+NGKL D+VLGY T+  Y+ D T FG ++GRVANRIGGA+FTLNG+ Y L AND  NT
Sbjct  61    PDRNGKLDDVVLGYPTIEGYKNDSTYFGGLIGRVANRIGGAKFTLNGVEYNLPANDHGNT  120

Query  388   LHGGPKGISKVYWKVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKM  564
             LHGG +G S V W+V  +E++S ++  Y+S DG+QGFPG V  +VTY I     +L +KM
Sbjct  121   LHGGTRGFSDVIWEVTSYEKNSHVSLHYHSYDGEQGFPGAVDVYVTYMIIGGN-RLGLKM  179

Query  565   NAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNT  744
              A  L+K TP+NLA H+YWNL GH SG+I S  +Q+FA  ITPVD  LIPTGQI+ +  T
Sbjct  180   EATPLDKATPINLASHSYWNLAGHGSGDIFSHDIQLFASKITPVDDKLIPTGQIVPVQGT  239

Query  745   AFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKA  924
              +DFL+ + +GS+  +LP    G+DINY VD   +    K   VA V + +SG  ME+ +
Sbjct  240   PYDFLQSRSIGSKFNELPS---GYDINYVVDYVPNGHVHK---VAVVQEPKSGRKMELWS  293

Query  925   TAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHT  1104
               PGVQFYT+N L D  GK  A Y  +  L LETQGFPD+VNHPNFPS IV P + Y H 
Sbjct  294   NKPGVQFYTSNMLNDTLGKDGATYRRYGGLALETQGFPDSVNHPNFPSQIVNPGENYLHV  353

Query  1105  LHITF  1119
             +   F
Sbjct  354   MVYRF  358



>emb|CAN61059.1| hypothetical protein VITISV_011619 [Vitis vinifera]
Length=329

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 228/355 (64%), Gaps = 38/355 (11%)
 Frame = +1

Query  82    LCFFISFALIVS-----GQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLG  246
             LC F+  A  ++       +   Y +K+G+FSVKLTNYGA V S+ILPD+NGKL D+VLG
Sbjct  7     LCCFLLLAFAIAKVSEASSEIGVYELKRGNFSVKLTNYGATVVSVILPDRNGKLDDVVLG  66

Query  247   YDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYW  426
             +D+V +Y+ D T FGAIVGRVANRI GAQFTLNG  YKL  N+G N LHGGPKG S V W
Sbjct  67    FDSVEDYKNDTTYFGAIVGRVANRIKGAQFTLNGKKYKLVPNEGKNMLHGGPKGFSDVIW  126

Query  427   KVKKHEESS-ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNL  603
              V+ ++++S +TF Y+S DG++G P                          LNK TPVNL
Sbjct  127   HVQSYDKNSHVTFVYHSFDGEEGRP--------------------------LNKATPVNL  160

Query  604   AQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQ  783
             A H+YWNLGGH SG++ S ++Q+FA  ITPVD  LIPTG+IL +  T +DFL   ++ ++
Sbjct  161   ASHSYWNLGGHSSGDVFSHQVQLFADKITPVDDELIPTGKILPVEGTPYDFLNIHEIKTR  220

Query  784   MAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHL  963
               +LP    G+DINY +   + VG       A VY+ +SG  ME+    PG+QFYT+N L
Sbjct  221   FHELPS---GYDINYVL---NYVGNEHFHKAAVVYESKSGRKMELWTNQPGLQFYTSNML  274

Query  964   QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
               VKGKG   Y ++  +CLETQGFPDAVNHP+FPS IV P + Y+H +   F  +
Sbjct  275   GTVKGKGGVTYNNYDGICLETQGFPDAVNHPDFPSQIVNPGEIYEHFMVYRFTAK  329



>dbj|BAK01606.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 222/329 (67%), Gaps = 10/329 (3%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KKGDFS+K+TN+GA + S+++PD +G+LTD+VLGYDTV  Y +       I GRVANRI 
Sbjct  18    KKGDFSIKVTNWGATLVSVLVPDCHGELTDVVLGYDTVAGYAKGGAAGSTI-GRVANRIA  76

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
              A+F L+G  Y+L  NDGNNT+HGGP+G +KV W VK++    +   ITF Y+S DG+QG
Sbjct  77    NARFVLDGRTYRLLRNDGNNTIHGGPRGFNKVIWTVKEYVHDGDSPYITFYYHSFDGEQG  136

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPG +  +VTY + + PY L + MNA A  K TPVNL  H YWNL GH SG++L  ++QI
Sbjct  137   FPGYLDVYVTYQLSD-PYDLSIHMNATARGKATPVNLVNHAYWNLAGHGSGDVLEHEVQI  195

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             FA   TPVD  +IPTGQ+  +  T +DFL P  VG+ M  +P G GG+DIN+AVDG  + 
Sbjct  196   FASRYTPVDGYMIPTGQVAPVAGTKYDFLAPTPVGANMEIVPGGGGGYDINFAVDGQQNA  255

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
                  + VA+V D  SG  +E+ A  PGVQ YTAN L + KGKG  VY  + ALCLETQ 
Sbjct  256   ----MRPVARVQDPDSGRALELWANQPGVQLYTANWLINDKGKGGEVYGQYGALCLETQA  311

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             +PDAVNHP FPS+IV   + YKH +   F
Sbjct  312   YPDAVNHPEFPSSIVRLGEVYKHDMLFKF  340



>dbj|BAK02841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 222/329 (67%), Gaps = 10/329 (3%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KKGDFS+K+TN+GA + S+++PD +G+LTD+VLGYDTV  Y +       I GRVANRI 
Sbjct  36    KKGDFSIKVTNWGATLVSVLVPDCHGELTDVVLGYDTVAGYAKGGAAGSTI-GRVANRIA  94

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
              A+F L+G  Y+L  NDGNNT+HGGP+G +KV W VK++    +   ITF Y+S DG+QG
Sbjct  95    NARFVLDGRTYRLLRNDGNNTIHGGPRGFNKVIWTVKEYVHDGDSPYITFYYHSFDGEQG  154

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPG +  +VTY + + PY L + MNA A  K TPVNL  H YWNL GH SG++L  ++QI
Sbjct  155   FPGYLDVYVTYQLSD-PYDLSIHMNATARGKATPVNLVNHAYWNLAGHGSGDVLEHEVQI  213

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             FA   TPVD  +IPTGQ+  +  T +DFL P  VG+ M  +P G GG+DIN+AVDG  + 
Sbjct  214   FASRYTPVDGYMIPTGQVAPVAGTKYDFLAPTPVGANMEIVPGGGGGYDINFAVDGQQNA  273

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
                  + VA+V D  SG  +E+ A  PGVQ YTAN L + KGKG  VY  + ALCLETQ 
Sbjct  274   ----MRPVARVQDPDSGRALELWANQPGVQLYTANWLINDKGKGGEVYGQYGALCLETQA  329

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             +PDAVNHP FPS+IV   + YKH +   F
Sbjct  330   YPDAVNHPEFPSSIVRLGEVYKHDMLFKF  358



>ref|XP_010930434.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Elaeis guineensis]
Length=338

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 229/346 (66%), Gaps = 15/346 (4%)
 Frame = +1

Query  112   VSGQDNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN  285
             ++G+D K   + +  G  + K+TN GA + SL++PD  G L D+VLG+D++  Y  +   
Sbjct  1     MAGEDRKPGLFELSNGTITAKITNLGATITSLLVPDAQGNLADVVLGFDSLESYHDNPPY  60

Query  286   FGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSI  456
             FG IVGRVANRI   +FTLNG+ Y L  N+G N+LHGG KG +KV W+V ++   +  S+
Sbjct  61    FGCIVGRVANRIKQGKFTLNGVEYSLAINNGPNSLHGGNKGFNKVLWEVVEYNNDKNPSV  120

Query  457   TFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGH  636
             TF Y+S+DG++G+PGDVI   TY++  +   L ++M A  LNKPTP+NLAQH YWNL GH
Sbjct  121   TFKYHSKDGEEGYPGDVIVTATYSLPSS-TSLKLEMEAVPLNKPTPINLAQHTYWNLAGH  179

Query  637   DSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGF  816
             +SGN+L   +QI+A H+TPVD N IPTG+I+ ++ T FDF    ++GS++ +LP    G+
Sbjct  180   NSGNVLGHSIQIWASHVTPVDENSIPTGEIMPVSGTPFDFTTENKIGSRIHELPV---GY  236

Query  817   DINYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSA  990
             D NY +    D G  K   K VAKV    S   + + A APGVQFYTAN++  V GK  A
Sbjct  237   DHNYVL----DCGEEKSGLKHVAKVKHPLSSRVLNLWADAPGVQFYTANYVSGVVGKAGA  292

Query  991   VYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             VYE HA LCLETQGFP+A+N PNFPS  V P + Y+H +   F  +
Sbjct  293   VYEKHAGLCLETQGFPNAINQPNFPSIAVQPGEKYRHNMLFEFSTE  338



>emb|CDP15260.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 210/286 (73%), Gaps = 12/286 (4%)
 Frame = +1

Query  271   QDDTN-FGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEE  447
             Q+DT  FGAIVGRV NRIGGAQFTLNG+HYKL+AN+  N LHGG KG S + W V+K+ +
Sbjct  32    QNDTQYFGAIVGRVVNRIGGAQFTLNGVHYKLDANEKPNMLHGGRKGFSLLTWNVEKYVK  91

Query  448   SS----ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHN  615
                   I  +YYS DG++GFPG+++  VTY + E PYKL V M A+ALNK TPVNLAQH+
Sbjct  92    DRANPFIVLSYYSHDGEEGFPGNLLVRVTYALLE-PYKLSVIMEAEALNKATPVNLAQHS  150

Query  616   YWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKL  795
             YWNLGGH+SG++LS+ +QIF  H TP ++ LIPTG+IL +  T +DFLKP ++ SQM  L
Sbjct  151   YWNLGGHNSGDVLSDTVQIFGLHYTPANNQLIPTGEILPVKGTPYDFLKPHKIQSQMKGL  210

Query  796   PKGSG--GFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQD  969
             P+G    G+++NYA+D   D    K K  A  Y +++GIGM I  +APG+QFYTAN+L +
Sbjct  211   PRGGAPSGYNVNYALDEGKD---HKLKLAAIAYSKKTGIGMMISTSAPGLQFYTANYL-N  266

Query  970   VKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTL  1107
             V GKG  VY+SHAA C ETQGFPDAVNHPNFPSTIV P   Y H +
Sbjct  267   VTGKGGYVYQSHAAYCFETQGFPDAVNHPNFPSTIVNPGDLYVHNI  312



>emb|CAD40900.2| OSJNBa0036B21.18 [Oryza sativa Japonica Group]
Length=401

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 222/363 (61%), Gaps = 36/363 (10%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFS+++TN+GA + S++LPD  GKL D+VLGYDT+ EY    T FGA+VGRVAN
Sbjct  38    YELRKGDFSIRVTNWGAVIMSVVLPDSRGKLDDVVLGYDTIAEYVNSSTYFGALVGRVAN  97

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHG---------------------GPKGISKVYWKV  432
             RI  A+F L+G  Y L  NDG NTLHG                     G +G S V W V
Sbjct  98    RIAKARFVLDGKAYHLYPNDGKNTLHGILEKFPEVQEIHGAWFISTNSGHRGFSNVTWTV  157

Query  433   KKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVN  600
             K+H    +   IT  Y+S DG+QGFPG +  +VTY +   PY L V MNA A  K TPVN
Sbjct  158   KEHVGGGDAPYITLYYHSFDGEQGFPGALDVYVTYQL-SGPYVLSVHMNATAAGKATPVN  216

Query  601   LAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGS  780
             LAQH+YWNLGG  SG+IL   +Q+FA   TPVD+ LIPTGQ+  +  T  D   P  VG+
Sbjct  217   LAQHSYWNLGGTGSGDILGNTVQLFASRYTPVDAELIPTGQVAPVTGTPCDLRAPTPVGA  276

Query  781   QMAKLPKGSG-------GFDINYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAP  933
             ++  +  G         GFD NYAVDG DDV       + V  V D +SG  +E+ A  P
Sbjct  277   RVHLVTGGLSKTGATIYGFDTNYAVDGGDDVDAHAHALRRVTVVRDGKSGRSLELWANQP  336

Query  934   GVQFYTANHL-QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLH  1110
             GVQFYT N L  DVKGKG   Y  + ALCLETQGFPDAVNHPNFPS IV P Q YKH + 
Sbjct  337   GVQFYTGNFLTADVKGKGGKAYGQYGALCLETQGFPDAVNHPNFPSVIVRPGQVYKHEMV  396

Query  1111  ITF  1119
               F
Sbjct  397   YKF  399



>ref|XP_009121606.1| PREDICTED: aldose 1-epimerase isoform X2 [Brassica rapa]
Length=497

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 220/336 (65%), Gaps = 17/336 (5%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KK + +VK TN+GA + SL  PDKNGK  DIVLGYD+V  YE D   FGA VGRVA
Sbjct  172   LYELKKENLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVESYETDKVYFGATVGRVA  231

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG A F LNG  YK  ANDG NTLHGG KG   V W V KH    ++  I FTY S D
Sbjct  232   NRIGKAHFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIVFTYTSPD  291

Query  481   GDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
                GFPG++I  VTY  +K+N  KL V M AKA +K TPVNLA H YWNLGGH+SG+ILS
Sbjct  292   ---GFPGELIVTVTYKLVKDN--KLSVVMEAKAKDKATPVNLAHHTYWNLGGHNSGDILS  346

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
             E++QI     TPVD  LIPTG+I  +  T +DFL+P+ +   M  L     G+DINY +D
Sbjct  347   EEIQILGSSYTPVDGELIPTGKISPVKRTPYDFLQPRPIKDNMKDL---KTGYDINYCLD  403

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G  D    K + + ++ D++SG  ME+ A  PG+QFYT   L+D+KGK   VY++ A LC
Sbjct  404   GKAD----KMRKIVELVDKKSGRKMELSANQPGLQFYTGGMLKDIKGKNGTVYQAFAGLC  459

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             LETQ +PD+VN+P FPS IV P + YKH +   F +
Sbjct  460   LETQSYPDSVNNPKFPSQIVEPGKNYKHNMLFKFSI  495



>ref|XP_006400031.1| hypothetical protein EUTSA_v10013324mg [Eutrema salsugineum]
 gb|ESQ41484.1| hypothetical protein EUTSA_v10013324mg [Eutrema salsugineum]
Length=502

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 221/335 (66%), Gaps = 12/335 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
              Y +KKG+ +VK TN+GA + SL  PDKNGK  DIVLGYD+V  Y+ D   FGA VGRVA
Sbjct  174   LYELKKGNLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVKSYKTDKVYFGATVGRVA  233

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRD  480
             NRIG AQF LNG  YK  ANDG NTLHGG KG   V W V KH    ++  I FTY S D
Sbjct  234   NRIGKAQFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIVFTYTSPD  293

Query  481   GDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSE  660
             GDQGFPG++   VTY + +N  +L V M A   +K TPVNLA H+YWNLGGH++G+ILSE
Sbjct  294   GDQGFPGELNVTVTYQLVKNN-ELSVVMEAMPKDKATPVNLAHHSYWNLGGHNAGDILSE  352

Query  661   KLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG  840
             ++QI     TPVD  LIPTG I  +  T +DFL+ + +   M  L     G+DINY +DG
Sbjct  353   EIQILGSSYTPVDGELIPTGNISPVKGTPYDFLQLRPIKDNMKDLKT---GYDINYCLDG  409

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
               D    K + + ++ D++SG  ME+    PG+QFYT   L+++KGK   VY+++A LCL
Sbjct  410   KAD----KMRKIVELIDKKSGRKMELSGNQPGLQFYTGGMLKNIKGKNGTVYQAYAGLCL  465

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             ETQ +P+AVN+P FPS IV P + YKHT+   F +
Sbjct  466   ETQSYPNAVNNPKFPSQIVEPGKKYKHTMLFKFSI  500



>ref|XP_003550776.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
 gb|KHN18538.1| Aldose 1-epimerase [Glycine soja]
Length=351

 Score =   330 bits (846),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 226/333 (68%), Gaps = 16/333 (5%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +K+GD  + LTNYGA + S+I PDK+GKL DIVLGYD++  Y+ D   FGA++GRVA
Sbjct  28    FYELKRGDLRLNLTNYGATIISVITPDKHGKLADIVLGYDSIDSYKNDTVYFGALIGRVA  87

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEE-SSITFTYYSRDGDQ  489
             NRI GA+FTL+G  YKL AND  NTLHGG +G   V W V+ H++   +TFTY S + +Q
Sbjct  88    NRIRGAKFTLDGKTYKLPANDHGNTLHGGARGFGDVVWSVESHKKHRHVTFTYDSFENEQ  147

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             GFPG +   VTY +    +KL VKM AK ++K TPVNLAQH YWNL GH+SG+ILS  +Q
Sbjct  148   GFPGKLKVSVTYMLIGR-HKLAVKMIAKPVDKATPVNLAQHTYWNLRGHNSGDILSHTVQ  206

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             IF  HITPVD  LIPTG+I+ +  T +DFL+P++VGSQ+ +     G +D+NY +D    
Sbjct  207   IFGSHITPVDRLLIPTGEIISVKGTPYDFLEPKKVGSQIQE-----GLYDMNYVLD----  257

Query  850   VGTRKKKTVAKVY---DERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCL  1020
                  KK ++KV    D  SG  +E+ +   G+QFYT+  L   KGK  AVY  HA + L
Sbjct  258   --KSFKKHLSKVVVVTDPVSGRKLELWSNQLGLQFYTSGQLNATKGKDGAVYRKHAGIAL  315

Query  1021  ETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             ETQGFPD+VN+P FPS IV P + YKHT+   F
Sbjct  316   ETQGFPDSVNYPYFPSQIVRPGEIYKHTMLYRF  348



>ref|XP_002455882.1| hypothetical protein SORBIDRAFT_03g026790 [Sorghum bicolor]
 gb|EES01002.1| hypothetical protein SORBIDRAFT_03g026790 [Sorghum bicolor]
Length=368

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 219/331 (66%), Gaps = 7/331 (2%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KK DFS+K+TN+GA + S+I+PD  G L D+VLGYDTV EY    + FGA+VGRVANR+ 
Sbjct  37    KKWDFSIKVTNWGATLMSVIVPDSKGNLADVVLGYDTVAEYVNGSSYFGALVGRVANRVA  96

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
               +F L+G  Y L  NDG N LHGG +G SKV W VK++    +   ITF Y+S DG+QG
Sbjct  97    KGRFVLDGKAYHLYINDGKNALHGGHRGFSKVIWTVKEYVPDCDSPYITFYYHSFDGEQG  156

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPGD+  +VTY +  +PY L + MNA ALNK TPVNL  H YWNLGGH SG++L   +Q+
Sbjct  157   FPGDLDVYVTYQL-SSPYDLSLHMNATALNKATPVNLVNHAYWNLGGHGSGDVLGHLIQV  215

Query  673   FAYHITPVDSNLIPTGQIL-LINNTAFDFLKPQQVGSQMAKLPKGSG-GFDINYAVDGYD  846
              A   TPVD ++IPTGQ+  ++  T +D  +  +VG+++  +  G   G+D+NYAVD   
Sbjct  216   SASRYTPVDKSMIPTGQVAGVVAGTPYDLRRLTRVGARIGLVSGGGAVGYDLNYAVDQGS  275

Query  847   DVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLET  1026
                +   + VA V D  SG   E+ A  PGVQ YT+N L+D KGKG  VY+ + ALCLET
Sbjct  276   SPSSALTQQVAFVRDPASGRAFELWANQPGVQLYTSNWLKDEKGKGGKVYQKYGALCLET  335

