BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24480_g3_i3 len=1845 path=[1:0-411 @413@!:412-1786 1788:1787-1822
12027:1823-1844]

Length=1845
                                                                      Score     E

ref|XP_009624611.1|  PREDICTED: protein FAM135B-like                    448   2e-143   
ref|XP_009764933.1|  PREDICTED: protein FAM135B-like                    444   6e-142   
ref|XP_004236518.1|  PREDICTED: protein FAM135B-like                    441   1e-140   
ref|XP_006344989.1|  PREDICTED: protein FAM135B-like                    431   1e-136   
ref|XP_011087183.1|  PREDICTED: protein FAM135B-like                    424   7e-134   
emb|CDP14916.1|  unnamed protein product                                419   3e-132   
ref|XP_010657558.1|  PREDICTED: protein FAM135B-like isoform X2         397   4e-124   
ref|XP_010657559.1|  PREDICTED: protein FAM135B-like isoform X3         397   8e-124   
emb|CBI20004.3|  unnamed protein product                                393   2e-122   
ref|XP_010657557.1|  PREDICTED: protein FAM135B-like isoform X1         392   4e-122   
ref|XP_008219154.1|  PREDICTED: protein FAM135B                         388   2e-120   
ref|XP_007225275.1|  hypothetical protein PRUPE_ppa001454mg             385   3e-119   
gb|KHN05988.1|  Protein FAM135B-like protein                            367   3e-116   
ref|XP_007018374.1|  Serine esterase family protein, putative iso...    371   8e-116   
ref|XP_009357226.1|  PREDICTED: protein FAM135B-like                    374   4e-115   
ref|XP_008378676.1|  PREDICTED: protein FAM135B-like isoform X2         357   7e-114   
ref|XP_008378679.1|  PREDICTED: uncharacterized protein LOC103441...    356   1e-113   
ref|XP_008378677.1|  PREDICTED: uncharacterized protein LOC103441...    356   1e-113   
ref|XP_008378675.1|  PREDICTED: uncharacterized protein LOC103441...    356   2e-113   
ref|XP_007018372.1|  Serine esterase family protein, putative iso...    369   4e-113   
ref|XP_007018371.1|  Serine esterase family protein isoform 1           366   2e-111   
gb|KHF98482.1|  Uncharacterized protein F383_15397                      364   2e-111   
ref|XP_007161366.1|  hypothetical protein PHAVU_001G063100g             355   2e-111   
ref|XP_007161367.1|  hypothetical protein PHAVU_001G063100g             355   3e-111   
ref|XP_006601058.1|  PREDICTED: protein FAM135B-like isoform X5         360   1e-110   
ref|XP_006601054.1|  PREDICTED: protein FAM135B-like isoform X1         360   2e-110   
ref|XP_006601057.1|  PREDICTED: protein FAM135B-like isoform X4         360   2e-110   
gb|EYU26438.1|  hypothetical protein MIMGU_mgv1a001820mg                358   2e-109   
ref|XP_008464798.1|  PREDICTED: protein FAM135B-like isoform X1         357   9e-109   
gb|KDO50641.1|  hypothetical protein CISIN_1g003622mg                   352   1e-108   
ref|XP_004146761.1|  PREDICTED: protein FAM135B-like                    356   2e-108   
ref|XP_010260961.1|  PREDICTED: uncharacterized protein LOC104599...    348   2e-108   
ref|XP_009335484.1|  PREDICTED: protein FAM135B-like isoform X2         356   3e-108   
ref|XP_010671312.1|  PREDICTED: uncharacterized protein LOC104888...    350   6e-108   
ref|XP_009335483.1|  PREDICTED: protein FAM135B-like isoform X1         355   6e-108   
ref|XP_011071768.1|  PREDICTED: protein FAM135B-like                    353   8e-108   
ref|XP_010260962.1|  PREDICTED: uncharacterized protein LOC104599...    346   1e-107   
ref|XP_010260959.1|  PREDICTED: uncharacterized protein LOC104599...    345   2e-107   
ref|XP_010061587.1|  PREDICTED: protein FAM135B-like isoform X2         352   4e-107   
ref|XP_010061586.1|  PREDICTED: protein FAM135B-like isoform X1         353   4e-107   
ref|XP_002528165.1|  conserved hypothetical protein                     353   6e-107   Ricinus communis
ref|XP_006432281.1|  hypothetical protein CICLE_v10000310mg             352   1e-106   
ref|XP_006491849.1|  PREDICTED: protein FAM135B-like isoform X1         350   3e-106   
gb|KDO50637.1|  hypothetical protein CISIN_1g003622mg                   350   4e-106   
ref|XP_010671308.1|  PREDICTED: protein FAM135B-like isoform X1         350   6e-106   
ref|XP_011031519.1|  PREDICTED: protein FAM135B-like isoform X1         348   1e-105   
ref|XP_011031520.1|  PREDICTED: protein FAM135B-like isoform X2         348   1e-105   
ref|XP_004498451.1|  PREDICTED: protein FAM135B-like isoform X2         347   2e-105   
ref|XP_004498450.1|  PREDICTED: protein FAM135B-like isoform X1         347   4e-105   
ref|XP_008464799.1|  PREDICTED: protein FAM135B-like isoform X2         347   6e-105   
ref|XP_006491850.1|  PREDICTED: protein FAM135B-like isoform X2         347   8e-105   
gb|KDO50636.1|  hypothetical protein CISIN_1g003622mg                   347   8e-105   
ref|XP_010671310.1|  PREDICTED: protein FAM135B-like isoform X2         344   3e-104   
gb|KHN39182.1|  Protein FAM135B-like protein                            337   6e-104   
ref|XP_009416893.1|  PREDICTED: protein FAM135B-like isoform X1         344   1e-103   
ref|XP_010241697.1|  PREDICTED: protein FAM135B-like isoform X2         342   3e-103   
ref|XP_009416894.1|  PREDICTED: protein FAM135B-like isoform X2         342   5e-103   
ref|XP_010241696.1|  PREDICTED: protein FAM135B-like isoform X1         342   5e-103   
ref|XP_009403472.1|  PREDICTED: uncharacterized protein LOC103987...    339   7e-103   
gb|KDO50635.1|  hypothetical protein CISIN_1g003622mg                   341   1e-102   
ref|XP_004299845.1|  PREDICTED: protein FAM135B-like                    341   1e-102   
gb|KEH31286.1|  serine esterase family protein, putative                340   2e-102   
ref|XP_009403464.1|  PREDICTED: protein FAM135B-like isoform X2         339   8e-102   
ref|XP_009403456.1|  PREDICTED: protein FAM135B-like isoform X1         339   9e-102   
gb|KEH39721.1|  serine esterase family protein, putative                340   2e-101   
ref|XP_006584994.1|  PREDICTED: protein FAM135B-like isoform X2         337   3e-101   
ref|XP_006584995.1|  PREDICTED: protein FAM135B-like isoform X3         336   4e-101   
ref|XP_003532627.1|  PREDICTED: protein FAM135B-like isoform X1         337   4e-101   
ref|XP_002325960.2|  hypothetical protein POPTR_0019s10640g             336   7e-101   Populus trichocarpa [western balsam poplar]
ref|XP_003532974.2|  PREDICTED: protein FAM135B-like isoform X1         335   1e-100   
ref|XP_006300307.1|  hypothetical protein CARUB_v10019821mg             331   1e-100   
gb|KHG18911.1|  Uncharacterized protein F383_24156                      335   1e-100   
gb|EYU42501.1|  hypothetical protein MIMGU_mgv1a019105mg                334   2e-100   
ref|XP_006433706.1|  hypothetical protein CICLE_v10000361mg             333   7e-100   
gb|KDO81354.1|  hypothetical protein CISIN_1g004223mg                   332   1e-99    
ref|XP_006376124.1|  hypothetical protein POPTR_0013s10030g             332   2e-99    
ref|XP_006472989.1|  PREDICTED: protein FAM135B-like                    332   3e-99    
gb|KHG27392.1|  Uncharacterized protein F383_03647                      331   3e-99    
ref|XP_006585465.1|  PREDICTED: protein FAM135B-like isoform X3         330   1e-98    
ref|XP_011003969.1|  PREDICTED: protein FAM135B-like isoform X2         327   1e-98    
gb|KHN33483.1|  Protein FAM135B-like protein                            329   2e-98    
ref|XP_010414739.1|  PREDICTED: protein FAM135B-like isoform X1         329   3e-98    
ref|XP_006300308.1|  hypothetical protein CARUB_v10019821mg             329   3e-98    
ref|XP_006578252.1|  PREDICTED: protein FAM135B-like isoform X4         329   4e-98    
ref|XP_003523761.1|  PREDICTED: protein FAM135B-like isoform X1         329   4e-98    
ref|XP_010912436.1|  PREDICTED: uncharacterized protein LOC105038...    328   5e-98    
ref|NP_001185264.1|  protein ZW18                                       327   5e-98    
gb|KHN08199.1|  Protein FAM135A-like protein                            328   6e-98    
ref|XP_008378681.1|  PREDICTED: protein FAM135B-like isoform X6         314   7e-98    
ref|XP_008784168.1|  PREDICTED: uncharacterized protein LOC103703...    328   8e-98    
ref|XP_010912437.1|  PREDICTED: uncharacterized protein LOC105038...    327   9e-98    
ref|XP_008784166.1|  PREDICTED: uncharacterized protein LOC103703...    328   1e-97    
ref|XP_010511081.1|  PREDICTED: protein FAM135B-like isoform X1         328   1e-97    
ref|XP_008784165.1|  PREDICTED: uncharacterized protein LOC103703...    328   1e-97    
ref|XP_006597335.1|  PREDICTED: protein FAM135B-like isoform X1         327   1e-97    
gb|EPS74264.1|  hypothetical protein M569_00489                         326   2e-97    
ref|NP_564732.1|  protein ZW18                                          327   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003968.1|  PREDICTED: protein FAM135B-like isoform X1         326   3e-97    
ref|XP_006581472.1|  PREDICTED: protein FAM135B-like isoform X2         326   4e-97    
ref|XP_010470263.1|  PREDICTED: protein FAM135B-like                    326   5e-97    
ref|XP_003527859.1|  PREDICTED: protein FAM135B-like isoform X1         326   5e-97    
ref|XP_010912435.1|  PREDICTED: protein FAM135B-like isoform X2         327   5e-97    
ref|XP_010912434.1|  PREDICTED: protein FAM135B-like isoform X1         326   6e-97    
ref|XP_010414740.1|  PREDICTED: protein FAM135B-like isoform X2         326   6e-97    
ref|XP_006392304.1|  hypothetical protein EUTSA_v10023308mg             323   9e-97    
ref|XP_006585466.1|  PREDICTED: protein FAM135B-like isoform X4         323   4e-96    
ref|XP_010511082.1|  PREDICTED: protein FAM135B-like isoform X2         323   6e-96    
ref|XP_004504749.1|  PREDICTED: protein FAM135B-like isoform X2         322   1e-95    
ref|XP_006417506.1|  hypothetical protein EUTSA_v10006833mg             322   2e-95    
gb|KDP30675.1|  hypothetical protein JCGZ_15550                         321   3e-95    
ref|XP_010458322.1|  PREDICTED: protein FAM135B-like isoform X1         321   4e-95    
ref|XP_004485525.1|  PREDICTED: protein FAM135B-like                    320   6e-95    
ref|XP_006306176.1|  hypothetical protein CARUB_v10011744mg             320   7e-95    
ref|XP_010480403.1|  PREDICTED: protein FAM135B-like                    316   7e-95    
ref|XP_004504748.1|  PREDICTED: protein FAM135B-like isoform X1         320   8e-95    
ref|XP_002510012.1|  conserved hypothetical protein                     319   1e-94    Ricinus communis
ref|XP_002892542.1|  hypothetical protein ARALYDRAFT_888257             320   1e-94    
ref|XP_004504750.1|  PREDICTED: protein FAM135B-like isoform X3         319   2e-94    
ref|XP_002886694.1|  hypothetical protein ARALYDRAFT_475399             318   2e-94    
ref|XP_010490575.1|  PREDICTED: protein FAM135B-like isoform X1         319   2e-94    
ref|XP_010458323.1|  PREDICTED: protein FAM135B-like isoform X2         319   2e-94    
ref|XP_008781420.1|  PREDICTED: uncharacterized protein LOC103701...    318   6e-94    
ref|XP_008781421.1|  PREDICTED: uncharacterized protein LOC103701...    318   7e-94    
ref|XP_010544041.1|  PREDICTED: protein FAM135B isoform X2              317   8e-94    
ref|XP_010104541.1|  Xylulose kinase                                    325   8e-94    
ref|XP_010548718.1|  PREDICTED: protein FAM135B-like isoform X1         317   1e-93    
ref|XP_010544040.1|  PREDICTED: protein FAM135B isoform X1              317   1e-93    
ref|XP_010548759.1|  PREDICTED: protein FAM135B-like isoform X2         316   3e-93    
ref|XP_002518844.1|  conserved hypothetical protein                     312   7e-93    Ricinus communis
ref|XP_010930972.1|  PREDICTED: protein FAM135B-like isoform X1         315   9e-93    
ref|XP_010930973.1|  PREDICTED: protein FAM135B-like isoform X2         315   1e-92    
ref|XP_010490582.1|  PREDICTED: protein FAM135B-like isoform X2         314   1e-92    
emb|CDY53830.1|  BnaA09g57220D                                          313   2e-92    
ref|XP_009118280.1|  PREDICTED: protein FAM135B-like isoform X1         313   3e-92    
ref|XP_003603667.1|  Protein FAM135A                                    312   3e-92    
ref|XP_008339057.1|  PREDICTED: protein FAM135B-like isoform X1         297   4e-92    
ref|NP_172469.2|  putative serine esterase family protein               312   6e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113319.1|  PREDICTED: protein FAM135B isoform X2              312   7e-92    
gb|AAC34330.1|  Unknown protein                                         313   1e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDY48842.1|  BnaA09g14710D                                          312   1e-91    
ref|XP_006597336.1|  PREDICTED: protein FAM135B-like isoform X2         311   2e-91    
emb|CDY22610.1|  BnaC08g42440D                                          311   2e-91    
ref|XP_006851399.1|  hypothetical protein AMTR_s00040p00048570          310   7e-91    
ref|NP_001077501.1|  putative serine esterase family protein            309   1e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02191.1|  hypothetical protein                                   309   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113318.1|  PREDICTED: protein FAM135B isoform X1              309   1e-90    
emb|CDY42051.1|  BnaC09g15360D                                          309   1e-90    
ref|XP_007137278.1|  hypothetical protein PHAVU_009G113900g             307   3e-90    
ref|XP_007137277.1|  hypothetical protein PHAVU_009G113900g             307   4e-90    
emb|CDY57934.1|  BnaA06g38020D                                          305   2e-89    
ref|XP_009148317.1|  PREDICTED: protein FAM135B-like                    305   3e-89    
ref|XP_007148461.1|  hypothetical protein PHAVU_006G210700g             304   6e-89    
ref|XP_004172147.1|  PREDICTED: protein FAM135B-like                    281   2e-86    
ref|XP_008339058.1|  PREDICTED: protein FAM135B-like isoform X2         277   3e-85    
ref|XP_004977307.1|  PREDICTED: protein FAM135B-like isoform X1         293   1e-84    
emb|CDY62730.1|  BnaC05g49220D                                          290   8e-84    
ref|XP_003578866.1|  PREDICTED: protein FAM135B-like isoform X1         288   1e-82    
ref|XP_006663851.1|  PREDICTED: protein FAM135B-like                    287   2e-82    
gb|EAY82379.1|  hypothetical protein OsI_37591                          285   1e-81    Oryza sativa Indica Group [Indian rice]
gb|ABA95883.1|  ZW18 protein, putative, expressed                       285   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442863.1|  hypothetical protein SORBIDRAFT_08g004040          285   2e-81    Sorghum bicolor [broomcorn]
dbj|BAJ96339.1|  predicted protein                                      284   3e-81    
gb|EMS45160.1|  hypothetical protein TRIUR3_28212                       281   5e-81    
gb|KDP41550.1|  hypothetical protein JCGZ_15957                         280   2e-80    
ref|XP_008378680.1|  PREDICTED: protein FAM135B-like isoform X5         268   3e-80    
tpg|DAA55595.1|  TPA: hypothetical protein ZEAMMB73_390128              273   5e-78    
ref|XP_008674445.1|  PREDICTED: protein FAM135B-like isoform X1         273   3e-77    
gb|EAZ19756.1|  hypothetical protein OsJ_35335                          265   2e-74    Oryza sativa Japonica Group [Japonica rice]
gb|AFW56158.1|  hypothetical protein ZEAMMB73_791038                    260   5e-73    
gb|KHN26706.1|  Protein FAM135B-like protein                            245   2e-67    
ref|XP_004980194.1|  PREDICTED: uncharacterized protein LOC101768227    245   4e-67    
ref|XP_007159044.1|  hypothetical protein PHAVU_002G204000g             244   4e-67    
ref|XP_003577790.1|  PREDICTED: protein FAM135B-like isoform X1         243   1e-66    
ref|XP_008784169.1|  PREDICTED: uncharacterized protein LOC103703...    241   4e-66    
ref|XP_010912438.1|  PREDICTED: uncharacterized protein LOC105038...    241   4e-66    
gb|AFW65627.1|  hypothetical protein ZEAMMB73_476369                    234   1e-65    
gb|AAX96483.1|  Putative serine esterase (DUF676)                       239   2e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006581473.1|  PREDICTED: protein FAM135B-like isoform X3         233   6e-64    
gb|KHN37209.1|  Protein FAM135A-like protein                            233   6e-64    
ref|XP_002450339.1|  hypothetical protein SORBIDRAFT_05g003960          233   2e-63    Sorghum bicolor [broomcorn]
ref|XP_008679700.1|  PREDICTED: protein FAM135B-like isoform X2         232   7e-63    
ref|XP_008679699.1|  PREDICTED: protein FAM135B-like isoform X1         232   8e-63    
ref|XP_008781422.1|  PREDICTED: uncharacterized protein LOC103701...    229   7e-62    
ref|XP_010061589.1|  PREDICTED: uncharacterized protein LOC104449...    209   2e-60    
ref|XP_010930976.1|  PREDICTED: uncharacterized protein LOC105051...    224   4e-60    
gb|EEC67744.1|  hypothetical protein OsI_35253                          223   5e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_004977308.1|  PREDICTED: protein FAM135B-like isoform X2         215   4e-57    
gb|EMT01462.1|  hypothetical protein F775_52678                         216   4e-57    
gb|EMT05862.1|  hypothetical protein F775_18479                         215   2e-56    
ref|XP_006491851.1|  PREDICTED: protein FAM135B-like isoform X3         210   1e-55    
gb|KDO50638.1|  hypothetical protein CISIN_1g003622mg                   210   1e-55    
ref|XP_004504751.1|  PREDICTED: protein FAM135B-like isoform X4         210   2e-55    
gb|KDO50639.1|  hypothetical protein CISIN_1g003622mg                   208   6e-55    
ref|XP_010260963.1|  PREDICTED: uncharacterized protein LOC104599...    197   2e-52    
ref|XP_008674446.1|  PREDICTED: uncharacterized protein LOC103650...    196   1e-50    
emb|CAN69922.1|  hypothetical protein VITISV_025317                     185   5e-47    Vitis vinifera
ref|XP_009118283.1|  PREDICTED: uncharacterized protein LOC103843...    178   2e-44    
emb|CAN79530.1|  hypothetical protein VITISV_042727                     168   5e-43    Vitis vinifera
ref|XP_008679701.1|  PREDICTED: uncharacterized protein LOC103654...    171   4e-42    
ref|XP_010238687.1|  PREDICTED: uncharacterized protein LOC100833...    164   6e-40    
ref|XP_002965112.1|  hypothetical protein SELMODRAFT_406265             158   5e-38    
emb|CBI39933.3|  unnamed protein product                                152   7e-37    
gb|KHN34258.1|  hypothetical protein glysoja_049386                     145   4e-36    
ref|XP_010548765.1|  PREDICTED: uncharacterized protein LOC104820...    147   2e-34    
ref|XP_010237907.1|  PREDICTED: uncharacterized protein LOC100837...    138   3e-31    
emb|CAN63299.1|  hypothetical protein VITISV_044137                     135   5e-31    Vitis vinifera
ref|XP_010930974.1|  PREDICTED: uncharacterized protein LOC105051...    138   6e-31    
ref|XP_008679702.1|  PREDICTED: uncharacterized protein LOC103654...    132   4e-29    
ref|XP_008378702.1|  PREDICTED: uncharacterized protein LOC103441782    122   3e-28    
emb|CAN73093.1|  hypothetical protein VITISV_041305                     120   1e-27    Vitis vinifera
emb|CAN75944.1|  hypothetical protein VITISV_040742                     110   3e-22    Vitis vinifera
ref|XP_006432280.1|  hypothetical protein CICLE_v10000310mg           94.7    5e-17    
ref|XP_007159043.1|  hypothetical protein PHAVU_002G203900g           86.7    1e-16    
gb|KDO50640.1|  hypothetical protein CISIN_1g003622mg                 92.0    3e-16    
ref|XP_004170721.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAM1...  88.6    4e-15    
ref|XP_006596303.1|  PREDICTED: nucleoside diphosphate kinase 2, ...  74.3    5e-11    
gb|KHN34458.1|  Nucleoside diphosphate kinase 2, chloroplastic        72.4    7e-11    
gb|AAB60753.1|  F21M12.37 gene product                                61.6    1e-06    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85156.1|  predicted protein                                    61.6    1e-06    
ref|XP_003760456.1|  PREDICTED: protein FAM135B                       58.5    2e-05    



