BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24493_g2_i1 len=362 path=[1:0-195 197:196-244 4472:245-337
904:338-361]

Length=362
                                                                      Score     E

ref|XP_007039329.1|  Subtilase family protein                         70.5    1e-11   
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5       70.9    2e-11   
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3       69.7    4e-11   
ref|XP_010436973.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  69.7    4e-11   
ref|XP_010436981.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  69.3    5e-11   
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3       68.9    7e-11   
ref|XP_006397045.1|  hypothetical protein EUTSA_v10028448mg           68.9    7e-11   
ref|NP_564413.2|  subtilase family protein                            68.9    8e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAD03430.1|  similar to the subtilase family of serine proteas...  68.9    8e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...  68.9    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567361.1|  Subtilase family protein                            68.6    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437025.1|  PREDICTED: subtilisin-like protease SBT3.5       68.2    1e-10   
ref|XP_002874634.1|  subtilase family protein                         68.2    1e-10   
ref|XP_002891021.1|  predicted protein                                68.2    1e-10   
emb|CDX99526.1|  BnaC09g24660D                                        68.2    1e-10   
ref|NP_564414.2|  Subtilase family protein SBT3.3                     68.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                  68.2    2e-10   
gb|AAD03438.1|  similar to the subtilase family of serine proteas...  67.4    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567358.1|  Subtilase family protein                            67.4    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.4    2e-10   
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.4    3e-10   
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.4    3e-10   
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  67.0    3e-10   
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5       67.0    3e-10   
ref|XP_002891022.1|  subtilase family protein                         67.0    3e-10   
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg           67.0    3e-10   
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg           67.0    3e-10   
emb|CDX86874.1|  BnaA09g22640D                                        67.0    3e-10   
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...  67.0    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478713.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  66.6    4e-10   
ref|XP_002874635.1|  subtilase family protein                         66.6    4e-10   
gb|AAD03431.1|  similar to the subtilase family of serine proteas...  66.2    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg           66.2    7e-10   
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg           66.2    7e-10   
ref|NP_001190697.1|  subtilisin-like protease                         66.2    7e-10   
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg           66.2    7e-10   
emb|CAB40021.1|  subtilisin-like protease-like protein                65.9    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567362.1|  subtilisin-like protease                            65.9    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078370.1|  subtilisin-like protease                         65.9    9e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49641.1|  BnaCnng17930D                                        65.9    9e-10   
dbj|BAE98849.1|  subtilisin-like protease -like protein               65.9    9e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                  65.9    9e-10   
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479           65.5    9e-10   
emb|CDX93808.1|  BnaA09g24080D                                        65.5    1e-09   
ref|XP_010434150.1|  PREDICTED: subtilisin-like protease SBT3.3       63.2    1e-09   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3       65.5    1e-09   
emb|CDX94251.1|  BnaC02g29110D                                        65.5    1e-09   
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg           65.5    1e-09   
ref|XP_002872521.1|  predicted protein                                65.5    1e-09   
ref|XP_002872522.1|  subtilase family protein                         65.5    1e-09   
ref|NP_567360.1|  Subtilase family protein                            65.1    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  65.1    1e-09   
ref|XP_010449026.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  64.7    1e-09   
ref|NP_567359.1|  Subtilase family protein                            65.1    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3       65.1    2e-09   
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg           65.1    2e-09   
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  64.7    2e-09   
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3       64.7    2e-09   
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5       64.7    2e-09   
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3       64.7    2e-09   
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg           64.7    2e-09   
emb|CDY07491.1|  BnaA07g25700D                                        64.7    2e-09   
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5       64.3    2e-09   
ref|XP_002867836.1|  subtilase family protein                         64.3    2e-09   
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg           64.3    2e-09   
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg           64.3    2e-09   
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg           64.3    3e-09   
ref|XP_010099424.1|  Subtilisin-like protease                         63.5    3e-09   
emb|CDX93811.1|  BnaA09g24110D                                        64.3    3e-09   
ref|XP_010434151.1|  PREDICTED: subtilisin-like protease SBT3.3       63.2    3e-09   
ref|XP_008392653.1|  PREDICTED: subtilisin-like protease              63.9    3e-09   
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3       64.3    3e-09   
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3       64.3    3e-09   
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  64.3    3e-09   
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                  64.3    3e-09   
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.9    4e-09   
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg           63.9    4e-09   
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg           63.9    4e-09   
emb|CDY25259.1|  BnaA02g21970D                                        63.9    4e-09   
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.9    4e-09   
emb|CDX91186.1|  BnaC02g04110D                                        63.9    4e-09   
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4       63.9    4e-09   
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    4e-09   
emb|CDX93810.1|  BnaA09g24100D                                        63.5    4e-09   
emb|CDX84657.1|  BnaA03g15730D                                        63.5    5e-09   
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3       63.5    5e-09   
ref|XP_006413792.1|  hypothetical protein EUTSA_v10024501mg           63.5    5e-09   
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.5    6e-09   
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3       63.2    6e-09   
ref|XP_002867838.1|  subtilase family protein                         63.2    6e-09   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  63.2    6e-09   
emb|CDY54842.1|  BnaC05g51310D                                        63.5    6e-09   
emb|CDY67954.1|  BnaAnng25710D                                        63.2    6e-09   
ref|XP_010437012.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  63.2    7e-09   
emb|CDX98693.1|  BnaA03g44780D                                        63.2    7e-09   
emb|CDX82843.1|  BnaC01g12930D                                        63.2    7e-09   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  63.2    7e-09   
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  62.8    8e-09   
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g           62.8    8e-09   Populus trichocarpa [western balsam poplar]
emb|CDY65868.1|  BnaAnng21170D                                        62.4    1e-08   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                  62.8    1e-08   
dbj|BAD94221.1|  subtilisin proteinase like protein                   59.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564412.1|  Subtilase 3.5                                       62.4    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3       62.4    1e-08   
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg           62.4    1e-08   
emb|CAB87667.1|  subtilisin-like protease-like protein                62.4    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568255.1|  Subtilase family protein                            62.4    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3       62.4    1e-08   
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3       62.4    1e-08   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  62.0    2e-08   
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3       61.6    2e-08   
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3       61.6    2e-08   
ref|XP_002867837.1|  subtilase family protein                         61.6    2e-08   
emb|CDX94044.1|  BnaC07g36780D                                        61.6    2e-08   
ref|XP_002891020.1|  subtilase family protein                         61.2    3e-08   
ref|XP_004309572.1|  PREDICTED: subtilisin-like protease-like         61.2    3e-08   
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg           61.2    3e-08   
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4       61.2    3e-08   
ref|XP_002317663.1|  subtilase family protein                         61.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3       61.2    3e-08   
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3       61.2    3e-08   
emb|CDX79081.1|  BnaA01g11480D                                        61.2    3e-08   
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  61.2    3e-08   
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease              60.8    3e-08   
ref|NP_567632.1|  Subtilase family protein                            60.8    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  60.8    4e-08   
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  60.8    4e-08   
emb|CDX98690.1|  BnaA03g44750D                                        60.8    4e-08   
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3       60.8    5e-08   
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5       60.8    5e-08   
emb|CDX94043.1|  BnaC07g36770D                                        60.8    5e-08   
ref|XP_010436465.1|  PREDICTED: subtilisin-like protease SBT3.5       60.5    5e-08   
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                  60.5    5e-08   
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3       60.5    5e-08   
ref|XP_010445236.1|  PREDICTED: subtilisin-like protease SBT3.5       60.5    5e-08   
gb|ACN35690.1|  unknown                                               58.9    6e-08   Zea mays [maize]
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg           60.5    6e-08   
emb|CBI23066.3|  unnamed protein product                              60.1    6e-08   
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5       60.1    7e-08   Vitis vinifera
ref|XP_002871506.1|  subtilase family protein                         60.1    8e-08   
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg           60.1    8e-08   
emb|CDY61569.1|  BnaCnng38020D                                        60.1    8e-08   
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  59.7    9e-08   
ref|XP_010538683.1|  PREDICTED: subtilisin-like protease SBT3.5       59.7    9e-08   
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  59.7    1e-07   
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  59.7    1e-07   
ref|NP_567633.2|  Subtilase family protein                            59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36809.1|  subtilisin proteinase-like                           59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24366.1|  subtilisin proteinase-like                            59.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538146.1|  PREDICTED: subtilisin-like protease SBT3.5       59.3    1e-07   
ref|XP_002893748.1|  hypothetical protein ARALYDRAFT_336380           57.0    1e-07   
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg           59.3    1e-07   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor   58.9    2e-07   Zea mays [maize]
gb|AID21628.1|  At4g21326p-like protein                               58.5    2e-07   
gb|KFK41045.1|  hypothetical protein AALP_AA2G078300                  58.5    2e-07   
gb|AID21678.1|  At4g21326p-like protein                               58.5    2e-07   
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg           58.5    2e-07   
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3       58.2    3e-07   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3       58.2    3e-07   
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                   58.2    3e-07   
gb|KFK41050.1|  hypothetical protein AALP_AA2G078900                  58.2    3e-07   
ref|XP_004309569.1|  PREDICTED: subtilisin-like protease SDD1-like    58.2    3e-07   
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...  58.2    3e-07   
emb|CBI23085.3|  unnamed protein product                              58.2    4e-07   
ref|XP_010449086.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  58.2    4e-07   
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  57.8    4e-07   
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  57.8    4e-07   
ref|XP_010104913.1|  Subtilisin-like protease                         57.8    4e-07   
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg           57.8    5e-07   
ref|NP_567625.4|  subtilase 3.12                                      57.4    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5       57.4    5e-07   
emb|CAA20197.1|  putative protein                                     57.8    6e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CBI23086.3|  unnamed protein product                              57.4    6e-07   
ref|XP_002869894.1|  hypothetical protein ARALYDRAFT_329472           57.4    6e-07   
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5       57.0    7e-07   
ref|XP_006283179.1|  hypothetical protein CARUB_v10004209mg           57.0    7e-07   
gb|ADQ37345.1|  unknown                                               57.0    7e-07   
ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5       57.0    8e-07   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5       57.0    8e-07   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like    57.0    8e-07   
gb|ADQ37388.1|  unknown                                               57.0    8e-07   
ref|NP_193895.2|  Subtilase family protein                            56.6    9e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AID21685.1|  At4g21326p-like protein                               56.6    1e-06   
emb|CAB36808.1|  subtilisin-like protease                             56.6    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564869.1|  Subtilase-like protein                              56.6    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg              56.6    1e-06   
ref|XP_010474133.1|  PREDICTED: subtilisin-like protease SBT3.3       56.2    1e-06   
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3       56.2    1e-06   
gb|KHN12354.1|  Subtilisin-like protease                              53.1    1e-06   
gb|ABV21208.1|  At4g21326                                             55.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513580.1|  PREDICTED: subtilisin-like protease SBT3.3       55.8    2e-06   
emb|CDX94032.1|  BnaC07g36660D                                        55.8    2e-06   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760        55.5    2e-06   Sorghum bicolor [broomcorn]
emb|CDY49640.1|  BnaCnng17920D                                        55.1    3e-06   
gb|ADQ37356.1|  unknown                                               55.1    4e-06   
ref|XP_009348701.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  53.9    4e-06   
ref|XP_010439493.1|  PREDICTED: subtilisin-like protease SBT3.5       54.7    4e-06   
ref|XP_006283139.1|  hypothetical protein CARUB_v10004165mg           54.7    5e-06   
ref|XP_002518937.1|  Cucumisin precursor, putative                    54.7    5e-06   Ricinus communis
ref|XP_010495162.1|  PREDICTED: subtilisin-like protease SBT3.3       53.5    5e-06   
gb|AID21603.1|  At4g21326p-like protein                               54.7    5e-06   
gb|AID21581.1|  AT4G21326p                                            54.7    5e-06   
ref|XP_002887016.1|  subtilase family protein                         54.3    5e-06   
gb|AID21653.1|  At4g21326p-like protein                               54.3    5e-06   
emb|CCI61494.1|  unnamed protein product                              54.3    5e-06   
ref|XP_010434192.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  54.3    6e-06   
ref|XP_010434193.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  54.3    6e-06   
ref|XP_010456502.1|  PREDICTED: subtilisin-like protease SBT3.3       54.3    6e-06   
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3       54.3    6e-06   
gb|AID21686.1|  At4g21323p-like protein                               54.3    6e-06   
gb|AID21654.1|  At4g21323p-like protein                               54.3    6e-06   
emb|CDY07492.1|  BnaA07g25710D                                        54.3    6e-06   
ref|XP_002298973.2|  subtilase family protein                         53.9    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010449088.1|  PREDICTED: subtilisin-like protease SBT3.5       53.9    7e-06   
dbj|BAK05842.1|  predicted protein                                    53.9    7e-06   
gb|EMT21161.1|  Cucumisin                                             53.9    8e-06   
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048             53.9    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  53.9    9e-06   
ref|NP_564868.2|  Subtilisin-like serine endopeptidase family pro...  53.9    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AID21679.1|  At4g21323p-like protein                               53.9    9e-06   
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5       53.5    9e-06   
ref|XP_002888489.1|  subtilase family protein                         53.5    1e-05   
ref|XP_006377885.1|  hypothetical protein POPTR_0011s15430g           53.5    1e-05   
ref|NP_001169390.1|  putative subtilase family protein precursor      53.5    1e-05   Zea mays [maize]
gb|AEW09204.1|  hypothetical protein CL4686Contig1_05                 49.7    1e-05   
ref|XP_010419003.1|  PREDICTED: subtilisin-like protease SBT3.3       53.1    1e-05   
emb|CDY58475.1|  BnaA03g58460D                                        53.1    1e-05   
ref|XP_009137185.1|  PREDICTED: subtilisin-like protease SBT5.4       53.1    1e-05   
ref|XP_006413795.1|  hypothetical protein EUTSA_v10024459mg           53.1    1e-05   
ref|XP_004309570.1|  PREDICTED: subtilisin-like protease-like         53.1    2e-05   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g           52.8    2e-05   Populus trichocarpa [western balsam poplar]
gb|AID21602.1|  At4g21323p-like protein                               52.8    2e-05   
gb|AID21582.1|  AT4G21323p                                            52.4    2e-05   
ref|XP_006370728.1|  hypothetical protein POPTR_0001s45460g           51.6    2e-05   
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  52.4    2e-05   
gb|ADQ37368.1|  unknown                                               52.4    2e-05   
gb|AID21619.1|  At4g21323p-like protein                               52.4    3e-05   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5       52.4    3e-05   
gb|AID21627.1|  At4g21323p-like protein                               52.4    3e-05   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  52.4    3e-05   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  52.0    3e-05   
ref|XP_002873539.1|  hypothetical protein ARALYDRAFT_909167           51.6    3e-05   
ref|XP_010511549.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  52.0    4e-05   
emb|CCI61493.1|  unnamed protein product                              52.0    4e-05   
ref|NP_567624.1|  Subtilase family protein                            52.0    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5       52.0    4e-05   
ref|XP_009137186.1|  PREDICTED: subtilisin-like protease SBT5.3       51.6    4e-05   
ref|XP_010511550.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  51.6    4e-05   
emb|CDY70485.1|  BnaA03g58450D                                        51.6    4e-05   
ref|XP_007039203.1|  Subtilase family protein, putative               51.6    4e-05   
ref|XP_011079238.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  51.2    5e-05   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1         51.2    5e-05   
gb|EMT21267.1|  Subtilisin-like protease                              51.2    6e-05   
ref|XP_003629621.1|  Subtilisin-like protease                         51.2    7e-05   
gb|AET04097.2|  subtilisin-like serine protease                       51.2    7e-05   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g           51.2    7e-05   
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...  50.8    7e-05   
gb|EMS55531.1|  Subtilisin-like protease                              50.8    7e-05   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...  50.8    7e-05   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease              50.8    8e-05   
ref|XP_010931718.1|  PREDICTED: subtilisin-like protease SBT3.5       50.8    8e-05   
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...  50.8    8e-05   
ref|XP_008804316.1|  PREDICTED: subtilisin-like protease SBT5.4       50.8    9e-05   
ref|XP_008778788.1|  PREDICTED: subtilisin-like protease SBT5.4       50.1    9e-05   
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...  50.4    9e-05   
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478           50.1    1e-04   
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5       50.1    2e-04   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  50.1    2e-04   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...  50.1    2e-04   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5       49.7    2e-04   
gb|EAZ09847.1|  hypothetical protein OsI_32138                        49.7    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative    49.7    2e-04   Ricinus communis
ref|NP_001063751.1|  Os09g0530800                                     49.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AIC80773.1|  subtilase                                             49.7    2e-04   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1         49.7    2e-04   
ref|NP_001046523.1|  Os02g0271600                                     49.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like         49.7    2e-04   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3       49.3    2e-04   
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like        49.7    2e-04   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like         49.3    2e-04   
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  49.3    2e-04   
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  49.3    2e-04   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg           49.3    3e-04   
ref|XP_010663005.1|  PREDICTED: subtilisin-like protease SBT3.3       46.2    3e-04   
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661            48.9    4e-04   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  48.5    4e-04   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like         48.5    4e-04   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  48.5    4e-04   
ref|XP_006351094.1|  PREDICTED: cucumisin-like                        48.5    4e-04   
gb|EMT21268.1|  Subtilisin-like protease                              48.5    4e-04   
ref|XP_008674940.1|  PREDICTED: subtilisin-like protease SBT5.3       48.5    5e-04   
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g           48.5    5e-04   
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3       48.5    5e-04   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative    48.1    5e-04   
gb|EMS68678.1|  Subtilisin-like protease                              48.1    5e-04   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                    48.1    6e-04   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5       48.1    6e-04   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg           47.8    7e-04   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...  47.8    7e-04   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...  47.8    7e-04   
ref|XP_006357625.1|  PREDICTED: subtilisin-like protease-like         47.8    7e-04   
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg           47.8    7e-04   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                 47.8    8e-04   
emb|CAE76061.1|  B1248C03.20                                          47.8    8e-04   
gb|EEE60418.1|  hypothetical protein OsJ_13612                        47.8    8e-04   
ref|XP_010109770.1|  hypothetical protein L484_008446                 47.8    8e-04   
gb|EMS61069.1|  Subtilisin-like protease                              47.8    9e-04   
ref|XP_006653124.1|  PREDICTED: subtilisin-like protease-like         47.4    0.001   