Query  1027  QGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             Q FPDAVNHPNFPS IV P   Y+H +   F
Sbjct  336   QAFPDAVNHPNFPSEIVRPGGVYRHDMLFKF  366



>ref|XP_006827141.1| hypothetical protein AMTR_s00010p00250550 [Amborella trichopoda]
 gb|ERM94378.1| hypothetical protein AMTR_s00010p00250550 [Amborella trichopoda]
Length=368

 Score =   330 bits (846),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 171/334 (51%), Positives = 224/334 (67%), Gaps = 10/334 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             K Y +KKGD  V++TN+GA + S+++PD  GKL D+VLG++ +  Y  D T FGAIVGRV
Sbjct  38    KIYELKKGDMQVRVTNWGAIILSVVIPDSKGKLDDVVLGFEKLGSYINDTTYFGAIVGRV  97

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESS---ITFTYYSRD  480
             ANRI   +F LNG  Y+L  NDGNNTLHGG +G SKV+W +K+ ++     IT TY+S D
Sbjct  98    ANRIKDGRFVLNGQAYRLFRNDGNNTLHGGHRGFSKVFWTMKEKQDGEFPYITLTYHSFD  157

Query  481   GDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSE  660
             G+QGFPGD+   VTY +  +  ++ V M A   NKPTPVNLAQH YWNL G +SG IL  
Sbjct  158   GEQGFPGDLDVSVTYKLVGD-LQISVSMEAIPRNKPTPVNLAQHTYWNLAGQNSGPILGN  216

Query  661   KLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDG  840
              +Q++A   TPVD  LIPTG+IL + NT +DFL+P  VGS+++++   + G+DINY +  
Sbjct  217   TVQLWASQYTPVDKTLIPTGEILSVGNTPYDFLQPYTVGSRISEV---ASGYDINYVLSS  273

Query  841   YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVK-GKGSAVYESHAALC  1017
               +    +K   AKV D ++G  +E+     G+QFYT N L DV  GKG  VY  H AL 
Sbjct  274   SKESNGLRK--AAKVTDHKTGRVLELWTDNVGLQFYTGNMLNDVTGGKGGCVYGIHDALA  331

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFPD+VNHPNFPS IV P Q Y+H +   F
Sbjct  332   LETQGFPDSVNHPNFPSQIVNPGQVYRHNMLYKF  365



>ref|XP_007155325.1| hypothetical protein PHAVU_003G191500g [Phaseolus vulgaris]
 gb|ESW27319.1| hypothetical protein PHAVU_003G191500g [Phaseolus vulgaris]
Length=354

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 225/331 (68%), Gaps = 8/331 (2%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             +FY +++GDF + LTNYGA + SL  PDK+GK  DIVLGYD++  YE D + FGA++GRV
Sbjct  28    EFYELERGDFKLNLTNYGATIISLTTPDKHGKPADIVLGYDSIDSYENDKSYFGALIGRV  87

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEE-SSITFTYYSRDGD  486
             ANRI GA+FTL+G  Y+L AND  NTLHGG +G S V W V+ H++ S ITFTY S + +
Sbjct  88    ANRIAGAKFTLDGKTYQLPANDHGNTLHGGSRGFSDVVWSVESHKKHSHITFTYNSYENE  147

Query  487   QGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKL  666
             QGFPG +   VTY +    ++L VKM AK ++K TPVNLAQH YWNLGGH+SG+ILS  +
Sbjct  148   QGFPGKLKVKVTYMLI-GAHELAVKMIAKPVDKATPVNLAQHTYWNLGGHNSGDILSHIV  206

Query  667   QIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYD  846
             QIF  HIT VD  LIPTG+I+ +  T +DFL+P++V + + +LP     +D+NY +D   
Sbjct  207   QIFGSHITAVDKLLIPTGEIISVKGTPYDFLEPKKVATYIHELPD---LYDMNYVLDKSF  263

Query  847   DVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLET  1026
                  K   VA V D  SG  ME+ +   GVQFYT+  L   KGK  A+Y   AA+ LET
Sbjct  264   QNHLSK---VAVVRDPVSGRKMELWSNQLGVQFYTSGQLNATKGKDGAIYHKFAAIALET  320

Query  1027  QGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             QGFPD+VNHP FP+ IV P + Y+H +   F
Sbjct  321   QGFPDSVNHPYFPTQIVKPGETYEHIMVYRF  351



>emb|CBW45774.1| ORW1943Ba0077G13.2 [Oryza rufipogon]
Length=409

 Score =   329 bits (843),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 224/371 (60%), Gaps = 44/371 (12%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKN----------------GKLTDIVLGYDTVMEY  267
             Y ++KGDFS+++TN+GA + S++LPD                  GKL D+VLGYDT+ EY
Sbjct  38    YELRKGDFSIRVTNWGAVIMSVVLPDSRVSWGFRAETLETCFLPGKLDDVVLGYDTIAEY  97

Query  268   EQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHG-------------GPKG  408
                 T FGA+VGRVANRI  A+F L+G  Y L  NDG NTLHG             G +G
Sbjct  98    VNSSTYFGALVGRVANRIAKARFVLDGKAYHLYPNDGKNTLHGILEKFPEVQEIHGGHRG  157

Query  409   ISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKA  576
              S V W VK+H    +   IT  Y+S DG+QGFPG +  +VTY +   PY L V MNA A
Sbjct  158   FSNVTWTVKEHVGGGDAPYITLYYHSFDGEQGFPGALDVYVTYQL-SGPYVLSVHMNATA  216

Query  577   LNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDF  756
               K TPVNLAQH+YWNLGG  SG+IL   +Q+FA   TPVD+ LIPTGQ+  +  T +D 
Sbjct  217   AGKATPVNLAQHSYWNLGGAGSGDILGNTVQLFASRYTPVDAELIPTGQVAPVAGTPYDL  276

Query  757   LKPQQVGSQMAKLPKGSG-------GFDINYAVDGYDDVGTRKK--KTVAKVYDERSGIG  909
               P  VG+++  +  G         GFD NYAVDG DDV       + VA V D +SG  
Sbjct  277   RAPTPVGARVHLVTGGLSKTGATIYGFDTNYAVDGGDDVDAHAHALRRVAVVRDGKSGRS  336

Query  910   MEIKATAPGVQFYTANHL-QDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQ  1086
             +E+ A  PGVQFYT N L  DVKGKG   Y  + ALCLETQGFPDAVNHPNFPS IV P 
Sbjct  337   LELWANQPGVQFYTGNFLTADVKGKGGKAYGQYGALCLETQGFPDAVNHPNFPSVIVRPG  396

Query  1087  QPYKHTLHITF  1119
             Q YKH +   F
Sbjct  397   QVYKHEMVYKF  407



>gb|KDO72516.1| hypothetical protein CISIN_1g0479222mg, partial [Citrus sinensis]
Length=288

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 212/287 (74%), Gaps = 10/287 (3%)
 Frame = +1

Query  121  QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
            ++ KFY +KKGDFSVK TN+GA + S+ LPDK+GK+ D+VLGYD+V +Y+ D T FG++V
Sbjct  8    EEVKFYELKKGDFSVKFTNWGATIVSVFLPDKDGKVDDVVLGYDSVDDYKNDTTYFGSVV  67

Query  301  GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES----SITFTY  468
            GRVANRIGGAQFTL+G HYKL AN+ +N LHGGPKG S V WKVK +E       I F+Y
Sbjct  68   GRVANRIGGAQFTLDGTHYKLVANEKSNMLHGGPKGFSDVIWKVKTYENEGPTPKIVFSY  127

Query  469  YSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGN  648
            +S DG++GFPGD+   V+Y++     +L VKM AKA NK TPVNLAQH+YWNLGGH SG+
Sbjct  128  HSTDGEEGFPGDLDVTVSYSLTSEK-ELSVKMKAKARNKATPVNLAQHSYWNLGGHSSGD  186

Query  649  ILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINY  828
            ILS+++QIFA   TPVD  LIPTG+I  +  T +DFL+P  +GS + KLP   GG+DINY
Sbjct  187  ILSQEVQIFASSYTPVDDQLIPTGKIETVEGTPYDFLQPHTIGSSIDKLP---GGYDINY  243

Query  829  AVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQD  969
             +D   D  ++K + VA V+D++SG  ME+ A  PGVQ+YT   +++
Sbjct  244  VLD--KDDSSKKMRKVAIVHDKKSGRVMELLADQPGVQYYTGGQIKE  288



>ref|XP_004975839.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=368

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 217/336 (65%), Gaps = 11/336 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFSVK+TN+GA + S++LPD  G L D+VLGYDT+ +Y      FGA+VGRVAN
Sbjct  34    YELRKGDFSVKVTNWGATLTSVVLPDCKGNLADVVLGYDTIADYVNGSNYFGALVGRVAN  93

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             R+  A+F L+G  Y L  NDG N LHGG +G SKV W VK +    +   IT  Y+S DG
Sbjct  94    RVANARFVLDGKVYHLVPNDGKNALHGGKRGFSKVIWTVKDYVGGGDSPYITLYYHSFDG  153

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             ++GFPGD+  +VTY +    Y+L + MNA AL+K TPVNLA H YWNL G   G+IL   
Sbjct  154   EEGFPGDLDVYVTYRLLGR-YELSLHMNATALDKATPVNLANHAYWNLAGQGRGDILGHT  212

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG---GFDINYAV  834
             +Q+FA   TPVD  LIPTG ++ +  T +D   P  VG+ +  +  G     G+D NYAV
Sbjct  213   VQLFASRYTPVDGALIPTGAVVPVAGTPYDLRAPTPVGAHVRAIYGGKAGIYGYDTNYAV  272

Query  835   DGYDDVGTRKKKTVAKVYD-ERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
             DG       +K  VA V D   SG  ME+ A  PGVQFYT N L+DVKGKG  VY  + A
Sbjct  273   DGGAGAAALRK--VAVVRDGGGSGRAMELWANQPGVQFYTGNFLKDVKGKGGKVYGQYGA  330

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LCLETQGFPDAVNHPNFPS IV P Q Y+H +   F
Sbjct  331   LCLETQGFPDAVNHPNFPSQIVRPGQVYRHDMVFKF  366



>gb|KDP33182.1| hypothetical protein JCGZ_13447 [Jatropha curcas]
Length=340

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 220/340 (65%), Gaps = 9/340 (3%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAI  297
             Q    + +  G   V LTNYGA + SL +PDK G++ DIVLG+D++ EY + +   FG I
Sbjct  6     QKAHIFELNNGTIRVNLTNYGATITSLFVPDKKGEVDDIVLGFDSIEEYMKGNAPYFGCI  65

Query  298   VGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTY  468
             VGRVANRI   +F+L G+ Y L  N+G N+LHGG KG  KV W V +H   E+ SITF Y
Sbjct  66    VGRVANRIKEGKFSLEGVDYSLAVNNGPNSLHGGNKGFDKVIWDVVEHKSGEKPSITFKY  125

Query  469   YSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGN  648
              S DG++G+PGDV    TYT+  +   + + M A   NKPTPVNLAQH YWNL GH SGN
Sbjct  126   ESCDGEEGYPGDVTVTATYTLISST-SMRLDMEALPKNKPTPVNLAQHTYWNLAGHSSGN  184

Query  649   ILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINY  828
             +L   +QI+  HITPVD + IPTG+ LL+  T FDF   ++VGS ++++P    G+D NY
Sbjct  185   VLDHLVQIWGSHITPVDQDSIPTGEFLLVKGTVFDFTSEKRVGSSISEVP--GLGYDHNY  242

Query  829   AVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
              +D  ++      K  AK+ +  S   + +   APG+QFYTAN++  V GKG AVYE H+
Sbjct  243   VLDSGEE--KSGLKHAAKLKEPSSSRVLNLWTDAPGMQFYTANYVNGVSGKGGAVYEKHS  300

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
              LC ETQGFP+A+N PNFPS ++ P Q YKHT+   F V+
Sbjct  301   GLCFETQGFPNAINQPNFPSIVIHPGQKYKHTMLFEFSVE  340



>emb|CDX70595.1| BnaC03g06790D [Brassica napus]
Length=309

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/315 (53%), Positives = 211/315 (67%), Gaps = 14/315 (4%)
 Frame = +1

Query  196   SLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNAND  375
             SL  PDKNGK  DIVLGYD+V  Y+ D   FGA VGRVANRIG AQF LNG  YK  AND
Sbjct  2     SLHFPDKNGKTGDIVLGYDSVKSYKTDKVYFGATVGRVANRIGKAQFKLNGKEYKTTAND  61

Query  376   GNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTI-KEN  540
             G NTLHGG KG   V W VKKH    ++  I FTY S DGDQGFPG+V   VTY + KEN
Sbjct  62    GKNTLHGGKKGFGDVVWGVKKHKYDGKKPHIVFTYTSPDGDQGFPGEVNVTVTYKLDKEN  121

Query  541   PYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTG  720
               +L V M AK  +K TP+NLA H+YWNLGGH++G+ILSE++QI     TPVDS LIPTG
Sbjct  122   --ELSVVMEAKPKDKATPINLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDSELIPTG  179

Query  721   QILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERS  900
             +I  +  T++DFL+ + +   M  L     G+DINY +DG  D    K + + ++ D++S
Sbjct  180   EISPVKGTSYDFLQLRPIKDNMKDL---KTGYDINYCLDGKAD----KMRKIVELVDKKS  232

Query  901   GIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVT  1080
             G  ME+    PG+QFYT   L+D+KGK    Y++ A LCLETQG+P++VN+P FPS IV 
Sbjct  233   GRKMELSGNQPGLQFYTGGLLKDIKGKNGTTYQAFAGLCLETQGYPNSVNNPKFPSQIVE  292

Query  1081  PQQPYKHTLHITFRV  1125
             P + YKHT+   F +
Sbjct  293   PGKTYKHTMLFKFSI  307



>ref|XP_004975836.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=361

 Score =   325 bits (832),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 212/330 (64%), Gaps = 12/330 (4%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KKGDFS+K+TN+GA + S+I PD  G L D+VLGYDTV  +    + FGA+VGRVANR+ 
Sbjct  37    KKGDFSIKVTNWGATLMSVIAPDSKGNLADVVLGYDTVAGFVNGSSYFGALVGRVANRVA  96

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
               +F L+G  Y L  NDG N LHGG +G SKV W VK++    +   ITF Y S DG+QG
Sbjct  97    KGRFVLDGKAYHLYINDGKNALHGGHRGFSKVIWTVKEYVPDCDSPYITFYYRSFDGEQG  156

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPGD+  +VTY +   PY L + MNA ALNK TPVNL  H YWNL GH SG++L   +Q+
Sbjct  157   FPGDLDVYVTYQL-SGPYDLSLHMNATALNKATPVNLVNHAYWNLAGHGSGDVLGHVIQV  215

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG-GFDINYAVDGYDD  849
              A   TPVD ++IPTG+I  +  T +D  +P  +GS++  +  G   G+D+NYAV G   
Sbjct  216   LASQYTPVDQSMIPTGEIAAVAGTPYDLRRPTPLGSRIGLVSGGGAVGYDVNYAVHG---  272

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
                +    VA+V D  SG   E+ A  PGVQ YT+N L+D KGK   VY  + ALCLETQ
Sbjct  273   ---QGFTLVARVRDPASGRAFELWANQPGVQLYTSNWLKDEKGKAGKVYGKYGALCLETQ  329

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              FPDAVNHPNFPS I+ P   Y+H +   F
Sbjct  330   AFPDAVNHPNFPSAILRPGGVYRHDMLFKF  359



>emb|CDX78613.1| BnaA03g05250D [Brassica napus]
Length=309

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 210/315 (67%), Gaps = 14/315 (4%)
 Frame = +1

Query  196   SLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNAND  375
             SL  PDKNGK  DIVLGYD+V  Y+ D   FGA VGRVANRIG AQF LNG  YK  AND
Sbjct  2     SLHFPDKNGKAGDIVLGYDSVKSYKTDKVYFGATVGRVANRIGKAQFKLNGKEYKTTAND  61

Query  376   GNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTI-KEN  540
             G NTLHGG KG   V W VKKH    ++  I FTY S DGDQGFPG+V   VTY + KEN
Sbjct  62    GKNTLHGGKKGFGDVVWGVKKHKYDGKKPHIVFTYTSPDGDQGFPGEVNVTVTYKLDKEN  121

Query  541   PYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTG  720
               +L V M AK  +K TP+NLA H+YWNLGGH++G+ILSE++QI     TPVD  LIPTG
Sbjct  122   --ELSVVMEAKPKDKATPINLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTG  179

Query  721   QILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERS  900
             +I  +  T++DFL+ + +   M  L     G+DINY +DG  D    K + + ++ D++S
Sbjct  180   EISPVKGTSYDFLQLRPIKDNMKDL---KAGYDINYCLDGKAD----KMRKIVELIDKKS  232

Query  901   GIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVT  1080
             G  ME+    PG+QFYT   L+D+KGK    Y++ A LCLETQG+P++VN+P FPS IV 
Sbjct  233   GRKMELSGNQPGLQFYTGGMLKDIKGKNGTTYQAFAGLCLETQGYPNSVNNPKFPSQIVE  292

Query  1081  PQQPYKHTLHITFRV  1125
             P + YKHT+   F +
Sbjct  293   PGKTYKHTMLFKFSI  307



>ref|XP_011001585.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Populus euphratica]
Length=358

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 222/340 (65%), Gaps = 14/340 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN--FGAIVG  303
             + + +  G   V +TNYGA + SL +PDK+G++ D+VLG+D++  Y Q D    FG IVG
Sbjct  26    EHFELNNGTIHVTVTNYGATITSLYVPDKHGEVADVVLGFDSIEAYVQKDNAPYFGCIVG  85

Query  304   RVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYS  474
             RVANRI   +F LNG+ Y L  N+G N+LHGG KG  KV W V   K  E+ SITF Y S
Sbjct  86    RVANRIKEGKFHLNGVDYSLPINNGPNSLHGGNKGFDKVVWDVVEQKDGEQPSITFKYES  145

Query  475   RDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNIL  654
              DG++G+PGDVI   TYT+  +   L + M A   NK TP+NLAQH YWNL GH+SGN+L
Sbjct  146   HDGEEGYPGDVIVTATYTLTSSK-TLRLDMEAVPKNKITPINLAQHTYWNLAGHNSGNVL  204

Query  655   SEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAV  834
                +QI    ITPVD N IPTG++L +  TAFDF   ++VGS + ++P    G+D NY +
Sbjct  205   EHLVQISGSQITPVDKNSIPTGELLPVKGTAFDFTSEKKVGSSIREVP--GLGYDHNYVL  262

Query  835   DGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
             D     G +K+  K VAKV D  S   + +   APGVQFYTAN++  V+GKG AVYE H+
Sbjct  263   DS----GEKKEGLKHVAKVKDPSSSRVLNLWTDAPGVQFYTANYVNGVRGKGGAVYEKHS  318

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
              LCLETQGFP+A+N PNFPS +V P   YKH++   F V+
Sbjct  319   GLCLETQGFPNAINQPNFPSIVVVPGDKYKHSMLFEFSVE  358



>gb|ABK22097.1| unknown [Picea sitchensis]
Length=345

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 219/335 (65%), Gaps = 10/335 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEY-EQDDTNFGAIVGRVA  312
             + +KKGD  +K+TN+GA + SL +PD NG L D+VLG+D++  Y +     FG IVGRVA
Sbjct  16    FELKKGDLQLKVTNWGATITSLQVPDANGNLADVVLGFDSLTPYMDGSSLYFGCIVGRVA  75

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDG  483
             NRI    FTL+G HY L  N+G NTLHGG  G  KV WKV++    E  S+ F+Y+S DG
Sbjct  76    NRIKNGGFTLSGQHYSLPINNGPNTLHGGKIGFDKVVWKVEERKDGENPSVKFSYHSHDG  135