>ref|XP_009624611.1| PREDICTED: protein FAM135B-like [Nicotiana tomentosiformis]
Length=819

 Score =   448 bits (1152),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 254/400 (64%), Positives = 306/400 (77%), Gaps = 19/400 (5%)
 Frame = +1

Query  622   MSIILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRN  801
             MS+IL R RW+IAGLN+  P TPKRL+S + RP  LL  SQ+QQ Q +KS  +S S HR 
Sbjct  1     MSVILRRFRWMIAGLNKGTPGTPKRLHSADVRPVPLLPLSQQQQLQLLKSYYESKSEHRK  60

Query  802   -SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
               Q ML+AV+EI++YIHRFHNLDLFQQGWYQIKITMRWE+GDY  +GTPSRV+QYEAPD 
Sbjct  61    PKQPMLEAVHEISIYIHRFHNLDLFQQGWYQIKITMRWEDGDYGLLGTPSRVIQYEAPDL  120

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
             GS+++ GVW IDDTD+S+ TQPFRIKYARQDILLS++VSFNLSLSK+E      +SAVIL
Sbjct  121   GSEDVYGVWRIDDTDHSFSTQPFRIKYARQDILLSMMVSFNLSLSKHE---GPPASAVIL  177

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL YAPILENG +LQ+SLD  PAAVHEFRLP KALLGLHSYCPVHFDAFHAVLVD SV
Sbjct  178   KFELFYAPILENGISLQSSLDACPAAVHEFRLPSKALLGLHSYCPVHFDAFHAVLVDVSV  237

Query  1339  HICLLKRGVHTLSSKVASGSCSD-DASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKA  1515
             HI LLK GV+T S KV S S  D D+++ED+D+AKQ +L+K F  ARDIL EEL+K+SKA
Sbjct  238   HISLLKGGVYTSSQKVPSESRVDEDSNTEDYDQAKQEMLVKAFSGARDILFEELQKISKA  297

Query  1516  INQAIDVNDFSSKHEDKDLFTSRQSTSSKD----NAEVSGQMPSQKQSVSQKRNGITDFR  1683
             INQ+ID  DF+SK +D+      +   S D    N + SG++PS+        NG     
Sbjct  298   INQSIDFTDFTSKFDDEQ---GSKFPPSADTDLMNGKASGEVPSKIS------NGFKKL-  347

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             N+ V  S SKD+L  L+HS GNQV YLWS+F++FHR H+T
Sbjct  348   NDGVFQSQSKDDLSQLYHSLGNQVLYLWSLFMRFHRTHKT  387



>ref|XP_009764933.1| PREDICTED: protein FAM135B-like [Nicotiana sylvestris]
Length=819

 Score =   444 bits (1143),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 256/401 (64%), Positives = 303/401 (76%), Gaps = 21/401 (5%)
 Frame = +1

Query  622   MSIILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRN  801
             MS+IL R RW+IAGLN+  P TPKRL+S + RP  LL  SQKQQ Q +KS  +S S HR 
Sbjct  1     MSVILRRFRWMIAGLNKGTPGTPKRLHSADVRPVPLLPLSQKQQLQLLKSYYESKSEHRK  60

Query  802   -SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
               Q ML+AV+EI++YIHRFHNLDLFQQGWYQIKITMRWE+GDY  +GTPSRV+QYEAPD 
Sbjct  61    PKQPMLEAVHEISIYIHRFHNLDLFQQGWYQIKITMRWEDGDYGLLGTPSRVIQYEAPDL  120