>ref|XP_007039329.1| Subtilase family protein [Theobroma cacao]
 gb|EOY23830.1| Subtilase family protein [Theobroma cacao]
Length=512

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VEPP GITV+VTP+ L F+ + ++IS+ V++STS+  NTGYYFGSLTW DGV+NV I
Sbjct  437  KALVEPPFGITVTVTPNILVFHSTAQEISYQVRVSTSHQVNTGYYFGSLTWTDGVHNVAI  496

Query  181  PISVKTM  161
            PIS +T 
Sbjct  497  PISARTQ  503



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
             KVMVEPP GI V+V+P TL FN + K+ SF V++ST++  NTGYYFGSLTW+D  +NV I
Sbjct  1458  KVMVEPPLGIQVTVSPETLVFNSTTKRASFKVRVSTTHKINTGYYFGSLTWSDSEHNVTI  1517

Query  181   PISVKTM  161
             P+SV+T 
Sbjct  1518  PLSVRTQ  1524


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND  203
            +V VEPP G  V+VTP TL F    K++SF V+IST++  NTGYYFGSLTW+D
Sbjct  703  RVKVEPPLGFQVTVTPKTLVFKAKTKRVSFKVRISTTHKINTGYYFGSLTWSD  755



>ref|XP_010470055.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=750

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KVM++PP G++++VTP TL FN + K +SF V++ST++  NTGYYFGSLTW D V+NV I
Sbjct  675  KVMIDPPIGVSMTVTPYTLEFNSTTKNVSFKVRVSTTHKVNTGYYFGSLTWTDSVHNVVI  734

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  735  PVSVRTQ  741



>ref|XP_010436973.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=758

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KVM++PP GI+++VTP TL FN + K +SF V++ST +  NTGYYFGSLTW D ++NV I
Sbjct  683  KVMIDPPIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKVNTGYYFGSLTWTDNLHNVVI  742

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  743  PVSVRTQ  749



>ref|XP_010436981.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=667

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KVM++PP GI+++VTP TL FN + K +SF V++ST +  NTGYYFGSLTW D ++NV I
Sbjct  592  KVMIDPPIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKVNTGYYFGSLTWTDNLHNVVI  651

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  652  PVSVRTQ  658



>ref|XP_010421968.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=759

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KVM++PP G++++VTP TL F+ + K +SF V++ST +  NTGYYFGSLTW D V+NV I
Sbjct  684  KVMIDPPIGVSMTVTPDTLEFSSTTKIVSFKVRVSTRHKVNTGYYFGSLTWTDSVHNVVI  743

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  744  PVSVRTQ  750



>ref|XP_006397045.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
 gb|ESQ38498.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
Length=777

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G  V+VTP TL FN + K++SF V +ST++  NTGYYFGSLTW+D V++V I
Sbjct  702  KVAVEPPLGFQVTVTPETLVFNSATKRVSFQVTVSTTHKINTGYYFGSLTWSDSVHDVTI  761

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  762  PLSVRTQ  768



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP GI V VTP TL FN   K +SF+V +ST++  NTG+YFGSLTW D ++NV I
Sbjct  698  KVLVEPPLGIQVVVTPETLVFNSKTKSVSFTVIVSTTHKINTGFYFGSLTWTDSIHNVVI  757

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  758  PVSVRTQ  764



>gb|AAD03430.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 47.5, E=3.8e-12, n=2) [Arabidopsis thaliana]
Length=685

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++EPP GI V+VTP TL FN + K++SF VK+ST++  NTGY+FGSLTW+D ++NV I
Sbjct  610  KVVIEPPIGIQVTVTPETLLFNSTTKRVSFKVKVSTTHKINTGYFFGSLTWSDSLHNVTI  669

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  670  PLSVRTQ  676



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP GI V VTP TL FN   K +SF+V +ST++  NTG+YFGSLTW D ++NV I
Sbjct  688  KVLVEPPLGIQVVVTPETLVFNSKTKSVSFTVIVSTTHKINTGFYFGSLTWTDSIHNVVI  747

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  748  PVSVRTQ  754



>ref|NP_567361.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40047.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78177.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82895.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++EPP GI V+VTP TL FN + K++SF VK+ST++  NTGY+FGSLTW+D ++NV I
Sbjct  700  KVVIEPPIGIQVTVTPETLLFNSTTKRVSFKVKVSTTHKINTGYFFGSLTWSDSLHNVTI  759

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  760  PLSVRTQ  766



>ref|XP_010437025.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=778

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
            V VEPP GI V+VTP TL FN + K+ SF V++ST++  NTGYYFGSLTW+D ++NV IP
Sbjct  704  VTVEPPLGIQVTVTPETLVFNSTTKRASFKVRVSTTHKINTGYYFGSLTWSDSLHNVTIP  763

Query  178  ISVKTM  161
            +SV+T 
Sbjct  764  LSVRTQ  769



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++EPP G+ V+VTP TL FN + K++SF V++ST +  NTGY+FGSLTW+D ++NV I
Sbjct  706  KVVIEPPLGVVVTVTPETLVFNSTTKRVSFKVRVSTKHKINTGYFFGSLTWSDSLHNVTI  765

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  766  PLSVRTQ  772



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V+VTP+TL FN   K +SF V++ST +  NTGY FGSLTW D V+NV I
Sbjct  699  KVVVEPPLGVRVAVTPATLVFNSKTKSVSFRVRVSTKHKINTGYLFGSLTWTDSVHNVVI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PVSVRTQ  765



>emb|CDX99526.1| BnaC09g24660D [Brassica napus]
Length=753

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V+VTP TL FN + KK+SF V++S ++  NTGYYFGSLTW+D V+NV I
Sbjct  678  KVAVEPPFGVQVTVTPETLVFNSTNKKVSFQVRVSATHKTNTGYYFGSLTWSDYVHNVTI  737

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  738  PLSVRTQ  744



>ref|NP_564414.2| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
 sp|Q9MAP5.1|SBT33_ARATH RecName: Full=Subtilisin-like protease SBT3.3; AltName: Full=Subtilase 
subfamily 3 member 3; Short=AtSBT3.3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31276.1|AC006424_5 Third of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAM20591.1| subtilase, putative [Arabidopsis thaliana]
 gb|AAQ56790.1| At1g32960 [Arabidopsis thaliana]
 gb|AEE31544.1| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
Length=777

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V VTP TL FN     +SF+V++ST++  NTGYYFGSLTW D V+NV I
Sbjct  702  KVSVEPPLGVRVVVTPETLVFNSKTISVSFTVRVSTTHKINTGYYFGSLTWTDSVHNVVI  761

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  762  PLSVRTQ  768



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V+VTP TL FN + K+ SF+ ++ST +  NTG+YFGSL W D V+NV I
Sbjct  701  KVVVEPPLGVRVAVTPETLVFNSTTKRASFTARVSTIHKINTGFYFGSLIWTDSVHNVTI  760

Query  181  PISVKT  164
            P+SV+T
Sbjct  761  PVSVRT  766



>gb|AAD03438.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=49.7, E=9.2e-13, n=3) [Arabidopsis thaliana]
Length=774

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + K++SF V +ST++  NTGYYFGSLTW+D ++NV I
Sbjct  699  RVAVEPPLGTQVTVTPETLVFNSTTKRVSFKVSVSTTHKINTGYYFGSLTWSDSLHNVTI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PLSVRTQ  765



>ref|NP_567358.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40044.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78174.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82892.1| Subtilase family protein [Arabidopsis thaliana]
Length=765

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + K++SF V +ST++  NTGYYFGSLTW+D ++NV I
Sbjct  690  RVAVEPPLGTQVTVTPETLVFNSTTKRVSFKVSVSTTHKINTGYYFGSLTWSDSLHNVTI  749

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  750  PLSVRTQ  756



>ref|XP_010529681.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Tarenaya 
hassleriana]
Length=704

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ + V P TL FNP  +++SF+V++STS+  NTG+YFGSLTW D V+NV I
Sbjct  629  KVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAI  688

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  689  PVSVRTQ  695



>ref|XP_010529680.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ + V P TL FNP  +++SF+V++STS+  NTG+YFGSLTW D V+NV I
Sbjct  632  KVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAI  691

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  692  PVSVRTQ  698



>ref|XP_010529679.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Tarenaya 
hassleriana]
Length=717

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ + V P TL FNP  +++SF+V++STS+  NTG+YFGSLTW D V+NV I
Sbjct  642  KVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAI  701

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  702  PVSVRTQ  708



>ref|XP_010478712.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=771

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTPSTL FN   +K+SF V++ T++  NTGYYFGSLTW D V+NV I
Sbjct  696  KAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTGYYFGSLTWTDSVHNVVI  755

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  756  PLSVRTQ  762



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTPSTL FN   +K+SF V++ T++  NTGYYFGSLTW D V+NV I
Sbjct  696  KAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKVRVVTNHRVNTGYYFGSLTWTDSVHNVVI  755

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  756  PLSVRTQ  762



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V VTP TL FN   K +SF+V +ST++  NTG+YFGSLTW D V+NV I
Sbjct  699  KVAVEPPLGVRVVVTPETLVFNSKTKSVSFTVLVSTTHKINTGFYFGSLTWTDSVHNVVI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PLSVRTQ  765