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+    TYT+  N  +L + M A   NKPTPV+LAQH YWNL GH+SG+IL   
Sbjct  136   EQGFPGDLDVSATYTLSGN-LELRLDMEAVPRNKPTPVSLAQHTYWNLAGHNSGDILDHS  194

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +QI+  H+TPVD NLIPTG++L I  T FDF   + VGS + ++P   GG+D N+ +D  
Sbjct  195   VQIWGSHVTPVDENLIPTGELLPIKGTPFDFTNEKIVGSTINEVP---GGYDHNFVLDCG  251

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
             + +   K     KV D  S   +++   APG+QFYT N L  V GKG AVY  HA LCLE
Sbjct  252   ESMDGLKH--AIKVEDPSSSRVLDLWTNAPGMQFYTGNFLDGVVGKGGAVYGKHAGLCLE  309

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             TQGFP+AVN  NFPS IV+P + Y+HT+   F V 
Sbjct  310   TQGFPNAVNQANFPSIIVSPGEVYRHTMVYKFSVH  344



>ref|XP_011001586.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Populus euphratica]
Length=357

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 223/339 (66%), Gaps = 13/339 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + +  G   V +TNYGA + SL +PDK+G++ D+VLG+D++  Y +D+   FG IVGR
Sbjct  26    EHFELNNGTIHVTVTNYGATITSLYVPDKHGEVADVVLGFDSIEAYVKDNAPYFGCIVGR  85

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +F LNG+ Y L  N+G N+LHGG KG  KV W V   K  E+ SITF Y S 
Sbjct  86    VANRIKEGKFHLNGVDYSLPINNGPNSLHGGNKGFDKVVWDVVEQKDGEQPSITFKYESH  145

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDVI   TYT+  +   L + M A   NK TP+NLAQH YWNL GH+SGN+L 
Sbjct  146   DGEEGYPGDVIVTATYTLTSSK-TLRLDMEAVPKNKITPINLAQHTYWNLAGHNSGNVLE  204

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI    ITPVD N IPTG++L +  TAFDF   ++VGS + ++P    G+D NY +D
Sbjct  205   HLVQISGSQITPVDKNSIPTGELLPVKGTAFDFTSEKKVGSSIREVP--GLGYDHNYVLD  262

Query  838   GYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
                  G +K+  K VAKV D  S   + +   APGVQFYTAN++  V+GKG AVYE H+ 
Sbjct  263   S----GEKKEGLKHVAKVKDPSSSRVLNLWTDAPGVQFYTANYVNGVRGKGGAVYEKHSG  318

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             LCLETQGFP+A+N PNFPS +V P   YKH++   F V+
Sbjct  319   LCLETQGFPNAINQPNFPSIVVVPGDKYKHSMLFEFSVE  357



>ref|XP_006578581.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=355

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 178/339 (53%), Positives = 220/339 (65%), Gaps = 13/339 (4%)
 Frame = +1

Query  118   GQDNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFG  291
             G D K  FY +K+GD  + LTNYGA + S+I+PDK+G L DI LGYD + +Y+ D   FG
Sbjct  22    GNDKKIGFYQLKRGDLHLNLTNYGASLISVIVPDKHGNLDDITLGYDDIEQYKNDSWYFG  81

Query  292   AIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTY  468
             A +GRVANRIG AQFTL+G  YKL AND  NTLHGG KG S V W VK H E+  ITFTY
Sbjct  82    ATIGRVANRIGHAQFTLDGHTYKLPANDHGNTLHGGFKGFSDVVWTVKSHKEDDHITFTY  141

Query  469   YSRDGDQGFPGDVIAHVTYT-IKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSG  645
              S D +QGFPG +   VTY  I  N Y L  KM A+ ++K TPVNLA H YWNL G +SG
Sbjct  142   DSHDNEQGFPGRLEVSVTYMLIGTNKYSL--KMIARPIDKATPVNLAHHTYWNLKGQNSG  199

Query  646   -NILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDI  822
              NILS ++QIF   ITPVD  LIPTG+   +  T +DFL+P++VGS++  LP   G +D+
Sbjct  200   DNILSHEVQIFGSKITPVDKELIPTGKFESVKGTPYDFLEPREVGSRINDLP---GLYDM  256

Query  823   NYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
             NY +D       RK   V  V ++ SG  +E+ +   G+QFYT   L   KGK  A+Y  
Sbjct  257   NYVLDASSPYHFRK---VIIVREKVSGRKLELWSNQLGLQFYTGGMLNATKGKDGAIYHK  313

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             H  + LETQGFPDAVN PNFPS IV P + YKH +   F
Sbjct  314   HGGMALETQGFPDAVNRPNFPSQIVRPGETYKHYMVYRF  352



>ref|XP_010274745.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=339

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/345 (47%), Positives = 223/345 (65%), Gaps = 11/345 (3%)
 Frame = +1

Query  109   IVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-  285
             +   Q  + + +  G   VK++NYGA + S+++PDK G L D+VLG+D++  Y +     
Sbjct  1     MADNQKAELFELDNGTMRVKISNYGATITSMVVPDKQGNLADVVLGFDSLEPYLKGAAPY  60

Query  286   FGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSI  456
             FG IVGRVANRI   +FTLNG+ Y L  N   N+LHGG KG +KV W+V +H   E  SI
Sbjct  61    FGCIVGRVANRIKDGKFTLNGVEYSLLINKPPNSLHGGHKGFAKVVWEVVEHKDGEHPSI  120

Query  457   TFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGH  636
             TF Y S DG++G+PGDV     YT+  +   + + M A   NKPTP++LAQH YWNL GH
Sbjct  121   TFKYNSPDGEEGYPGDVTVTAIYTLTSS-TTMRLDMEALVENKPTPISLAQHTYWNLSGH  179

Query  637   DSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGF  816
              SGN+L   +QI+A HITPVD N IPTG+I+ +  T FDF   +++G+ + ++P    G+
Sbjct  180   SSGNVLEHLVQIWASHITPVDENTIPTGEIMPVKGTPFDFTTEKKIGASIHEVP--GLGY  237

Query  817   DINYAVD-GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAV  993
             D NY +D G + +G R     AKV D  S   + + + APG+QFYTAN++  + GKG A+
Sbjct  238   DHNYVLDCGEEKLGLRH---AAKVKDPSSSRVLNLWSNAPGMQFYTANYVNGIVGKGGAI  294

Query  994   YESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             Y  H+ALCLETQGFP+A+N PNFPS +V P   YKHT+   F V+
Sbjct  295   YGKHSALCLETQGFPNAINQPNFPSVVVQPGDKYKHTMLFEFSVE  339



>emb|CDJ26298.1| unnamed protein product [Triticum aestivum]
Length=371

 Score =   320 bits (820),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 230/364 (63%), Gaps = 20/364 (5%)
 Frame = +1

Query  70    APLFLCFFISFALIVSGQDNK---------FYVIKKGDFSVKLTNYGARVASLILPDKNG  222
             APL LC  ++ +L   G + +         +Y +++G+FS+ +TN+GA + S+ LPDKNG
Sbjct  13    APL-LCLAVAVSL--GGVEARKHPGKETLGYYELRRGEFSMVVTNWGATILSVRLPDKNG  69

Query  223   KLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGP  402
             ++ D+VLGY T+  Y  D T FGA+VGRVANRI G +FT+    Y    NDGNNTLHGG 
Sbjct  70    RIDDVVLGYKTIGGYVNDTTYFGALVGRVANRIAGGRFTIKNHPYHTYTNDGNNTLHGGH  129

Query  403   KGISKVYWKVKKHEESS---ITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAK  573
             +G ++V+W V++    +   ITF Y S DG++GFPG +   VTY I +  Y   V M A+
Sbjct  130   RGFNQVFWSVRERATGAFPYITFYYRSGDGEEGFPGALDVLVTYKI-DGDYSYSVTMYAR  188

Query  574   ALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFD  753
              ++KPTPVNLAQH YWNL GH  G IL   +QIFA  +TPV  +LIPTG +  +  T FD
Sbjct  189   PVDKPTPVNLAQHTYWNLRGHGRGTILDHSVQIFASAVTPVGGDLIPTGAVTPVAGTPFD  248

Query  754   FLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAP  933
             F  P   G+++A++    GG+DINY +DG D  G   +K VA V +  SG  ME+    P
Sbjct  249   FRAPTAPGARIAEV---EGGYDINYVLDGRDADGQGVRK-VAVVSEATSGRVMELWGDQP  304

Query  934   GVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHI  1113
             GVQFYT N L+  +GKG AVYE H  LCLETQ FPDAV++P FP+ I    Q YKH +  
Sbjct  305   GVQFYTGNFLKGDEGKGGAVYEKHGGLCLETQDFPDAVHNPKFPTEIYRAGQVYKHYMLY  364

Query  1114  TFRV  1125
              F +
Sbjct  365   KFSI  368



>ref|XP_006372578.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
 gb|ERP50375.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
Length=357

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 224/350 (64%), Gaps = 15/350 (4%)
 Frame = +1

Query  103   ALIVSGQDNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQD  276
             A+  +  D K   + +  G   V +TNYGA + SL +PDK+GK+ D+VLG+D++  Y +D
Sbjct  15    AMSTTAADAKAEHFELNNGTIRVTVTNYGATITSLYVPDKHGKVADVVLGFDSIEAYVKD  74

Query  277   DTN-FGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHE  444
             + + FG IVGRVANRI   +F LNG+ Y L  N+G N+LHGG KG  KV W V   K  E
Sbjct  75    NASYFGCIVGRVANRIKEGKFHLNGVDYSLPKNNGPNSLHGGNKGFDKVVWDVVEQKDGE  134

Query  445   ESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWN  624
             + SITF Y S DG++G+PGDVI   TYT+  +   L + M A   NK TP+NLA H YWN
Sbjct  135   QPSITFKYESHDGEEGYPGDVIVTATYTLTSSK-TLRLDMEAVPKNKTTPINLAHHTYWN  193

Query  625   LGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKG  804
             L GH SGN+L   +QI    ITPVD N IPTG++L +  TAFDF   ++VGS + ++P  
Sbjct  194   LAGHSSGNVLEHLVQISGSQITPVDKNSIPTGELLPVKGTAFDFTSEKKVGSSIREVP--  251

Query  805   SGGFDINYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKG  978
               G+D NY +D     G +K+  K VAKV D  S   + +   APGVQFYTAN++  V G
Sbjct  252   GLGYDHNYVLD----YGEKKEGLKHVAKVKDPSSSRVLNLWTDAPGVQFYTANYVNGVPG  307

Query  979   KGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             KG AVYE H+ LCLETQGFP+A+N PNFPS +V P   YKH++   F  +
Sbjct  308   KGGAVYEKHSGLCLETQGFPNAINQPNFPSIVVVPGDKYKHSMLFEFSEE  357



>ref|XP_007036806.1| Galactose mutarotase-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY21307.1| Galactose mutarotase-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=336

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/337 (49%), Positives = 220/337 (65%), Gaps = 10/337 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF-GAIVGR  306
             + + +  G   VK+TNYG  + SL +PDKNG+L D+VLG+D++  Y Q  + F G IVGR
Sbjct  6     EIFELNNGTMQVKITNYGCTITSLSVPDKNGQLADVVLGFDSLEPYVQGASPFFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +FTLNG+ Y L  N+  N+LHGG KG  K  W+V   KK E  SITF Y+S 
Sbjct  66    VANRIKEGKFTLNGVEYSLPINNPPNSLHGGFKGFDKKIWEVVEYKKGENPSITFKYHSA  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TYT+  +   + ++M A   NK TP+NLAQH YWNL GH+SGNIL 
Sbjct  126   DGEEGYPGDVSVTATYTLTSS-TTMKLEMEAVPENKATPINLAQHTYWNLAGHNSGNILD  184

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+A HITPVD N IPTG+I+ +  T FDF   ++VG+ + ++     G+D NY + 
Sbjct  185   HSIQIWASHITPVDQNTIPTGEIMPVKGTPFDFTAEKKVGTSIHEV---GLGYDHNYVLG  241

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G ++      K  AKV D  S   + +  +APGVQFYTAN++  V GKG AVY  H+ LC
Sbjct  242   GGEE--KLGLKHAAKVKDPSSARVLNLWTSAPGVQFYTANYVNRVVGKGGAVYNKHSGLC  299

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             LETQGFP+A+N PNFPS +V P   Y+HT+   F V+
Sbjct  300   LETQGFPNAINQPNFPSVVVQPGNKYQHTMLFEFSVE  336



>ref|XP_006372579.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
 gb|ERP50376.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
Length=358

 Score =   319 bits (818),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 223/351 (64%), Gaps = 16/351 (5%)
 Frame = +1

Query  103   ALIVSGQDNK--FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQD  276
             A+  +  D K   + +  G   V +TNYGA + SL +PDK+GK+ D+VLG+D++  Y Q 
Sbjct  15    AMSTTAADAKAEHFELNNGTIRVTVTNYGATITSLYVPDKHGKVADVVLGFDSIEAYVQK  74

Query  277   D--TNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKH  441
             D  + FG IVGRVANRI   +F LNG+ Y L  N+G N+LHGG KG  KV W V   K  
Sbjct  75    DNASYFGCIVGRVANRIKEGKFHLNGVDYSLPKNNGPNSLHGGNKGFDKVVWDVVEQKDG  134

Query  442   EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYW  621
             E+ SITF Y S DG++G+PGDVI   TYT+  +   L + M A   NK TP+NLA H YW
Sbjct  135   EQPSITFKYESHDGEEGYPGDVIVTATYTLTSSK-TLRLDMEAVPKNKTTPINLAHHTYW  193

Query  622   NLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPK  801
             NL GH SGN+L   +QI    ITPVD N IPTG++L +  TAFDF   ++VGS + ++P 
Sbjct  194   NLAGHSSGNVLEHLVQISGSQITPVDKNSIPTGELLPVKGTAFDFTSEKKVGSSIREVP-  252

Query  802   GSGGFDINYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVK  975
                G+D NY +D     G +K+  K VAKV D  S   + +   APGVQFYTAN++  V 
Sbjct  253   -GLGYDHNYVLD----YGEKKEGLKHVAKVKDPSSSRVLNLWTDAPGVQFYTANYVNGVP  307

Query  976   GKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             GKG AVYE H+ LCLETQGFP+A+N PNFPS +V P   YKH++   F  +
Sbjct  308   GKGGAVYEKHSGLCLETQGFPNAINQPNFPSIVVVPGDKYKHSMLFEFSEE  358



>ref|XP_003528185.2| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=353

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 215/331 (65%), Gaps = 10/331 (3%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVA  312
             FY +K+G+  + LTNYGA V S+ +PDK+G L DI LGYD + +Y+ D   FGA +GRVA
Sbjct  28    FYQLKRGNLHLNLTNYGASVISVFVPDKHGNLGDITLGYDDIEQYKNDSWYFGATIGRVA  87

Query  313   NRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EESSITFTYYSRDGDQ  489
             NRIG AQFTL+G  YKL AND  NTLHGG  G S V W VK H E+  +TFTY S D +Q
Sbjct  88    NRIGHAQFTLDGHTYKLPANDHGNTLHGGFTGFSDVVWTVKSHKEDDHVTFTYDSYDHEQ  147

Query  490   GFPGDVIAHVTY-TIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKL  666
             GFPG +   VTY  I  N Y   VKM AK ++K TPVNLA H YWNL GH+ G+ILS ++
Sbjct  148   GFPGRLEVSVTYMVIGTNKYS--VKMIAKPIDKATPVNLAHHTYWNLKGHNGGDILSHEV  205

Query  667   QIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYD  846
             QIF   ITPVD  LIPTG+   +  T +DFL+P++VGS++  LP   G +D+NY +D   
Sbjct  206   QIFGSKITPVDKKLIPTGKFESVKGTPYDFLEPREVGSRINDLP---GLYDMNYVLDASS  262

Query  847   DVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLET  1026
                 RK   V  V ++ SG  +E+ +   G+QFYT   L   KGK  A+Y  H  + LET
Sbjct  263   PNHFRK---VLIVREKVSGRKLELWSNQIGLQFYTGGMLNATKGKDGAIYHKHGGMALET  319

Query  1027  QGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             QGFPDAVNH NFPS IV P + YKH +   F
Sbjct  320   QGFPDAVNHSNFPSQIVRPGETYKHYMVYRF  350



>ref|XP_009417229.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=334

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 220/335 (66%), Gaps = 12/335 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQD-DTNFGAIVGR  306
             + Y ++ G  +VKLTN+GA + SL++PD NGKL D+VLG+DTV  Y++     FG IVGR
Sbjct  4     ELYELRNGTITVKLTNFGATITSLLVPDANGKLADVVLGFDTVEPYQKGLSPYFGCIVGR  63

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +F LNG  Y L  N+  N+LHGG  G  KV W+V ++  +   SITF Y S+
Sbjct  64    VANRIKDGKFALNGAEYSLYINNPPNSLHGGKIGFDKVLWEVTEYNNNVFPSITFKYQSK  123

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGD+     Y++      L ++M A  LNK TPVNLAQH YWNL GH+SGNIL 
Sbjct  124   DGEEGYPGDLSVTAKYSLPSRT-SLKLEMEAVPLNKATPVNLAQHTYWNLAGHNSGNILD  182

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI A H+TPVD NLIPTG+I+ ++ T FDF   +++GS++ +L     G+D NY +D
Sbjct  183   HSIQILASHLTPVDKNLIPTGEIMPVSGTCFDFTTEKKIGSRIHEL---QVGYDHNYVLD  239

Query  838   -GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
              G +  G    K  AKV D      +++   APG+QFYT N++  V GKG AVY  HAAL
Sbjct  240   CGEERSGL---KHAAKVKDPSGSRVLDLWTDAPGMQFYTGNYVDGVVGKGGAVYGKHAAL  296

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             CLETQGFP+A+N PNFPS +V P +  KHT+   F
Sbjct  297   CLETQGFPNAINQPNFPSVVVQPGEKSKHTMLFEF  331



>ref|XP_006482094.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=339

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 220/338 (65%), Gaps = 11/338 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + +  G   +K+TNYGA V  L +PD++G + DIVLG+D++  Y +D++  FG IVGR
Sbjct  8     ELFELNNGSIRIKITNYGAIVTHLFVPDRHGNVADIVLGFDSIESYMKDNSPYFGCIVGR  67

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +F LNG+HY L AN+G N+LHGG KG  KV W+V  H++    SITF Y SR
Sbjct  68    VANRIRDGKFALNGVHYTLPANNGPNSLHGGNKGFDKVLWEVVDHKDGDHPSITFKYQSR  127

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV A  TY +  +   + + M A   NK TP+NLAQH YWNL GH+SG++L 
Sbjct  128   DGEEGYPGDVTATATYALTSSK-TMRLDMEAVPKNKATPINLAQHTYWNLAGHNSGDVLD  186

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               LQI+   ITPVD N IPTG+ L +  TAFDF   +++G+ +  +P    G+D NY +D
Sbjct  187   HSLQIWGSQITPVDQNSIPTGEFLPVKGTAFDFTSEKKIGNSITDVP--GLGYDHNYVLD  244

Query  838   -GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
              G + +G    K  AKV D      +++   APG+QFYTAN++  V GK  AVYE H+ L
Sbjct  245   CGEEKIGL---KHAAKVKDPSGSRVLDLWTDAPGMQFYTANYVNGVAGKEGAVYEKHSGL  301

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             CLETQGFP+A+N  NFPS +V P + YK T+   F  +
Sbjct  302   CLETQGFPNAINQSNFPSIVVQPGEKYKQTMLFEFSAE  339



>gb|EAZ23543.1| hypothetical protein OsJ_07241 [Oryza sativa Japonica Group]
Length=358