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
             GS+++ GVW IDDTD+S+ TQPFRIKYARQDILLS++VSFNLSLSK+E      +SAVIL
Sbjct  121   GSEDVYGVWRIDDTDHSFSTQPFRIKYARQDILLSMMVSFNLSLSKHE---GPPTSAVIL  177

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL YAPILENG +LQASLD  PAAVHEFRLP KALLGLHSYCPVHFDAFHAVLVD SV
Sbjct  178   KFELFYAPILENGISLQASLDACPAAVHEFRLPSKALLGLHSYCPVHFDAFHAVLVDVSV  237

Query  1339  HICLLKRGVHTLSSKVASGSCSD-DASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKA  1515
             HI LLK GV+T S KV S S  D D +SED+D+AKQ +L+K F  ARDIL EEL+K+SKA
Sbjct  238   HISLLKGGVYTSSQKVPSDSRVDEDNNSEDYDQAKQEMLVKAFSGARDILFEELQKISKA  297

Query  1516  INQAIDVNDFSSKHEDKD--LFTSRQST---SSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
             INQ+ID  DF+SK +D+    F     T   + K +AEV  ++P          NG    
Sbjct  298   INQSIDFTDFTSKFDDEQGSKFPPSADTDLMNDKASAEVPSKIP----------NGFKKL  347

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              N+ V  S SKD+L  L+HS GNQV YLWS+F++FHR H+ 
Sbjct  348   -NDGVFQSQSKDDLRQLYHSLGNQVLYLWSLFMRFHRTHKA  387



>ref|XP_004236518.1| PREDICTED: protein FAM135B-like [Solanum lycopersicum]
 ref|XP_010318952.1| PREDICTED: protein FAM135B-like [Solanum lycopersicum]
Length=819

 Score =   441 bits (1134),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 249/400 (62%), Positives = 303/400 (76%), Gaps = 19/400 (5%)
 Frame = +1

Query  622   MSIILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRN  801
             MS+IL RLRW+IAGLN+  PVT KRL+S + RP  L   S++QQ Q +KS  +S S HR 
Sbjct  1     MSVILRRLRWMIAGLNKGTPVTLKRLHSADVRPVPLSPLSKQQQLQLLKSYYESKSEHRK  60

Query  802   -SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
               Q ML+AV+EI++YIHRFHNLDLFQQGWYQIKITMRWENGD   +GTPSRV+QYEAPD 
Sbjct  61    PKQPMLEAVHEISIYIHRFHNLDLFQQGWYQIKITMRWENGDDGVLGTPSRVIQYEAPDL  120

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
             GS+++ GVW IDDTD+S+ TQPFRIKYARQDILLS++VSFNLSL+K+E      +S VIL
Sbjct  121   GSEDVYGVWRIDDTDHSFSTQPFRIKYARQDILLSMMVSFNLSLNKHE---GPSTSGVIL  177

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL YAPILENG +LQ S D  PAAVHEFRLPPKALLGLHSYCPVHFD FHAVLVD SV
Sbjct  178   KFELFYAPILENGTSLQDSSDASPAAVHEFRLPPKALLGLHSYCPVHFDVFHAVLVDVSV  237

Query  1339  HICLLKRGVHTLSSKVASGSCSD-DASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKA  1515
             HI LLK GVHT S KV S    D D  +ED++  KQ +LIK   +ARDILLEEL K+SK+
Sbjct  238   HISLLKSGVHTSSKKVPSDPPVDKDNDNEDYNPGKQEMLIKALSSARDILLEELEKISKS  297

Query  1516  INQAIDVNDFSSKHEDKDLFTSRQSTSSKD----NAEVSGQMPSQKQSVSQKRNGITDFR  1683
             INQ+ID+ DF+SK +DK    + Q  +S D    N E + ++PS+  + ++K        
Sbjct  298   INQSIDLTDFTSKFDDKQ---ASQFPASADTDLMNDEAAREVPSKILNGTKK-------L  347

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              + VL S SKDEL+ L+HS G+QVFYLWS+F++FHR H+T
Sbjct  348   EDGVLQSQSKDELLQLYHSLGDQVFYLWSMFMRFHRTHKT  387



>ref|XP_006344989.1| PREDICTED: protein FAM135B-like [Solanum tuberosum]
Length=819

 Score =   431 bits (1107),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 243/398 (61%), Positives = 301/398 (76%), Gaps = 15/398 (4%)
 Frame = +1

Query  622   MSIILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRN  801
             MS+IL RLRW+IAGLN+  PVTPKRL+S + RP  L   S++QQ Q +KS  +S S HR 
Sbjct  1     MSVILRRLRWMIAGLNKGTPVTPKRLHSADVRPVPLSPLSKQQQLQLLKSYYESKSEHRK  60

Query  802   -SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
               Q ML+AV+EI++YIHRFHNLDLFQQGWYQIKITMRWENGD   +GTPSRV+QYEAPD 
Sbjct  61    PKQPMLEAVHEISIYIHRFHNLDLFQQGWYQIKITMRWENGDNGVLGTPSRVIQYEAPDL  120

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
             GS+++ GVW IDDTD+S+ TQPFRIKYARQDILLS++VSFNLSL+ +E      +S VIL
Sbjct  121   GSEDVYGVWRIDDTDHSFSTQPFRIKYARQDILLSMMVSFNLSLNIHE---GPSTSGVIL  177

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL YAPILENG +L  SLD  PAAVHEFRLP KALLGLHSYCPVHFD FHAVLVD SV
Sbjct  178   KFELFYAPILENGTSLLDSLDASPAAVHEFRLPSKALLGLHSYCPVHFDVFHAVLVDVSV  237

Query  1339  HICLLKRGVHTLSSKVASGSCSD-DASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKA  1515
             HI LLK GV+T S KV S    D D  +ED+++ KQ +LIK   +ARD+LLEEL K+SKA
Sbjct  238   HISLLKSGVYTSSKKVPSDPRVDEDNDNEDYNQGKQEMLIKALSSARDLLLEELEKISKA  297

Query  1516  INQAIDVNDFSSKHEDKDL--FTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNE  1689
             INQ+ID  DF+SK  DK    F++  +T    N + + ++PS+  + ++K         +
Sbjct  298   INQSIDFTDFTSKFGDKQASQFSASAATDLM-NDKAAREVPSKILNDTKK-------LED  349

Query  1690  EVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              VL S SKDEL+ L+HS G+QV++LWS+F++FHR H+T
Sbjct  350   GVLQSQSKDELLQLYHSLGDQVYFLWSMFMRFHRTHKT  387



>ref|XP_011087183.1| PREDICTED: protein FAM135B-like [Sesamum indicum]
Length=821

 Score =   424 bits (1089),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 232/394 (59%), Positives = 298/394 (76%), Gaps = 9/394 (2%)
 Frame = +1

Query  622   MSIILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRN  801
             MS++L+RL+WII G N+    TPKRL+  + +P+  L+  Q ++ Q +K NS   +    
Sbjct  1     MSVLLQRLKWIINGFNKSPSFTPKRLDGPDVKPSPQLNFDQLEKQQAVKPNSLKPNREIF  60

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
              + ML+A +EI++YIHRFHNLDLFQQGWYQ+KITMRWE+ D  S+GTP+RVVQYEAPD G
Sbjct  61    KRPMLEAAHEISIYIHRFHNLDLFQQGWYQLKITMRWEDDDSGSLGTPARVVQYEAPDLG  120

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             SD+I GVW IDD D+S+ TQPFRI+YARQD+LL+++VSFNLSLSK+E      +SAVILK
Sbjct  121   SDDIYGVWRIDDIDHSFSTQPFRIRYARQDVLLAMMVSFNLSLSKFE---GPPTSAVILK  177

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FELLY P+LEN  N+QA LDT PAAVHEFRLPPKALLGLH+YCPVHFDAFHAVLVD SVH
Sbjct  178   FELLYTPVLENRFNVQACLDTSPAAVHEFRLPPKALLGLHAYCPVHFDAFHAVLVDTSVH  237

Query  1342  ICLLKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             + LLK GVH+ S K++S    +DD    + DK+KQV+L+K   +ARDILLEEL+K+SKAI
Sbjct  238   VSLLKSGVHSSSLKISSDPKANDDDIDGEHDKSKQVMLVKALSSARDILLEELQKLSKAI  297

Query  1519  NQAIDVNDFSSKHEDKDLFTSR-QSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEV  1695
             NQ ID+ND +S     +LF S  +S   + +A+V G + S  Q+V +K N   DFR++ +
Sbjct  298   NQPIDINDITS----NELFGSTPRSDRERVDAKVPGLVSSNPQNVLEKPNDEVDFRDDGL  353

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
             LHSLS D+L+  F   GNQ+ YLWS+FL FHRA+
Sbjct  354   LHSLSVDKLLRSFDLIGNQMSYLWSVFLNFHRAN  387



>emb|CDP14916.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   419 bits (1077),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 230/396 (58%), Positives = 296/396 (75%), Gaps = 13/396 (3%)
 Frame = +1

Query  622   MSIILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRN  801
             MS IL RLRW+I GLN+ AP   K+L+ T+ RP  LL+ SQ++Q+Q +  +S       +
Sbjct  1     MSAILRRLRWVITGLNKSAP---KKLHITDVRPLPLLTPSQQKQTQLLDLSSLEPKAKES  57

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
              Q ML+AV+EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +Y S+GTPSRVVQYEAPD G
Sbjct  58    EQPMLEAVHEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEYSSLGTPSRVVQYEAPDMG  117

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
              D+ICG+W I+DTD+S+ TQPFRI+YARQD+ LS++V+F L LSK+E L    +SAV+LK
Sbjct  118   CDDICGIWRINDTDHSFSTQPFRIRYARQDVFLSMMVAFTLPLSKHEGLS---TSAVLLK  174

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP+LE+  NL ASLD  PAAVHEFRLPPK+LLGLH+YCPVHFDAFH+VLVD +VH
Sbjct  175   FELMYAPVLEDSSNLLASLDACPAAVHEFRLPPKSLLGLHTYCPVHFDAFHSVLVDITVH  234

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I LLK G+   S +V SGS   + + E  D +KQV+LIK F+TARD+L+EEL+ +SKAIN
Sbjct  235   ISLLKGGLLPSSLQVPSGSLGREVAGEKNDTSKQVLLIKAFVTARDLLIEELQNLSKAIN  294

Query  1522  QAIDVNDFSSKHEDKDL---FTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEE  1692
             Q +D+ DF+SK +D +    F SR   ++  +  VSG+  S+  +  QK N   D ++  
Sbjct  295   QTVDIPDFTSKLDDNEFLGCFASRDEENT--DLVVSGKDSSEYNNGFQKGN--IDTQSFR  350

Query  1693  VLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              L SLS DEL+  FH  GNQ F+LWS F KFHRA++
Sbjct  351   TLDSLSNDELLRSFHLLGNQTFHLWSTFSKFHRANK  386



>ref|XP_010657558.1| PREDICTED: protein FAM135B-like isoform X2 [Vitis vinifera]
Length=801

 Score =   397 bits (1021),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 216/400 (54%), Positives = 274/400 (69%), Gaps = 41/400 (10%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW I G+N  A  +PKRL + + +P                             +
Sbjct  1     MFRRLRWFI-GMNHRAAASPKRLANAKPKP---------------------------PPA  32

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ ++E  GTP+RVVQYEAP+ G ++
Sbjct  33    MLETVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDEEFELPGTPARVVQYEAPELGPED  92

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDDTDNS+ TQPFRI+YARQD+LLS+++SFNLSL KYE L    +SA+ILKFEL
Sbjct  93    AYGVWRIDDTDNSFSTQPFRIRYARQDVLLSLMISFNLSLRKYEGLS---TSAIILKFEL  149

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP+LENG  LQASLD  PA+VHEFR+PPKALLGLHSYCPVHFD+FHAVLVD S+HI L
Sbjct  150   MYAPMLENGSELQASLDACPASVHEFRIPPKALLGLHSYCPVHFDSFHAVLVDISIHITL  209

Query  1351  LKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVV--------LIKGFLTARDILLEELRK  1503
             L+ G+H  SSKV S     +D + E+ + + Q +        + K    ARD LLEEL+K
Sbjct  210   LRAGIHAPSSKVPSNFHAVEDVAGENLNGSIQGMGHVADLKQVFKALFAARDRLLEELQK  269

Query  1504  VSKAINQAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
             +SK INQ ID+ DF SK  D  L  TS Q+     +A+ SGQ+  + QS  +K NGI + 
Sbjct  270   LSKEINQTIDLTDFISKLNDTKLIHTSLQADVVTTDAQPSGQVSGEPQSGLEKANGIVEL  329