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTPSTL FN   +K+SF +++ T++  NTGYYFGSLTW D V+NV I
Sbjct  696  KAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKIRVLTNHRVNTGYYFGSLTWTDSVHNVVI  755

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  756  PLSVRTQ  762



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KVM++ P G+ ++VTP+TL FN    K+SF V+ ST++  NTGYYFGSLTW D V+NV I
Sbjct  684  KVMIDAPLGVNMTVTPNTLEFNAMTTKVSFKVRFSTTHKVNTGYYFGSLTWTDNVHNVVI  743

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  744  PVSVRTQ  750



>emb|CDX86874.1| BnaA09g22640D [Brassica napus]
Length=747

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V+VTP TL FN + KK+SF V++ST++  NTGYYFGSLTW+D V+N  I
Sbjct  672  KVAVEPPLGVQVTVTPETLVFNSTNKKVSFKVRVSTTHKTNTGYYFGSLTWSDYVHNATI  731

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  732  PLSVRTQ  738



>ref|NP_174573.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AAF31279.1|AC006424_8 Fourth of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
 gb|AEE31545.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=734

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTPSTL FN   +K+SF V++ T+++ NTGYYFGSLTW D V+NV I
Sbjct  659  KPVIEAPMGVNVTVTPSTLVFNAYTRKLSFKVRVLTNHIVNTGYYFGSLTWTDSVHNVVI  718

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  719  PVSVRTQ  725



>ref|XP_010478713.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=645

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTPSTL FN   +K+SF V++ T++  NTGYYFGSLTW D V+NV I
Sbjct  570  KAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTGYYFGSLTWTDSVHNVVI  629

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  630  PLSVRTQ  636



>ref|XP_002874635.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50894.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G  V+VTP TL FN   K++SF VK+ST +  NTG+YFGSLTW+D ++NV I
Sbjct  699  KVAVEPPLGFKVTVTPETLVFNTRTKRVSFKVKVSTKHKINTGFYFGSLTWSDSMHNVTI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PLSVRTQ  765



>gb|AAD03431.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 45.8, E=1.1e-11, n=2) [Arabidopsis thaliana]
Length=751

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + KK+ F VK+ST++  NTGYYFGSLTW+D ++NV I
Sbjct  676  RVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTI  735

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  736  PLSVRTQ  742



>ref|XP_006397047.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
 gb|ESQ38500.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
Length=723

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VE P G+ V+VTP  L FN + K++SF VK+ST++  NTGYYFGSLTW+D V+NV I
Sbjct  648  KVAVEAPLGVQVTVTPEKLVFNSTTKRVSFKVKVSTTHKINTGYYFGSLTWSDSVHNVTI  707

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  708  PLSVRTQ  714



>ref|XP_006286454.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19352.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=754

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KVM++ P G+ + VTP+TL FN   +K+SF V++ T++  NTGYYFGSLTW D V+NV I
Sbjct  679  KVMIDAPIGVNMIVTPATLEFNSMTRKVSFKVRVLTTHKVNTGYYFGSLTWTDNVHNVVI  738

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  739  PVSVRTQ  745



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + KK+ F VK+ST++  NTGYYFGSLTW+D ++NV I
Sbjct  719  RVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTI  778

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  779  PLSVRTQ  785



>ref|XP_006306827.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
 gb|EOA39725.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
Length=769

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP GI V+VTP TL FN     + F+V++ST++  NTG+YFGSL W D ++NV I
Sbjct  694  KVVVEPPLGIRVAVTPETLVFNTKKISVPFTVRVSTTHKINTGFYFGSLMWTDSMHNVTI  753

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  754  PVSVRTQ  760



>emb|CAB40021.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
 emb|CAB78178.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=803

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + KK+ F VK+ST++  NTGYYFGSLTW+D ++NV I
Sbjct  728  RVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTI  787

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  788  PLSVRTQ  794



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + KK+ F VK+ST++  NTGYYFGSLTW+D ++NV I
Sbjct  703  RVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTI  762

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  763  PLSVRTQ  769



>ref|NP_001078370.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82897.1| subtilisin-like protease [Arabidopsis thaliana]
Length=722

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + KK+ F VK+ST++  NTGYYFGSLTW+D ++NV I
Sbjct  647  RVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTI  706

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  707  PLSVRTQ  713



>emb|CDY49641.1| BnaCnng17930D [Brassica napus]
Length=743

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP GI + V+P TL F P+ KKI+F+VK+ST++  NT Y+FGSLTW D GV+NVR
Sbjct  670  KAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTHRVNTDYHFGSLTWTDNGVHNVR  729

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  730  IPLSVRT  736



>dbj|BAE98849.1| subtilisin-like protease -like protein [Arabidopsis thaliana]
Length=722

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VEPP G  V+VTP TL FN + KK+ F VK+ST++  NTGYYFGSLTW+D ++NV I
Sbjct  647  RVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTI  706

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  707  PLSVRTQ  713



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V+VTP  L FN + K++SF+V++ST++  NTG+YFGSL W D V+NV I
Sbjct  666  KVVVEPPLGVRVAVTPEMLMFNSTTKRVSFTVRVSTTHKINTGFYFGSLIWTDSVHNVTI  725

Query  181  PISVKTM  161
            P+S++T 
Sbjct  726  PVSIRTQ  732



>ref|XP_002893749.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70008.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTP TL FN   +K+SF V++ T++  NTGYYFGSLTW D V+NV I
Sbjct  642  KAVIEAPMGVNVTVTPRTLVFNAKTRKLSFKVRVITNHRVNTGYYFGSLTWTDSVHNVVI  701

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  702  PVSVRTQ  708



>emb|CDX93808.1| BnaA09g24080D [Brassica napus]
Length=748

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K++SF V+ ST++  NTGYYFGSL W D V+NV I
Sbjct  673  KVVVEPPLGVRVVVTPKKLVFNSKTKRVSFKVRASTTHKINTGYYFGSLIWTDNVHNVTI  732

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  733  PVSVRTQ  739



>ref|XP_010434150.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=257

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL FN +  ++   SVK  TS+  NTGY+FGSLTW DGV+NV 
Sbjct  185  KAVIESPLGITLTVKPTTLVFNSAANRVLTFSVKAKTSHKVNTGYFFGSLTWTDGVHNVT  244

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  245  IPVSVKT  251



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K++SF V+ ST++  NTGYYFGSL W D V+NV I
Sbjct  699  KVVVEPPLGVRVVVTPKKLVFNSKTKRVSFKVRASTTHKINTGYYFGSLIWTDNVHNVTI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PVSVRTQ  765



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP GI V+V P  L FN   K +S+ V++ST +  NTG+YFGSLTW+D V+NV I
Sbjct  686  KVKVEPPLGIQVTVVPKKLVFNSKTKTLSYQVRVSTRHKINTGFYFGSLTWSDSVHNVII  745

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  746  PLSVRTQ  752



>ref|XP_006304869.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
 gb|EOA37767.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
Length=759

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++VEPP GI +SVTP+TL FN +VKK+SF V +ST++  N+ YYFGSLTW DG +NV I
Sbjct  686  KLVVEPPLGIKISVTPNTLLFNSNVKKLSFKVTVSTTHKANSIYYFGSLTWTDGSHNVTI  745

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  746  PLSVRTQ  752



>ref|XP_002872521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=766

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V VE P GI V+VTP TL FN + K +SF V++ST++  NTGYYFGSLTW+D ++NV I
Sbjct  691  RVAVELPLGIQVTVTPETLVFNSTTKGVSFKVRVSTTHKINTGYYFGSLTWSDSLHNVTI  750

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  751  PLSVRTQ  757



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ V+VTP+ L F+ +  K SF+V++ST++  NTGYYFGSLTW D ++NV I
Sbjct  662  KVVIDPPTGVNVAVTPTELVFDSTTTKRSFTVRVSTTHKVNTGYYFGSLTWTDNLHNVAI  721

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  722  PVSVRTQ  728



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ V+VTP+ L F+ +  K SF+V++ST++  NTGYYFGSLTW D ++NV I
Sbjct  672  KVVIDPPTGVNVAVTPTELVFDSTTTKRSFTVRVSTTHKVNTGYYFGSLTWTDTLHNVAI  731

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  732  PVSVRTQ  738



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTPS L FN   +K+SF V++ T++  NTGYYFGSLTW D V+NV I
Sbjct  696  KAVIEAPMGVNVNVTPSALVFNAKTRKLSFKVRVVTNHRVNTGYYFGSLTWTDSVHNVVI  755

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  756  PLSVRTQ  762



>ref|XP_010449026.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=471

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL FN +  ++   SV+  TS+  N+GY+FGSLTW DGV+NV 
Sbjct  399  KAVIESPLGITLTVKPTTLVFNSAANRVLTFSVQAKTSHKVNSGYFFGSLTWTDGVHNVT  458

Query  184  IPISVKTMY*VRIK  143
            IP+SVKT   +RIK
Sbjct  459  IPVSVKTK--IRIK  470



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP GI V+VTP+ L F+ +  K SF+V++ST++  NTGYYFGSLTW D ++NV I
Sbjct  681  KVVIDPPTGINVAVTPAELVFDYTTTKRSFTVRVSTTHKVNTGYYFGSLTWTDNMHNVAI  740

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  741  PVSVRTQ  747



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++ PP G+ ++V P+ L FNP  KK+SF+V +ST++  NTGYYFGSLTW D V+ V I
Sbjct  687  KVLINPPSGVRMTVKPNMLRFNPRTKKVSFTVTVSTTHKVNTGYYFGSLTWTDNVHRVVI  746

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  747  PVSVRTQ  753



>ref|XP_006399712.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
 gb|ESQ41165.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
Length=752

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++VEPP GI +SVTP+TL FN SVKK+S+ V +ST++  N+ YYFG LTW DG +NV I
Sbjct  679  KLVVEPPLGIKISVTPNTLQFNSSVKKLSYKVTVSTTHKANSIYYFGRLTWTDGSHNVTI  738

Query  181  PISVKT  164
            P+S++T
Sbjct  739  PLSIRT  744



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL FN +  ++   SV+  TS+  N+GY+FGSLTW DGV+NV 
Sbjct  703  KAVIESPLGITLTVKPTTLVFNSAANRVLTFSVQAKTSHKVNSGYFFGSLTWTDGVHNVT  762

Query  184  IPISVKTMY*VRIK  143
            IP+SVKT   +RIK
Sbjct  763  IPVSVKTK--IRIK  774



>ref|XP_009344070.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=699

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +EPP G  V V P+ L FN +V+K++F++ IS  +  NTGYYFGSLTW DGV+ VRI
Sbjct  623  KATIEPPFGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTGYYFGSLTWVDGVHAVRI  682

Query  181  PISVKTMY  158
            P+SVKT +
Sbjct  683  PLSVKTEF  690



>ref|XP_010463200.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++VEPP G+ +SVTP+TL FN +VKK+SF V +ST++  N+ YYFGSLTW DG +NV I
Sbjct  674  KLIVEPPLGVKISVTPNTLLFNSNVKKLSFKVTVSTTHKSNSIYYFGSLTWTDGSHNVTI  733

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  734  PLSVRTQ  740



>ref|XP_009105192.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP GI + V+P TL F P+ KKI+F+VK+ST++  NT Y+FGSLTW D G +NVR
Sbjct  686  KAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTHRVNTDYHFGSLTWTDNGAHNVR  745

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  746  IPLSVRT  752



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP TL FN   K +SF V++ST++  NTG++FGSL W D ++NV I
Sbjct  707  KVVVEPPFGVRVVVTPETLRFNSKTKSVSFKVRVSTTHKINTGFFFGSLIWTDSLHNVTI  766

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  767  PVSVRTQ  773



>emb|CDY07491.1| BnaA07g25700D [Brassica napus]
Length=759

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP GI + V+P TL F P+ KKI+F+VK+ST++  NT Y+FGSLTW D G +NVR
Sbjct  686  KAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTHRVNTDYHFGSLTWTDNGAHNVR  745

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  746  IPLSVRT  752



>ref|XP_010480961.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++VEPP G+ +SVTP+TL FN +VKKISF V +ST++  N+ YYFGSLTW DG +NV I
Sbjct  674  KLIVEPPLGVKISVTPNTLLFNSNVKKISFKVTVSTTHKSNSIYYFGSLTWTDGSHNVTI  733

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  734  PLSVRTQ  740



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++EPP GIT++V P+TL F  + K++   SVK  TS+  N+GY+FGSLTW DGV++V 
Sbjct  688  KAVIEPPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVI  747

Query  184  IPISVKTMY  158
            IP+SVKT Y
Sbjct  748  IPVSVKTRY  756



>ref|XP_006391365.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
 gb|ESQ28651.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
Length=791

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP+GI V VTP TL F  + KKI+F VK+ST++  NT Y FGSLTW D G +NVR
Sbjct  718  KALIEPPQGINVQVTPETLEFGSNAKKITFKVKVSTTHRTNTDYLFGSLTWTDNGAHNVR  777

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  778  IPLSVRT  784



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V+VEPP G  V+V P TL FN   K++SF V+IST++  NTGYYFGSLTW+D V+NV I
Sbjct  705  RVVVEPPLGFQVTVEPKTLVFNSQTKRVSFKVRISTTHKINTGYYFGSLTWSDSVHNVTI  764

Query  181  PISVKTM  161
             +SV+T 
Sbjct  765  HVSVRTQ  771



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+ V+VTP TL FN   KK+SF V++ T++  NTGYYFGSLTW D ++NV I
Sbjct  701  KAVIEAPMGVNVTVTPRTLVFNAKTKKLSFKVRVLTNHRVNTGYYFGSLTWTDSLHNVVI  760