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 176/367 (48%), Positives = 224/367 (61%), Gaps = 42/367 (11%)
 Frame = +1

Query  82    LCFFISFALIVSGQDNK----------FYVIKKGDFSVKLTNYGARVASLILPDKNGKLT  231
             L F    AL +SG+ N            Y +KKGDFS+++TN+GA + S+ILPD  G L 
Sbjct  11    LAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGATIMSVILPDSKGNLA  70

Query  232   DIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGI  411
             D+VLGYDTV EY      FG ++GRVANRI  A+FTL+G  Y+L  NDGNN+LHGG +G 
Sbjct  71    DVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYRLFRNDGNNSLHGGHRGF  130

Query  412   SKVYWKVKKH-----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKA  576
             SKV W VK       +   IT  Y+S DG+QGFPGD+   VTY +   PY L V+MNA A
Sbjct  131   SKVIWTVKGARRPGGDSPRITLYYHSFDGEQGFPGDLDVFVTYELPR-PYVLAVRMNATA  189

Query  577   LNKPTPVNLAQHNYWNLGGHDSG--NILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
               K TPVNLA H YWNL G  SG  ++L+E ++I A                    +  +
Sbjct  190   RGKATPVNLAHHAYWNLAGEGSGAASVLAETVRIHA--------------------SRPY  229

Query  751   DFLKPQQVGSQM--AKLPKGS-GGFDINYAVDGYDDVGTRKK-KTVAKVYDERSGIGMEI  918
             DFL    VG+++  A +P G+  G+D NYAVDG    G R++ + VA+V D  +G  ME+
Sbjct  230   DFLAGAPVGARIVGAAVPGGAVSGYDTNYAVDGAAADGERRRLRPVAEVRDGATGRAMEV  289

Query  919   KATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYK  1098
              A  PGVQFYT+N L  V+GKG  VY  + ALCLETQGFPDAVNHP+FPS IV P Q Y+
Sbjct  290   WADQPGVQFYTSNGLAGVRGKGGRVYGRYGALCLETQGFPDAVNHPSFPSQIVRPGQVYE  349

Query  1099  HTLHITF  1119
             H +   F
Sbjct  350   HNMVFKF  356



>ref|XP_003573719.1| PREDICTED: aldose 1-epimerase [Brachypodium distachyon]
Length=333

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 220/334 (66%), Gaps = 10/334 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + +  G  + K+ N+GA + SL++PD  G L D+VLG+DT+  Y +  +  FG IVGR
Sbjct  4     EIFELSNGRITAKIANFGATIISLLVPDAQGDLADVVLGFDTLEPYLKGISPYFGCIVGR  63

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +FTLNG+ Y L  N+G N LHGG +G  KV W V   K  ++ SITF Y+S+
Sbjct  64    VANRIKNGKFTLNGVEYSLPINNGPNCLHGGLRGFDKVVWDVVERKDGKDPSITFQYHSK  123

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++GFPGDV+   TY++ E P  L + M A A NK TP++LAQH YWNL GH+SG+ L 
Sbjct  124   DGEEGFPGDVVVRATYSLPE-PTTLRLDMEAIAENKATPISLAQHTYWNLAGHNSGDTLG  182

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+  + TPVD N IPTG+I+ + +T FDF    +VG+++  +P   GG+D NY +D
Sbjct  183   HSIQIWGKYYTPVDENSIPTGEIVPVKDTPFDFTTLHKVGARINDVP---GGYDHNYVLD  239

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+      K  AK+ D  +   + +   APG+QFYTAN++  + GKG AVYE H+A+C
Sbjct  240   CGDE--KNGLKLAAKLKDPSTSRTLNLWTDAPGMQFYTANYVDGITGKGGAVYEKHSAVC  297

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFP+A+N PNFPS +V P + YKHT+   F
Sbjct  298   LETQGFPNAINQPNFPSVVVQPGEKYKHTMLFEF  331



>ref|XP_002282634.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
Length=338

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 222/346 (64%), Gaps = 14/346 (4%)
 Frame = +1

Query  109   IVSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-  285
             + S +  + + +  G   VK+TNYGA + SL +PDK+G L D+VLG D++  Y + D   
Sbjct  1     MASERKPEIFELNNGTMQVKITNYGATITSLSVPDKDGNLADVVLGCDSLEPYLKGDVPY  60

Query  286   FGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SI  456
             FG IVGRVANRI   +FTLNGI Y+L  N   N+LHGG KG SK  W+V + +E    SI
Sbjct  61    FGCIVGRVANRIKDGKFTLNGIEYQLPINKPPNSLHGGHKGFSKKVWEVAERKEGKTPSI  120

Query  457   TFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGH  636
             TF Y+S DG++G+PGDV    TYT+  +   + + M A   NKPTP+NLAQH YWNL GH
Sbjct  121   TFKYHSHDGEEGYPGDVSVTATYTLTSS-TTMRLDMEAVPENKPTPINLAQHTYWNLAGH  179

Query  637   DSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGF  816
              SGNIL   +QI+  HITPVD N +PTG+I  +  T FDF   +++G+ + ++     G+
Sbjct  180   SSGNILDHSIQIWGSHITPVDQNTVPTGEITPVKATPFDFTTEKKIGTSIHEV---GLGY  236

Query  817   DINYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSA  990
             D NYA+D     G  K+  K  AKV D  S   + +  TAPG+QFYTAN++  V GK  A
Sbjct  237   DHNYALD----CGEEKEGLKHAAKVKDPSSSRVLNLWTTAPGMQFYTANYVNGVAGKDGA  292

Query  991   VYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             VY  H+ LCLETQG+P+A+N PNFPS +V P + Y+HT+   F V+
Sbjct  293   VYGKHSGLCLETQGYPNAINQPNFPSIVVQPGEKYQHTMLFEFSVE  338



>ref|XP_006430571.1| hypothetical protein CICLE_v10012137mg [Citrus clementina]
 gb|ESR43811.1| hypothetical protein CICLE_v10012137mg [Citrus clementina]
Length=339

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 220/338 (65%), Gaps = 11/338 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + +  G   +K+TNYGA V  L +PD++G + DIVLG+D++  Y +D++  FG IVGR
Sbjct  8     ELFELNNGSIRIKITNYGAIVTHLFVPDRHGNVADIVLGFDSIESYMKDNSPYFGCIVGR  67

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +F LNG+HY L  N+G N+LHGG KG  KV W+V +H++    SITF Y SR
Sbjct  68    VANRIRDGKFALNGVHYTLPVNNGPNSLHGGNKGFDKVLWEVVEHKDGDHPSITFKYQSR  127

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV A  TY +  +   + + M A   NK TP+NLAQH YWNL GH+SG++L 
Sbjct  128   DGEEGYPGDVTATATYALTSSK-TMRLDMEAVPKNKATPINLAQHTYWNLAGHNSGDVLD  186

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               LQI+   ITPVD N IPTG+ L +  TAFDF   +++G+ +  +P    G+D NY +D
Sbjct  187   HSLQIWGSQITPVDQNSIPTGEFLPVKGTAFDFTSEKKIGNSITDVP--GLGYDHNYVLD  244

Query  838   -GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
              G + +G    K  AKV D      +++   APG+QFYTAN++  V GK  AVYE H+ L
Sbjct  245   CGEEKIGL---KHAAKVKDPSGSRVLDLWTDAPGMQFYTANYVNGVAGKEGAVYEKHSGL  301

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             CLETQGFP+A+N  NFPS +V P + YK T+   F  +
Sbjct  302   CLETQGFPNAINQSNFPSIVVQPGEKYKQTMLFEFSAE  339



>ref|XP_002467340.1| hypothetical protein SORBIDRAFT_01g025920 [Sorghum bicolor]
 gb|EER94338.1| hypothetical protein SORBIDRAFT_01g025920 [Sorghum bicolor]
Length=337

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 217/334 (65%), Gaps = 10/334 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             +   +  G  + +++N+GA + SL++PD  G + D+VLG+D +  Y +  +  FG IVGR
Sbjct  8     RILELSNGKITARISNWGATITSLLVPDAQGSIADVVLGFDDLDPYVKGMSPYFGCIVGR  67

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSR  477
             VANRI   +F LN + Y L  N+G N+LHGG +G  KV W V  H   E  SITF Y+S+
Sbjct  68    VANRIKDGKFRLNEVEYSLPVNNGPNSLHGGLRGFDKVVWDVVDHKDGECPSITFQYHSK  127

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TY++ E    L + M A   NK TP++LAQH YWNL GH SG+IL+
Sbjct  128   DGEEGYPGDVTIRATYSLPE-AATLRLDMEATPENKATPISLAQHTYWNLAGHASGDILN  186

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+  HITPVD N IPTG+I+ +N T+FDF    ++G ++  +P   GG+D NY +D
Sbjct  187   HSIQIWGKHITPVDENTIPTGEIMPVNGTSFDFTTEHKIGERINDVP---GGYDHNYMLD  243

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+      K  AK+ D  S   +E+   APG+QFYTAN++ D+ GKG AVYE HA +C
Sbjct  244   CGDE--KNGLKHAAKLRDPSSLRTLELWTDAPGMQFYTANYVNDISGKGGAVYEKHAGVC  301

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFP+A+N PNFPS +V P + YKHT+   F
Sbjct  302   LETQGFPNAINQPNFPSVVVRPGEKYKHTMLFEF  335



>gb|EAY77740.1| hypothetical protein OsI_32784 [Oryza sativa Indica Group]
Length=334

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 218/330 (66%), Gaps = 10/330 (3%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGRVANR  318
             +  G  + K+  +GA + SL++PD +G L D+VLG+DT+  Y +  +  FG IVGRVANR
Sbjct  9     LSNGRITAKIAAWGATITSLLVPDAHGNLADVVLGFDTLEPYMKGISPYFGCIVGRVANR  68

Query  319   IGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSRDGDQ  489
             I   +FTLNG+ Y L  N+G N+LHGG KG  KV W V   K  E  SITF Y+S+DG++
Sbjct  69    IKEGKFTLNGVEYSLTINNGPNSLHGGLKGFDKVVWDVVERKSGECPSITFQYHSKDGEE  128

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             G+PGDV    TY++ ++   L + M A A NK TP+NLAQH YWNL GH+SG+ L   +Q
Sbjct  129   GYPGDVTVRATYSLPDST-TLRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQ  187

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             I+  HITPVD N IPTG+I+ + +T FDF    ++G+++  +P   GG+D NY +D  ++
Sbjct  188   IWGKHITPVDENTIPTGEIMPVKDTPFDFTTEHKIGARINDVP---GGYDHNYVLDSGEE  244

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
                   K  AK+ D  +   +++   APG+QFYTAN++  + GKG AVYE H+ +CLETQ
Sbjct  245   --KNGLKHAAKLKDSSNSRTLDLWTDAPGMQFYTANYVDGITGKGGAVYEKHSGVCLETQ  302

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFP+A+N PNFPS +V P + YKHT+   F
Sbjct  303   GFPNAINQPNFPSVVVQPGEKYKHTMLFEF  332



>ref|XP_002317867.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEE96087.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=337

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 222/343 (65%), Gaps = 10/343 (3%)
 Frame = +1

Query  112   VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEY-EQDDTNF  288
             ++ Q  + + +  G   VK+TN G  + SL LPDKNG L D+VLG+D+V  Y  +    F
Sbjct  1     MADQKPQIFELNNGTMQVKITNLGCTITSLSLPDKNGNLADVVLGFDSVEPYLNRVAPYF  60

Query  289   GAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSIT  459
             GAIVGRVANRI   +FTLNG  Y L  N   N+LHGG KG   V W+V   KK E+ SIT
Sbjct  61    GAIVGRVANRIKDGKFTLNGADYTLPVNRPPNSLHGGNKGFDIVVWEVAEYKKGEKPSIT  120

Query  460   FTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHD  639
             F Y+SRDG++G+PGD+    TYT+  +   + + M A A NK TPV+LAQH YWNL GH+
Sbjct  121   FKYHSRDGEEGYPGDLSVTATYTLTSS-MTMRLDMEAVAENKATPVSLAQHTYWNLAGHN  179

Query  640   SGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFD  819
             SGNIL + +QI+  H+TPVD N++PTG+I+ +  T FDF   ++VG+ + ++     G+D
Sbjct  180   SGNILDQSVQIWGSHVTPVDQNIVPTGEIMPVKGTPFDFTTEKKVGASIHEV---GLGYD  236

Query  820   INYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYE  999
              NY +D  +  G    K  AKV D  S   +++    PG+QFYTAN++  + GKG AVY 
Sbjct  237   HNYVLDCGE--GKEGLKHAAKVKDPSSSRVLDLWTNTPGMQFYTANYVNGIVGKGGAVYG  294

Query  1000  SHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
              H+ LCLETQGFP+A+N PNFPS ++ P + YKHT+   F ++
Sbjct  295   KHSGLCLETQGFPNAINQPNFPSVVIQPGEKYKHTMLFEFSIE  337



>ref|NP_001064192.1| Os10g0155500 [Oryza sativa Japonica Group]
 gb|ABB46780.1| Aldose 1-epimerase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26106.1| Os10g0155500 [Oryza sativa Japonica Group]
Length=362

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 217/329 (66%), Gaps = 9/329 (3%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGRVANR  318
             +  G  + K+  +GA + SLI+PD +G L D+VLG+DT+  Y +  +  FG IVGRVANR
Sbjct  38    LSNGRITAKIAAWGATITSLIVPDAHGNLADVVLGFDTLEPYMKGISPYFGCIVGRVANR  97

Query  319   IGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV--KKHEESSITFTYYSRDGDQG  492
             I   +FTLNG+ Y L  N+G N+LHGG KG  KV W V  +K E  SITF Y+S+DG++G
Sbjct  98    IKEGKFTLNGVEYSLAINNGPNSLHGGLKGFDKVVWDVVERKSECPSITFQYHSKDGEEG  157

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             +PGDV    TY++ ++   L + M A A NK TP+NLAQH YWNL GH+SG+ L   +QI
Sbjct  158   YPGDVTVRATYSLPDST-TLRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQI  216

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDV  852
             +  HITPVD N IPTG+I+ +  T FDF    ++G+++  +P   GG+D NY +D  ++ 
Sbjct  217   WGKHITPVDENTIPTGEIMPVKGTPFDFTTEHKIGARINDVP---GGYDHNYVLDSGEE-  272

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
                  K  AK+ D  +   +++   APG+QFYTAN++  V GKG AVY  H+ +CLETQG
Sbjct  273   -KNGLKHAAKLKDSSNSRTLDLWTDAPGMQFYTANYVDGVTGKGGAVYGKHSGVCLETQG  331

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             FP+A+N PNFPS +V P + YKHT+   F
Sbjct  332   FPNAINQPNFPSVVVQPGEKYKHTMLFEF  360



>ref|XP_010265811.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=339

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 223/342 (65%), Gaps = 13/342 (4%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAI  297
             Q  + + +  G   VK++NYGA + SL++PDK G LTD+VLG+D++  Y +     FG I
Sbjct  5     QKAELFELDNGTVRVKISNYGATITSLLVPDKQGNLTDVVLGFDSLEPYLKGAAPYFGCI  64

Query  298   VGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTY  468
             VGRVANRI   +F LNG+ Y L  N+  N+LHGG KG  KV W+V   K  E  SITF Y
Sbjct  65    VGRVANRIKDGKFMLNGVEYSLPINNPPNSLHGGNKGFDKVVWEVIERKDGENPSITFRY  124

Query  469   YSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGN  648
             +S DG++G+PG+VI   TYT+  +   + + M A   NKPTP+NLAQH YWNL GH SG+
Sbjct  125   HSHDGEEGYPGNVIITATYTLTSSA-TMKLDMEAVPENKPTPINLAQHTYWNLAGHSSGD  183

Query  649   ILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG-GFDIN  825
             +L   +QI+  HITPVD N IPTG+I+ +  T FDF   +++G+ + ++   SG G+D N
Sbjct  184   VLEHLIQIWGSHITPVDQNSIPTGEIMPVKGTPFDFTAEKKIGASINEV---SGLGYDHN  240

Query  826   YAVD-GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
             Y +D G +  G    K  AKV D  S   + +   APG+QFYTAN++  V GKG AVY  
Sbjct  241   YVLDFGEEKSGL---KHAAKVKDPSSSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYGK  297

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             H+ALCLETQGFP+A+N P+FPS +V P + YKHT+   F V+
Sbjct  298   HSALCLETQGFPNAINQPSFPSVVVQPGEKYKHTMLFEFSVE  339



>ref|XP_002531177.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF31192.1| aldose-1-epimerase, putative [Ricinus communis]
Length=335

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 217/337 (64%), Gaps = 9/337 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + +  G  SV+LTNYGA + SL +PDK GKL DIVLG+D+V  Y + +   FG IVGR
Sbjct  4     QLFELNNGTISVRLTNYGATITSLFVPDKQGKLDDIVLGFDSVEAYMKGNAPYFGCIVGR  63

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSR  477
             VANRI   +F+LNG+ Y L  N+G N+LHGG KG  KV W V +H   E+ SITF Y S 
Sbjct  64    VANRIKEGKFSLNGVEYSLAINNGPNSLHGGIKGFDKVVWDVVEHKSGEQPSITFKYESH  123

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV     YT+  +   + + + A   +K TPVNLAQH YWNL GH+SGN+L 
Sbjct  124   DGEEGYPGDVTVTAKYTLTSSK-SMRLDLEAVPKSKSTPVNLAQHTYWNLAGHNSGNVLE  182

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+   ITPVD N IPTG+ L +  T FDF   ++VGS ++K+     G+D NY +D
Sbjct  183   HLVQIWGSQITPVDQNSIPTGEFLPVKGTVFDFTSEKKVGSSISKVE--GLGYDHNYILD  240

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               ++      K  AKV D  S   + +   APG+QFYTAN++  V GKG AVY+ H+ LC
Sbjct  241   SEEE--KEGLKHAAKVKDPSSSRVLNLWTNAPGMQFYTANYVNGVSGKGGAVYDKHSGLC  298

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
              ETQGFP+++N  NFPS +V P + YKH++   F V+
Sbjct  299   FETQGFPNSINQQNFPSIVVHPGEKYKHSMLFEFSVE  335



>ref|XP_004984206.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=368

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 229/367 (62%), Gaps = 23/367 (6%)
 Frame = +1

Query  76    LFLCFFISFALIVSG------------QDNKFYVIKKGDFSVKLTNYGARVASLILPDKN  219
             L LC  I    I +G            Q   FY +++G+FS+ +TN+GA + ++ +PDKN
Sbjct  8     LLLCIAIVLLAIGNGGVPGAEARKKGKQSLGFYELRRGEFSMVVTNWGATILAVRIPDKN  67

Query  220   GKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGG  399
             G + D+VLGY  +  Y  + T FGA+VGRVANRI G +FT+    Y    NDGNNTLHGG
Sbjct  68    GHINDVVLGYKDIGSYVNETTYFGALVGRVANRIAGGRFTIKDRAYHTYRNDGNNTLHGG  127

Query  400   PKGISKVYWKVKKH---EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNA  570
              +G ++V+W V++    +   ITF+Y S DG+QGFPG++   VTY I +  +   V M A
Sbjct  128   HRGFNQVFWSVRERVTGDFPHITFSYRSYDGEQGFPGNLDVLVTYKI-DGDFSYSVTMYA  186

Query  571   KALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAF  750
             + L+KPTPVNLAQH YWNL GH +G+IL   +QIFA  +TPV  +LIPTG +  +  T F
Sbjct  187   RPLDKPTPVNLAQHTYWNLRGHGNGSILDHAVQIFASAVTPVAGDLIPTGAVAPVAGTPF  246