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             R++  L+SLSKD+L+  FH  GNQ+ YLW+ FL FHRA++
Sbjct  330   RSDRPLNSLSKDDLLNSFHLLGNQILYLWNTFLNFHRANK  369



>ref|XP_010657559.1| PREDICTED: protein FAM135B-like isoform X3 [Vitis vinifera]
Length=793

 Score =   397 bits (1019),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 217/394 (55%), Positives = 273/394 (69%), Gaps = 37/394 (9%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW I G+N  A  +PKRL + + +P                             +
Sbjct  1     MFRRLRWFI-GMNHRAAASPKRLANAKPKP---------------------------PPA  32

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEA--PDTGS  984
             ML+ V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ ++E  GTP+RVVQYEA  P+ G 
Sbjct  33    MLETVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDEEFELPGTPARVVQYEAAAPELGP  92

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
             ++  GVW IDDTDNS+ TQPFRI+YARQD+LLS+++SFNLSL KYE L    +SA+ILKF
Sbjct  93    EDAYGVWRIDDTDNSFSTQPFRIRYARQDVLLSLMISFNLSLRKYEGLS---TSAIILKF  149

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP+LENG  LQASLD  PA+VHEFR+PPKALLGLHSYCPVHFD+FHAVLVD S+HI
Sbjct  150   ELMYAPMLENGSELQASLDACPASVHEFRIPPKALLGLHSYCPVHFDSFHAVLVDISIHI  209

Query  1345  CLLKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
              LL+ G+H  SSKV S     +D + E+ + + QV   K    ARD LLEEL+K+SK IN
Sbjct  210   TLLRAGIHAPSSKVPSNFHAVEDVAGENLNGSIQV--FKALFAARDRLLEELQKLSKEIN  267

Query  1522  QAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             Q ID+ DF SK  D  L  TS Q+     +A+ SGQ+  + QS  +K NGI + R++  L
Sbjct  268   QTIDLTDFISKLNDTKLIHTSLQADVVTTDAQPSGQVSGEPQSGLEKANGIVELRSDRPL  327

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +SLSKD+L+  FH  GNQ+ YLW+ FL FHRA++
Sbjct  328   NSLSKDDLLNSFHLLGNQILYLWNTFLNFHRANK  361



>emb|CBI20004.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   393 bits (1009),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 217/394 (55%), Positives = 269/394 (68%), Gaps = 46/394 (12%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW I G+N  A  +PKRL + + +P                             +
Sbjct  1     MFRRLRWFI-GMNHRAAASPKRLANAKPKP---------------------------PPA  32

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ ++E  GTP+RVVQYEAP+ G ++
Sbjct  33    MLETVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDEEFELPGTPARVVQYEAPELGPED  92

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDDTDNS+ TQPFRI+YARQD+LLS+++SFNLSL KYE L    +SA+ILKFEL
Sbjct  93    AYGVWRIDDTDNSFSTQPFRIRYARQDVLLSLMISFNLSLRKYEGLS---TSAIILKFEL  149

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP+LENG  LQASLD  PA+VHEFR+PPKALLGLHSYCPVHFD+FHAVLVD S+HI L
Sbjct  150   MYAPMLENGSELQASLDACPASVHEFRIPPKALLGLHSYCPVHFDSFHAVLVDISIHITL  209

Query  1351  LKRGVHTLSSKV---ASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             L+ G+H  SSKV     G  +D          KQV   K    ARD LLEEL+K+SK IN
Sbjct  210   LRAGIHAPSSKVPRFGMGHVAD---------LKQV--FKALFAARDRLLEELQKLSKEIN  258

Query  1522  QAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             Q ID+ DF SK  D  L  TS Q+     +A+ SGQ+  + QS  +K NGI + R++  L
Sbjct  259   QTIDLTDFISKLNDTKLIHTSLQADVVTTDAQPSGQVSGEPQSGLEKANGIVELRSDRPL  318

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +SLSKD+L+  FH  GNQ+ YLW+ FL FHRA++
Sbjct  319   NSLSKDDLLNSFHLLGNQILYLWNTFLNFHRANK  352



>ref|XP_010657557.1| PREDICTED: protein FAM135B-like isoform X1 [Vitis vinifera]
Length=803

 Score =   392 bits (1008),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 216/402 (54%), Positives = 274/402 (68%), Gaps = 43/402 (11%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW I G+N  A  +PKRL + + +P                             +
Sbjct  1     MFRRLRWFI-GMNHRAAASPKRLANAKPKP---------------------------PPA  32

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEA--PDTGS  984
             ML+ V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ ++E  GTP+RVVQYEA  P+ G 
Sbjct  33    MLETVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDEEFELPGTPARVVQYEAAAPELGP  92

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
             ++  GVW IDDTDNS+ TQPFRI+YARQD+LLS+++SFNLSL KYE L    +SA+ILKF
Sbjct  93    EDAYGVWRIDDTDNSFSTQPFRIRYARQDVLLSLMISFNLSLRKYEGLS---TSAIILKF  149

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP+LENG  LQASLD  PA+VHEFR+PPKALLGLHSYCPVHFD+FHAVLVD S+HI
Sbjct  150   ELMYAPMLENGSELQASLDACPASVHEFRIPPKALLGLHSYCPVHFDSFHAVLVDISIHI  209

Query  1345  CLLKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVV--------LIKGFLTARDILLEEL  1497
              LL+ G+H  SSKV S     +D + E+ + + Q +        + K    ARD LLEEL
Sbjct  210   TLLRAGIHAPSSKVPSNFHAVEDVAGENLNGSIQGMGHVADLKQVFKALFAARDRLLEEL  269

Query  1498  RKVSKAINQAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGIT  1674
             +K+SK INQ ID+ DF SK  D  L  TS Q+     +A+ SGQ+  + QS  +K NGI 
Sbjct  270   QKLSKEINQTIDLTDFISKLNDTKLIHTSLQADVVTTDAQPSGQVSGEPQSGLEKANGIV  329

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             + R++  L+SLSKD+L+  FH  GNQ+ YLW+ FL FHRA++
Sbjct  330   ELRSDRPLNSLSKDDLLNSFHLLGNQILYLWNTFLNFHRANK  371



>ref|XP_008219154.1| PREDICTED: protein FAM135B [Prunus mume]
Length=806

 Score =   388 bits (996),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 256/345 (74%), Gaps = 18/345 (5%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD+V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +Y SVGTP+RVVQYEAPD GSD
Sbjct  35    AMLDSVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDSEYTSVGTPARVVQYEAPDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ TQPFRIKYARQDI LS+++SFNLSL++YE L    SSAVILKFE
Sbjct  95    DVYGVWRIDDSDNSFSTQPFRIKYARQDIFLSIMISFNLSLARYEGLS---SSAVILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+PPKALLGLHSYCP+HFD FHAVLVD +VHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPPKALLGLHSYCPIHFDVFHAVLVDVTVHIS  211

Query  1348  LLKRGVHTLSSKVAS-GSCSDDASSEDFDKAKQ------------VVLIKGFLTARDILL  1488
             LLK   +   SKV S  S ++D   E    + Q            ++LIK  L ARDILL
Sbjct  212   LLKAVSYMPPSKVPSDSSIAEDVGREGLSGSNQASAQVAAAGVNDIMLIKSLLAARDILL  271

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EEL+K+SKAI+QAID+ DF SK +D    +  Q      +A+VSGQ   + Q+  +K NG
Sbjct  272   EELQKLSKAIDQAIDLTDFISKMDDTKFDSFLQENLVAADAKVSGQ--GKPQNGLEKVNG  329

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              ++F + E+L  LS+D L+  FHS G+QV YLW+ FL FHR ++T
Sbjct  330   TSEFGSGELLRPLSRDALLNSFHSLGDQVLYLWNTFLNFHRFNKT  374



>ref|XP_007225275.1| hypothetical protein PRUPE_ppa001454mg [Prunus persica]
 gb|EMJ26474.1| hypothetical protein PRUPE_ppa001454mg [Prunus persica]
Length=825

 Score =   385 bits (989),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 258/364 (71%), Gaps = 37/364 (10%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD+V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +Y SVGTP+RVVQYEAPD GSD
Sbjct  35    AMLDSVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDSEYTSVGTPARVVQYEAPDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ TQPFRIKYARQDI LS+++SFNLSLS+YE L    SSAVILKFE
Sbjct  95    DVYGVWRIDDTDNSFSTQPFRIKYARQDIFLSIMISFNLSLSRYEGLS---SSAVILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+PPKALLGLHSYCPVHFD FHAVLVD +VHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPPKALLGLHSYCPVHFDVFHAVLVDVTVHIS  211

Query  1348  LLKRGVHTLSSKVAS--------------------------GSCSDDASSEDFDKAKQV-  1446
             LLK   +TL SKV S                           S ++D   E    + QV 
Sbjct  212   LLKAVSYTLPSKVPSLLIVLKTNSVHTFFVKLTWDLIYFSDSSIAEDVGGEGLSGSNQVC  271

Query  1447  -----VLIKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNA  1611
                  +L+K  L+ARDILLEEL+K+SKAI+QAID+ DF SK +D    +  Q      +A
Sbjct  272   CVNDIMLVKSLLSARDILLEELQKLSKAIDQAIDLTDFISKMDDTKFDSILQENLVAADA  331

Query  1612  EVSGQMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
             +VSGQ   + Q+  +K NG ++F + E+L  LS+  L+  FHS G+QV YLW+ FL FHR
Sbjct  332   KVSGQ--GKPQNGLEKVNGTSEFGSGELLRPLSRGALLNSFHSLGDQVLYLWNTFLNFHR  389

Query  1792  AHRT  1803
              ++T
Sbjct  390   FNKT  393



>gb|KHN05988.1| Protein FAM135B-like protein [Glycine soja]
Length=481

 Score =   367 bits (942),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 241/333 (72%), Gaps = 21/333 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M +AV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +  S G P+RVVQYEA D G  +
Sbjct  1     MFEAVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEDVSFGIPARVVQYEARDLGPSS  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I G+W IDDTDNS+ TQPFRIKYARQDI L +++SFNLSL ++EVL    ++AVILKFEL
Sbjct  61    IYGIWRIDDTDNSFSTQPFRIKYARQDIHLCMMISFNLSLGRFEVLP---TTAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP  ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDA HAVLVD S+H+ L
Sbjct  118   MYAPTFENGADLQASLDAYPAAVHEFRIPPKALLGLHSYCPVHFDALHAVLVDVSIHVSL  177

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             L         K AS + SD AS     K K  +++K  LTA  ILLEEL+K+SKA++QAI
Sbjct  178   L---------KAASTAPSDAASV----KLKAFMIVKALLTAHGILLEELQKLSKAVDQAI  224

Query  1531  DVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQ-MPSQKQSVSQKRNGITDFRNEEVLHS  1704
             D+ +F SK  D  L  S  Q+       E+SGQ MP   Q+  +  +   DF   E L S
Sbjct  225   DIPEFVSKRNDMKLINSVPQANQFTTEVEISGQRMP---QNGLEGADRALDFETAEKLRS  281

Query  1705  LSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             LSK EL+  +HS GN++ YLW+IFLKFHR ++T
Sbjct  282   LSKRELLNCYHSVGNRLLYLWNIFLKFHRDNKT  314



>ref|XP_007018374.1| Serine esterase family protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY15599.1| Serine esterase family protein, putative isoform 4 [Theobroma 
cacao]
Length=632

 Score =   371 bits (952),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 255/346 (74%), Gaps = 20/346 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V EIA+YIHRFHNLDLFQQGWYQ+KITMRW++ +++SV TP+RVVQYEAP+ GSD+
Sbjct  36    MLDTVQEIAIYIHRFHNLDLFQQGWYQLKITMRWDDDEHDSVATPARVVQYEAPNLGSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDDTDNS+ TQPFRIKY+RQD+LLSV+V+F+L L++ E      SSAVILKFEL
Sbjct  96    GYGIWRIDDTDNSFATQPFRIKYSRQDVLLSVMVAFDLPLTENE---GPSSSAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LYA +LENG   QAS D  PAAVHEFR+PPKALLGLHSYCPV+FDAFHAVLVD SVHI L
Sbjct  153   LYAHVLENGFEFQASPDGCPAAVHEFRIPPKALLGLHSYCPVYFDAFHAVLVDVSVHISL  212

Query  1351  LKRGVHTLSSKVASG--SCSDDASSEDFDKA------------KQVVLIKGFLTARDILL  1488
             LK G     +KV S   + +DD + E  D +            KQV+L+K  L ARD LL
Sbjct  213   LKAGSRKAPTKVPSAPYTATDDVAGESIDGSTQVLDEGSSTDLKQVMLVKALLNARDTLL  272