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  761  PLSVRTQ  767



>ref|XP_010099424.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB78386.1| Subtilisin-like protease [Morus notabilis]
Length=394

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +V+PP+GI +SV P  L FN +   ISF+V +S+++   TGYYFGSLTW DGV+ V  
Sbjct  323  KAVVKPPQGIRISVRPRLLTFNATNNTISFTVAVSSTHRVTTGYYFGSLTWTDGVHTVNS  382

Query  181  PISVKT  164
            PISV+T
Sbjct  383  PISVRT  388



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K +SF V++ST +  NTG+YFGSL W D V+NV I
Sbjct  677  KVVVEPPLGVRVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFYFGSLIWRDSVHNVTI  736

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  737  PVSVRTQ  743



>ref|XP_010434151.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=374

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL FN +  ++   SVK  TS+  NTGY+FGSLTW DGV+NV 
Sbjct  304  KAVIESPLGITLTVNPTTLVFNSAANRVLTFSVKAKTSHKVNTGYFFGSLTWTDGVHNVT  363

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  364  IPVSVKT  370



>ref|XP_008392653.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=499

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +EPP G  V V P+ L FN +V+K++F++ IS  +  NTGYYFGSLTW DGV+ VRI
Sbjct  421  KATIEPPFGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTGYYFGSLTWVDGVHAVRI  480

Query  181  PISVKTMY  158
            P+SV+T +
Sbjct  481  PLSVRTEF  488



>ref|XP_009128710.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=764

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++ PP G+ V VTP+T  FN +  K+SF+V+++T++  NTGY+FGSLTW+D ++NV I
Sbjct  689  KVVINPPTGVNVGVTPTTFVFNSTATKLSFTVRVTTTHRVNTGYFFGSLTWSDNMHNVAI  748

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  749  PLSVRTQ  755



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K +SF V++ST +  NTG+YFGSL W D V+NV I
Sbjct  699  KVVVEPPLGVRVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFYFGSLIWRDSVHNVTI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PVSVRTQ  765



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V+++PP G+ ++V P  L FN   K I+F V +S+++  NTGYYFGSLTW DGV+ VR 
Sbjct  709  RVVIQPPIGVVITVNPDVLVFNSMTKSITFKVTVSSTHHVNTGYYFGSLTWTDGVHEVRS  768

Query  181  PISVKT  164
            P+SV+T
Sbjct  769  PLSVRT  774


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
             K M+EPP GI V+V P  L FN      +  V++ST++  NTGYYFGSLTW DGV+ V  
Sbjct  1418  KAMIEPPLGIPVTVRPDILVFN-----STXQVEVSTAHQVNTGYYFGSLTWMDGVHTVSS  1472

Query  181   PISVKTM  161
             PISV+T 
Sbjct  1473  PISVRTQ  1479



>gb|KFK31852.1| hypothetical protein AALP_AA6G166800 [Arabis alpina]
Length=1462

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  358   VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
             V+++PP GI V+VTP+TL FN + +K+SF+V++ST++  NTGYYFGSL+W D +++V IP
Sbjct  1388  VVIDPPTGINVTVTPTTLVFNSTTRKLSFTVRVSTTHKVNTGYYFGSLSWTDNLHDVAIP  1447

Query  178   ISVKTM  161
             +SV+T 
Sbjct  1448  VSVRTQ  1453



>ref|XP_010529409.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Tarenaya 
hassleriana]
Length=761

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + ++EPP GI V  TP  L F+   K+++F VKIST +  NTGY FGSLTW DGV++VRI
Sbjct  689  EAVIEPPLGINVEATPKKLVFDSRNKRVTFVVKISTRHEVNTGYLFGSLTWTDGVHDVRI  748

Query  181  PISVKT  164
            P+SV+T
Sbjct  749  PLSVRT  754



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V V P TL FN   K++SF+V++ST++  NTG+YFGSLTW D V+NV I
Sbjct  695  KVVVEPPLGVIVVVKPETLVFNSKFKRVSFTVRVSTTHKTNTGFYFGSLTWTDSVHNVII  754

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  755  PVSVRTQ  761



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ V VTP+ L FN +  K+SF+VK+ST++  NTGY+FGSLTW D ++NV I
Sbjct  689  KVVIDPPMGVNVIVTPTKLVFNSTATKLSFTVKVSTTHKVNTGYFFGSLTWTDNLHNVAI  748

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  749  PVSVRTQ  755



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++ PP G+ V VTP+T  FN +  K+SF+V+++T++  NTGY+FGSLTW+D ++NV I
Sbjct  667  KVVINPPTGVNVGVTPTTFVFNSTATKLSFTVRVTTTHRVNTGYFFGSLTWSDNMHNVAI  726

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  727  PLSVRTQ  733



>ref|XP_010529408.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Tarenaya 
hassleriana]
Length=765

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + ++EPP GI V  TP  L F+   K+++F VKIST +  NTGY FGSLTW DGV++VRI
Sbjct  693  EAVIEPPLGINVEATPKKLVFDSRNKRVTFVVKISTRHEVNTGYLFGSLTWTDGVHDVRI  752

Query  181  PISVKT  164
            P+SV+T
Sbjct  753  PLSVRT  758



>emb|CDX91186.1| BnaC02g04110D [Brassica napus]
Length=760

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++V+PP G+ +SVTP TL FN  VKK+S+ V +ST++  N+ Y+FGSLTW DG++NV I
Sbjct  687  KLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHKANSIYFFGSLTWTDGIHNVVI  746

Query  181  PISVKTM  161
            P+S++T 
Sbjct  747  PLSIRTQ  753



>ref|XP_009125836.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++V+PP G+ +SVTP TL FN  VKK+S+ V +ST++  N+ Y+FGSLTW DG++NV I
Sbjct  687  KLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHKANSIYFFGSLTWTDGIHNVVI  746

Query  181  PISVKTM  161
            P+S++T 
Sbjct  747  PLSIRTQ  753



>ref|XP_009137200.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=766

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++VTP+TL F+ + K++    VK  TS+  NTGY+FGSLTW DGV++V+
Sbjct  694  KAVIESPLGITLTVTPNTLVFSSAAKRVLTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVK  753

Query  184  IPISVKTMY*VRI  146
            IP+SV+T   +++
Sbjct  754  IPVSVQTKIMIKV  766



>emb|CDX93810.1| BnaA09g24100D [Brassica napus]
Length=750

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K +SF+V++ST++  NTGYYFGSL W+D V  V I
Sbjct  675  KVVVEPPLGVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGYYFGSLVWSDSVRKVTI  734

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  735  PVSVRTQ  741



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP GI + V+P TL F P+ KKI+F+VK+ST++ +NT Y FGSLTW D G +NVR
Sbjct  686  KAVIEPPLGIKLQVSPETLKFGPNTKKITFTVKVSTTHRWNTDYLFGSLTWTDNGAHNVR  745

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  746  IPLSVRT  752



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G+T++V P+TL FN +  ++   SVK  TS+  NTGY+FGSLTW DGV+NV 
Sbjct  803  KAVIESPLGVTLTVKPTTLVFNSAANRVLTFSVKAKTSHKVNTGYFFGSLTWTDGVHNVT  862

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  863  IPVSVKT  869



>ref|XP_006413792.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
 gb|ESQ55245.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
Length=748

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP GI + V P TL FN S KK+ F V++STSY  NTGY+FGS TW DG  NV I
Sbjct  680  RAVVEPPPGIKIVVEPETLVFNSSTKKLGFKVRVSTSYKSNTGYFFGSFTWTDGTRNVTI  739

Query  181  PISVKT  164
            P+SV+T
Sbjct  740  PLSVRT  745



>ref|XP_010437005.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=762

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++ PP G+ ++V P+ L FNP  KK+SF+V +ST++  NTGYYFGSLTW D V  V I
Sbjct  687  KVVINPPTGVRMTVKPNILRFNPRTKKVSFTVTVSTTHKVNTGYYFGSLTWTDNVRRVVI  746

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  747  PVSVRTQ  753



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP GI + V+P TL F P+ KKI+F+VK+ST++ +NT Y FGSLTW D G +NVR
Sbjct  686  KAVIEPPLGIKLQVSPKTLEFGPNTKKITFTVKVSTTHRWNTDYLFGSLTWTDNGAHNVR  745

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  746  IPLSVRT  752



>ref|XP_002867838.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44097.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K +++PP GIT++V P+TL FN + K+    SVK  TS+  N+GY+FGSLTW DGV++V 
Sbjct  586  KAVIKPPLGITLTVNPTTLVFNSAAKRSLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVT  645

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  646  IPVSVKT  652



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V+V P+ L FN   KK+S+ V++ST +  NTG+YFGSLTW+D V++V I
Sbjct  704  KVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVII  763

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  764  PLSVRTQ  770



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
             KV+VEPP G+ V VTP  L FN   K +SF+V++ST++  NTGYYFGSL W+D V  V I
Sbjct  1349  KVVVEPPLGVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGYYFGSLIWSDSVRKVTI  1408

Query  181   PISVKTM  161
             P+SV+T 
Sbjct  1409  PVSVRTQ  1415


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K +SF V++ST +  NTG+YFGSL W D V+NV I
Sbjct  639  KVVVEPPLGVQVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFYFGSLIWRDSVHNVTI  698

Query  181  PISV  170
            P+ +
Sbjct  699  PVHI  702



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V+V P+ L FN   KK+S+ V++ST +  NTG+YFGSLTW+D V++V I
Sbjct  700  KVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVII  759

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  760  PLSVRTQ  766



>ref|XP_010437012.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=666

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++ PP G+ ++V P+ L FNP  KK+SF+V +ST++  NTGYYFGSLTW D V  V I
Sbjct  591  KVVINPPTGVRMTVKPNILRFNPRTKKVSFTVTVSTTHKVNTGYYFGSLTWTDNVRRVVI  650

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  651  PVSVRTQ  657



>emb|CDX98693.1| BnaA03g44780D [Brassica napus]
Length=765

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++VTP+TL F+ + K++    VK  TS+  NTGY+FGSLTW DGV++V+
Sbjct  693  KAVIESPLGITLTVTPNTLVFSSAAKRVLTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVK  752

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  753  IPVSVQT  759



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+T++V+P+TL F+ S + +S++V   TS+  NTGY+FGSLTW DGV++VRI
Sbjct  696  KAVIESPLGVTLTVSPTTLVFD-SGEVLSYAVTAKTSHKVNTGYFFGSLTWTDGVHDVRI  754

Query  181  PISVKT  164
            P+SV+T
Sbjct  755  PVSVQT  760



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V+V P+ L FN   KK+S+ V++ST +  NTG+YFGSLTW+D V++V I
Sbjct  648  KVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVII  707

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  708  PLSVRTQ  714



>ref|XP_009128706.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Brassica 
rapa]
Length=643

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V+V P+ L FN   KK+S+ V++ST +  NTG+YFGSLTW+D V++V I
Sbjct  568  KVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVII  627

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  628  PLSVRTQ  634



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + ++EPP G +VSV P+ L FN   KKI+F+V ++T++  NTGY+FGS+TW DGV+ VR 
Sbjct  674  RAVIEPPFGTSVSVKPNVLAFNHKTKKITFTVTVTTAHQVNTGYFFGSITWTDGVHTVRS  733

Query  181  PISVKT  164
            P+SV+T
Sbjct  734  PLSVRT  739



>emb|CDY65868.1| BnaAnng21170D, partial [Brassica napus]
Length=672

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++V+PP G+ +SVTP TL FN  VKK+S+ V +ST++  N+ Y+FGSLTW DG +NV I
Sbjct  599  KLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHKANSIYFFGSLTWTDGTHNVVI  658

Query  181  PISVKTM  161
            P+S++T 
Sbjct  659  PLSIRTQ  665



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  VE   G+ V+VTP TL FN + KK+SF VK+ST++  NTGYYFGSLTW+D V+NV I
Sbjct  712  KASVELLSGVQVTVTPETLVFNSTTKKVSFKVKVSTTHKINTGYYFGSLTWSDSVHNVTI  771

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  772  PLSVRTQ  778



>dbj|BAD94221.1| subtilisin proteinase like protein [Arabidopsis thaliana]
Length=141

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            + ++E P GIT++V P+TL F  + K++   SVK  TS+  NTGY+FGSLTW+DGV++V 
Sbjct  71   RAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVI  130

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  131  IPVSVKT  137



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP GI V V P TL FN   K +SF+V++ST++  NTG+YFG+L W D ++NV I
Sbjct  699  KVVVEPPLGIQVVVAPETLVFNSKTKNVSFTVRVSTTHKINTGFYFGNLIWTDSMHNVTI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PVSVRTQ  765



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P G+T++V+P+TL F  S + +S++V   TS+  NTGY+FGSLTW DGV++VRI
Sbjct  681  KAVIESPLGVTLTVSPTTLVFG-SGEVLSYAVTAKTSHEVNTGYFFGSLTWTDGVHDVRI  739

Query  181  PISVKT  164
            P+SV+T
Sbjct  740  PVSVQT  745



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K +VE P GI ++V+P+TL F+ + K++   +VK   S+  NTGY+FGSLTW DGV+NV 
Sbjct  694  KAVVESPLGINLTVSPTTLVFSSATKRVLTFTVKAKRSHKVNTGYFFGSLTWTDGVHNVT  753

Query  184  IPISVKTMY*VR  149
            IP+SVKT + ++
Sbjct  754  IPVSVKTKFMIK  765



>emb|CAB87667.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=755

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++VEPP G+ +SVTP+TL FN +VK +S+ V +ST++  N+ YYFGSLTW DG + V I
Sbjct  682  KLIVEPPLGVKISVTPNTLLFNSNVKILSYKVTVSTTHKSNSIYYFGSLTWTDGSHKVTI  741