Query  751   DFLKPQQVGSQMAKLPKGSGGFDINYAVDG-YDDVGTRKKKTVAKVYDERSGIGMEIKAT  927
             DF  P   G+++A++    GG+DINY +DG  D  G RK   VA V +  SG  ME+ A 
Sbjct  247   DFRVPAAPGARIAEV---EGGYDINYVLDGAADGQGVRK---VAVVSEADSGRVMELWAD  300

Query  928   APGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTL  1107
              PG+QFYT N L+  +GKG AVY  H  LCLETQ +PDAV+ P FP+ +  P Q YKH +
Sbjct  301   QPGLQFYTGNFLKGDEGKGGAVYAKHGGLCLETQDYPDAVHEPGFPAEVYRPGQVYKHYM  360

Query  1108  HITFRVQ  1128
                F ++
Sbjct  361   LYKFSLK  367



>ref|XP_011039151.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=337

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 223/345 (65%), Gaps = 14/345 (4%)
 Frame = +1

Query  112   VSGQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEY-EQDDTNF  288
             ++ Q  + + +  G   VK+TN G  + SL LPDKNG L D+VLG+D+V  Y  +    F
Sbjct  1     MADQKPQIFELNNGTMQVKITNLGCTITSLSLPDKNGNLADVVLGFDSVEPYLNRVAPYF  60

Query  289   GAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSIT  459
             GAIVGRVANRI   +FTLNG+ Y L  N   N+LHGG KG   V W+V   KK E+ SIT
Sbjct  61    GAIVGRVANRIKDGKFTLNGVDYTLPVNRPPNSLHGGHKGFDIVVWEVAEYKKGEKPSIT  120

Query  460   FTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHD  639
             F Y+SRDG++G+PGD+    TYT+  +   + + M A A NK TPV+LAQH YWNL GH 
Sbjct  121   FKYHSRDGEEGYPGDLSVTATYTLTSS-MTMRLDMEAVAENKATPVSLAQHTYWNLAGHS  179

Query  640   SGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFD  819
             SGNIL + +QI+  H+TPVD N++PTG+I+ +  T FDF   ++VG+ + ++     G+D
Sbjct  180   SGNILDQSVQIWGSHVTPVDQNIVPTGEIMPVKGTPFDFTTEKKVGASLHEV---GLGYD  236

Query  820   INYAVDGYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAV  993
              NY +D     G  K+  K  A+V D  S   +++    PG+QFYTAN++  + GKG AV
Sbjct  237   HNYVLD----CGEEKEGLKHAARVKDPSSSRVLDLWTNTPGMQFYTANYVNGIVGKGGAV  292

Query  994   YESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             Y  H+ LCLETQGFP+A+N PNFPS ++ P + Y+HT+   F ++
Sbjct  293   YGKHSGLCLETQGFPNAINQPNFPSVVIQPGEKYEHTMLFEFSIE  337



>ref|XP_002466911.1| hypothetical protein SORBIDRAFT_01g016500 [Sorghum bicolor]
 gb|EER93909.1| hypothetical protein SORBIDRAFT_01g016500 [Sorghum bicolor]
Length=450

 Score =   317 bits (813),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 219/328 (67%), Gaps = 12/328 (4%)
 Frame = +1

Query  151   GDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGRVANRIGG  327
             G   V+LTN GA V SL++PDKNG L D+VLG+D++  Y    +  FG IVGRVANRI  
Sbjct  127   GSVRVRLTNVGAAVTSLLVPDKNGVLADVVLGFDSLDPYLNGTSPYFGCIVGRVANRIKD  186

Query  328   AQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSRDGDQGFP  498
              +FTLNG+ Y L+ N+  NTLHGG KG  K  W+V ++   ++ SITF YYS+DG++G+P
Sbjct  187   GKFTLNGVQYNLSINNPPNTLHGGFKGFDKTVWEVAEYNKGDKPSITFKYYSKDGEEGYP  246

Query  499   GDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFA  678
             GDV   V Y++  +   L ++M A  LNK TP++LAQH YWNL GHDSG++LS  +QI+ 
Sbjct  247   GDVSVTVRYSLLPS-ATLKLEMEAIPLNKATPISLAQHTYWNLAGHDSGDVLSHSIQIWG  305

Query  679   YHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYD-DVG  855
               ITPVD   IPTG+ + ++ T FDFL   ++GS++ ++P   GG+D NY +D  +   G
Sbjct  306   SQITPVDQTSIPTGEFMPVSGTPFDFLTGNRIGSRIDQVP---GGYDHNYMLDSSEVRSG  362

Query  856   TRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGF  1035
              R    VAKV D  S   ++I A APGVQFYT N L  + GKG AVY  H+ LCLETQGF
Sbjct  363   LRH---VAKVSDPSSLRALDIWADAPGVQFYTGNFLHGIVGKGGAVYGKHSGLCLETQGF  419

Query  1036  PDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             P+AVN PNFPS +  P + Y+HT+   F
Sbjct  420   PNAVNQPNFPSVVFHPGEKYRHTMLFEF  447



>ref|XP_006648778.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=328

 Score =   313 bits (801),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 204/332 (61%), Gaps = 48/332 (14%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +KKGDFS+++TN+GA + S++LPD NG L D+VLGYDTV EY      FG ++GRVAN
Sbjct  38    YELKKGDFSIRVTNWGATLMSVVLPDSNGNLGDVVLGYDTVAEYVNGTAYFGGLIGRVAN  97

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             R+  A+FTL+G  Y+L  NDGNN+LHGG +G SKV W V++H        IT  Y+S DG
Sbjct  98    RVANARFTLDGKTYRLFRNDGNNSLHGGHRGFSKVVWTVREHVGGGASPCITLFYHSFDG  157

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+  +VTY ++ +PY L V+MNA A  K TPVNLA H YWNLGGH SG +L E 
Sbjct  158   EQGFPGDLDVYVTYELR-SPYVLAVRMNATARGKATPVNLAHHAYWNLGGHGSGTVLDET  216

Query  664   LQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGY  843
             +Q+FA   TPVD+ LIPTG+           L P                          
Sbjct  217   VQLFASRYTPVDAALIPTGR-----------LAP--------------------------  239

Query  844   DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLE  1023
                   + + VA V D  +G  ME+ A  PGVQFYT N L  V+GK   VY  + ALCLE
Sbjct  240   ------RLRPVAVVRDGATGRAMELWADQPGVQFYTGNGLAGVRGKDGRVYGRYGALCLE  293

Query  1024  TQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             TQGFPDAVNHP+FPS IV P Q Y+H +   F
Sbjct  294   TQGFPDAVNHPSFPSQIVRPGQVYEHNMVFRF  325



>ref|XP_006826839.1| hypothetical protein AMTR_s00010p00093760 [Amborella trichopoda]
 gb|ERM94076.1| hypothetical protein AMTR_s00010p00093760 [Amborella trichopoda]
Length=355

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 223/337 (66%), Gaps = 12/337 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + +  G   +KLTN+GA + SL++PD  G L D+VLG+D++  Y +  +  FG IVGR
Sbjct  14    ELFGLSNGTLQLKLTNWGATITSLLVPDSKGDLADVVLGFDSLEPYLKGASPYFGCIVGR  73

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV--KKHEES-SITFTYYSR  477
             VANRI   +F LNG  Y L  N   N+LHGG +G  KV W+V  K H+E+ SITF Y+S 
Sbjct  74    VANRIKDGKFALNGEQYSLPINKPPNSLHGGERGFDKVAWEVLEKDHDETPSITFKYHSH  133

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG+QG+PGD+    TY++   P  L + M +   NKPTP++LAQH YWNL GH++GN L 
Sbjct  134   DGEQGYPGDLNITATYSLP-GPMTLRLDMESIPENKPTPISLAQHTYWNLAGHNAGNTLD  192

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +Q++  HITPVD   +PTG+I+ +  T FDFL+ +++GS++ ++P   GG+D NY +D
Sbjct  193   HHIQLWGSHITPVDQYTVPTGEIMPVKGTPFDFLEEKKIGSRIHEVP---GGYDHNYVLD  249

Query  838   -GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
              G + +G    K VA++ D  S   + + + APGVQFYT N++  V GKG AVY  HA L
Sbjct  250   CGEEKMGL---KLVARLRDPSSSRVLTLWSNAPGVQFYTGNYVNGVVGKGGAVYGKHAGL  306

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             CLETQGFP+A+N PNFPS +V P + YKHT+   F V
Sbjct  307   CLETQGFPNAINQPNFPSIVVEPGKKYKHTMLFEFSV  343



>ref|XP_008669323.1| PREDICTED: aldose 1-epimerase-like [Zea mays]
 tpg|DAA37480.1| TPA: hypothetical protein ZEAMMB73_906179 [Zea mays]
Length=361

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 214/330 (65%), Gaps = 12/330 (4%)
 Frame = +1

Query  145   KKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIG  324
             KKGDFS+K+TN+GA + S+I+PD  G L D+VLGYD + +Y    + FG +VGRVANRI 
Sbjct  37    KKGDFSIKVTNWGATLMSVIVPDSKGNLADVVLGYDKLAQYVDASSAFGTVVGRVANRIA  96

Query  325   GAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDGDQG  492
                F L+G   +LN  DG  TLHGG +G ++V W VK++    +   IT  Y S DG+QG
Sbjct  97    NGSFVLDGKTIRLN-KDGTTTLHGGHRGFNRVIWTVKEYVPGGDSPYITLYYRSFDGEQG  155

Query  493   FPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQI  672
             FPGD+  +VTY +   PY+L   MNA AL+K TPVNLA H YWNL G  SG+ L   +Q+
Sbjct  156   FPGDLDVYVTYQLCCGPYELRAVMNATALDKATPVNLANHAYWNLAG--SGDALGHLVQV  213

Query  673   FAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKL-PKGSGGFDINYAVDGYDD  849
              A   TPVD+ +IPTG++  +  T +D   P  +GS++  +   G  GFD+NYAVDG   
Sbjct  214   LASRYTPVDAAMIPTGEVAPVTGTPYDLRAPTLLGSRIKHVSAAGMAGFDVNYAVDG---  270

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
              G R ++ VA++ D  SG  +E+ A  PGVQ YT+N L +V+GKG  VY  + A+CLETQ
Sbjct  271   DGFRFRR-VARLRDPASGRALELWANQPGVQLYTSNWLSNVEGKGGRVYGQYGAVCLETQ  329

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              FPDAVNHPNFPS IV P   Y+H +   F
Sbjct  330   AFPDAVNHPNFPSEIVRPGGTYQHDMLFKF  359



>emb|CBI15585.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 215/330 (65%), Gaps = 14/330 (4%)
 Frame = +1

Query  157   FSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGRVANRIGGAQ  333
               VK+TNYGA + SL +PDK+G L D+VLG D++  Y + D   FG IVGRVANRI   +
Sbjct  1     MQVKITNYGATITSLSVPDKDGNLADVVLGCDSLEPYLKGDVPYFGCIVGRVANRIKDGK  60

Query  334   FTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSRDGDQGFPGD  504
             FTLNGI Y+L  N   N+LHGG KG SK  W+V + +E    SITF Y+S DG++G+PGD
Sbjct  61    FTLNGIEYQLPINKPPNSLHGGHKGFSKKVWEVAERKEGKTPSITFKYHSHDGEEGYPGD  120

Query  505   VIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYH  684
             V    TYT+  +   + + M A   NKPTP+NLAQH YWNL GH SGNIL   +QI+  H
Sbjct  121   VSVTATYTLTSS-TTMRLDMEAVPENKPTPINLAQHTYWNLAGHSSGNILDHSIQIWGSH  179

Query  685   ITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDDVGTRK  864
             ITPVD N +PTG+I  +  T FDF   +++G+ + ++     G+D NYA+D     G  K
Sbjct  180   ITPVDQNTVPTGEITPVKATPFDFTTEKKIGTSIHEV---GLGYDHNYALD----CGEEK  232

Query  865   K--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFP  1038
             +  K  AKV D  S   + +  TAPG+QFYTAN++  V GK  AVY  H+ LCLETQG+P
Sbjct  233   EGLKHAAKVKDPSSSRVLNLWTTAPGMQFYTANYVNGVAGKDGAVYGKHSGLCLETQGYP  292

Query  1039  DAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +A+N PNFPS +V P + Y+HT+   F V+
Sbjct  293   NAINQPNFPSIVVQPGEKYQHTMLFEFSVE  322



>ref|XP_009620755.1| PREDICTED: aldose 1-epimerase [Nicotiana tomentosiformis]
Length=335

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 215/337 (64%), Gaps = 10/337 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF-GAIVGR  306
             K + +  G   VK++N G  + SL +PDK+G L D+VLG+DTV  Y++    F G IVGR
Sbjct  5     KIFELNNGSMQVKVSNLGCTILSLSVPDKDGNLGDVVLGFDTVEPYQKGLAPFFGCIVGR  64

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +F+LNG+ Y L  N   N+LHGG KG  KV W+V +H+E    SITF Y+SR
Sbjct  65    VANRIKEGKFSLNGVDYTLPINKPPNSLHGGHKGFDKVVWEVAEHKEGKHPSITFKYHSR  124

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGD+    TYT+      L + M A   NKPTPV+LAQH YWNLGGH+SG+IL 
Sbjct  125   DGEEGYPGDLSVTATYTLTSK-TTLRLDMEAVPANKPTPVSLAQHTYWNLGGHNSGDILD  183

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
                QI+A HITPVD N IPTG+IL +  T FDF   +Q+G  + ++     G+D NY +D
Sbjct  184   NTAQIWANHITPVDQNTIPTGEILPVKGTPFDFTAEKQIGRDIQQV---GLGYDHNYVLD  240

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D       K  AK+ D +S   + +   APG+QFYTAN++  V GKG AVY  HA +C
Sbjct  241   CVDV--KDGLKHAAKIKDPKSSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYNKHAGVC  298

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             LETQGFP+AVN PNFPS IV P   Y H +   F V+
Sbjct  299   LETQGFPNAVNTPNFPSVIVQPGDKYIHNMLYEFSVE  335



>tpg|DAA45585.1| TPA: aldose 1-epimerase [Zea mays]
Length=367

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/339 (49%), Positives = 217/339 (64%), Gaps = 11/339 (3%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             Q   FY +++G+FS+ +TN+GA + S+ LPDKNG + D+VLGY  +  Y  D T FGA+V
Sbjct  34    QSLGFYELRRGEFSMVVTNWGATILSVRLPDKNGHIDDVVLGYKNIGSYVNDTTYFGALV  93

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYY  471
             GRVANRI G +FT+    Y    NDGNNTLHGG +G ++V+W V++    E   ITF Y 
Sbjct  94    GRVANRIAGGRFTIRDHAYHTYRNDGNNTLHGGHRGFNQVFWSVRERVTGEFPHITFAYR  153

Query  472   SRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNI  651
             S DG+QGFPG++   VTY I +      V M A+ L+KPTPVNLAQH YWNL GH +G +
Sbjct  154   SYDGEQGFPGNLDVLVTYKI-DGDCSYSVTMYARPLDKPTPVNLAQHTYWNLRGHGNGTV  212

Query  652   LSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYA  831
             L   +QIFA  +TPV   LIPTG +  +  T FDF  P   G+ +A++    GG+DINY 
Sbjct  213   LRHAVQIFASAVTPVGRGLIPTGAVTPVAGTPFDFRAPAAPGAHIAEV---EGGYDINYV  269

Query  832   VDG-YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
             +DG  D  G RK   VA V +  SG  ME+ A  PG+QFYT N L+  +GKG AVY  +A
Sbjct  270   LDGETDGQGVRK---VAVVSEADSGRVMELWADQPGLQFYTGNMLKGDEGKGGAVYPKYA  326

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
              +CLETQ +PDAV+ P FP+ +  P Q YKH +   F +
Sbjct  327   GMCLETQDYPDAVHEPAFPAEVYRPGQLYKHYMLYKFSI  365



>ref|XP_010918323.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=341

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 222/339 (65%), Gaps = 13/339 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + + K   +VK++N+GA + SL++PD +G L D+VLG+D++  Y +     FG IVGR
Sbjct  10    EVFELTKDKITVKISNWGATITSLLVPDAHGNLDDVVLGFDSMEPYIKGMAPYFGCIVGR  69

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV----KKHEESSITFTYYS  474
             VANRI   +FTLNG+ Y L  N   N+LHGG KG  KV W++    K  E  SITF Y+S
Sbjct  70    VANRIKDGKFTLNGMEYSLPINKPPNSLHGGRKGFDKVLWEIAEYNKNGENPSITFRYHS  129

Query  475   RDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNIL  654
             +DG++G+PGDV    TY++  +   L ++M A   NK TP++LAQH YWNL GH+SGNIL
Sbjct  130   KDGEEGYPGDVSVTATYSLPSS-TSLKLEMEAVPQNKATPISLAQHTYWNLAGHNSGNIL  188

Query  655   SEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAV  834
                +QI A  ITPVD+N +PTG+I+ +  T FDFLK  ++GS++ ++P   GG+D NY +
Sbjct  189   EHSIQIPASQITPVDANTVPTGEIMPVKGTPFDFLKENKIGSRIHEVP---GGYDHNYVL  245

Query  835   D-GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
             D G +  G R     A++ D  S   + I   APG+QFYT N++  + GKG AVY  HA 
Sbjct  246   DCGEERSGLRH---AARLKDPSSSRVLNIWTDAPGMQFYTGNYVNGIVGKGGAVYGKHAG  302

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             LCLETQGFP+A+N PNFPS +V P + Y+H +   F V+
Sbjct  303   LCLETQGFPNAINQPNFPSVVVQPGEKYRHVMLFEFSVE  341



>ref|XP_009405677.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=334

 Score =   310 bits (795),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 220/336 (65%), Gaps = 14/336 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + Y +  G  +VK+TN+GA + S+++PD NG L D+VLG+DTV  Y++     FG IVGR
Sbjct  4     ELYELSNGTITVKITNFGATITSILVPDANGNLADVVLGFDTVEPYQKGAGRYFGCIVGR  63

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSR  477
             VANRI   +FTLNG+ Y L+ N+  N+LHGG  G  KV W+V ++   E  SITF Y+S+
Sbjct  64    VANRIKEGKFTLNGLDYSLHINNPPNSLHGGKIGFDKVLWEVAEYNNDEFPSITFKYHSK  123

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGD+     Y++      L ++M A   NK TPV+LAQH YWNL GH+SG+IL 
Sbjct  124   DGEEGYPGDLSVIAKYSLPSG-TSLKLEMEAVPTNKATPVSLAQHTYWNLAGHNSGHILD  182

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+A H+TPVD NLIPTG+I+ +  T FDF   +++ S++ ++P    G+D NY + 
Sbjct  183   HSIQIWASHVTPVDENLIPTGEIMPVTGTPFDFTSERKIDSRIHEVPV---GYDHNYVL-  238

Query  838   GYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
                D G ++   K  AKV D  S   + +   APG+QFYT N +  V GKG AVYE HA 
Sbjct  239   ---DCGEKRCGLKHAAKVKDPSSSRVLNLWTDAPGLQFYTGNFVTGVVGKGGAVYEKHAG  295

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LCLETQGFP+A+N PNFPS +V P +  KHT+   F
Sbjct  296   LCLETQGFPNAINQPNFPSIVVQPGEKSKHTMLFEF  331



>emb|CDO98338.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 221/337 (66%), Gaps = 10/337 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             K + +  G   +K+++ G  + SL +PDKNGKL D+VLG+D +  Y +     FG IVGR
Sbjct  5     KLFELNNGTIQLKVSSLGCTITSLSVPDKNGKLGDVVLGFDALEPYLKGAAPYFGCIVGR  64

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE---ESSITFTYYSR  477
             VANRI   +FTL+G HY L  N   N+LHGG KG  KV W++ +H+   E SITF YYSR
Sbjct  65    VANRIKDGKFTLDGAHYSLPINKPPNSLHGGHKGYDKVVWELVEHKQGNEPSITFKYYSR  124