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
              EL+K+  AINQA+D+N+F+SK  D  LF T  Q+     + EVSGQ   + Q+  ++ N
Sbjct  273   GELQKLGNAINQAVDLNEFTSKMNDLKLFDTFLQANEVTADGEVSGQ--GKPQNGLERVN  330

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G ++F+++ +L +LSK++++ +FH  G+Q+ YLW+ FL FHR ++T
Sbjct  331   GRSEFQSDRLLQNLSKEDIIKMFHISGDQMLYLWNSFLNFHRDNKT  376



>ref|XP_009357226.1| PREDICTED: protein FAM135B-like [Pyrus x bretschneideri]
 ref|XP_009357227.1| PREDICTED: protein FAM135B-like [Pyrus x bretschneideri]
 ref|XP_009357228.1| PREDICTED: protein FAM135B-like [Pyrus x bretschneideri]
Length=808

 Score =   374 bits (960),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 253/345 (73%), Gaps = 19/345 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +Y SVGTP+RVVQYEAPD GSD
Sbjct  37    AMLDAVQEIAVYIHRFHNLDLFQQGWYQIKITMRWEDSEYTSVGTPARVVQYEAPDLGSD  96

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ TQPFRIKYARQD+ LS+++SFNLSL+ +E +    SS +ILKFE
Sbjct  97    DVYGVWRIDDTDNSFSTQPFRIKYARQDVFLSIMISFNLSLAGHEGIS---SSPIILKFE  153

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD SVHI 
Sbjct  154   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSVHIS  213

Query  1348  LLKRGVHTLSSKVAS-GSCSDDASSEDFDKAKQ------------VVLIKGFLTARDILL  1488
             LLK   +T  SKV S  S ++D   E      Q            ++  K  L ARDILL
Sbjct  214   LLKAVSYTHPSKVPSYSSTTEDVGGEGLSGLNQASTQAAAAVVNDIIRAKSLLNARDILL  273

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EEL+K+SKAI+QAID+ DF SK +D      +++  + D+ +VSGQ   + Q+  QK NG
Sbjct  274   EELQKLSKAIDQAIDLTDFISKIDDTKFDFLQENLVAADD-KVSGQ--GKPQNGLQKVNG  330

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              + F + E++  LS+D L   FHS G+QV YLW+ FLKFHR ++T
Sbjct  331   TSKFGSGELVCPLSRDALQNSFHSLGDQVLYLWNTFLKFHRFNKT  375



>ref|XP_008378676.1| PREDICTED: protein FAM135B-like isoform X2 [Malus domestica]
Length=369

 Score =   357 bits (916),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 247/337 (73%), Gaps = 15/337 (4%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKITMRW++ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITMRWQDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDSDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCS-DDASSEDFDKAKQ--------VVLIKGFLTARDILLEELR  1500
             LLK   +T   KV S S + ++  +E    + Q        ++L K  L ARDILLEEL+
Sbjct  212   LLKAVSYTHPLKVPSDSSTPENVGTEGXSGSNQAAAADVNDIILAKSLLNARDILLEELQ  271

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
             K+SKAI+QAID+ DF SK +D      +++  + D+ +VSGQ   + Q+  +K NG + F
Sbjct  272   KLSKAIDQAIDLTDFISKIDDTKFDFLQENWVAADD-KVSGQ--GKPQNGLEKLNGTSKF  328

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
              + E++  LS+  L   FHS G+QV YLW+ FL FHR
Sbjct  329   GSGELVRHLSRGALQNSFHSLGDQVLYLWNTFLNFHR  365



>ref|XP_008378679.1| PREDICTED: uncharacterized protein LOC103441755 isoform X4 [Malus 
domestica]
Length=348

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/328 (59%), Positives = 241/328 (73%), Gaps = 18/328 (5%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKITMRW++ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITMRWQDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDSDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LLK   +T   K A+   +D            ++L K  L ARDILLEEL+K+SKAI+QA
Sbjct  212   LLKAVSYTHPLKAAAADVND------------IILAKSLLNARDILLEELQKLSKAIDQA  259

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSL  1707
             ID+ DF SK +D      +++  + D+ +VSGQ   + Q+  +K NG + F + E++  L
Sbjct  260   IDLTDFISKIDDTKFDFLQENWVAADD-KVSGQ--GKPQNGLEKLNGTSKFGSGELVRHL  316

Query  1708  SKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
             S+  L   FHS G+QV YLW+ FL FHR
Sbjct  317   SRGALQNSFHSLGDQVLYLWNTFLNFHR  344



>ref|XP_008378677.1| PREDICTED: uncharacterized protein LOC103441755 isoform X3 [Malus 
domestica]
Length=352

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 243/328 (74%), Gaps = 14/328 (4%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKITMRW++ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITMRWQDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDSDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LLK   +T   K ++ + + D +         ++L K  L ARDILLEEL+K+SKAI+QA
Sbjct  212   LLKAVSYTHPLKASTQAAAADVN--------DIILAKSLLNARDILLEELQKLSKAIDQA  263

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSL  1707
             ID+ DF SK +D      +++  + D+ +VSGQ   + Q+  +K NG + F + E++  L
Sbjct  264   IDLTDFISKIDDTKFDFLQENWVAADD-KVSGQ--GKPQNGLEKLNGTSKFGSGELVRHL  320

Query  1708  SKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
             S+  L   FHS G+QV YLW+ FL FHR
Sbjct  321   SRGALQNSFHSLGDQVLYLWNTFLNFHR  348



>ref|XP_008378675.1| PREDICTED: uncharacterized protein LOC103441755 isoform X1 [Malus 
domestica]
Length=373

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 247/341 (72%), Gaps = 19/341 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKITMRW++ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITMRWQDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDSDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCS-DDASSEDFDKAKQ------------VVLIKGFLTARDILL  1488
             LLK   +T   KV S S + ++  +E    + Q            ++L K  L ARDILL
Sbjct  212   LLKAVSYTHPLKVPSDSSTPENVGTEGXSGSNQASTQAAAADVNDIILAKSLLNARDILL  271

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EEL+K+SKAI+QAID+ DF SK +D      +++  + D+ +VSGQ   + Q+  +K NG
Sbjct  272   EELQKLSKAIDQAIDLTDFISKIDDTKFDFLQENWVAADD-KVSGQ--GKPQNGLEKLNG  328

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
              + F + E++  LS+  L   FHS G+QV YLW+ FL FHR
Sbjct  329   TSKFGSGELVRHLSRGALQNSFHSLGDQVLYLWNTFLNFHR  369



>ref|XP_007018372.1| Serine esterase family protein, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007018373.1| Serine esterase family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY15597.1| Serine esterase family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY15598.1| Serine esterase family protein, putative isoform 2 [Theobroma 
cacao]
Length=808

 Score =   369 bits (947),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 255/346 (74%), Gaps = 20/346 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V EIA+YIHRFHNLDLFQQGWYQ+KITMRW++ +++SV TP+RVVQYEAP+ GSD+
Sbjct  36    MLDTVQEIAIYIHRFHNLDLFQQGWYQLKITMRWDDDEHDSVATPARVVQYEAPNLGSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDDTDNS+ TQPFRIKY+RQD+LLSV+V+F+L L++ E      SSAVILKFEL
Sbjct  96    GYGIWRIDDTDNSFATQPFRIKYSRQDVLLSVMVAFDLPLTENE---GPSSSAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LYA +LENG   QAS D  PAAVHEFR+PPKALLGLHSYCPV+FDAFHAVLVD SVHI L
Sbjct  153   LYAHVLENGFEFQASPDGCPAAVHEFRIPPKALLGLHSYCPVYFDAFHAVLVDVSVHISL  212

Query  1351  LKRGVHTLSSKVASG--SCSDDASSEDFDKA------------KQVVLIKGFLTARDILL  1488
             LK G     +KV S   + +DD + E  D +            KQV+L+K  L ARD LL
Sbjct  213   LKAGSRKAPTKVPSAPYTATDDVAGESIDGSTQVLDEGSSTDLKQVMLVKALLNARDTLL  272

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
              EL+K+  AINQA+D+N+F+SK  D  LF T  Q+     + EVSGQ   + Q+  ++ N
Sbjct  273   GELQKLGNAINQAVDLNEFTSKMNDLKLFDTFLQANEVTADGEVSGQ--GKPQNGLERVN  330

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G ++F+++ +L +LSK++++ +FH  G+Q+ YLW+ FL FHR ++T
Sbjct  331   GRSEFQSDRLLQNLSKEDIIKMFHISGDQMLYLWNSFLNFHRDNKT  376



>ref|XP_007018371.1| Serine esterase family protein isoform 1 [Theobroma cacao]
 gb|EOY15596.1| Serine esterase family protein isoform 1 [Theobroma cacao]
Length=875

 Score =   366 bits (940),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/342 (57%), Positives = 252/342 (74%), Gaps = 20/342 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V EIA+YIHRFHNLDLFQQGWYQ+KITMRW++ +++SV TP+RVVQYEAP+ GSD+
Sbjct  36    MLDTVQEIAIYIHRFHNLDLFQQGWYQLKITMRWDDDEHDSVATPARVVQYEAPNLGSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDDTDNS+ TQPFRIKY+RQD+LLSV+V+F+L L++ E      SSAVILKFEL
Sbjct  96    GYGIWRIDDTDNSFATQPFRIKYSRQDVLLSVMVAFDLPLTENE---GPSSSAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LYA +LENG   QAS D  PAAVHEFR+PPKALLGLHSYCPV+FDAFHAVLVD SVHI L
Sbjct  153   LYAHVLENGFEFQASPDGCPAAVHEFRIPPKALLGLHSYCPVYFDAFHAVLVDVSVHISL  212

Query  1351  LKRGVHTLSSKVASG--SCSDDASSEDFDKA------------KQVVLIKGFLTARDILL  1488
             LK G     +KV S   + +DD + E  D +            KQV+L+K  L ARD LL
Sbjct  213   LKAGSRKAPTKVPSAPYTATDDVAGESIDGSTQVLDEGSSTDLKQVMLVKALLNARDTLL  272

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
              EL+K+  AINQA+D+N+F+SK  D  LF T  Q+     + EVSGQ   + Q+  ++ N
Sbjct  273   GELQKLGNAINQAVDLNEFTSKMNDLKLFDTFLQANEVTADGEVSGQ--GKPQNGLERVN  330

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
             G ++F+++ +L +LSK++++ +FH  G+Q+ YLW+ FL FHR
Sbjct  331   GRSEFQSDRLLQNLSKEDIIKMFHISGDQMLYLWNSFLNFHR  372



>gb|KHF98482.1| Uncharacterized protein F383_15397 [Gossypium arboreum]
Length=818

 Score =   364 bits (935),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 248/345 (72%), Gaps = 19/345 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD+V EIA+YIHRFHNLDLFQQGWYQ+K+T+RW+N +Y  VGTP+RVVQYEAP   SD 
Sbjct  36    MLDSVQEIAIYIHRFHNLDLFQQGWYQLKLTVRWDNDEYAPVGTPARVVQYEAPSLVSDE  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + GVW IDDTDNS+ TQPFRIKYARQD+ LS++V+F+L + + E   +   SAVILKFEL
Sbjct  96    VFGVWRIDDTDNSFATQPFRIKYARQDVYLSIMVAFDLPIPENEGPPL---SAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LYAP+L NG + QAS D  PAA+HEFR+PPKALLGLHSYCPV+FDAFHAVLVD SVH  L
Sbjct  153   LYAPVLVNGSDFQASPDYCPAAIHEFRIPPKALLGLHSYCPVYFDAFHAVLVDVSVHTTL  212

Query  1351  LKRGVHTLSSKVAS--GSCSDDASSEDFDKA------------KQVVLIKGFLTARDILL  1488
             LK G   + +KV S   S ++D S E  D +            KQV+L+K  L ARD LL
Sbjct  213   LKAGSRKVHTKVPSIAYSTTNDVSGESIDGSTQALDQVASTDLKQVMLVKALLNARDTLL  272

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
              EL+K+S AIN AID+ +F+SK  D  LF S        +AE S Q   + Q+  ++ NG
Sbjct  273   AELQKLSDAINHAIDLTEFTSKMNDMKLFDSFLEEPVAADAEDSAQ--GKPQNGLERVNG  330

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               +F+++ +LH+LSKD+++ +F+  G+QVFYLW+ FL FHR  +T
Sbjct  331   RLEFQSDRLLHNLSKDDVLKIFNLSGDQVFYLWNTFLNFHRDSKT  375



>ref|XP_007161366.1| hypothetical protein PHAVU_001G063100g [Phaseolus vulgaris]
 gb|ESW33360.1| hypothetical protein PHAVU_001G063100g [Phaseolus vulgaris]
Length=509