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  742  PLSVRTQ  748



>ref|NP_568255.1| Subtilase family protein [Arabidopsis thaliana]
 gb|ABE66153.1| subtilase family protein [Arabidopsis thaliana]
 gb|AED91742.1| Subtilase family protein [Arabidopsis thaliana]
Length=762

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++VEPP G+ +SVTP+TL FN +VK +S+ V +ST++  N+ YYFGSLTW DG + V I
Sbjct  689  KLIVEPPLGVKISVTPNTLLFNSNVKILSYKVTVSTTHKSNSIYYFGSLTWTDGSHKVTI  748

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  749  PLSVRTQ  755



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV VEPP G+ V VTP  L FN   K +SF+V++ST++  NTGYYFGSL W+D V  V I
Sbjct  697  KVGVEPPLGVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGYYFGSLVWSDSVRKVTI  756

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  757  PVSVRTQ  763



>ref|XP_010056037.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=773

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
             ++EPP G TV+V P  L F+P  KK +FSV +  +   NTGYYFGSL W DGV+ VR P
Sbjct  699  AVIEPPSGTTVTVRPHVLAFDPETKKAAFSVTVCAAVPVNTGYYFGSLVWTDGVHAVRSP  758

Query  178  ISVKTM  161
            ++V+ +
Sbjct  759  LAVRVL  764



>ref|XP_010542106.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=712

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G++V+VTP  + FN + K++SF+V++ST +  N+G+YFGSLTW +  +NV I
Sbjct  637  KVVVEPPLGVSVTVTPDMIVFNSTTKRVSFTVRVSTGHKVNSGFYFGSLTWTESAHNVTI  696

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  697  PLSVRTQ  703



>ref|XP_010455450.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ V+VTP+ L F+ +  K+SF+V++ST++  NTGYYFGSLTW + ++NV I
Sbjct  688  KVVIDPPTGVNVTVTPTELVFDSTNTKLSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVI  747

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  748  PVSVRTQ  754



>ref|XP_010421967.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ V+VTP+ L F+ +  K+SF+V++ST++  NTGYYFGSLTW + ++NV I
Sbjct  686  KVVIDPPTGVNVTVTPTELVFDSTNTKLSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVI  745

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  746  PVSVRTQ  752



>ref|XP_002867837.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44096.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++EPP GIT++V P+TL F  + K++   SVK  TS+  N GY+FGSLTW DGV++V 
Sbjct  597  KAVIEPPLGITLTVNPTTLVFKSAAKRVVTFSVKAKTSHKVNGGYFFGSLTWTDGVHDVT  656

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  657  IPVSVKT  663



>emb|CDX94044.1| BnaC07g36780D [Brassica napus]
Length=727

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-----svkistSYLFNTGYYFGSLTWNDGV  197
            K ++E P GIT++VTP+TL F+ + K++        VK  TS+  NTGY+FGSLTW DGV
Sbjct  651  KAVIESPLGITLTVTPNTLVFSSAAKRVLTFKPTFKVKAKTSHKVNTGYFFGSLTWTDGV  710

Query  196  NNVRIPISVKT  164
            ++V+IP+SV+T
Sbjct  711  HDVKIPVSVQT  721



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP GI V VTP TL FN   K +SF+V +ST++  NTG+YFG+L W D ++NV I
Sbjct  699  KVVLDPPLGIRVVVTPETLVFNSKTKSVSFTVGVSTTHKINTGFYFGNLIWTDSMHNVTI  758

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  759  PVSVRTQ  765



>ref|XP_004309572.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=837

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  ++PP G  VSV P+ L FN +VKK++F + IST++  NTGYYFGSLTW D V+ VRI
Sbjct  762  EATIDPPLGTVVSVKPNLLVFNSTVKKLTFEIVISTTHQMNTGYYFGSLTWTDRVHAVRI  821

Query  181  PISVKTMY  158
            P+SV+T +
Sbjct  822  PLSVRTNF  829



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  ++PP GI+V+V P TL FN ++K ISF+V +ST++  NTGYYFGSLTW DG + V  
Sbjct  708  KANIDPPPGISVAVRPETLVFNSTIKTISFTVAVSTTHQVNTGYYFGSLTWTDGEHLVTS  767

Query  181  PISVKTM  161
            PISV+T 
Sbjct  768  PISVRTQ  774



>ref|XP_009348696.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=759

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +EPP GI V V P TL FN +VKKISF+V++ST+Y  NT Y+FGSLTW DGV+ V  
Sbjct  684  KAQIEPPPGINVVVRPETLVFNSTVKKISFTVEVSTTYRVNTAYFFGSLTWTDGVHAVTS  743

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  744  PMSVRTQ  750



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +VM+EPP G +VSV P+ L FN   KKI+F+V ++T++  NT Y FGSLTW DGV+ VR 
Sbjct  698  RVMIEPPFGTSVSVKPNVLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGVHIVRS  757

Query  181  PISVKTMY  158
            P+SV+T +
Sbjct  758  PLSVRTEF  765



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +EPP GI V V P  L FN +VK +SF+V +ST+Y  NT Y+FGSLTW DGV+ V  
Sbjct  643  KTQIEPPLGINVVVKPEALVFNSTVKALSFTVAVSTTYQVNTAYFFGSLTWTDGVHAVSS  702

Query  181  PISVKTM  161
            PISV+T 
Sbjct  703  PISVRTQ  709



>ref|XP_010529677.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=767

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV++EPP G+ V V P TL FN   K++SF+V+++T++  N+G+YFG LTW D V  V I
Sbjct  692  KVVMEPPSGVRVDVNPKTLVFNSETKRVSFTVRVTTAHKVNSGFYFGRLTWTDSVREVTI  751

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  752  PVSVRTQ  758



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +++ P GIT++V+P+TL F  S + +S++V   TS+  NTGY+FGSLTW DGV++VRI
Sbjct  681  KAVIKSPLGITLTVSPTTLVFG-SGEVLSYAVTAKTSHKVNTGYFFGSLTWTDGVHDVRI  739

Query  181  PISVKT  164
            P+SV+T
Sbjct  740  PVSVQT  745



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
            V+VEPP G  V V P  L FN   KKISF+V +S+ +  + GYYFGSL W DGV++VR P
Sbjct  731  VIVEPPTGTIVLVNPPILIFNSMTKKISFTVTVSSMHQLSAGYYFGSLIWTDGVHDVRSP  790

Query  178  ISVKT  164
            ISV+T
Sbjct  791  ISVRT  795



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  +E P G  VSV P+ L FN +V+K+ F++ IS  +  NTGYYFGSL+W DGV+ VRI
Sbjct  697  RATIETPFGTIVSVNPNALVFNSTVRKLDFTITISAIHRMNTGYYFGSLSWADGVHVVRI  756

Query  181  PISVKTMY  158
            P+SV+T +
Sbjct  757  PLSVRTEF  764



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL FN + K++   SVK  TS+  N+GY+FGSLTW DGV++V 
Sbjct  702  KAVIESPLGITLTVNPTTLVFNSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVI  761

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  762  IPVSVKT  768



>ref|XP_010542096.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=812

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFN-PsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K++VE P GI V V P TL FN  + ++++F+V++ST +  NTG+YFGSLTW+D V+NV 
Sbjct  736  KILVENPLGIDVEVRPDTLVFNNSTARRVAFTVRVSTKHKINTGFYFGSLTWSDSVHNVT  795

Query  184  IPISVKTM  161
            IP+SV+T 
Sbjct  796  IPVSVRTQ  803



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
            V+VEPP G  V V P  L FN   KKISF+V +S+ +  + GYYFGSL W DGV++VR P
Sbjct  708  VIVEPPTGTIVLVNPPILIFNSMTKKISFTVTVSSMHQLSAGYYFGSLIWTDGVHDVRSP  767

Query  178  ISVKT  164
            ISV+T
Sbjct  768  ISVRT  772



>emb|CDX98690.1| BnaA03g44750D [Brassica napus]
Length=696

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL F+   KK+   +VK  TS+  NTGY+FGSLTW DGV++V+
Sbjct  624  KAVIESPLGITLTVHPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVK  683

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  684  IPVSVQT  690



>ref|XP_009137202.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=771

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL F+   KK+   +VK  TS+  NTGY+FGSLTW DGV++V+
Sbjct  699  KAVIESPLGITLTVNPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVK  758

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  759  IPVSVQT  765



>ref|XP_010528996.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=756

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VE P GI + V P TL FN   KK+S++V +STS+  NTGY FGSLTW DG +NV I
Sbjct  684  RAVVEAPLGIKLVVKPETLVFNSQTKKVSYTVSVSTSHKVNTGYLFGSLTWTDGTHNVAI  743

Query  181  PISVKT  164
            P+SV+T
Sbjct  744  PVSVRT  749



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+TL F+   KK+   +VK  TS+  NTGY+FGSLTW DGV++V+
Sbjct  701  KAVIESPLGITLTVNPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVK  760

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  761  IPVSVQT  767



>ref|XP_010436465.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=629

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F+ + KK+ F V++S+S+  NTGY+FGS TW DG  NV I
Sbjct  559  RAVVEPPQGVKIVVEPETLVFSSNTKKLGFKVRVSSSHKSNTGYFFGSFTWTDGTRNVTI  618

Query  181  PISVKT  164
            P+SV+T
Sbjct  619  PLSVRT  624



>gb|KFK28745.1| hypothetical protein AALP_AA7G041500 [Arabis alpina]
Length=764

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P GIT++V P+ L F+ S K++   SVK  TS+  NTGY+FGSLTW DGV++V+
Sbjct  692  KAVIESPLGITLTVNPTILVFSSSAKRLLTFSVKAKTSHKVNTGYFFGSLTWTDGVHDVK  751

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  752  IPVSVKT  758



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +VM+EPP G +VSV P+ L FN   KKI+F+V ++T++  NT Y FGSLTW DG + VR 
Sbjct  698  RVMIEPPFGTSVSVKPNVLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGEHKVRS  757

Query  181  PISVKTMY  158
            P+SV+T +
Sbjct  758  PLSVRTEF  765



>ref|XP_010445236.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=856

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTGY+FGS TW DG  NV I
Sbjct  786  RAVVEPPQGVKIVVEPETLVFEQNTKKLGFKVRVSSSHKSNTGYFFGSFTWTDGTRNVTI  845

Query  181  PISVKT  164
            P+SV+T
Sbjct  846  PLSVRT  851



>gb|ACN35690.1| unknown [Zea mays]
Length=279

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VE P G+ V+V+PS L FN +V+K++F V           YYFGSLTW DGV+ VRI
Sbjct  205  RARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAKLKVQGRYYFGSLTWEDGVHAVRI  264

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  265  PLVVRTM  271



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+++PP G+ + VTP  L FN   KK+SF V++ST++  N GYYFGSLTW D V+NV I
Sbjct  687  KVVIDPPMGVNMIVTPKWLVFNSMTKKVSFKVRVSTTHKVNNGYYFGSLTWTDKVHNVVI  746

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  747  PVSVRTQ  753



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +  P GIT++V P TL F+ ++K ++FSV +S+ +  NTGY FGSLTW DGV+ VR 
Sbjct  624  KASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGYSFGSLTWIDGVHAVRS  683

Query  181  PISVKTM  161
            PISV+TM
Sbjct  684  PISVRTM  690



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +  P GIT++V P TL F+ ++K ++FSV +S+ +  NTGY FGSLTW DGV+ VR 
Sbjct  701  KASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGYSFGSLTWIDGVHAVRS  760

Query  181  PISVKTM  161
            PISV+TM
Sbjct  761  PISVRTM  767



>ref|XP_002871506.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47765.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=762

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K++V PP G+ +SVTP TL FN +VKK+SF V +ST++  N+ YYFGSLTW DG + V I
Sbjct  689  KLVVRPPLGVKISVTPKTLLFNSNVKKLSFKVIVSTTHKSNSIYYFGSLTWTDGSHKVTI  748

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  749  PLSVRTQ  755



>ref|XP_006301525.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
 gb|EOA34423.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
Length=757

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K M++ P+GI + V+P TL+F+ +  KI+F+VK+ST++  NT Y+FGSLTW D G +NVR
Sbjct  684  KAMIQAPQGINLQVSPETLDFSSNTNKITFTVKVSTTHRSNTDYHFGSLTWIDNGGHNVR  743

Query  184  IPISVKT  164
            IPISV+T
Sbjct  744  IPISVRT  750



>emb|CDY61569.1| BnaCnng38020D [Brassica napus]
Length=1177

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
             K ++E P GI + V P TL F P+ KKI+F+VK+ST++ +NT Y FGSLTW D G +NVR
Sbjct  1104  KAVIEAPLGIKLQVGPETLEFGPNTKKITFTVKVSTTHRWNTDYNFGSLTWTDNGAHNVR  1163

Query  184   IPISVKTMY  158
             IP+SV+T +
Sbjct  1164  IPLSVRTRF  1172



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + ++EPP GIT+ V P TL FN S KKISF++ ISTS+ + T YYFGSLTW DG++ VR 
Sbjct  692  EAIIEPPLGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRS  751

Query  181  PISVKTMY  158
            P SV+  +
Sbjct  752  PTSVRNEF  759



>ref|XP_010538683.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=696

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP GI + V P  L FN   KK +FS+ +STS+  NTG++FGSL W DG  NV +
Sbjct  626  RAVVEPPLGINILVKPEALAFNSDTKKQTFSMSVSTSHKTNTGFFFGSLVWTDGTRNVSV  685

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  686  PLSVRTQ  692



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + ++EPP GIT+ V P TL FN S KKISF++ ISTS+ + T YYFGSLTW DG++ VR 
Sbjct  700  EAIIEPPLGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRS  759