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PG++    TYT+  +   L + M A   NKPTPV+LAQH YWNLGGH+SGN+L 
Sbjct  125   DGEEGYPGELAVTATYTLT-SATTLRLDMKAVPQNKPTPVSLAQHTYWNLGGHNSGNVLD  183

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+A H+TPVD N IPTG+I+ + +T FDF   Q++GS++ ++     G+D NY +D
Sbjct  184   HTIQIWAKHVTPVDQNTIPTGEIMPVKDTPFDFTTEQKIGSRIHEV---GIGYDHNYVLD  240

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+      K   K+ D  S   + +   APG+QFYTAN++  + GKG A Y+ H+ +C
Sbjct  241   CEDE--QWGLKHAVKLKDPVSSRVLNLWTNAPGMQFYTANYVHGIVGKGGAQYDKHSGVC  298

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             LETQGFP+A+N PNFPS +V P + Y+H++   F V+
Sbjct  299   LETQGFPNAINQPNFPSIVVRPGEKYEHSMLFEFSVE  335



>gb|AAL75737.1|AC091724_10 Putative aldose 1-epimerase - like protein [Oryza sativa Japonica 
Group]
 gb|AAM46059.1|AC122145_13 Putative aldose 1-epimerase - like protein [Oryza sativa Japonica 
Group]
 gb|EAZ15347.1| hypothetical protein OsJ_30764 [Oryza sativa Japonica Group]
Length=343

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 217/339 (64%), Gaps = 19/339 (6%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTV---MEYEQDDTN--------F  288
             +  G  + K+  +GA + SLI+PD +G L D+VLG+DT+   MEY              F
Sbjct  9     LSNGRITAKIAAWGATITSLIVPDAHGNLADVVLGFDTLEPYMEYVGTGKGGQKGISPYF  68

Query  289   GAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV--KKHEESSITF  462
             G IVGRVANRI   +FTLNG+ Y L  N+G N+LHGG KG  KV W V  +K E  SITF
Sbjct  69    GCIVGRVANRIKEGKFTLNGVEYSLAINNGPNSLHGGLKGFDKVVWDVVERKSECPSITF  128

Query  463   TYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDS  642
              Y+S+DG++G+PGDV    TY++ ++   L + M A A NK TP+NLAQH YWNL GH+S
Sbjct  129   QYHSKDGEEGYPGDVTVRATYSLPDST-TLRLDMEAVAENKATPINLAQHTYWNLAGHNS  187

Query  643   GNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDI  822
             G+ L   +QI+  HITPVD N IPTG+I+ +  T FDF    ++G+++  +P   GG+D 
Sbjct  188   GDTLDHSIQIWGKHITPVDENTIPTGEIMPVKGTPFDFTTEHKIGARINDVP---GGYDH  244

Query  823   NYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
             NY +D  ++      K  AK+ D  +   +++   APG+QFYTAN++  V GKG AVY  
Sbjct  245   NYVLDSGEE--KNGLKHAAKLKDSSNSRTLDLWTDAPGMQFYTANYVDGVTGKGGAVYGK  302

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             H+ +CLETQGFP+A+N PNFPS +V P + YKHT+   F
Sbjct  303   HSGVCLETQGFPNAINQPNFPSVVVQPGEKYKHTMLFEF  341



>ref|XP_004975843.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=362

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 210/330 (64%), Gaps = 11/330 (3%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++KGDFSVK+TN+GA + S+ILPD  G L D+VLG DTV +Y  D + FG + GRVA 
Sbjct  32    YELRKGDFSVKVTNWGATIMSVILPDSKGNLADVVLGRDTVAQYVNDTSFFGPVAGRVAQ  91

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI   +F L+G  Y LN NDG NTL GG +G  KV W V+++    +   IT  Y S DG
Sbjct  92    RIAQGRFVLDGKVYHLNINDGRNTLQGGGRGFHKVIWTVREYVCAGDSPYITLYYRSFDG  151

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPG++  HVTY +  +PY L V MNA AL+K TPVNL QH YWNLGGH SG++L   
Sbjct  152   EQGFPGNLDVHVTYRV-SSPYTLGVHMNATALDKATPVNLLQHTYWNLGGHGSGDVLGHA  210

Query  664   LQIFAYHITPVDSNLIP-TGQILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINYAVD  837
             L++ A   TP+D  ++P +G++  +  T FDF  P  +G+++ ++  G   G+D NY VD
Sbjct  211   LRLAASRYTPLDGEMLPSSGRVAPVAGTPFDFRAPTPIGARIRQVMGGRVVGYDANYVVD  270

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G       + + VA V D  SG  +E+    P VQ YTAN L   +GKG  VY+  A  C
Sbjct  271   GEPG----RMRPVAAVRDGASGRALELWGNQPCVQLYTANWLNHTEGKGGEVYDRWAGFC  326

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTL  1107
             LETQG+PDAVNHP FPS I+   Q Y+H +
Sbjct  327   LETQGYPDAVNHPEFPSQILRHGQVYRHDM  356



>gb|EMT01730.1| Aldose 1-epimerase [Aegilops tauschii]
Length=331

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 204/330 (62%), Gaps = 42/330 (13%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y +KKGDFS+K+TN+GA + S+ILPD  G L D++LGYDTV EY      FG ++GRVAN
Sbjct  40    YELKKGDFSIKVTNWGATLMSVILPDSRGNLGDVILGYDTVAEYVNGTAYFGGLIGRVAN  99

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEESSITFTYYSRDGDQGF  495
             RI  A+FTL+G  Y+L  NDGNNTLHG                                F
Sbjct  100   RIANARFTLDGKAYRLVPNDGNNTLHG--------------------------------F  127

Query  496   PGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIF  675
             PGDV  HV Y +   P++L V+MNA A  K TPVNLA H YWNLGGH SG++L E++++F
Sbjct  128   PGDVDVHVKYQL-SGPHELSVRMNATARGKATPVNLAHHAYWNLGGHGSGSVLGEEVRLF  186

Query  676   AYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAK-LPKGSGGFDINYAVDGYDDV  852
             A   TPVD+ LIPTG +  +  T +DF  P  VGS++   L +G  G+DINY VDG    
Sbjct  187   ASRYTPVDAALIPTGHLAPVAGTPYDFRTPAAVGSRIGGLLSRGVNGYDINYVVDG----  242

Query  853   GTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQG  1032
                  + VA V D  SG  ME+ A  PGVQFYTAN L  V+GKG  VY  + ALCLETQG
Sbjct  243   --GGLRPVAVVRDGASGRAMELWADQPGVQFYTANGLSGVRGKGGKVYGRYGALCLETQG  300

Query  1033  FPDAVNHPNFPSTIVTPQQPYKHTLHITFR  1122
             FPDAVN P+FPS IV P + Y H  H+ F+
Sbjct  301   FPDAVNRPSFPSQIVRPGKVYMH--HMVFK  328



>gb|EAZ30964.1| hypothetical protein OsJ_15042 [Oryza sativa Japonica Group]
Length=363

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 209/334 (63%), Gaps = 13/334 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             YV++KGDFSVK+TN+GA + S++LPD  G L D+VLG DT+ EY  D   FG + GRV  
Sbjct  35    YVLRKGDFSVKITNWGATMMSVVLPDSKGNLADVVLGLDTIAEYVNDTNYFGPVTGRVGQ  94

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI   +F L+G  Y    NDG N +HGG +G SKV W VK++    +   IT  Y S DG
Sbjct  95    RIARGRFVLDGKVYHTYINDGRNAIHGGHRGFSKVIWTVKEYVGGGDSPYITLYYRSFDG  154

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+ A+VTY +  +PY L ++MNA ALNK TPVN  QH YWNLGG   G++L   
Sbjct  155   EQGFPGDLDAYVTYQL-SSPYVLALRMNATALNKATPVNFLQHTYWNLGGQGRGDVLGHT  213

Query  664   LQIFAYHITPVDSNLIP-TGQILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINYAVD  837
             LQ+ A   TP+D  L+P +G +  +  T +DF  P  +G+++ ++  G   G+DINY +D
Sbjct  214   LQLSASRYTPLDEELLPSSGVVAPVAGTPYDFRHPTPIGARIRQVMGGRIAGYDINYVID  273

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G    G RK   VA   D  SG  +E+ A  P +Q YT N L ++KGKG  VY+ +   C
Sbjct  274   G---EGMRK---VAAARDGASGRALELWANQPAMQLYTGNWLNNIKGKGGKVYQQYGGFC  327

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQG+ DAVNHP FPS  V P Q Y+H +   F
Sbjct  328   LETQGYVDAVNHPEFPSMTVRPGQVYRHDMAFKF  361



>ref|XP_004983378.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=335

 Score =   308 bits (790),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 214/334 (64%), Gaps = 10/334 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             K   +  G  + ++ ++GA + SL++PD +G + D+VLG+D +  Y +     FG IVGR
Sbjct  6     KIIELSNGRITTRIASWGATITSLLVPDAHGNVADVVLGFDDLEPYMKGMAPYFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSR  477
             VANRI   +FTLNG  Y L  N+G N+LHGG  G  KV W V +H   E  S+TF Y+S+
Sbjct  66    VANRIKDGKFTLNGAEYSLPINNGPNSLHGGLTGFDKVMWDVVEHKDGECPSVTFQYHSK  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TY++ E    L + M A   +K TP+NLAQH YWNL GH+SG+IL+
Sbjct  126   DGEEGYPGDVTVRATYSLPE-ATTLRLDMEAIPHDKATPINLAQHTYWNLAGHNSGDILN  184

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+  HITPVD N IPTG+I+ +  T FDF    ++G ++  +P   GG+D NY +D
Sbjct  185   HTIQIWGKHITPVDENTIPTGEIMPVEGTPFDFTTEHKIGERINDVP---GGYDHNYVLD  241

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+      K  AK+ D  S   + +   APG+QFYTAN++  + GKG AVYE HA +C
Sbjct  242   CGDE--KNGVKHAAKLRDPSSSRTLNLWTDAPGMQFYTANYVTGITGKGGAVYEKHAGVC  299

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFP+A+N PNFPS +V P + YKHT+   F
Sbjct  300   LETQGFPNAINQPNFPSVVVQPGEKYKHTMLFEF  333



>ref|XP_010034276.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW84109.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=340

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/339 (47%), Positives = 218/339 (64%), Gaps = 13/339 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF-GAIVGR  306
             + + +  G   VK+ N G  +ASL +P K+GKL D+VLG+D+V  Y +    F G IVGR
Sbjct  9     ELFELDNGTMRVKIANLGCTIASLSVPGKDGKLADVVLGFDSVEPYLKGAAPFFGCIVGR  68

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +FTL+G+ + L  N   N+LHGG KG  KV W+V   KK E  SITF Y+S 
Sbjct  69    VANRIKEGKFTLDGVEHSLPINKPPNSLHGGHKGFDKVIWEVADYKKGENPSITFKYHSH  128

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TYT+  +   + + M A   NK TP++LAQH YWNL GHDSGNIL+
Sbjct  129   DGEEGYPGDVAVTATYTLTSS-TTMRLDMEAVPENKATPISLAQHTYWNLAGHDSGNILN  187

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+A HITPVD N IPTG+I+ +  TAFDF   +++G+ + ++P    G+D NY + 
Sbjct  188   HSIQIWANHITPVDQNTIPTGEIMPVKGTAFDFTTEKKIGTSIHEVP--GLGYDHNYVL-  244

Query  838   GYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
                D G  K   K  AK+ D  S   +++   APG+QFYT N++  V GKG A Y  H+ 
Sbjct  245   ---DCGEEKSGLKHAAKLKDPSSSRVLDLWTNAPGMQFYTGNYVNGVVGKGDAAYGKHSG  301

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +CLETQGFP+A+N PNFPS IV P + YKH++   F ++
Sbjct  302   VCLETQGFPNAINQPNFPSVIVRPGEKYKHSMLFEFSLE  340



>ref|XP_009766422.1| PREDICTED: aldose 1-epimerase [Nicotiana sylvestris]
Length=335

 Score =   308 bits (789),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/339 (48%), Positives = 216/339 (64%), Gaps = 14/339 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF-GAIVGR  306
             K + +  G   V ++N G  + SL +PDK+G L D+VLG+DT+  Y++    F G IVGR
Sbjct  5     KIFELNNGSMQVTVSNLGCTILSLSVPDKDGNLGDVVLGFDTLEPYQKGLAPFFGCIVGR  64

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +F+LNG+ Y L  N   N+LHGG KG  KV W+V +H+E    SITF Y+SR
Sbjct  65    VANRIKEGKFSLNGVDYTLPINKPPNSLHGGHKGYDKVVWEVAEHKEGEHPSITFKYHSR  124

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGD+    TYT+      L + M A   NKPTPV+LAQH YWNLGGH+SG+IL 
Sbjct  125   DGEEGYPGDLSVTATYTLTSK-TTLRLDMEAVPANKPTPVSLAQHTYWNLGGHNSGDILD  183

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
                QI+A HITPVD N+IPTG+I+ +  T FDF   +Q+G  + ++     G+D NY + 
Sbjct  184   NTAQIWANHITPVDQNIIPTGEIMPVKGTPFDFTAEKQIGRDIQQV---GLGYDHNYVL-  239

Query  838   GYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
                D G  K   K  AK+ D +S   + +   APG+QFYTAN++  V GKG AVY  HA 
Sbjct  240   ---DCGDVKDGLKHAAKIKDPKSSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYNKHAG  296

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +CLETQGFP+AVN PNFPS IV P   Y H +   F V+
Sbjct  297   VCLETQGFPNAVNTPNFPSVIVQPGDKYIHNMLYEFSVE  335



>gb|EAY94387.1| hypothetical protein OsI_16154 [Oryza sativa Indica Group]
 emb|CBW45775.1| ORW1943Ba0077G13.3 [Oryza rufipogon]
Length=363

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 208/334 (62%), Gaps = 13/334 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             YV++KGDFSVK+TN+GA + S++LPD  G L D+VLG DT+ EY  D   FG + GRV  
Sbjct  35    YVLRKGDFSVKITNWGATMMSVVLPDSKGNLADVVLGLDTIAEYVNDTNYFGPVTGRVGQ  94

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI   +F L+G  Y    NDG N +HGG +G SKV W VK++    +   IT  Y S DG
Sbjct  95    RIARGRFVLDGKVYHTYINDGRNAIHGGHRGFSKVIWTVKEYVGGGDSPYITLYYRSFDG  154

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+ A+VTY +  +PY L ++MNA ALNK TPVN  QH YWNLGG   G++L   
Sbjct  155   EQGFPGDLDAYVTYQL-SSPYVLALRMNATALNKATPVNFLQHTYWNLGGQGRGDVLGHT  213

Query  664   LQIFAYHITPVDSNLIP-TGQILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINYAVD  837
             LQ+ A   TP+D  L+P +G +  +  T +DF  P  +G+++ ++  G   G+DINY +D
Sbjct  214   LQLSASRYTPLDEELLPSSGVVAPVAGTPYDFRHPTPIGARIRQVMGGRIAGYDINYVID  273

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G    G RK   VA   D  SG  +E+ A  P +Q YT N L + KGKG  VY+ +   C
Sbjct  274   G---EGMRK---VAAARDGASGRALELWANQPAMQLYTGNWLNNTKGKGGKVYQQYGGFC  327

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQG+ DAVNHP FPS  V P Q YKH +   F
Sbjct  328   LETQGYVDAVNHPEFPSMTVRPGQVYKHDMAFKF  361



>ref|XP_002465201.1| hypothetical protein SORBIDRAFT_01g033970 [Sorghum bicolor]
 gb|EER92199.1| hypothetical protein SORBIDRAFT_01g033970 [Sorghum bicolor]
Length=371

 Score =   309 bits (792),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 160/339 (47%), Positives = 218/339 (64%), Gaps = 9/339 (3%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             Q   FY +++G+FS+ +TN+GA + ++ LPDKNG + D+VLGY  +  Y  D T FGA+V
Sbjct  36    QSLGFYELRRGEFSMIVTNWGATILAVRLPDKNGHIDDVVLGYKDIGSYVNDTTYFGALV  95

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYY  471
             GRVANRI G +FT+    Y    NDGNNTLHGG +G ++V+W V++    E   ITF Y 
Sbjct  96    GRVANRIAGGRFTIKDRPYHTYQNDGNNTLHGGHRGFNQVFWSVRERVTGEFPHITFAYR  155

Query  472   SRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNI  651
             S DG+QGFPG++   VTY I +  Y   V M A+ ++KPTP+NLAQH YWNL GH  G++
Sbjct  156   SYDGEQGFPGNLDVLVTYKI-DGDYSYSVTMYARPVDKPTPINLAQHTYWNLRGHGHGDV  214

Query  652   LSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYA  831
             L   +QIFA  +TPV  +LIPTG +  +  T FDF  P   G+++A++ +G  G+DINY 
Sbjct  215   LRHAVQIFASAVTPVGGDLIPTGAVTPVAGTPFDFRAPAAPGARIAQV-EGGVGYDINYV  273

Query  832   VDGY-DDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
             +DG  D  G RK   VA V ++ SG  ME+    PG+QFYT N L   +GK  AVY  + 
Sbjct  274   LDGETDGQGVRK---VAVVSEDESGRVMELWGNQPGLQFYTGNFLDGDQGKDGAVYAKYG  330

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
              +CLETQ +PDAV+ P FP+ +  P Q YKH +   F +
Sbjct  331   GMCLETQDYPDAVHEPGFPAEVYRPGQVYKHYMLYKFSI  369



>gb|EYU24186.1| hypothetical protein MIMGU_mgv1a009569mg [Erythranthe guttata]
Length=338

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 225/342 (66%), Gaps = 18/342 (5%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             K + +  G   VK++NYG  + SL +PDK+GKL D+VLG+DT+  Y++     FG IVGR
Sbjct  6     KIFELNNGSMQVKVSNYGCTITSLFVPDKDGKLGDVVLGFDTIEPYQRGAAPYFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +FTLNG  Y L  N   N+LHGG KG  KV W+V ++++    SITF Y+S 
Sbjct  66    VANRIKEGKFTLNGTEYSLPINKPPNSLHGGQKGFDKVIWEVAEYKQGDTPSITFKYHSH  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKAL--NKPTPVNLAQHNYWNLGGHDSGN-  648
             DG++G+PGDV    TYT+     K  ++++ + +  +K TP++LAQH YWNL GH+SGN 
Sbjct  126   DGEEGYPGDVSFTATYTLTS---KTTMRLDMEGIPKDKATPISLAQHTYWNLSGHNSGNS  182

Query  649   ILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQ-QVGSQMAKLPKGSGGFDIN  825
             IL   +QI+A HITPVD N++PTG+IL + NT FDF     ++GS++ ++     G+D N
Sbjct  183   ILDHTIQIWANHITPVDQNIVPTGEILAVKNTPFDFTAENTKIGSRIQEV---GIGYDHN  239

Query  826   YAVD-GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYES  1002
             Y +D G + +G ++    AK+ D  S   + +   APG+QFYTAN++  + GKG AVYE 
Sbjct  240   YVLDCGEEKLGLKR---AAKLVDPTSSRTLNLWTDAPGMQFYTANYVNGIVGKGGAVYEK  296

Query  1003  HAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             H A CLETQGFP+A+N PNFPS +V P + YKHT+   F  +
Sbjct  297   HGAACLETQGFPNAINQPNFPSVVVQPGEKYKHTMLFEFSAE  338



>ref|XP_006490787.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
 gb|KDO47396.1| hypothetical protein CISIN_1g019518mg [Citrus sinensis]
Length=340