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 238/344 (69%), Gaps = 19/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+AV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +    G P+RVVQYEA D    +
Sbjct  1     MLEAVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEDICFGIPARVVQYEAHDLRPSS  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I G+W IDDTDNS+ TQPFRI+YARQDI L +++SFNLSL ++EVL    ++AVILKFEL
Sbjct  61    IYGIWRIDDTDNSFSTQPFRIRYARQDIHLCMMISFNLSLDRFEVLP---TTAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP  ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDA HAVLVD +VH+ L
Sbjct  118   MYAPTFENGADLQASLDAYPAAVHEFRIPPKALLGLHSYCPVHFDALHAVLVDVTVHVSL  177

Query  1351  LKRGVHTLSSKVASGSCSDD-ASSEDFD------------KAKQVVLIKGFLTARDILLE  1491
             L    +  +SKV S S   +  S   +D            K K  +L+K  LTA DILL+
Sbjct  178   LTAASNQSASKVPSFSRDAEFVSDRSYDSLNQGWSDIASVKLKNAMLVKALLTAYDILLD  237

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EL K+SKA+ QAID+++  SK     L  S  QS       E+SGQ   + Q+  + RN 
Sbjct  238   ELEKLSKAVGQAIDISEVLSKRNSMKLINSVPQSDQFTTEVEISGQ--DKSQNYVEGRNR  295

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
                  N E L SLS  EL+  +HS GNQ+ YLW+IFLKFHR ++
Sbjct  296   ALPSENAEKLRSLSMRELLNCYHSVGNQLLYLWNIFLKFHRDNK  339



>ref|XP_007161367.1| hypothetical protein PHAVU_001G063100g [Phaseolus vulgaris]
 gb|ESW33361.1| hypothetical protein PHAVU_001G063100g [Phaseolus vulgaris]
Length=520

 Score =   355 bits (912),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 239/345 (69%), Gaps = 19/345 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +ML+AV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +    G P+RVVQYEA D    
Sbjct  11    AMLEAVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEDICFGIPARVVQYEAHDLRPS  70

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W IDDTDNS+ TQPFRI+YARQDI L +++SFNLSL ++EVL    ++AVILKFE
Sbjct  71    SIYGIWRIDDTDNSFSTQPFRIRYARQDIHLCMMISFNLSLDRFEVLP---TTAVILKFE  127

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAP  ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDA HAVLVD +VH+ 
Sbjct  128   LMYAPTFENGADLQASLDAYPAAVHEFRIPPKALLGLHSYCPVHFDALHAVLVDVTVHVS  187

Query  1348  LLKRGVHTLSSKVASGSCSDD-ASSEDFD------------KAKQVVLIKGFLTARDILL  1488
             LL    +  +SKV S S   +  S   +D            K K  +L+K  LTA DILL
Sbjct  188   LLTAASNQSASKVPSFSRDAEFVSDRSYDSLNQGWSDIASVKLKNAMLVKALLTAYDILL  247

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             +EL K+SKA+ QAID+++  SK     L  S  QS       E+SGQ   + Q+  + RN
Sbjct  248   DELEKLSKAVGQAIDISEVLSKRNSMKLINSVPQSDQFTTEVEISGQ--DKSQNYVEGRN  305

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
                   N E L SLS  EL+  +HS GNQ+ YLW+IFLKFHR ++
Sbjct  306   RALPSENAEKLRSLSMRELLNCYHSVGNQLLYLWNIFLKFHRDNK  350



>ref|XP_006601058.1| PREDICTED: protein FAM135B-like isoform X5 [Glycine max]
Length=727

 Score =   360 bits (924),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 199/346 (58%), Positives = 241/346 (70%), Gaps = 24/346 (7%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M +AV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +  S G P+RVVQYEA D G  
Sbjct  11    AMFEAVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEDVSFGIPARVVQYEARDLGPS  70

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W IDDTDNS+ TQPFRIKYARQDI L +++SFNLSL ++EVL    ++AVILKFE
Sbjct  71    SIYGIWRIDDTDNSFSTQPFRIKYARQDIHLCMMISFNLSLGRFEVLP---TTAVILKFE  127

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAP  ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDA HAVLVD S+H+ 
Sbjct  128   LMYAPTFENGADLQASLDAYPAAVHEFRIPPKALLGLHSYCPVHFDALHAVLVDVSIHVS  187

Query  1348  LLKRG------------VHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLE  1491
             LLK              V   S        SD AS     K K  +++K  LTA  ILLE
Sbjct  188   LLKAASTAPRNSRNAEFVANKSYDTLDQGLSDAASV----KLKAFMIVKALLTAHGILLE  243

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQ-MPSQKQSVSQKRN  1665
             EL+K+SKA++QAID+ +F SK  D  L  S  Q+       E+SGQ MP   Q+  +  +
Sbjct  244   ELQKLSKAVDQAIDIPEFVSKRNDMKLINSVPQANQFTTEVEISGQRMP---QNGLEGAD  300

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                DF   E L SLSK EL+  +HS GN++ YLW+IFLKFHR ++T
Sbjct  301   RALDFETAEKLRSLSKRELLNCYHSVGNRLLYLWNIFLKFHRDNKT  346



>ref|XP_006601054.1| PREDICTED: protein FAM135B-like isoform X1 [Glycine max]
 ref|XP_006601055.1| PREDICTED: protein FAM135B-like isoform X2 [Glycine max]
 ref|XP_006601056.1| PREDICTED: protein FAM135B-like isoform X3 [Glycine max]
Length=768

 Score =   360 bits (925),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 199/346 (58%), Positives = 241/346 (70%), Gaps = 24/346 (7%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M +AV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +  S G P+RVVQYEA D G  
Sbjct  11    AMFEAVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEDVSFGIPARVVQYEARDLGPS  70

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W IDDTDNS+ TQPFRIKYARQDI L +++SFNLSL ++EVL    ++AVILKFE
Sbjct  71    SIYGIWRIDDTDNSFSTQPFRIKYARQDIHLCMMISFNLSLGRFEVLP---TTAVILKFE  127

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAP  ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDA HAVLVD S+H+ 
Sbjct  128   LMYAPTFENGADLQASLDAYPAAVHEFRIPPKALLGLHSYCPVHFDALHAVLVDVSIHVS  187

Query  1348  LLKRG------------VHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLE  1491
             LLK              V   S        SD AS     K K  +++K  LTA  ILLE
Sbjct  188   LLKAASTAPRNSRNAEFVANKSYDTLDQGLSDAASV----KLKAFMIVKALLTAHGILLE  243

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQ-MPSQKQSVSQKRN  1665
             EL+K+SKA++QAID+ +F SK  D  L  S  Q+       E+SGQ MP   Q+  +  +
Sbjct  244   ELQKLSKAVDQAIDIPEFVSKRNDMKLINSVPQANQFTTEVEISGQRMP---QNGLEGAD  300

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                DF   E L SLSK EL+  +HS GN++ YLW+IFLKFHR ++T
Sbjct  301   RALDFETAEKLRSLSKRELLNCYHSVGNRLLYLWNIFLKFHRDNKT  346



>ref|XP_006601057.1| PREDICTED: protein FAM135B-like isoform X4 [Glycine max]
Length=767

 Score =   360 bits (925),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 199/346 (58%), Positives = 241/346 (70%), Gaps = 24/346 (7%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M +AV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +  S G P+RVVQYEA D G  
Sbjct  11    AMFEAVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDDEDVSFGIPARVVQYEARDLGPS  70

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W IDDTDNS+ TQPFRIKYARQDI L +++SFNLSL ++EVL    ++AVILKFE
Sbjct  71    SIYGIWRIDDTDNSFSTQPFRIKYARQDIHLCMMISFNLSLGRFEVLP---TTAVILKFE  127

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAP  ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDA HAVLVD S+H+ 
Sbjct  128   LMYAPTFENGADLQASLDAYPAAVHEFRIPPKALLGLHSYCPVHFDALHAVLVDVSIHVS  187

Query  1348  LLKRG------------VHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLE  1491
             LLK              V   S        SD AS     K K  +++K  LTA  ILLE
Sbjct  188   LLKAASTAPRNSRNAEFVANKSYDTLDQGLSDAASV----KLKAFMIVKALLTAHGILLE  243

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQ-MPSQKQSVSQKRN  1665
             EL+K+SKA++QAID+ +F SK  D  L  S  Q+       E+SGQ MP   Q+  +  +
Sbjct  244   ELQKLSKAVDQAIDIPEFVSKRNDMKLINSVPQANQFTTEVEISGQRMP---QNGLEGAD  300

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                DF   E L SLSK EL+  +HS GN++ YLW+IFLKFHR ++T
Sbjct  301   RALDFETAEKLRSLSKRELLNCYHSVGNRLLYLWNIFLKFHRDNKT  346



>gb|EYU26438.1| hypothetical protein MIMGU_mgv1a001820mg [Erythranthe guttata]
Length=755

 Score =   358 bits (918),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 200/341 (59%), Positives = 250/341 (73%), Gaps = 27/341 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+AV+E+++YIHRFHNLDLFQQGWYQ+KIT+RWE+GD  S GTP+RVVQYEAPD GS++
Sbjct  1     MLEAVHEVSIYIHRFHNLDLFQQGWYQLKITIRWEDGDSGSFGTPARVVQYEAPDLGSED  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRI+YARQDILL+++VSFNLSL+K+E      +SAVILKFEL
Sbjct  61    IYGVWRIDDVDHSFSTQPFRIRYARQDILLAMMVSFNLSLNKFE---NPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LYAP+LEN  ++QA LDT P+A+HEFRL PKALLGLH+YCPVHFDAFHAV+VD SVH+ +
Sbjct  118   LYAPVLENRYSVQACLDTCPSAIHEFRLSPKALLGLHAYCPVHFDAFHAVVVDTSVHVSM  177

Query  1351  LKRGVHTLSSKVASGSC-----SDD-ASSEDF----DKAKQVVLIKGFLTARDILLEELR  1500
             LK GV   S K  S  C     SD  AS +DF    D++KQV+L+K   +ARDIL+EEL+
Sbjct  178   LKSGVRISSVKALSNKCILSSFSDPRASDDDFVGENDESKQVMLVKALSSARDILVEELQ  237

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
             K+SK INQ ID+ D +S   DK         S + +  +S   PS+K       NG  D 
Sbjct  238   KLSKGINQPIDMKDIAS---DK-----LAGFSPRSDEGISDISPSKKP------NGEVDS  283

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             +++  LH LS+D L   F   G QVFYLWS FL FHRA++T
Sbjct  284   QHDGSLHLLSEDNLHKSFDLIGGQVFYLWSTFLNFHRANKT  324



>ref|XP_008464798.1| PREDICTED: protein FAM135B-like isoform X1 [Cucumis melo]
Length=799

 Score =   357 bits (916),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 234/341 (69%), Gaps = 22/341 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD V EIA+YIHRFHNLDLFQQGWYQIK+TMRWE+ +Y SVGTP+RVVQYEAPD GS 
Sbjct  35    AMLDTVQEIAIYIHRFHNLDLFQQGWYQIKLTMRWEDSEYTSVGTPARVVQYEAPDLGSG  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             N  GVW IDDTDNS+ TQPF+IKYARQDILLS+++SFN  L KYE      +SAVILKFE
Sbjct  95    NSYGVWKIDDTDNSFSTQPFKIKYARQDILLSIMISFNFPLVKYEA---PSTSAVILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAPILE G  LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD S+HIC
Sbjct  152   LMYAPILEAGPELQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSIHIC  211

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQ---------VVLIKGFLTARDILLEELR  1500
             LL+        K +S    ++ ++  FD   Q         V LIK  LTARDILLEE +
Sbjct  212   LLRSYT---PGKRSSELHKENLAARHFDPQNQVGASRDEKDVTLIKALLTARDILLEEFQ  268

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
              +SKAI+Q +D  DF S  +D   +      S +DN  V G+   Q       +NG+   
Sbjct  269   NLSKAIDQTVDFTDFISGMDDTK-YVDVLIPSKRDN--VKGEAAGQ----GNPQNGLERT  321

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                + LH  +   +   FHS G+Q+ YLWS FLKFHRA +T
Sbjct  322   NGGDQLHQRAGSHMSHRFHSLGDQLLYLWSTFLKFHRASKT  362



>gb|KDO50641.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=640

 Score =   352 bits (904),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 242/335 (72%), Gaps = 28/335 (8%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  60    LDAVQEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  119

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+ LSV+++FNL +SKYEVL    +SAVILKFE
Sbjct  120   DFSGVWRIDDAENSFSTQPFRIKYARQDVHLSVMIAFNLYVSKYEVLS---TSAVILKFE  176