Query  181  PISVKTMY  158
            P SV+  +
Sbjct  760  PTSVRNEF  767



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + ++EPP GIT+ V P TL FN S KKISF++ ISTS+ + T YYFGSLTW DG++ VR 
Sbjct  660  EAIIEPPLGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRS  719

Query  181  PISVKTMY  158
            P SV+  +
Sbjct  720  PTSVRNEF  727



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            + ++E P GIT++V P+TL F  + K++   SVK  TS+  NTGY+FGSLTW+DGV++V 
Sbjct  696  RAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVI  755

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  756  IPVSVKT  762



>emb|CAB36809.1| subtilisin proteinase-like [Arabidopsis thaliana]
 emb|CAB81272.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=718

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            + ++E P GIT++V P+TL F  + K++   SVK  TS+  NTGY+FGSLTW+DGV++V 
Sbjct  648  RAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVI  707

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  708  IPVSVKT  714



>gb|AAL24366.1| subtilisin proteinase-like [Arabidopsis thaliana]
 gb|AAM91203.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=703

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            + ++E P GIT++V P+TL F  + K++   SVK  TS+  NTGY+FGSLTW+DGV++V 
Sbjct  633  RAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVI  692

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  693  IPVSVKT  699



>ref|XP_010538146.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=821

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +++ P GI V V P  L FN + KK+ FSVK+ST++  NTG+YFGSLTW DG++NV I
Sbjct  750  KPLIDAPFGINVEVRPEALAFNLNTKKLGFSVKVSTTHKANTGFYFGSLTWTDGIHNVTI  809

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  810  PLSVRTQ  816



>ref|XP_002893748.1| hypothetical protein ARALYDRAFT_336380 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70007.1| hypothetical protein ARALYDRAFT_336380 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsv-kkisfsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K M+E P G+ V+VTPSTL FN    +   F V++ T+   NT YYFGSLTW + V+N  
Sbjct  151  KAMIEAPMGVNVTVTPSTLVFNTLRPESSRFKVRVLTNQRVNTRYYFGSLTWTESVHNAV  210

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  211  IPVSVRT  217



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  +E P G  VSV P+ L FN +V+K+ F++ IST +  NTGYYFGSL+W DGV+ V+I
Sbjct  697  RATIETPFGTIVSVNPNALVFNSTVRKLDFTITISTIHRMNTGYYFGSLSWADGVHVVKI  756

Query  181  PISVKTMY  158
            P+SV+T +
Sbjct  757  PLSVRTEF  764



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VE P G+ V+V+PS L FN +V+K++F V           YYFGSLTW DGV+ VRI
Sbjct  694  RARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAKLKVQGRYYFGSLTWEDGVHAVRI  753

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  754  PLVVRTM  760



>gb|AID21628.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + MVEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  686  RAMVEPPQGVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>gb|KFK41045.1| hypothetical protein AALP_AA2G078300 [Arabis alpina]
Length=757

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWND-GVNNVR  185
            K ++EPP GI + V+P TL F  +  KI+F VK+ST++  NT Y+FGSLTW D G ++VR
Sbjct  684  KAVIEPPLGINLQVSPETLEFGSNTNKITFMVKVSTTHRVNTDYHFGSLTWTDNGAHDVR  743

Query  184  IPISVKT  164
            IP S++T
Sbjct  744  IPFSIRT  750



>gb|AID21678.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + MVEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  686  RAMVEPPQGVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>ref|XP_006391366.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
 gb|ESQ28652.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
Length=729

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K MVE P GI + V P TL F  +  KI++SV++ T++  N+ +YFGSL W DGV+NV I
Sbjct  657  KAMVENPFGIELEVNPKTLEFGSNTTKITYSVRVRTNHKVNSDFYFGSLCWTDGVHNVTI  716

Query  181  PISVKT  164
            P+SV+T
Sbjct  717  PVSVRT  722



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++E P GI + V P +L FN + KK++F VK+S+++  NT +YFGSLTW DG  NV I
Sbjct  690  KAVIESPSGINLEVNPQSLVFNSATKKVTFKVKVSSTHKVNTEFYFGSLTWTDGTTNVTI  749

Query  181  PISVKT  164
            P+SV+T
Sbjct  750  PLSVRT  755



>ref|XP_010056036.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=774

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
             ++EPP G TV+V P  L F+   KK +FSV +  +   NTGYYFGSL W DGV+ VR P
Sbjct  700  AVIEPPSGTTVTVRPHVLAFDRETKKAAFSVTVCAAAPVNTGYYFGSLVWTDGVHAVRSP  759

Query  178  ISVK  167
            ++V+
Sbjct  760  LAVR  763



>gb|KCW72614.1| hypothetical protein EUGRSUZ_E01074 [Eucalyptus grandis]
Length=758

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
             ++EPP G TV+V P  L F+   KK +FSV +  +   NTGYYFGSL W DGV+ VR P
Sbjct  684  AVIEPPSGTTVTVRPHVLAFDRETKKAAFSVTVCAAAPVNTGYYFGSLVWTDGVHAVRSP  743

Query  178  ISVK  167
            ++V+
Sbjct  744  LAVR  747



>gb|KFK41050.1| hypothetical protein AALP_AA2G078900 [Arabis alpina]
Length=757

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPI  176
            +VEPP GI + V P+TL F  +  KI+FSV++ T++  N+ +YFGSL W DGV+NV IP+
Sbjct  687  IVEPPSGIELEVNPNTLIFGSNTTKITFSVRVRTNHKVNSDFYFGSLCWTDGVHNVTIPV  746

Query  175  SVKT  164
            SV+T
Sbjct  747  SVRT  750



>ref|XP_004309569.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=824

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +VMV+ P G+ ++V P TL+FN + + +S+ V   ++   N GY FGSLTW DG ++VRI
Sbjct  750  RVMVQAPPGVEMTVKPPTLSFNITAQILSYKVTFFSTQKVNGGYKFGSLTWTDGEHDVRI  809

Query  181  PISVK  167
            PI+++
Sbjct  810  PIAIR  814



>gb|AGN12874.1| putative transcription factor DYSFUNCTIONAL TAPETUM 1 [Sisymbrium 
irio]
Length=775

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VE P+G+ + V P TL F+ S KK+ F V++STS+  NTGY+FGS TW DG  NV I
Sbjct  708  RAVVEAPEGVKIVVEPQTLVFSSSTKKLGFKVRVSTSHKSNTGYFFGSFTWTDGTRNVTI  767

Query  181  PISVKT  164
            P+SV+T
Sbjct  768  PLSVRT  773



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
             K  +  P G T++V P TL F+ ++K ++FSV +S+    NTGY FGSLTW DGV+ VR 
Sbjct  1809  KASIISPAGTTITVKPDTLIFDSTIKTVTFSVTVSSIQQVNTGYSFGSLTWIDGVHAVRS  1868

Query  181   PISVKTM  161
             PISV+TM
Sbjct  1869  PISVRTM  1875


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  355   MVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPI  176
             +++PP G+T+ + P  L FN  ++ I+F V +S++   +TG+ FGSL W+DG + VRIPI
Sbjct  1063  VIDPPPGVTIKLEPDRLVFNSKIRTITFRVMVSSARRVSTGFSFGSLAWSDGEHAVRIPI  1122

Query  175   SVKT  164
             SV+T
Sbjct  1123  SVRT  1126



>ref|XP_010449086.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010449087.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=755

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P  L F+ + KK+ F V++S+S+  NTGY+FGS TW DG  NV I
Sbjct  685  RAVVEPPEGVKIVVEPEALVFDWNTKKLGFKVRVSSSHKSNTGYFFGSFTWTDGTRNVTI  744

Query  181  PISVKT  164
            P+SV+T
Sbjct  745  PLSVRT  750



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V++E P   +VSV P  L FN + KK +FSV ++T+Y  NTGY+FGS+TW DGV+ VR 
Sbjct  700  RVVIEAPFCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGYFFGSITWIDGVHTVRS  759

Query  181  PISVKT  164
            P+SV+T
Sbjct  760  PLSVRT  765



>ref|XP_011038010.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Populus 
euphratica]
Length=704

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V++E P   +VSV P  L FN + KK +FSV ++T+Y  NTGY+FGS+TW DGV+ VR 
Sbjct  629  RVVIEAPFCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGYFFGSITWIDGVHTVRS  688

Query  181  PISVKT  164
            P+SV+T
Sbjct  689  PLSVRT  694



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  +EPP G+ VSV P  L FN +++KISF V IST++  NT Y FGSLTW D V+ VRI
Sbjct  728  EATIEPPSGVLVSVKPEFLVFNSTIEKISFQVTISTTHQMNTDYLFGSLTWTDKVHIVRI  787

Query  181  PISVKT  164
            P+SV+T
Sbjct  788  PLSVRT  793



>ref|XP_006287131.1| hypothetical protein CARUB_v10000302mg [Capsella rubella]
 gb|EOA20029.1| hypothetical protein CARUB_v10000302mg [Capsella rubella]
Length=742

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
            V+V+PP G+ ++VTP+ L FNP V+K+SF V +ST++  N+ YYFGS+TW DG + V IP
Sbjct  670  VIVKPPLGVEITVTPNILLFNPLVQKLSFEVTVSTTHKSNSIYYFGSITWTDGSHFVSIP  729

Query  178  ISVKT  164
            +SV+T
Sbjct  730  LSVRT  734



>ref|NP_567625.4| subtilase 3.12 [Arabidopsis thaliana]
 gb|AEE84441.1| subtilase 3.12 [Arabidopsis thaliana]
Length=754

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG++FGS TW DG  NV I
Sbjct  684  RAVVEPPRGVEIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGFFFGSFTWTDGTRNVTI  743

Query  181  PISVKTMY*VRIKIL  137
            P+S      VRI++L
Sbjct  744  PLS------VRIRVL  752



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +  P GIT++V P TL FN ++K ++FSV +S+ +  NT Y FGSLTW DGV+ V+ 
Sbjct  701  KASIISPAGITITVKPDTLIFNSTIKTVTFSVTVSSIHQVNTEYSFGSLTWVDGVHAVKS  760

Query  181  PISVKTM  161
            PISV+TM
Sbjct  761  PISVRTM  767



>emb|CAA20197.1| putative protein [Arabidopsis thaliana]
 emb|CAB79131.1| putative protein [Arabidopsis thaliana]
Length=1736

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
             + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG++FGS TW DG  NV I
Sbjct  1666  RAVVEPPRGVEIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGFFFGSFTWTDGTRNVTI  1725

Query  181   PISVKTMY*VRIKIL  137
             P+S      VRI++L
Sbjct  1726  PLS------VRIRVL  1734



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +  P GIT++V P TL FN ++K ++FSV +S+ +  NT Y FGSLTW DGV+ V+ 
Sbjct  767  KASIISPAGITITVKPDTLIFNSTIKTVTFSVTVSSIHQVNTEYSFGSLTWVDGVHAVKS  826

Query  181  PISVKTM  161
            PISV+TM
Sbjct  827  PISVRTM  833



>ref|XP_002869894.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46153.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. 
lyrata]
Length=1745

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361   KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
             + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  1675  RAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTI  1734

Query  181   PISVKT  164
             P+SV+T
Sbjct  1735  PLSVRT  1740



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  +  P G T++V P TL F+ ++K ++FSV +S+    NTGY FGSLTW DGV+ VR 
Sbjct  701  KASIISPAGTTITVKPDTLIFDSTIKTVTFSVTVSSIQQVNTGYSFGSLTWIDGVHAVRS  760

Query  181  PISVKTM  161
            PISV+TM
Sbjct  761  PISVRTM  767



>ref|XP_006283179.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
 gb|EOA16077.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
Length=760

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  690  KAVVEPPQGVKIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGSRNVTI  749

Query  181  PISVKT  164
            P+SV+T
Sbjct  750  PLSVRT  755



>gb|ADQ37345.1| unknown [Arabidopsis lyrata]
Length=696

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  626  RAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTI  685

Query  181  PISVKT  164
            P+SV+T
Sbjct  686  PLSVRT  691



>ref|XP_011038011.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=781

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++ PP GI+VSV P TL FN +  ++SF V  +T++  NT +YFGSLTW DG + V  
Sbjct  706  KSLIVPPIGISVSVRPQTLIFNSTTNRVSFKVTFTTTHKVNTRFYFGSLTWTDGFHAVTS  765

Query  181  PISVKTM  161
            PISV+T 
Sbjct  766  PISVRTQ  772



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +V PP G  V V P  L F+P V+++SF VKI+T +   T YYFGSLTW+DG + V+I
Sbjct  710  EAVVVPPLGTVVKVNPKHLQFSPEVREMSFKVKITTLHNITTEYYFGSLTWSDGKHEVKI  769

Query  181  PISVKTMY  158
            PISV+T +
Sbjct  770  PISVRTEF  777



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VEPP G+ V+V+PS L FN +V++++F V           Y FGSLTW DG + VRI
Sbjct  694  RAHVEPPPGVDVAVSPSLLTFNSTVRRLTFKVTFQAKLKVQGRYTFGSLTWEDGAHTVRI  753

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  754  PLVVRTM  760



>gb|ADQ37388.1| unknown [Capsella rubella]
Length=700

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  630  KAVVEPPQGVKIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGSRNVTI  689

Query  181  PISVKT  164
            P+SV+T
Sbjct  690  PLSVRT  695



>ref|NP_193895.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84484.1| Subtilase family protein [Arabidopsis thaliana]
Length=733

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            + ++E P GIT++V P+ L F  + K++   SVK  TS+  N+GY+FGSLTW DGV++V 
Sbjct  663  RAVIESPLGITLTVNPTILVFKSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVT  722