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/339 (47%), Positives = 216/339 (64%), Gaps = 13/339 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNF-GAIVGR  306
             + + +  G   VK+TNYGA + SL +PDK+G   D+VLG+D+V  Y +    F G IVGR
Sbjct  9     EVFELNNGSMQVKITNYGAIITSLSVPDKHGNWADVVLGFDSVEPYVKGAAPFFGCIVGR  68

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +F+L+G+ Y L  N   N+LHGG KG  KV W+V   KK E  SITF Y SR
Sbjct  69    VANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSR  128

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TYT+  +   + + M A   NKPTP++LAQH YWNL GH SGNIL 
Sbjct  129   DGEEGYPGDVSVMATYTLTSS-TTMRLDMEAVPENKPTPISLAQHTYWNLAGHHSGNILD  187

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+  HITPVD N +PTG+I+ +  T FDF   +++G+ + ++P    G+D NY + 
Sbjct  188   HSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVP--GLGYDHNYVL-  244

Query  838   GYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
                D G  K   K  AK+ +  +   + +   APG+QFYT N++  V GKG AVY  H+ 
Sbjct  245   ---DCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTGNYVNGVVGKGGAVYGKHSG  301

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +CLETQGFP+A+N PNFPS +V P + Y+HT+   F V+
Sbjct  302   VCLETQGFPNAINQPNFPSVVVRPGESYQHTMLFEFSVE  340



>gb|EMT28343.1| Aldose 1-epimerase [Aegilops tauschii]
Length=335

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 213/334 (64%), Gaps = 10/334 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             +  V+  G  +  + ++GA + SL++PD  G L D+VLG+DT+  Y +     FG IVGR
Sbjct  6     EICVLSNGRITANIASWGATITSLLVPDAQGDLADVVLGFDTLEPYLKGMAPYFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +F LNG+ Y L  N+G N+LHGG KG  KV W V   K+ E  SITF Y S+
Sbjct  66    VANRIKNGKFDLNGVEYSLPINNGPNSLHGGLKGFDKVVWDVVERKEGEYPSITFQYESK  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV     Y++ E    L + M A   NK TP++LAQH YWNL GH+SG+IL 
Sbjct  126   DGEEGYPGDVTVRAVYSLPE-ATTLRLDMEAIPANKATPISLAQHTYWNLAGHNSGSILD  184

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+A H+TPV+ N IPTG+I+ + +T FDF    ++G ++  +P   GG+D NY +D
Sbjct  185   HSIQIWAKHVTPVNENTIPTGEIMPVQDTPFDFTTEHRIGERINNVP---GGYDHNYVLD  241

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+      K  AK+ D  S   +++   APG+QFYTAN++  + GKG AVY  HA +C
Sbjct  242   SGDE--KNGLKHAAKLKDPSSSRTLDLWTDAPGMQFYTANYVNGITGKGGAVYGKHAGVC  299

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFP+A+N PNFPS +V P   YKHT+   F
Sbjct  300   LETQGFPNAINQPNFPSVVVQPGAKYKHTMLFEF  333



>ref|XP_003579893.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=362

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 222/368 (60%), Gaps = 23/368 (6%)
 Frame = +1

Query  61    IISAPLFLCFF----ISFALIVSGQDNKF---YVIKKGDFSVKLTNYGARVASLILPDKN  219
             +   P+FL       ++ AL  +    K    YV+KKGDFSVK+TN+GA + S++ PD  
Sbjct  1     MARTPVFLALLSLVVVASALATTADARKMVGVYVLKKGDFSVKITNWGATIMSIVFPDSK  60

Query  220   GKLTDIVLGYDTVMEYEQDDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGG  399
             G L D+VLG DT+ EY  D + FG + GRVA R+   +F L+G  Y    NDG N +HGG
Sbjct  61    GNLGDVVLGKDTLAEYVNDTSYFGPLTGRVAQRMARGRFVLDGKVYHTYINDGRNAIHGG  120

Query  400   PKGISKVYWKVKKH----EESSITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMN  567
              +G SKV W VK++    +   IT  Y S DG+QGFPGD+  + TY++  +PY L ++ N
Sbjct  121   HRGFSKVIWTVKEYVGGGDSPHITLYYRSFDGEQGFPGDLDVYATYSL-SSPYVLSIRTN  179

Query  568   AKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQIFAYHITPVDSNLIP-TGQILLINNT  744
             A ALNK TPVN  QH YWNLGG  SGNIL   LQ+FA   TP+D  L+P +G+++ +  T
Sbjct  180   ATALNKATPVNFLQHTYWNLGGKGSGNILGHTLQLFASRYTPMDDELLPSSGRVVPVAGT  239

Query  745   AFDFLKPQQVGSQMAKLPKGSG---GFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGME  915
              +DF  P  +G+++ ++  GS    G+DINY VDG    G RK   VA   D  SG  +E
Sbjct  240   PYDFRTPTPIGARIRQV-TGSNKVFGYDINYVVDG---EGMRK---VAVARDGASGRALE  292

Query  916   IKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPY  1095
               A  P +Q YT N+L   KGKG  VY+ +    LETQG+PDAVNHP FPS  +   Q Y
Sbjct  293   FWANQPAMQLYTGNYLNGTKGKGGEVYQQYGGFALETQGYPDAVNHPEFPSQTLRLGQVY  352

Query  1096  KHTLHITF  1119
             KH + I F
Sbjct  353   KHDMLIKF  360



>gb|EMS45763.1| Aldose 1-epimerase [Triticum urartu]
Length=335

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 213/334 (64%), Gaps = 10/334 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             +  V+  G  +  + ++GA + SL++PD  G L D+VLG+DT+  Y +     FG IVGR
Sbjct  6     EICVLSNGRITANIASWGATITSLLVPDAQGDLADVVLGFDTLEPYLKGMAPYFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +F LNG+ Y L  N+G N+LHGG KG  KV W V   K  E  SITF Y S+
Sbjct  66    VANRIKNGKFDLNGVEYSLPINNGPNSLHGGLKGFDKVVWDVVERKDGEYPSITFQYESK  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TY++ E    L + M A   NK TP++LAQH YWNL GH+SG+IL 
Sbjct  126   DGEEGYPGDVTVRATYSLPE-ATTLRLDMEAIPANKATPISLAQHTYWNLAGHNSGSILD  184

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+A H+TPV+ N IPTG+I+ + +T FDF    ++G +++ +P   GG+D NY +D
Sbjct  185   HSIQIWAKHVTPVNENTIPTGEIMPVQDTPFDFTTEHKIGDRISDVP---GGYDHNYVLD  241

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+      K  AK+ D  S   +++   APG+QFYTAN++  + GKG AVY  HA +C
Sbjct  242   SGDE--KNGLKHAAKLKDPSSSRTLDLWTDAPGMQFYTANYVNGITGKGGAVYGKHAGVC  299

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQGFP+A+N PNFPS +V P   YKH +   F
Sbjct  300   LETQGFPNAINQPNFPSVVVQPGAKYKHAMLFEF  333



>gb|KHG22159.1| Aldose 1-epimerase [Gossypium arboreum]
Length=336

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 212/338 (63%), Gaps = 12/338 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + Y +  G   V +TNYG  + SL +PDKNGKL D+VLG+DTV  Y +  +  FG IVGR
Sbjct  6     QIYELNNGTVVVTITNYGCTITSLSVPDKNGKLADVVLGFDTVEPYVKGASPYFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSR  477
             VANRI   +FTLNG  Y L  N   N+LHGG KG  K  W+V   KK ++ SITF Y S 
Sbjct  66    VANRIKNGKFTLNGTEYTLPINKPPNSLHGGFKGFDKRIWEVAEYKKGDKPSITFKYRSS  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+P DV    TYT+      + + M A   NK TP+NLAQH YWNL GH+SGNIL 
Sbjct  126   DGEEGYPSDVSVTATYTLTST-MTMKLDMEAVPENKATPINLAQHTYWNLAGHNSGNILD  184

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAV-  834
               +QI+A  +TPVD N +PTG+I  I  T FDF   ++VG Q+ ++     G+D NY + 
Sbjct  185   HTIQIWASEMTPVDENTVPTGEIKPIKGTPFDFTAEKKVGLQVHEV---GLGYDRNYVLG  241

Query  835   DGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
              G + +G ++    AK+ D  S   + +   APG+QFYT NH+  V GKG AVY  HA L
Sbjct  242   SGEEKLGLKR---AAKLKDPSSSRVLNLWTNAPGMQFYTGNHVNGVVGKGGAVYNKHAGL  298

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             CLETQGFP+A+N PNFPS +V P   Y+HT+   F V+
Sbjct  299   CLETQGFPNAINQPNFPSVVVQPGSKYQHTMLFEFSVE  336



>ref|NP_001140553.1| aldose 1-epimerase [Zea mays]
 gb|ACF84065.1| unknown [Zea mays]
 gb|ACG36338.1| aldose 1-epimerase [Zea mays]
 tpg|DAA52460.1| TPA: aldose 1-epimerase [Zea mays]
Length=336

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 217/341 (64%), Gaps = 14/341 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             K   +  G  + +++N+GA + SL++PD  G + D+VLG+D +  Y +  +  FG IVGR
Sbjct  6     KILELSNGKITARISNWGATITSLLVPDAQGSVADVVLGFDGLDPYVKGMSPYFGCIVGR  65

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSR  477
             VANRI   +FTLNG+ Y L  N+G N+LHGG KG  KV W V +H   E  SITF Y+S+
Sbjct  66    VANRIKDGKFTLNGLEYSLPVNNGPNSLHGGLKGFDKVVWDVVEHKDGECPSITFQYHSK  125

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV    TY++ E    L + M A   NK TP++LAQH YWNL GH  G+IL+
Sbjct  126   DGEEGYPGDVTIRATYSLPEA-TTLRLDMEATPENKATPISLAQHTYWNLAGHACGDILN  184

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               LQI+  HITPVD N IPTG+I+ ++ T FDF   +++G ++  +P   GG+D NY +D
Sbjct  185   HSLQIWGKHITPVDENTIPTGEIMPVDGTPFDFTTERRIGERIDGVP---GGYDHNYVLD  241

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+    K+   A++ D  S   +++   APG+Q YTAN++  + GK  AVY  HA +C
Sbjct  242   CGDEKDGLKR--AARLKDPSSLRTLDLWTDAPGMQLYTANYVDGIGGKAGAVYAKHAGVC  299

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQV*GC  1140
             LETQGFP+A+N P FPS +V P + YKHT+   F     GC
Sbjct  300   LETQGFPNAINQPEFPSVVVRPGEKYKHTMLFEFS----GC  336



>ref|XP_010679093.1| PREDICTED: aldose 1-epimerase [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 215/340 (63%), Gaps = 10/340 (3%)
 Frame = +1

Query  118   GQDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQD-DTNFGA  294
             G+  + + +  G  +VK+TNYG  + SL LPDK+GKL D+VLG+DTV  Y Q   + +G 
Sbjct  5     GKKAEIFELDNGSINVKITNYGCTITSLSLPDKDGKLADVVLGFDTVDPYLQGAGSYYGC  64

Query  295   IVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFT  465
             IVGRVANRI   +FTLNG+ Y L  N   N+LHGG KG  K  W V ++ +S   SITF 
Sbjct  65    IVGRVANRIKDGKFTLNGVQYTLPLNKPPNSLHGGNKGFDKQIWDVAEYRKSDTPSITFK  124

Query  466   YYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSG  645
             Y+S DG++G+PGD+    TYT+      + + M A A  K TPVNLAQH YWNL GH SG
Sbjct  125   YHSHDGEEGYPGDLFVTATYTLTSKT-TMRLDMEAVAEKKATPVNLAQHTYWNLAGHSSG  183

Query  646   NILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDIN  825
              +L   +QI+A H TPVD N +PTG+I  +  TAFDF   +++G  +A++     G+D N
Sbjct  184   PVLDHHIQIWANHYTPVDENTVPTGEIAPVKGTAFDFTSEKRIGQDIAQV---GMGYDHN  240

Query  826   YAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESH  1005
             Y +D  D+      K  A+V +  S   +++    PG+QFYT N++  V GK  AVYE H
Sbjct  241   YMLDCGDE--KMGLKHAARVREPSSRRVLDLWTNVPGMQFYTGNYVNGVTGKSGAVYEKH  298

Query  1006  AALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
             A LCLETQGFP+A+N PNFPS +V P + Y+H++   F +
Sbjct  299   AGLCLETQGFPNAINQPNFPSVVVEPGKKYQHSMLFEFSI  338



>ref|XP_006652377.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=361

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 212/334 (63%), Gaps = 12/334 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             YV++KGDFSVK+TN+GA + S++LPD  G L D+VLG DT+ EY  D + FG + GRVA 
Sbjct  32    YVLRKGDFSVKITNWGATIMSVVLPDSKGNLADVVLGKDTIAEYN-DTSYFGPVNGRVAQ  90

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI   +F L+G  Y    NDG N +HGG +G SKV W VK++    +   IT  Y+S DG
Sbjct  91    RIARGRFVLDGKVYHTYINDGKNAIHGGHRGFSKVIWTVKEYVGGGDSPYITLYYHSFDG  150

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+ A+VTY +  +PY L V+MNA ALNK TPVN  QH YWNLGG  SG++L   
Sbjct  151   EQGFPGDLDAYVTYQL-SSPYVLAVRMNATALNKATPVNFLQHTYWNLGGQGSGDVLGHT  209

Query  664   LQIFAYHITPVDSNLIPT-GQILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINYAVD  837
             LQ+ A   TP+D  L+P+ G +  +  T +DF  P  +G+++ ++  G   G+DINY +D
Sbjct  210   LQLSASRYTPLDEELLPSSGVVAPVAGTPYDFRAPTPIGARIRQVMGGRIAGYDINYVID  269

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G D  G RK   VA   D  SG  +E+ A  P +Q YT N L + KGK   VY  +  +C
Sbjct  270   G-DAHGMRK---VAAARDGASGRALELWANQPAMQLYTGNWLNNTKGKDGKVYGQYGGVC  325

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQG+ DAVNHP FPS  V P Q YKH +   F
Sbjct  326   LETQGYVDAVNHPEFPSMTVRPGQVYKHDMVFKF  359



>ref|XP_006661643.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=339

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 214/330 (65%), Gaps = 10/330 (3%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGRVANR  318
             +  G  + K+  +GA + SL++PD +G L D+VLG+DT+  Y +  +  FG IVGRVANR
Sbjct  14    LSNGSITAKIATWGATITSLLVPDAHGNLADVVLGFDTLEPYMKGISPYFGCIVGRVANR  73

Query  319   IGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSRDGDQ  489
             I   +FTLNG+ Y L  N+G N+LHGG KG  KV W V   K  E  SITF Y+S+DG++
Sbjct  74    IKDGKFTLNGVEYSLAINNGPNSLHGGLKGFDKVVWDVVERKGGECPSITFQYHSKDGEE  133

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             G+PGDV    TY+++ +   L + M A A NK TP+NLAQH YWNL GH+SG+ L   +Q
Sbjct  134   GYPGDVTIRATYSLRHS-TTLRLDMEAVAENKATPINLAQHTYWNLAGHNSGHTLDHSIQ  192

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             I+  HITPVD N IPTG+I+ + +T FDF    ++G+++  +P   GG+D NY +D  D+
Sbjct  193   IWGKHITPVDENTIPTGEIVPVKDTPFDFTTEHKIGARINDVP---GGYDHNYVLDCGDE  249

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
                   K   K+ D  +   +++   APG+QFYTAN++  + GK  AVY  H+ +CLETQ
Sbjct  250   --KNGLKHAVKLKDPSNSRTLDLWTDAPGMQFYTANYVDSISGKSGAVYVKHSGVCLETQ  307

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             GFP+A+N PNFPS +V P   YKH++   F
Sbjct  308   GFPNAINQPNFPSVVVQPGDKYKHSMLFEF  337



>ref|XP_011073000.1| PREDICTED: aldose 1-epimerase [Sesamum indicum]
Length=335

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 215/339 (63%), Gaps = 10/339 (3%)
 Frame = +1

Query  124   DNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIV  300
             + K + +  G   VK++NYG  + SL++PDK+GKL D+VLG+DT+  Y +     FG IV
Sbjct  3     EAKIFELNNGTMQVKVSNYGCTITSLLVPDKDGKLADVVLGFDTLEPYMKGAAPYFGCIV  62

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYY  471
             GRVANRI   +FTLNG+ Y L  N   N+LHGG KG  KV W+V ++++    SITF Y 
Sbjct  63    GRVANRIKDGKFTLNGVEYALPINKPPNSLHGGHKGYDKVIWEVAEYKQGDNPSITFKYR  122

Query  472   SRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNI  651
             SRDG++G+PGDV    TYT+      + + M     NKPTP++LAQH YWNL GHDSG+I
Sbjct  123   SRDGEEGYPGDVSFTATYTLTSK-TTMRLDMEGVPENKPTPISLAQHTYWNLAGHDSGSI  181

Query  652   LSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYA  831
             L   +QI+A HITPVD N +PTG+I+ +  T FDF    ++GS++ ++     G+D NY 
Sbjct  182   LDHTIQIWANHITPVDQNTVPTGEIMPVKGTPFDFTTESKIGSRIQEV---GLGYDHNYV  238

Query  832   VDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
             +D  D+    K    AK+ D  S   + +   APG+QFYTAN++  + GKG   Y   +A
Sbjct  239   LDCGDEKSGLKH--AAKLKDPTSSRTLNLWTNAPGMQFYTANYVNGIVGKGGVQYGKQSA  296

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
              CLETQGFP+A+N PNFPS +V P   YKH++   F  +
Sbjct  297   ACLETQGFPNAINQPNFPSVVVQPGGTYKHSMLFEFSAE  335



>emb|CAD40901.2| OSJNBa0036B21.19 [Oryza sativa Japonica Group]
Length=363

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 208/334 (62%), Gaps = 13/334 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             YV++KGDFSVK+TN+GA + S++LPD  G L D+VLG DT+ EY  D   FG + GRV  
Sbjct  35    YVLRKGDFSVKITNWGATMMSVVLPDSKGNLADVVLGLDTIAEYVNDTNYFGPVTGRVGQ  94

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI   +F L+G  Y    NDG N +HGG +G SKV W VK++    +   IT  Y S DG
Sbjct  95    RIARGRFVLDGKVYHTYINDGRNAIHGGHRGFSKVIWTVKEYVGGGDSPYITLYYRSFDG  154

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+ A+VTY +  +PY L ++MNA ALNK TPVN  QH YWNLGG   G++L   
Sbjct  155   EQGFPGDLDAYVTYQL-SSPYVLALRMNATALNKATPVNFLQHTYWNLGGQGRGDVLGHT  213

Query  664   LQIFAYHITPVDSNLIP-TGQILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINYAVD  837
             LQ+ A   TP+   L+P +G +  +  T +DF  P  +G+++ ++  G   G+DINY +D
Sbjct  214   LQLSASRYTPLHEELLPSSGVVAPVAGTPYDFRHPTPIGARIRQVMGGRIAGYDINYVID  273

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
             G    G RK   VA   D  SG  +E+ A  P +Q YT N L ++KGKG  VY+ +   C
Sbjct  274   G---EGMRK---VAAARDGASGRALELWANQPAMQLYTGNWLNNIKGKGGKVYQQYGGFC  327

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             LETQG+ DAVNHP FPS  V P Q Y+H +   F
Sbjct  328   LETQGYVDAVNHPEFPSMTVRPGQVYRHDMAFKF  361



>ref|XP_002453661.1| hypothetical protein SORBIDRAFT_04g010030 [Sorghum bicolor]
 gb|EES06637.1| hypothetical protein SORBIDRAFT_04g010030 [Sorghum bicolor]
Length=363

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/335 (47%), Positives = 210/335 (63%), Gaps = 13/335 (4%)
 Frame = +1