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  177   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  236

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  237   LLKASSSTAPPKSEFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  292

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  293   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  337

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  338   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  372



>ref|XP_004146761.1| PREDICTED: protein FAM135B-like [Cucumis sativus]
 gb|KGN47782.1| hypothetical protein Csa_6G401520 [Cucumis sativus]
Length=799

 Score =   356 bits (914),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 233/341 (68%), Gaps = 22/341 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD V EIA+YIHRFHNLDLFQQGWYQIK+TMRWE+ +Y SVGTP+RVVQYEAPD GS 
Sbjct  35    AMLDTVQEIAIYIHRFHNLDLFQQGWYQIKLTMRWEDSEYTSVGTPARVVQYEAPDLGSG  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             N  GVW IDDTDNS+ TQPF+IKYARQDILLS+++SFN  L KYE      +SAVILKFE
Sbjct  95    NSYGVWKIDDTDNSFSTQPFKIKYARQDILLSIMISFNFPLVKYEA---PSTSAVILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAPILE G  LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD S+HIC
Sbjct  152   LMYAPILEAGPELQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSIHIC  211

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQ---------VVLIKGFLTARDILLEELR  1500
             LL+        K +S    ++ ++  FD   Q         V LIK  LTARDILLEE +
Sbjct  212   LLRSYT---PGKKSSEPHKENLAARHFDPQTQVGASRDEKDVTLIKALLTARDILLEEFQ  268

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
              +SKAI+Q +D  DF S  +D   +      S +DN +         Q+  ++ NG   F
Sbjct  269   NLSKAIDQTVDFTDFISAMDDTK-YVDVLIPSKRDNVKGEAAGQGNPQNSLKRTNGGDQF  327

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                   H  +   +   FHS G+Q+ YLWS FLKFHRA++T
Sbjct  328   ------HQRADSHMSHRFHSLGDQLLYLWSTFLKFHRANKT  362



>ref|XP_010260961.1| PREDICTED: uncharacterized protein LOC104599909 isoform X2 [Nelumbo 
nucifera]
Length=515

 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 239/348 (69%), Gaps = 21/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+AV EIA+Y+HRFHNLDLFQQGWYQIKITMRWE+  Y S G P+RVVQYEAPD G DN
Sbjct  1     MLEAVQEIAIYVHRFHNLDLFQQGWYQIKITMRWEDDTYTSPGIPARVVQYEAPDGGLDN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDDTDNS++TQPFRIKYARQD+LLSV++SFNLSL K EV     +SAVILKFEL
Sbjct  61    ALGVWRIDDTDNSFYTQPFRIKYARQDVLLSVMISFNLSLEKCEV---PATSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             L++PILENG ++QASLD +PAAVHEF++PPKALLGLHSYCPVHFD FHAVLVD SVHI L
Sbjct  118   LFSPILENGFDMQASLDAFPAAVHEFQIPPKALLGLHSYCPVHFDYFHAVLVDLSVHIVL  177

Query  1351  LKRGVHTLSSK------------VASGSC--SDDASSE-DFDKAKQVVLIKGFLTARDIL  1485
             LK G H    K            +A  +C  S+  S + D   + Q+  +K  L ARDIL
Sbjct  178   LKAGAHGPRQKLEYFSDSQSVGDIAGVNCDGSNQVSGQRDSTYSNQIAFLKALLVARDIL  237

Query  1486  LEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             L+EL K++KAI+Q ID+   +S   D   F      +   N          +   S+ +N
Sbjct  238   LDELEKLNKAIDQTIDLTHLTSILGDNK-FIGTNLRADLHNTGAEDLRKGARLVASKSKN  296

Query  1666  GITDFRNEEVL--HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G  +   +EVL   SL K+ L+  F+S G+QV +LW+ FL FHR ++T
Sbjct  297   GFQNGTTDEVLQSQSLFKENLLCTFNSLGSQVSFLWNTFLNFHRVNKT  344



>ref|XP_009335484.1| PREDICTED: protein FAM135B-like isoform X2 [Pyrus x bretschneideri]
Length=804

 Score =   356 bits (913),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 245/341 (72%), Gaps = 15/341 (4%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITVRWEDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDTDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDANPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQ---------VVLIKGFLTARDILLEELR  1500
             LLK   +T   KV S S + +    + D             ++L K  L ARDILLEEL+
Sbjct  212   LLKAVSYTHPLKVPSDSSTPENVGTEGDSGSNQAAAADVNDIILAKSLLNARDILLEELQ  271

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
             K+ KAI+QAID+ DF SK +D      +++  + D+ +VSGQ   + Q+  +K NG + F
Sbjct  272   KLGKAIDQAIDLTDFISKIDDTKFDFLQENWVTADD-KVSGQ--GKPQNGLEKLNGTSKF  328

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              + E +  LS+  L   FHS G+QV YLW+ FL FHR ++T
Sbjct  329   GSGEAVRHLSRGALQNSFHSLGDQVLYLWNTFLNFHRFNKT  369



>ref|XP_010671312.1| PREDICTED: uncharacterized protein LOC104888134 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=643

 Score =   350 bits (899),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 257/403 (64%), Gaps = 45/403 (11%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +L RLRW+I    R   V  KRL   E +P                             +
Sbjct  1     MLRRLRWLIDLTQRNFAV--KRLTDAEVKPF--------------------------KPA  32

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD  +E+A+Y+HRFHNLDLFQQGWYQIKI+M+WE+GD   VG PSRVVQYEAP  GSD+
Sbjct  33    MLDTFHEVAIYLHRFHNLDLFQQGWYQIKISMKWEDGDGTYVGIPSRVVQYEAPKMGSDD  92

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD+DNS+ TQPF+I+YARQD+ LSV+++FN+SLS  EV      S VI+KFEL
Sbjct  93    SYGVWRIDDSDNSFSTQPFKIRYARQDVPLSVMIAFNVSLSNREV---PAKSGVIIKFEL  149

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +Y+P+LE G  LQA L T  AAVHEFR+PPKALLGLHSYCPV FDAFH+ LVD S+HI L
Sbjct  150   IYSPLLEKGSELQAILSTSAAAVHEFRIPPKALLGLHSYCPVLFDAFHSALVDISIHISL  209

Query  1351  LKRGVHTLSSKVASGSCS--------DDASSEDFDK-AKQVVLIKGFLTARDILLEELRK  1503
             LK    T   K+ S S +         D S++ F K  K+V+L+K  LTARDILLEE +K
Sbjct  210   LKTVAQTFQKKLPSNSFTVENIDGKFPDKSTKGFGKVVKEVLLVKSLLTARDILLEEAQK  269

Query  1504  VSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPS--QKQSVSQKRNGIT  1674
             + +AI+Q ID  +F S+ +D  LF S  Q+  S  +++  G+ P     Q   +K +   
Sbjct  270   LGRAIDQTIDFTEFISQLDDTKLFGSLLQADVSSTSSD--GKRPEFDDSQKSKEKESLFL  327

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             DFR+   L SLS+D L+   H+ GNQ  YLW+ FL FHRA++T
Sbjct  328   DFRSNGALQSLSRDSLLHFAHTIGNQNHYLWNTFLNFHRANKT  370



>ref|XP_009335483.1| PREDICTED: protein FAM135B-like isoform X1 [Pyrus x bretschneideri]
Length=808

 Score =   355 bits (911),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 248/345 (72%), Gaps = 19/345 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITVRWEDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDTDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDANPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVAS--------GSCSDDASSEDFDKA-----KQVVLIKGFLTARDILL  1488
             LLK   +T   KV S        G+  D  S++   +A       ++L K  L ARDILL
Sbjct  212   LLKAVSYTHPLKVPSDSSTPENVGTEGDSGSNQASTQAAAADVNDIILAKSLLNARDILL  271

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EEL+K+ KAI+QAID+ DF SK +D      +++  + D+ +VSGQ   + Q+  +K NG
Sbjct  272   EELQKLGKAIDQAIDLTDFISKIDDTKFDFLQENWVTADD-KVSGQ--GKPQNGLEKLNG  328

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              + F + E +  LS+  L   FHS G+QV YLW+ FL FHR ++T
Sbjct  329   TSKFGSGEAVRHLSRGALQNSFHSLGDQVLYLWNTFLNFHRFNKT  373



>ref|XP_011071768.1| PREDICTED: protein FAM135B-like [Sesamum indicum]
 ref|XP_011071769.1| PREDICTED: protein FAM135B-like [Sesamum indicum]
 ref|XP_011071770.1| PREDICTED: protein FAM135B-like [Sesamum indicum]
Length=748

 Score =   353 bits (906),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 241/331 (73%), Gaps = 15/331 (5%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+A++EIA+YIHRFHNLDLFQQGWYQIKITMRW   D  S+GTP+RV QYEAPD GSD+
Sbjct  1     MLEAIHEIAIYIHRFHNLDLFQQGWYQIKITMRWTGEDSGSLGTPARVAQYEAPDLGSDD  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + GVW IDD D+S+ TQPFRI+YARQDILLS++VSF         L+   +SAVILKFEL
Sbjct  61    VYGVWRIDDRDHSFSTQPFRIRYARQDILLSLMVSF--------TLQGPCTSAVILKFEL  112

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY P+LEN  N+Q  LD   AAVHEFRLPPKALLGLH+YCPVHFDAFHAVLVD +VH+ L
Sbjct  113   LYTPVLENRSNIQDCLDNI-AAVHEFRLPPKALLGLHTYCPVHFDAFHAVLVDITVHVSL  171

Query  1351  LKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             L+  V+T S KV SG  ++ +      DK+KQV+L++  L+A +IL EEL+K+S+AIN+ 
Sbjct  172   LRNAVYTSSQKVPSGLTANGSDVVGKHDKSKQVMLVQALLSACEILTEELKKLSQAINEP  231

Query  1528  IDVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             ID+ + +      +LF  +  S     +AEV GQ+ S+  S S+K  G  DF N+ VL  
Sbjct  232   IDIREITP----NELFGLTPSSLPETADAEVLGQVLSKLHSASEKAIGEVDFHNDAVLRR  287

Query  1705  LSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
             LS+D+L+      G+QV +LWSIFL FHRA+
Sbjct  288   LSEDKLLKSIDLIGHQVLHLWSIFLNFHRAN  318



>ref|XP_010260962.1| PREDICTED: uncharacterized protein LOC104599909 isoform X3 [Nelumbo 
nucifera]
Length=514

 Score =   346 bits (887),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 245/353 (69%), Gaps = 30/353 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+AV EIA+Y+HRFHNLDLFQQGWYQIKITMRWE+  Y S G P+RVVQYEAPD G DN
Sbjct  1     MLEAVQEIAIYVHRFHNLDLFQQGWYQIKITMRWEDDTYTSPGIPARVVQYEAPDGGLDN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDDTDNS++TQPFRIKYARQD+LLSV++SFNLSL K EV     +SAVILKFEL
Sbjct  61    ALGVWRIDDTDNSFYTQPFRIKYARQDVLLSVMISFNLSLEKCEV---PATSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             L++PILENG ++QASLD +PAAVHEF++PPKALLGLHSYCPVHFD FHAVLVD SVHI L
Sbjct  118   LFSPILENGFDMQASLDAFPAAVHEFQIPPKALLGLHSYCPVHFDYFHAVLVDLSVHIVL  177

Query  1351  LKRGVHTLSSK------------VASGSC--SDDASSE-DFDKAKQVVLIKGFLTARDIL  1485
             LK G H    K            +A  +C  S+  S + D   + Q+  +K  L ARDIL
Sbjct  178   LKAGAHGPRQKLEYFSDSQSVGDIAGVNCDGSNQVSGQRDSTYSNQIAFLKALLVARDIL  237

Query  1486  LEELRKVSKAINQAIDVNDFSS-----KHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSV  1650
             L+EL K++KAI+Q ID+   +S     K    +L     +T ++D      ++ + K   
Sbjct  238   LDELEKLNKAIDQTIDLTHLTSILGDNKFIGTNLRADLHNTGAED-LRKGARLVASKSKN  296

Query  1651  SQKRNGITDFRNEEVL--HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               ++NG TD    EVL   SL K+ L+  F+S G+QV +LW+ FL FHR ++T
Sbjct  297   GFQQNGTTD----EVLQSQSLFKENLLCTFNSLGSQVSFLWNTFLNFHRVNKT  345



>ref|XP_010260959.1| PREDICTED: uncharacterized protein LOC104599909 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010260960.1| PREDICTED: uncharacterized protein LOC104599909 isoform X1 [Nelumbo 
nucifera]
Length=516