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  723  IPVSVKT  729



>gb|AID21685.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  686  RAVVEPPQGVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>emb|CAB36808.1| subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB81271.1| subtilisin-like protease [Arabidopsis thaliana]
Length=769

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWNDGVNNVR  185
            + ++E P GIT++V P+ L F  + K++   SVK  TS+  N+GY+FGSLTW DGV++V 
Sbjct  699  RAVIESPLGITLTVNPTILVFKSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVT  758

Query  184  IPISVKT  164
            IP+SVKT
Sbjct  759  IPVSVKT  765



>ref|NP_564869.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAG51764.1|AC066691_4 subtilisin-like protein; 10849-13974 [Arabidopsis thaliana]
 gb|AEE34478.1| Subtilase-like protein [Arabidopsis thaliana]
Length=753

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPI  176
            ++E P GI + V P TL F  ++ KI+FSV++ +S+  NT +YFGSL W DGV+NV IP+
Sbjct  683  VIESPLGIELDVKPKTLVFGSNITKITFSVRVKSSHRVNTDFYFGSLCWTDGVHNVTIPV  742

Query  175  SVKTMY  158
            SV+T +
Sbjct  743  SVRTKF  748



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V+VEPP G  V VTP  L FN  +KKI++ V + + +    GYYFGSL W DGV++VR 
Sbjct  706  RVVVEPPTGTLVFVTPPILIFNSHIKKITYQVTVISVHPLIGGYYFGSLIWTDGVHDVRS  765

Query  181  PISVKT  164
            PI+V++
Sbjct  766  PIAVRS  771



>ref|XP_010474133.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=754

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VE P GI + V P TL F  ++ K +F+V++ TS+  N+ YYFGSL W DGV+NV I
Sbjct  682  KPLVESPLGIELDVNPKTLVFASNITKGTFNVRVKTSHRVNSDYYFGSLCWTDGVHNVTI  741

Query  181  PISVKT  164
            PI+V+T
Sbjct  742  PIAVRT  747



>ref|XP_009344068.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Pyrus x 
bretschneideri]
Length=758

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV ++PP G+ V+V P TL FN SVK I+F+V +ST++  NTGYYFGSLTW DG + V  
Sbjct  687  KVDIDPPLGVNVAVRPDTLVFNSSVKTITFTVAVSTTHHVNTGYYFGSLTWTDGKHVVTS  746

Query  181  PISVKTM  161
             +SV+ +
Sbjct  747  AVSVRVI  753



>gb|KHN12354.1| Subtilisin-like protease [Glycine soja]
Length=148

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +V+ P GI V V P TL+FN  V+ ++FSV   ++  F+  Y FGSLTW DG   VR 
Sbjct  79   KALVKVPHGIKVRVEPQTLSFNSDVRILNFSVSFLSTQKFHGDYKFGSLTWTDGKYFVRT  138

Query  181  PISVKTM  161
            PI+V+T+
Sbjct  139  PIAVRTI  145



>gb|ABV21208.1| At4g21326 [Arabidopsis thaliana]
Length=694

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NT ++FGS TW DG  NV I
Sbjct  624  RAVVEPPRGVEIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTDFFFGSFTWTDGTRNVTI  683

Query  181  PISVKT  164
            P+SV+T
Sbjct  684  PLSVRT  689



>ref|XP_010513580.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=730

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VE P GI + V P TL F  ++ K +F+V++ TS+  N+ YYFGSL W DGV+NV I
Sbjct  658  KPLVESPLGIELDVNPKTLVFASNITKSTFNVRVKTSHRVNSDYYFGSLCWTDGVHNVTI  717

Query  181  PISVKT  164
            P++V+T
Sbjct  718  PVAVRT  723



>emb|CDX94032.1| BnaC07g36660D [Brassica napus]
Length=784

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkis-fsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K +++ P G  V V+P  L FN    K +      S SY  NTG++FGSLTW+DG++NV 
Sbjct  710  KPVIKAPLGFDVKVSPEELVFNKGTSKAAFTVSVSSGSYKVNTGFFFGSLTWSDGLHNVT  769

Query  184  IPISVKTMY  158
            IP+SV+T +
Sbjct  770  IPVSVRTSF  778



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VE P G+ V+V+PS L FN +++ ++F V           Y FGSLTW DGV+ VRI
Sbjct  691  RARVEAPPGVDVTVSPSLLTFNSTMRSLTFKVTFQAKLKVQGRYNFGSLTWEDGVHTVRI  750

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  751  PLVVRTM  757



>emb|CDY49640.1| BnaCnng17920D [Brassica napus]
Length=757

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VEPP GI + V P TL F+ +  K +FSV++ +++  N  +YFGSL W DG +NV I
Sbjct  685  KPVVEPPFGIELEVNPKTLVFDSNTTKNTFSVRVRSNHKVNGDFYFGSLCWTDGAHNVTI  744

Query  181  PISVKT  164
            P+S++T
Sbjct  745  PVSIRT  750



>gb|ADQ37356.1| unknown [Arabidopsis lyrata]
Length=696

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FG  TW DG  NV I
Sbjct  626  RAVVEPPRGVKIVVEPETLMFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTI  685

Query  181  PISVKT  164
            P+SV+T
Sbjct  686  PLSVRT  691



>ref|XP_009348701.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease Glyma18g48580 
[Pyrus x bretschneideri]
Length=298

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  ++P  G  V V P TL FN +VK IS+SV +ST+Y  NT Y+FGSLTW DGV  V  
Sbjct  223  KAXIDPSPGTNVLVRPETLVFNSTVKTISYSVAVSTTYRVNTAYFFGSLTWTDGVYAVTS  282

Query  181  PISVKTM  161
            PISV+T 
Sbjct  283  PISVRTQ  289



>ref|XP_010439493.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=799

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVRIP  179
            ++E P G +V V+P  L FN    K +F+V +S  S+  NT +YFGSLTW+DGV NV IP
Sbjct  727  VIEAPFGFSVKVSPEKLVFNKGSNKTAFTVSVSPGSHRVNTAFYFGSLTWSDGVRNVTIP  786

Query  178  ISVKTMY  158
            IS++T +
Sbjct  787  ISLRTRF  793



>ref|XP_006283139.1| hypothetical protein CARUB_v10004165mg [Capsella rubella]
 gb|EOA16037.1| hypothetical protein CARUB_v10004165mg [Capsella rubella]
Length=803

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVRIP  179
            ++E P G +V V+P  L FN   KK +F+V +S  S+  NT +YFGSLTW+DGV+NV IP
Sbjct  731  VIEAPSGFSVVVSPEKLVFNKGTKKNAFTVSVSPGSHRVNTAFYFGSLTWSDGVHNVTIP  790

Query  178  ISVKTMY  158
            +S++T +
Sbjct  791  VSLRTRF  797



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V++EPP G  +SV P +L F+   KKI+F+V ++ +   NTGYYFGSL+W +GV+ V  
Sbjct  703  RVVIEPPFGTYISVKPDSLVFSRKTKKITFTVTVTAANQVNTGYYFGSLSWTNGVHTVAS  762

Query  181  PISVKT  164
            P+SV+T
Sbjct  763  PMSVRT  768



>ref|XP_010495162.1| PREDICTED: subtilisin-like protease SBT3.3, partial [Camelina 
sativa]
Length=295

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
            V+V+PP G+ ++VTP+ L FN  VKK+SF V +ST++  N+ YYFGS+TW DG + V IP
Sbjct  223  VIVKPPLGVEITVTPNILFFNSFVKKLSFEVTVSTTHKSNSIYYFGSITWTDGSHFVSIP  282

Query  178  ISVKT  164
            +SV+T
Sbjct  283  LSVRT  287



>gb|AID21603.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FG  TW DG  NV I
Sbjct  686  RAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>gb|AID21581.1| AT4G21326p [Arabidopsis halleri]
 gb|AID21618.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FG  TW DG  NV I
Sbjct  686  RAVVEPPRGVNIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>ref|XP_002887016.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63275.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPI  176
            ++E P GI + V P TL F  ++ KI+FSV++ TS+  NT YYFGSL W DGV+NV  P+
Sbjct  683  VIESPFGIELDVNPKTLVFGSNITKITFSVRVKTSHRVNTDYYFGSLCWTDGVHNVSTPV  742

Query  175  SVKT  164
            SV+T
Sbjct  743  SVRT  746



>gb|AID21653.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FG  TW DG  NV I
Sbjct  686  RAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>emb|CCI61494.1| unnamed protein product [Arabidopsis halleri]
Length=756

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P TL F  + KK+ F V++S+S+  NTG+ FG  TW DG  NV I
Sbjct  686  RAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTI  745

Query  181  PISVKT  164
            P+SV+T
Sbjct  746  PLSVRT  751



>ref|XP_010434192.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=799

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVRIP  179
            ++E P G +V V+P  L FN    K +F+V +S  S+  NT +YFGSLTW+DGV+NV IP
Sbjct  727  VMEAPFGFSVKVSPEKLVFNKGSNKTAFTVSVSPGSHRVNTAFYFGSLTWSDGVHNVTIP  786

Query  178  ISVKTMY  158
            IS++T +
Sbjct  787  ISLRTRF  793



>ref|XP_010434193.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=732

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVRIP  179
            ++E P G +V V+P  L FN    K +F+V +S  S+  NT +YFGSLTW+DGV+NV IP
Sbjct  660  VMEAPFGFSVKVSPEKLVFNKGSNKTAFTVSVSPGSHRVNTAFYFGSLTWSDGVHNVTIP  719

Query  178  ISVKTMY  158
            IS++T +
Sbjct  720  ISLRTRF  726



>ref|XP_010456502.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  358  VMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIP  179
            V+V+PP G+ ++VTP+ L FN  VK++SF V +ST++  N+ YYFGS+TW DG + V IP
Sbjct  691  VIVKPPLGVEITVTPNILFFNSFVKRLSFEVTVSTTHKSNSIYYFGSITWTDGSHFVSIP  750

Query  178  ISVKT  164
            +SV+T
Sbjct  751  LSVRT  755



>ref|XP_009105193.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=757

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++EPP GI + V P TL F  +  K +FSV++ +++  N  +YFGSL W DG +NV I
Sbjct  685  KPVIEPPFGIELEVNPKTLVFGSNTTKNTFSVRVRSNHQVNGDFYFGSLCWTDGAHNVTI  744

Query  181  PISVKT  164
            P+S++T
Sbjct  745  PVSIRT  750



>gb|AID21686.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN    K++F V++S  S+  NT +YFGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVSPKKLKFNKRRSKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>gb|AID21654.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkis-fsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN    K++      + S+  NT +YFGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSTGSHRVNTAFYFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>emb|CDY07492.1| BnaA07g25710D [Brassica napus]
Length=757

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K ++EPP GI + V P TL F  +  K +FSV++ +++  N  +YFGSL W DG +NV I
Sbjct  685  KPVIEPPFGIELEVNPKTLVFGSNTTKNTFSVRVRSNHQVNGDFYFGSLCWTDGAHNVTI  744

Query  181  PISVKT  164
            P+S++T
Sbjct  745  PVSIRT  750



>ref|XP_002298973.2| subtilase family protein [Populus trichocarpa]
 gb|EEE83778.2| subtilase family protein [Populus trichocarpa]
Length=786

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V++E P   +V V P  L FN + KKI+FSV ++T+Y  NTGY+FGS+TW DGV+ VR 
Sbjct  711  RVVIEAPFCCSVLVEPYVLVFNYTTKKITFSVTVNTTYQVNTGYFFGSITWIDGVHTVRS  770

Query  181  PISVKT  164
            P+SV+T
Sbjct  771  PLSVRT  776



>ref|XP_010449088.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=800

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -2

Query  355  MVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVRIP  179
            ++E P G +V V+P  L FN    KI+F V +S  S+  NT +YFGSLTW+DGV+NV IP
Sbjct  728  VMEAPFGFSVKVSPEKLVFNKGSNKIAFKVSVSPGSHRVNTAFYFGSLTWSDGVHNVTIP  787

Query  178  ISVKTMY  158
            IS++T +
Sbjct  788  ISLRTRF  794



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VE P G+ V+V+PS L FN +V +++F V           Y FGSLTW DG + VRI
Sbjct  696  RARVEAPPGVDVTVSPSLLTFNSTVNRLTFKVMFQAKLKVQGRYTFGSLTWEDGTHTVRI  755

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  756  PLVVRTM  762



>gb|EMT21161.1| Cucumisin [Aegilops tauschii]
Length=710

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VE P G+ V+V PS L FN +V +++F V           Y FGSLTW DG + VRI
Sbjct  636  RARVEAPPGVNVTVNPSLLTFNSTVNRLTFKVAFQAKLKVQGRYTFGSLTWEDGTHTVRI  695

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  696  PLVVRTM  702



>gb|AAG51763.1|AC066691_3 hypothetical protein; 8963-6048 [Arabidopsis thaliana]
Length=758

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGV-NNVR  185
            K +++ P+GI + V+P TL F  +  K +F+VK+ST++  NT Y FGSLTW D   +NVR
Sbjct  685  KAVIQAPQGINLQVSPETLEFGSNTNKTTFTVKVSTTHRANTDYLFGSLTWADNEGHNVR  744

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  745  IPLSVRT  751



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV+VEPP G+ V VTP  L FN   K +SF+V++ST++  NTGY   SLTW D V+NV I
Sbjct  681  KVVVEPPLGVIVVVTPEILVFNSKFKSVSFTVRVSTTHKINTGYX-SSLTWTDSVHNVII  739

Query  181  PISVKTM  161
            P+SV+T 
Sbjct  740  PVSVRTQ  746



>ref|NP_564868.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAC43166.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64891.1| At1g66210 [Arabidopsis thaliana]
 gb|AEE34477.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=759