Query  136   YVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRVAN  315
             Y ++ GDFSVK+TN+G  + S+ILPD  G L D+VLG DT+ EY  D + FG + GRVA 
Sbjct  33    YELRHGDFSVKITNWGTTIMSVILPDSKGNLADVVLGKDTIAEYINDTSFFGPVAGRVAG  92

Query  316   RIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSRDG  483
             RI   +F L+G  Y L+ NDG NTL GG +G +KV W VK++    +   +T  Y S DG
Sbjct  93    RIARGRFVLDGKVYHLDINDGRNTLQGGGRGFNKVIWTVKEYVAGGDSPYVTLYYRSFDG  152

Query  484   DQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEK  663
             +QGFPGD+  +VTY +  +PY+L V MNA AL + TPVNL QH YWNLGGH +G++L   
Sbjct  153   EQGFPGDLDVYVTYRL--SPYELGVHMNATALGRATPVNLLQHTYWNLGGHGAGDVLGHT  210

Query  664   LQIFAYHITPVDSNLIPTG--QILLINNTAFDFLKPQQVGSQMAKLPKGSG-GFDINYAV  834
             L++ A   TP+D+ ++P+       +  T FDFL P  +G+++  +  G   G+D NY V
Sbjct  211   LRLHASRYTPLDAEMLPSSGRGAAPVAGTPFDFLAPTPIGARIRGVVGGRVLGYDANYVV  270

Query  835   DGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
             DG       + + VA+  D  SG  +E+    P +Q YTAN L   KGKG AVYE +   
Sbjct  271   DGEPG----EMRPVARALDGASGRTLELWGNQPAMQLYTANWLNHTKGKGGAVYERYGGF  326

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             CLETQG+PDAVNHP FPS I+ P Q Y+H +   F
Sbjct  327   CLETQGYPDAVNHPEFPSQIIRPGQVYRHDMVFKF  361



>ref|XP_004982549.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=441

 Score =   309 bits (791),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 220/338 (65%), Gaps = 12/338 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             + + ++ G   V+LTN GA V SL++PDK G L D+VLG+DT+  Y    +  FG IVGR
Sbjct  111   ELFELRGGRIRVRLTNVGAAVTSLLVPDKKGVLADVVLGFDTLDPYLNGTSPYFGCIVGR  170

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYYSR  477
             VANRI   +FTLNG+ + L+ N+  NTLHGG KG  K  W+V ++   +  SITF Y+S+
Sbjct  171   VANRIKNGKFTLNGVQHNLSINNPPNTLHGGFKGFDKSIWEVAEYNKGDNPSITFKYHSK  230

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGDV     Y+I  +   L ++M A  LNK TP++LAQH YWNL GH+SG++L 
Sbjct  231   DGEEGYPGDVSVTARYSILPS-ATLKLEMEATPLNKATPISLAQHTYWNLAGHNSGDVLP  289

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI+   ITPVD   IPTG+ + ++ T FDFL   ++GS++ ++P   GG+D NY +D
Sbjct  290   HSVQIWGSKITPVDQTSIPTGEFMPVSGTPFDFLTGNRIGSRIDQVP---GGYDHNYVLD  346

Query  838   -GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAAL  1014
              G   +G R    VAKV D  S   ++I A APGVQFYT N L  + GKG  VY  HA  
Sbjct  347   SGELRLGLRH---VAKVVDPSSLRVLDIWADAPGVQFYTGNFLHGIVGKGGVVYGKHAGF  403

Query  1015  CLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             CLETQGFP+AVN PNFPS ++ P + Y+HT+   F  +
Sbjct  404   CLETQGFPNAVNQPNFPSIVIRPGEKYQHTMLFEFSTE  441



>ref|XP_002453662.1| hypothetical protein SORBIDRAFT_04g010040 [Sorghum bicolor]
 gb|EES06638.1| hypothetical protein SORBIDRAFT_04g010040 [Sorghum bicolor]
Length=364

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 210/337 (62%), Gaps = 13/337 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIVGRV  309
             + Y ++ GDFSVK+TN+GA + S+ LPD  G L D VLG DT+ EY  D + FG + GRV
Sbjct  32    RVYELRHGDFSVKITNWGATIMSVNLPDSKGNLADFVLGKDTIAEYINDTSFFGPVAGRV  91

Query  310   ANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH----EESSITFTYYSR  477
             A RI   +F L+G  Y L+ NDG NTL GG +G +KV W VK++    +   +T  Y S 
Sbjct  92    AGRIARGRFVLDGKVYHLDINDGRNTLQGGGRGFNKVIWTVKEYVAGGDSPYVTLYYRSF  151

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG+QGFPGD+  +VTY +  +PY+L V MNA AL + TPVNL QH YWNLGGH +G++L 
Sbjct  152   DGEQGFPGDLDVYVTYRL--SPYELGVHMNATALGRATPVNLLQHTYWNLGGHGAGDVLG  209

Query  658   EKLQIFAYHITPVDSNLIPTG--QILLINNTAFDFLKPQQVGSQMAKLPKGS-GGFDINY  828
               L++ A   TP+D+ ++P+       +  T FDFL P  +G+++  +  G   G+D NY
Sbjct  210   HTLRLHASRYTPLDAEMLPSSGRGAAPVAGTPFDFLAPTPIGARIRGVVGGRVPGYDANY  269

Query  829   AVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
              VDG       + + VA+  D  SG  +E+    P +Q YTAN L   KGKG AVYE + 
Sbjct  270   VVDGEPG----EMRPVARALDGASGRALELWGNQPAMQLYTANWLNHTKGKGGAVYERYG  325

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
               CLETQG+PDAVNHP FPS IV P Q Y+H +   F
Sbjct  326   GFCLETQGYPDAVNHPEFPSQIVRPGQVYRHDMVFKF  362



>gb|EAY97171.1| hypothetical protein OsI_19092 [Oryza sativa Indica Group]
Length=344

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 214/340 (63%), Gaps = 20/340 (6%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTV---MEY--------EQDDTNF  288
             +  G  + K+  +GA + SLI+PD  G L D+VLG+DT+   MEY        +     F
Sbjct  9     LSNGRITAKIAAWGATITSLIVPDARGNLADVVLGFDTLEPYMEYVGTGKGGQKSISPYF  68

Query  289   GAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSIT  459
             G IVGRVANRI   +FTLNG+ Y L  N+G N+LHGG KG  KV W V   K  E  SIT
Sbjct  69    GCIVGRVANRIKEGKFTLNGVEYSLAINNGPNSLHGGLKGFDKVVWDVVERKSGECPSIT  128

Query  460   FTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHD  639
             F Y S+DG++G+PGDV    TY++ ++   L + M A A NK TP+NLAQH YWNL GH+
Sbjct  129   FQYDSKDGEEGYPGDVTVRATYSLPDST-TLRLDMEAVAENKATPINLAQHTYWNLAGHN  187

Query  640   SGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFD  819
             SG+ L   +QI+  HITPVD N IPTG+I+ + +T FDF     +G+++  +P   GG+D
Sbjct  188   SGDTLDHSIQIWGKHITPVDENTIPTGEIMPVKDTPFDFTTEHNIGARINDVP---GGYD  244

Query  820   INYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYE  999
              NY +D  ++      K  AK+ D  +   +++   APG+QFYTAN++  + GKG AVY 
Sbjct  245   HNYVLDSGEE--KNGLKHAAKLKDSSNSRTLDLWTDAPGMQFYTANYVDGITGKGGAVYG  302

Query  1000  SHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
              H+ +CLETQG P+A+N PNFPS +V P + YKHT+   F
Sbjct  303   KHSGVCLETQGLPNAINQPNFPSVVVQPGEKYKHTMLFEF  342



>ref|XP_007037270.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY21771.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=398

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 196/283 (69%), Gaps = 8/283 (3%)
 Frame = +1

Query  274   DDTNFGAIVGRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH-EES  450
             D T FGAIVGRVANRI GA+FT+NG+ YKL AN+G NTLHGG KG + V W V+ + ++S
Sbjct  120   DTTYFGAIVGRVANRIKGAEFTINGVSYKLVANEGKNTLHGGSKGFADVIWHVRNYKQDS  179

Query  451   SITFTYYSRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLG  630
              +TFTYYS DG+QGFPG++   VTY I     KL VKM AK LNK TPVNLA H YWNLG
Sbjct  180   HVTFTYYSFDGEQGFPGNLQVSVTYMII-GTNKLGVKMEAKPLNKATPVNLALHTYWNLG  238

Query  631   GHDSGNILSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG  810
             GH SG+ILS  LQ+F   ITPVD  LIPTG+I  +  T +DFL+P ++GS + +LP    
Sbjct  239   GHSSGDILSHTLQLFGSSITPVDDELIPTGKIDPVQGTPYDFLQPHEIGSMLDQLPH---  295

Query  811   GFDINYAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSA  990
             G+D+NY +D       RK   VA V++ +SG  ME+    PGVQ YT+N L+  KGK   
Sbjct  296   GYDVNYVLDKSSPQHLRK---VAVVHESKSGRKMELWTNKPGVQVYTSNMLKSEKGKDGF  352

Query  991   VYESHAALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITF  1119
             VY ++A LCLETQGFPD+VNHPNFPS IV P +  KH +   F
Sbjct  353   VYSTYAGLCLETQGFPDSVNHPNFPSQIVNPGETCKHFMVFRF  395



>gb|EYU33340.1| hypothetical protein MIMGU_mgv1a009621mg [Erythranthe guttata]
Length=336

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 218/337 (65%), Gaps = 9/337 (3%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGR  306
             K + +  G   +KL+N+G  + SL++PDK+GKL D+VLG+DT+  Y + D   FG +VGR
Sbjct  5     KLFELNNGTIQLKLSNFGCTITSLLIPDKHGKLADVVLGFDTLDPYLKGDAPYFGCVVGR  64

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANR+   +F+L+G+HY L  N+  N+LHGG KG  KV W+V ++ +    SITF Y+SR
Sbjct  65    VANRVKDGKFSLDGVHYSLPINNPPNSLHGGHKGFDKVIWEVAEYNQGDSPSITFKYHSR  124

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PG V +        +   L ++M     NKPTP+NLAQH YWNL GH+SG IL 
Sbjct  125   DGEEGYPGSV-SFTATYTLTSKTTLTLEMEGVPENKPTPINLAQHTYWNLSGHNSGTILD  183

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
               +QI A HITPVD N IPTG+I  +  T FDF    ++GS++ ++     G+D NY +D
Sbjct  184   HTIQISANHITPVDQNSIPTGEITPVKGTPFDFTTESKIGSRIHEI---GIGYDHNYVLD  240

Query  838   GYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALC  1017
               D+  +   K  AK+ D  S   +++   APGVQFYTAN++  V GKG AVYE H A C
Sbjct  241   CGDE-KSNGLKHAAKLKDPISKRVLDLWTNAPGVQFYTANYVNGVIGKGGAVYEKHGAAC  299

Query  1018  LETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             LETQGFP+A+N PNFPS +V P + YKH++   F  +
Sbjct  300   LETQGFPNAINQPNFPSVVVRPGEKYKHSMLFEFSAE  336



>dbj|BAJ88499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 214/333 (64%), Gaps = 9/333 (3%)
 Frame = +1

Query  142   IKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN-FGAIVGRVANR  318
             +  G    +++N GA V SL++PDKNG L D+VLG+D++  Y    +  FG IVGRVANR
Sbjct  111   LDNGRIRARISNVGAAVTSLLVPDKNGALADVVLGFDSLDPYLNGTSPYFGCIVGRVANR  170

Query  319   IGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKV---KKHEESSITFTYYSRDGDQ  489
             I   +FTLNG+ Y L  N+  NTLHGG KG  KV W+V    K +  SIT  Y+S+DG++
Sbjct  171   IKDGKFTLNGVQYSLGINNPPNTLHGGFKGFDKVIWEVIEYNKGKTPSITLKYHSKDGEE  230

Query  490   GFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILSEKLQ  669
             G+PGDV     Y++  +  +L ++M A  LNK TP++LAQH YWNL GHDSG++L+  +Q
Sbjct  231   GYPGDVSVTARYSLPSS-MELKLEMEAAPLNKATPISLAQHTYWNLAGHDSGDVLAHSIQ  289

Query  670   IFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVDGYDD  849
             I    ITPVD   IPTG+ + ++ T FDFL   ++G ++ ++P   GG+D NY +D   +
Sbjct  290   IRGSQITPVDQISIPTGEFMQVSGTPFDFLTEAEIGERIGQVP---GGYDHNYVLDSSRE  346

Query  850   VGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAALCLETQ  1029
               +  +  VAKV D  S   + I + APGVQFYT N L  + GKG AVY  HA LCLETQ
Sbjct  347   AKSSLRH-VAKVTDPSSFRVLNIWSDAPGVQFYTGNFLGGIVGKGGAVYGKHAGLCLETQ  405

Query  1030  GFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             GFP+AVN PNFPS IV P + Y HT+   F  +
Sbjct  406   GFPNAVNQPNFPSVIVHPGEKYTHTMLFEFSTK  438



>ref|XP_004235803.1| PREDICTED: aldose 1-epimerase [Solanum lycopersicum]
Length=335

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/339 (47%), Positives = 216/339 (64%), Gaps = 14/339 (4%)
 Frame = +1

Query  130   KFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQD-DTNFGAIVGR  306
             K   +  G   VK++N G  + SL +PDK+G L D+VLG+DT+  Y++     FG IVGR
Sbjct  5     KIIELNNGSMQVKVSNLGCTILSLSVPDKDGNLGDVVLGFDTLEPYQKGLAPYFGCIVGR  64

Query  307   VANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHEES---SITFTYYSR  477
             VANRI   +F+LNG+ Y L  N   N+LHGG KG  KV W+V +H+E    SITFTY+ R
Sbjct  65    VANRIRDGKFSLNGVDYSLPINRPPNSLHGGHKGFDKVVWEVAEHKEGEHPSITFTYHCR  124

Query  478   DGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNILS  657
             DG++G+PGD+    TYT+      L + M A   NK TPV+LAQH YWNLGGH+SG+IL+
Sbjct  125   DGEEGYPGDLSVTATYTLTSK-TTLRLDMEAVPANKATPVSLAQHTYWNLGGHNSGDILN  183

Query  658   EKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYAVD  837
                QI+A HITPVD   +PTG+I+ +  T FDF   +Q+G  + ++     G+D NY +D
Sbjct  184   NTAQIWANHITPVDQYTVPTGEIMPVKGTPFDFTSEKQIGRDIQQV---GLGYDHNYVLD  240

Query  838   GYDDVGTRKK--KTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHAA  1011
                  G +K   K  AK+ D +S   +++   APG+QFYTAN++  V GKG AVY  HA 
Sbjct  241   ----CGDKKDGLKHAAKIKDPKSSRVLDLWTNAPGMQFYTANYVDGVVGKGGAVYNKHAG  296

Query  1012  LCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRVQ  1128
             +CLETQGFP+A+N PNFPS +V P   Y H +   F V+
Sbjct  297   VCLETQGFPNAINTPNFPSIVVQPGDKYIHNMVYEFSVE  335



>gb|ABK21947.1| unknown [Picea sitchensis]
Length=383

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 215/340 (63%), Gaps = 12/340 (4%)
 Frame = +1

Query  133   FYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTN---FGAIVG  303
             F+ ++KGD  + +TN+GA + SL LPD  G + D+ LGYD++  Y    +     GAI+G
Sbjct  44    FFHLQKGDLHINVTNWGATLVSLTLPDAKGHIADVALGYDSLASYMNVSSTRPYLGAILG  103

Query  304   RVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKHE---ESSITFTYYS  474
             RV+NR+  AQF LNG  Y L  NDGNNTLHGG +G   V WKVK++      S+ FTY+S
Sbjct  104   RVSNRVKNAQFMLNGETYHLPKNDGNNTLHGGLRGFDNVLWKVKEYRGGRRPSVKFTYHS  163

Query  475   RDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSG-NI  651
              DG+QGFPGD+   VTYTI  +  +L +   A   NK TPV+L  H YWNL GH+SG +I
Sbjct  164   FDGEQGFPGDLDVSVTYTISGD-MELRLDYEAIPRNKATPVSLTNHAYWNLAGHNSGRDI  222

Query  652   LSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSG--GFDIN  825
             L   ++I+A H TP D +LIPTGQIL +  T  DF K   VGS++ K+       GFD N
Sbjct  223   LDNSVKIWASHYTPTDDHLIPTGQILPVKGTPLDFRKETIVGSRINKVKSNEKPPGFDNN  282

Query  826   YAVDGYDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESH  1005
             Y +DG         K  A++ D  S   ME+ +TAPG+QFYT+N+L+D  GKG  +Y+ H
Sbjct  283   YVLDG--PKLKNGLKPAARMKDPWSSRVMEVWSTAPGMQFYTSNNLKDTVGKGGFLYKPH  340

Query  1006  AALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
              ALC ETQGFP+AVN PNFPS IV P Q Y+ T+   F V
Sbjct  341   TALCFETQGFPNAVNQPNFPSVIVKPGQIYRQTMLYKFSV  380



>ref|NP_001149545.1| aldose 1-epimerase precursor [Zea mays]
 gb|ACG35785.1| aldose 1-epimerase [Zea mays]
Length=367

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 214/339 (63%), Gaps = 11/339 (3%)
 Frame = +1

Query  121   QDNKFYVIKKGDFSVKLTNYGARVASLILPDKNGKLTDIVLGYDTVMEYEQDDTNFGAIV  300
             Q   FY +++G+FS+ +TN+GA + S+ LPDKNG + D+VLGY  +  Y  D T FGA+V
Sbjct  34    QSLGFYELRRGEFSMVVTNWGATILSVRLPDKNGHIDDVVLGYKNIGSYVNDTTYFGALV  93

Query  301   GRVANRIGGAQFTLNGIHYKLNANDGNNTLHGGPKGISKVYWKVKKH---EESSITFTYY  471
             GRVANRI G +FT+    Y    NDGNNTLHGG +G ++V+W V++    E   ITF Y 
Sbjct  94    GRVANRIAGGRFTIRDHAYHTYRNDGNNTLHGGHRGFNQVFWSVRERVTGEFPHITFAYR  153

Query  472   SRDGDQGFPGDVIAHVTYTIKENPYKLIVKMNAKALNKPTPVNLAQHNYWNLGGHDSGNI  651
             S DG+QGFPG++   VTY I +      V M A+ L+KPTPVNLAQH YWNL GH +G +
Sbjct  154   SYDGEQGFPGNLDVLVTYKI-DGDCSYSVTMYARPLDKPTPVNLAQHTYWNLRGHGNGTV  212

Query  652   LSEKLQIFAYHITPVDSNLIPTGQILLINNTAFDFLKPQQVGSQMAKLPKGSGGFDINYA  831
             L   +QIFA  +TPV   LIPTG +  +  T F F      G+ +A++    GG+DIN  
Sbjct  213   LRHAVQIFASAVTPVGRGLIPTGAVTPVAGTPFXFRAXSAPGAHIAEV---EGGYDINXV  269

Query  832   VDG-YDDVGTRKKKTVAKVYDERSGIGMEIKATAPGVQFYTANHLQDVKGKGSAVYESHA  1008
             +DG  D  G RK   VA V +  SG  ME+ A  PG+QFYT N L+  +GKG AVY  +A
Sbjct  270   LDGETDGQGVRK---VAVVSEADSGRVMELWADQPGLQFYTGNMLKGDEGKGGAVYPKYA  326

Query  1009  ALCLETQGFPDAVNHPNFPSTIVTPQQPYKHTLHITFRV  1125
              +CLETQ +PDAV+ P FP+ +  P Q YKH +   F +
Sbjct  327   GMCLETQDYPDAVHEPAFPAEVYRPGQLYKHYMLYKFSI  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273381520216