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGV-NNVR  185
            K +++ P+GI + V+P TL F  +  K +F+VK+ST++  NT Y FGSLTW D   +NVR
Sbjct  686  KAVIQAPQGINLQVSPETLEFGSNTNKTTFTVKVSTTHRANTDYLFGSLTWADNEGHNVR  745

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  746  IPLSVRT  752



>gb|AID21679.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN    K++F V++S  S+  NT +YFGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>ref|XP_010551747.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=761

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VE P G+ V V P  L FN + KK +F V +ST+   N+ ++FGSLTW DG NNV I
Sbjct  689  KPVVESPYGVKVVVNPKALVFNSTTKKATFKVHVSTTNEVNSAFFFGSLTWTDGTNNVTI  748

Query  181  PISVKT  164
            P+SV+T
Sbjct  749  PLSVRT  754



>ref|XP_002888489.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64748.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=760

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGV-NNVR  185
            K +++ P+GI + V+P TL F  +  KI+F+VK+ST++  NT Y FGSLTW D   +NVR
Sbjct  687  KAVIQAPQGINLQVSPETLEFGSNTNKITFTVKVSTTHRANTDYLFGSLTWTDNEGHNVR  746

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  747  IPLSVRT  753



>ref|XP_006377885.1| hypothetical protein POPTR_0011s15430g [Populus trichocarpa]
 gb|ERP55682.1| hypothetical protein POPTR_0011s15430g [Populus trichocarpa]
Length=587

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNV  188
            K +++PP GI++SV P  L FN ++K  SF V +ST++  NTGY+FGSLTW DGV+ V
Sbjct  508  KSLIDPPFGISISVRPKYLAFNSTIKATSFKVTVSTNHRVNTGYFFGSLTWTDGVHAV  565



>ref|NP_001169390.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN33599.1| unknown [Zea mays]
 tpg|DAA40612.1| TPA: putative subtilase family protein [Zea mays]
Length=769

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTG-YYFGSLTWNDGVNNVR  185
            +  VE P G+ VSV PS L FN +V++++F V      +   G Y FGSLTW DGV+ VR
Sbjct  694  RARVEAPPGVDVSVRPSLLAFNSTVRRLAFKVTFRAKLVKVQGRYTFGSLTWEDGVHAVR  753

Query  184  IPISVKTM  161
            IP+ V+TM
Sbjct  754  IPLVVRTM  761



>gb|AEW09204.1| hypothetical protein CL4686Contig1_05, partial [Pinus radiata]
 gb|AFG57997.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG57998.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG57999.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58000.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58001.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58002.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58003.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58004.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58005.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58006.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58007.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58008.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58009.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58010.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58011.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58012.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58013.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58014.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
Length=69

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            KV ++ P+G+ V V+PS L F+ +  KI++SV  + S   + GY FGS+TW DG +NVR 
Sbjct  3    KVTIDSPQGLDVKVSPSQLAFSGTSDKITYSVMFTASGNASKGYAFGSITWADGTHNVRT  62

Query  181  PISV  170
            P +V
Sbjct  63   PFAV  66



>ref|XP_010419003.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=719

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +VE P GI + V P TL F  ++ K +F+V++ TS+  N+ YYF SL W DGV+NV I
Sbjct  647  KPLVESPLGIELDVNPKTLVFASNITKGTFNVRVKTSHRVNSDYYFCSLCWTDGVHNVTI  706

Query  181  PISVKT  164
            PI+V+T
Sbjct  707  PIAVRT  712



>emb|CDY58475.1| BnaA03g58460D [Brassica napus]
Length=782

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkis-fsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K +++ P G  V V+P  L FN    K +      S SY  NTG++FGSLTW+DG++NV 
Sbjct  708  KPVIKAPLGFDVKVSPEELVFNKGTSKAAFTVSVSSGSYKANTGFFFGSLTWSDGLHNVT  767

Query  184  IPISVKTMY  158
            IP+SV+  +
Sbjct  768  IPVSVRANF  776



>ref|XP_009137185.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=781

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkis-fsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K +++ P G  V V+P  L FN    K +      S SY  NTG++FGSLTW+DG++NV 
Sbjct  707  KPVIKAPLGFDVKVSPEELVFNKGTSKAAFTVSVSSGSYKANTGFFFGSLTWSDGLHNVT  766

Query  184  IPISVKTMY  158
            IP+SV+  +
Sbjct  767  IPVSVRANF  775



>ref|XP_006413795.1| hypothetical protein EUTSA_v10024459mg [Eutrema salsugineum]
 gb|ESQ55248.1| hypothetical protein EUTSA_v10024459mg [Eutrema salsugineum]
Length=789

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkis-fsvkistSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  + V+P  L FN    K++      S S+  N+ +YFGSLTW+DG++NV 
Sbjct  715  KPVIEAPLGFDIKVSPDKLVFNKGTNKVAFTVSVSSGSHRANSAFYFGSLTWSDGLHNVT  774

Query  184  IPISVKTMY  158
            IP+SV+T +
Sbjct  775  IPVSVRTRF  783



>ref|XP_004309570.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=739

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 7/81 (9%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNN-VR  185
            K  + PP GI+V+V+P TL FN +++ I F+V++ST++  NTGYYFGSL W D   + V 
Sbjct  663  KARISPPWGISVAVSPETLVFNSNIETIYFTVEVSTTHEVNTGYYFGSLAWTDEWGHVVT  722

Query  184  IPISVKTMY*VRIKILLWELD  122
            IP+SV+T      +I+L+  D
Sbjct  723  IPMSVRT------QIILYYAD  737



>ref|XP_002317660.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
 gb|EEE98272.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
Length=786

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +V+ P GI + V P+TL+FN + K +S+ V   ++     GY FGSLTW DG + VR 
Sbjct  714  KAIVQAPFGINMRVEPTTLSFNMNNKILSYEVTFFSTQKVQGGYRFGSLTWTDGEHFVRS  773

Query  181  PISVKTM  161
            PISV+ M
Sbjct  774  PISVRAM  780



>gb|AID21602.1| At4g21323p-like protein [Arabidopsis halleri]
Length=803

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN    K++F V++S  S+  NT ++FGSLTW+DG++NV 
Sbjct  729  KPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFFFGSLTWSDGLHNVT  788

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  789  IPISLRTRF  797



>gb|AID21582.1| AT4G21323p [Arabidopsis halleri]
Length=804

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN    K++F V++S  S+  NT ++FGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVSPKKLKFNKKRNKVAFKVRVSPGSHRVNTAFFFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>ref|XP_006370728.1| hypothetical protein POPTR_0001s45460g, partial [Populus trichocarpa]
 gb|ERP67297.1| hypothetical protein POPTR_0001s45460g, partial [Populus trichocarpa]
Length=333

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  349  EPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPISV  170
             PP GI+VSV P T  FN +   +SF V  ST++  NT +YFGSLTW DG + V  PISV
Sbjct  266  SPPFGISVSVRPQTSIFNSTTNTVSFKVTFSTTHKVNTRFYFGSLTWTDGFHAVTSPISV  325

Query  169  KTM  161
            +T 
Sbjct  326  RTQ  328



>ref|XP_010919043.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Elaeis 
guineensis]
Length=741

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  352  VEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPIS  173
            V PP+GI + V P  L FN ++  ISF+V  ++S   ++ Y FGSLTW DGV+ VR P++
Sbjct  670  VHPPRGIKMEVMPLILEFNSTITSISFTVTFTSSRRVHSDYRFGSLTWTDGVHVVRSPVA  729

Query  172  VKTM  161
            V+ +
Sbjct  730  VRAI  733



>gb|ADQ37368.1| unknown [Arabidopsis lyrata]
Length=696

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            + +VEPP+G+ + V P  L F  + KK+ F V++S+S+  NTG+ FGS TW DG  NV I
Sbjct  626  RAVVEPPRGVKIVVEPEILMFCSNTKKLEFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTI  685

Query  181  PISVKT  164
             +SV+T
Sbjct  686  SLSVRT  691



>gb|AID21619.1| At4g21323p-like protein [Arabidopsis halleri]
Length=804

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN    K++F V++S  S+  NT ++FGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFFFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +  VE P G+ V+V PS L FN +  ++SF V           Y FGSLTW DG + VRI
Sbjct  696  RARVEAPPGVGVTVNPSLLIFNSTTNRLSFRVTFQAKLKVQGRYTFGSLTWEDGAHTVRI  755

Query  181  PISVKTM  161
            P+ V+TM
Sbjct  756  PLVVRTM  762



>gb|AID21627.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L F+    K++F V++S  S+  NT +YFGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVSPKKLKFSKRRSKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>ref|XP_010919042.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Elaeis 
guineensis]
Length=792

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  352  VEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRIPIS  173
            V PP+GI + V P  L FN ++  ISF+V  ++S   ++ Y FGSLTW DGV+ VR P++
Sbjct  721  VHPPRGIKMEVMPLILEFNSTITSISFTVTFTSSRRVHSDYRFGSLTWTDGVHVVRSPVA  780

Query  172  VKTM  161
            V+ +
Sbjct  781  VRAI  784



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = -2

Query  352  VEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNN-VRIPI  176
            VE P+G++V V PS L FN +V+K+ F V   +     +GY FGSLTW DGV++ VRIP+
Sbjct  697  VEAPRGVSVRVRPSILAFNSTVQKLKFKVTFGSRLKVQSGYLFGSLTWKDGVHHLVRIPL  756

Query  175  SVK  167
            +++
Sbjct  757  AIR  759



>ref|XP_002873539.1| hypothetical protein ARALYDRAFT_909167 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49798.1| hypothetical protein ARALYDRAFT_909167 [Arabidopsis lyrata subsp. 
lyrata]
Length=544

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            +V+++ P G+ ++VTP+ L FN  VKK+SF V +ST++  N+ YYFGS+TW DG + V I
Sbjct  472  RVIIQAPLGVEITVTPTLLVFNCFVKKLSFEVTVSTTHQSNSIYYFGSITWTDGYHVVSI  531

Query  181  PISVK  167
            P+SV+
Sbjct  532  PLSVR  536



>ref|XP_010511549.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWND-GVNNV  188
            K +++ P+GI + V+P TL F+ +       +VK+ST++  NT Y+FGSLTW D G +NV
Sbjct  686  KAVIQQPQGINLQVSPETLEFSSNTTNRITFTVKVSTTHKANTDYHFGSLTWIDNGGHNV  745

Query  187  RIPISVKT  164
            RIP+SV+T
Sbjct  746  RIPLSVRT  753



>emb|CCI61493.1| unnamed protein product [Arabidopsis halleri]
Length=804

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V P  L FN    K++F V++S  S+  NT +YFGSLTW+DG++NV 
Sbjct  730  KPVIETPLGFKVVVWPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVT  789

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  790  IPISLRTRF  798



>ref|NP_567624.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84440.1| Subtilase family protein [Arabidopsis thaliana]
Length=803

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkis-tSYLFNTGYYFGSLTWNDGVNNVR  185
            K ++E P G  V V+P  L FN +  K++F+V +S  S+  NT +YFGSLTW+D V+NV 
Sbjct  729  KPVIEAPFGFNVVVSPKKLKFNKTRNKLAFTVTVSPGSHRVNTAFYFGSLTWSDKVHNVT  788

Query  184  IPISVKTMY  158
            IPIS++T +
Sbjct  789  IPISLRTRF  797



>ref|XP_011040612.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K +V+ P GI + V P TL+FN S K +S+ V   ++     GY FGSLTW DG + VR 
Sbjct  706  KAIVQAPFGINMRVEPPTLSFNMSNKILSYEVTFFSTQKVQGGYRFGSLTWTDGEHFVRS  765

Query  181  PISVKTM  161
            PISV+ M
Sbjct  766  PISVRAM  772



>ref|XP_009137186.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=746

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTG-YYFGSLTWNDGVNNVR  185
            + ++EPP+G+ ++V P TL FN S K + F V+++TS+  N   Y FGS TW DG  NV 
Sbjct  678  RAVIEPPRGVKIAVEPETLVFNASTKILGFKVRVTTSHKNNMPVYLFGSFTWTDGTRNVT  737

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  738  IPLSVRT  744



>ref|XP_010511550.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=676

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisf-svkistSYLFNTGYYFGSLTWND-GVNNV  188
            K +++ P+GI + V+P TL F+ +       +VK+ST++  NT Y+FGSLTW D G +NV
Sbjct  602  KAVIQQPQGINLQVSPETLEFSSNTTNRITFTVKVSTTHKANTDYHFGSLTWIDNGGHNV  661

Query  187  RIPISVKT  164
            RIP+SV+T
Sbjct  662  RIPLSVRT  669



>emb|CDY70485.1| BnaA03g58450D, partial [Brassica napus]
Length=734

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTG-YYFGSLTWNDGVNNVR  185
            + ++EPP+G+ ++V P TL FN S K + F V+++TS+  N   Y FGS TW DG  NV 
Sbjct  666  RAVIEPPRGVKIAVEPETLVFNASTKILGFKVRVTTSHKNNMPVYLFGSFTWTDGTRNVT  725

Query  184  IPISVKT  164
            IP+SV+T
Sbjct  726  IPLSVRT  732



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -2

Query  361  KVMVEPPKGITVSVTPSTLNFNPsvkkisfsvkistSYLFNTGYYFGSLTWNDGVNNVRI  182
            K  VE   GI ++V P  L F+   K I+F+V IS+++  N GYYFGSLTW DG + VR 
Sbjct  704  KANVEFASGINIAVRPEILIFSSKTKTITFTVMISSAHNVNAGYYFGSLTWTDGGHVVRS  763

Query  181  PISVKT  164
            PISV+T
Sbjct  764  PISVRT  769



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 531073620825