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 245/353 (69%), Gaps = 30/353 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+AV EIA+Y+HRFHNLDLFQQGWYQIKITMRWE+  Y S G P+RVVQYEAPD G DN
Sbjct  1     MLEAVQEIAIYVHRFHNLDLFQQGWYQIKITMRWEDDTYTSPGIPARVVQYEAPDGGLDN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDDTDNS++TQPFRIKYARQD+LLSV++SFNLSL K EV     +SAVILKFEL
Sbjct  61    ALGVWRIDDTDNSFYTQPFRIKYARQDVLLSVMISFNLSLEKCEV---PATSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             L++PILENG ++QASLD +PAAVHEF++PPKALLGLHSYCPVHFD FHAVLVD SVHI L
Sbjct  118   LFSPILENGFDMQASLDAFPAAVHEFQIPPKALLGLHSYCPVHFDYFHAVLVDLSVHIVL  177

Query  1351  LKRGVHTLSSK------------VASGSC--SDDASSE-DFDKAKQVVLIKGFLTARDIL  1485
             LK G H    K            +A  +C  S+  S + D   + Q+  +K  L ARDIL
Sbjct  178   LKAGAHGPRQKLEYFSDSQSVGDIAGVNCDGSNQVSGQRDSTYSNQIAFLKALLVARDIL  237

Query  1486  LEELRKVSKAINQAIDVNDFSS-----KHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSV  1650
             L+EL K++KAI+Q ID+   +S     K    +L     +T ++D      ++ + K   
Sbjct  238   LDELEKLNKAIDQTIDLTHLTSILGDNKFIGTNLRADLHNTGAED-LRKGARLVASKSKN  296

Query  1651  SQKRNGITDFRNEEVL--HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               ++NG TD    EVL   SL K+ L+  F+S G+QV +LW+ FL FHR ++T
Sbjct  297   GFQQNGTTD----EVLQSQSLFKENLLCTFNSLGSQVSFLWNTFLNFHRVNKT  345



>ref|XP_010061587.1| PREDICTED: protein FAM135B-like isoform X2 [Eucalyptus grandis]
 ref|XP_010061588.1| PREDICTED: protein FAM135B-like isoform X2 [Eucalyptus grandis]
Length=765

 Score =   352 bits (903),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 191/344 (56%), Positives = 247/344 (72%), Gaps = 21/344 (6%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             +D   EIA+YIHRFHNLDLFQQGWYQIKITM+WE+G++ S GTP+RVVQYE PD GS++I
Sbjct  1     MDTTQEIAIYIHRFHNLDLFQQGWYQIKITMKWEDGEHGSPGTPARVVQYEVPDLGSEDI  60

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELL  1173
              G+W I+DTDNS+ TQPFRIKYARQD+LLS++VSFNL L K+E L    +SAV+LKFEL+
Sbjct  61    HGIWRINDTDNSFSTQPFRIKYARQDVLLSIMVSFNLPLGKFEGLS---TSAVVLKFELM  117

Query  1174  YAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLL  1353
             YAPI E+G  LQASLD+  AAVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD +VHI LL
Sbjct  118   YAPISESGSGLQASLDSCAAAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDTTVHISLL  177

Query  1354  K--------------RGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLE  1491
             K              R V  LS +   G          FD+ +Q+ +++  L +RD+L+E
Sbjct  178   KSSSVVAPPKVNRDSRNVEELSGENIHGLGQAVGPVSSFDE-RQLSVLRALLASRDLLVE  236

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             EL+ +SKAI+Q ID+ D ++K +DK L   R     + + +V G  P + Q+  +K N  
Sbjct  237   ELQNLSKAIDQPIDLTDVTAKVDDKTLIDLRAELGIEVD-KVLG--PDKLQNGIEKANQN  293

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D RN+ +L+S S+++L   FH  GNQV YLW+ FL+FHRA++T
Sbjct  294   VDTRNDGLLYSASREDLFHSFHVLGNQVLYLWNTFLQFHRANKT  337



>ref|XP_010061586.1| PREDICTED: protein FAM135B-like isoform X1 [Eucalyptus grandis]
 gb|KCW68571.1| hypothetical protein EUGRSUZ_F02184 [Eucalyptus grandis]
Length=801

 Score =   353 bits (905),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 249/346 (72%), Gaps = 21/346 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +++D   EIA+YIHRFHNLDLFQQGWYQIKITM+WE+G++ S GTP+RVVQYE PD GS+
Sbjct  35    AIMDTTQEIAIYIHRFHNLDLFQQGWYQIKITMKWEDGEHGSPGTPARVVQYEVPDLGSE  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W I+DTDNS+ TQPFRIKYARQD+LLS++VSFNL L K+E L    +SAV+LKFE
Sbjct  95    DIHGIWRINDTDNSFSTQPFRIKYARQDVLLSIMVSFNLPLGKFEGLS---TSAVVLKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAPI E+G  LQASLD+  AAVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD +VHI 
Sbjct  152   LMYAPISESGSGLQASLDSCAAAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDTTVHIS  211

Query  1348  LLK--------------RGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDIL  1485
             LLK              R V  LS +   G          FD+ +Q+ +++  L +RD+L
Sbjct  212   LLKSSSVVAPPKVNRDSRNVEELSGENIHGLGQAVGPVSSFDE-RQLSVLRALLASRDLL  270

Query  1486  LEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             +EEL+ +SKAI+Q ID+ D ++K +DK L   R     + + +V G  P + Q+  +K N
Sbjct  271   VEELQNLSKAIDQPIDLTDVTAKVDDKTLIDLRAELGIEVD-KVLG--PDKLQNGIEKAN  327

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                D RN+ +L+S S+++L   FH  GNQV YLW+ FL+FHRA++T
Sbjct  328   QNVDTRNDGLLYSASREDLFHSFHVLGNQVLYLWNTFLQFHRANKT  373



>ref|XP_002528165.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34216.1| conserved hypothetical protein [Ricinus communis]
Length=808

 Score =   353 bits (905),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 245/346 (71%), Gaps = 22/346 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD V EIA+YIHRFHNLDLFQQGWYQIKI++RWE+ +Y SVGTP+RVVQY++ D GSD
Sbjct  39    AMLDTVQEIAIYIHRFHNLDLFQQGWYQIKISVRWEDSEYTSVGTPARVVQYDSHDLGSD  98

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             N  GVW IDDTDNS+ TQPFRIKYA+QDI LS+++SFNLSLS +       +SAVILKFE
Sbjct  99    NTYGVWRIDDTDNSFSTQPFRIKYAKQDICLSIMISFNLSLSGH---MGPSTSAVILKFE  155

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL API EN   L A LD    AVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD +VHI 
Sbjct  156   LLQAPITENQLELLAYLDASSVAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDLTVHIS  215

Query  1348  LLKRGVHTLSSKVASGSC-SDDASSEDFDK------------AKQVVLIKGFLTARDILL  1488
             LLK G +    KV S SC  +D + +  D              KQ++L+K  L AR+ LL
Sbjct  216   LLKAGSYM---KVPSYSCIPEDIARQRIDGFNTTLGSMASVDMKQIMLVKALLVARETLL  272

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTS-SKDNAEVSGQMPSQKQSVSQKRN  1665
             EEL+K SKAI QAID+ DF+SK +D ++  S   ++    + EVSGQ   + Q+V +K N
Sbjct  273   EELQKFSKAIEQAIDLTDFTSKMDDVEMLDSIMGSNLGTADGEVSGQ--GKPQNVLEKAN  330

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G   FR++ +   +S+   V +FHS G Q+ YLW +FL+FHR +RT
Sbjct  331   GGVYFRSDVLQCIMSEAAAVNIFHSLGAQLSYLWGVFLQFHRVNRT  376



>ref|XP_006432281.1| hypothetical protein CICLE_v10000310mg [Citrus clementina]
 gb|ESR45521.1| hypothetical protein CICLE_v10000310mg [Citrus clementina]
Length=808

 Score =   352 bits (902),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 244/335 (73%), Gaps = 28/335 (8%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV+EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  61    LDAVHEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  120

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+ LSV+++FNLS+SKYEVL    +SAVILKFE
Sbjct  121   DFYGVWRIDDAENSFSTQPFRIKYARQDVHLSVMIAFNLSVSKYEVLS---TSAVILKFE  177

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  178   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  237

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  238   LLKASSSTAPPKSDFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  293

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  294   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  338

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  339   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  373



>ref|XP_006491849.1| PREDICTED: protein FAM135B-like isoform X1 [Citrus sinensis]
Length=807

 Score =   350 bits (899),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 242/335 (72%), Gaps = 28/335 (8%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  60    LDAVQEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  119

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+ LSV+++FNL +SKYEVL    +SAVILKFE
Sbjct  120   DFSGVWRIDDAENSFSTQPFRIKYARQDVHLSVMIAFNLYVSKYEVLS---TSAVILKFE  176

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  177   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  236

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  237   LLKASSSTAPPKSDFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  292

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  293   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  337

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  338   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  372



>gb|KDO50637.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=807

 Score =   350 bits (899),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 242/335 (72%), Gaps = 28/335 (8%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  60    LDAVQEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  119

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+ LSV+++FNL +SKYEVL    +SAVILKFE
Sbjct  120   DFSGVWRIDDAENSFSTQPFRIKYARQDVHLSVMIAFNLYVSKYEVLS---TSAVILKFE  176

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  177   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  236

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  237   LLKASSSTAPPKSEFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  292

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  293   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  337

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  338   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  372



>ref|XP_010671308.1| PREDICTED: protein FAM135B-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010671309.1| PREDICTED: protein FAM135B-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=801

 Score =   350 bits (897),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 257/403 (64%), Gaps = 45/403 (11%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +L RLRW+I    R   V  KRL   E +P                             +
Sbjct  1     MLRRLRWLIDLTQRNFAV--KRLTDAEVKPF--------------------------KPA  32

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD  +E+A+Y+HRFHNLDLFQQGWYQIKI+M+WE+GD   VG PSRVVQYEAP  GSD+
Sbjct  33    MLDTFHEVAIYLHRFHNLDLFQQGWYQIKISMKWEDGDGTYVGIPSRVVQYEAPKMGSDD  92

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD+DNS+ TQPF+I+YARQD+ LSV+++FN+SLS  EV      S VI+KFEL
Sbjct  93    SYGVWRIDDSDNSFSTQPFKIRYARQDVPLSVMIAFNVSLSNREV---PAKSGVIIKFEL  149

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +Y+P+LE G  LQA L T  AAVHEFR+PPKALLGLHSYCPV FDAFH+ LVD S+HI L
Sbjct  150   IYSPLLEKGSELQAILSTSAAAVHEFRIPPKALLGLHSYCPVLFDAFHSALVDISIHISL  209

Query  1351  LKRGVHTLSSKVASGSCS--------DDASSEDFDK-AKQVVLIKGFLTARDILLEELRK  1503
             LK    T   K+ S S +         D S++ F K  K+V+L+K  LTARDILLEE +K
Sbjct  210   LKTVAQTFQKKLPSNSFTVENIDGKFPDKSTKGFGKVVKEVLLVKSLLTARDILLEEAQK  269

Query  1504  VSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPS--QKQSVSQKRNGIT  1674
             + +AI+Q ID  +F S+ +D  LF S  Q+  S  +++  G+ P     Q   +K +   
Sbjct  270   LGRAIDQTIDFTEFISQLDDTKLFGSLLQADVSSTSSD--GKRPEFDDSQKSKEKESLFL  327

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             DFR+   L SLS+D L+   H+ GNQ  YLW+ FL FHRA++T
Sbjct  328   DFRSNGALQSLSRDSLLHFAHTIGNQNHYLWNTFLNFHRANKT  370



>ref|XP_011031519.1| PREDICTED: protein FAM135B-like isoform X1 [Populus euphratica]
Length=765

 Score =   348 bits (892),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 238/344 (69%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M + V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+ +Y S+ TP+RVVQYEAPD G +N
Sbjct  1     MFETVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDSEYTSLATPARVVQYEAPDLGGEN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + G+W IDDTDNS+ TQPFRIKYARQDI LS+++SF L L + E      +SAVILKFEL
Sbjct  61    LYGIWRIDDTDNSFLTQPFRIKYARQDIRLSIMISFTLPLGENE---GPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             + API +    L A  D    AVHEFR+PPKALLGLHSYCPVHFDAFH+VLVD SVHI L
Sbjct  118   MQAPITDTMVELLAYPDASSVAVHEFRIPPKALLGLHSYCPVHFDAFHSVLVDVSVHISL  177

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKA------------KQVVLIKGFLTARDILLEE  1494
             LK G      KV SGS   DA+S+  D++            K++ L+K  L AR+ L+EE
Sbjct  178   LKAGSFL---KVLSGSNGQDATSKISDESHQALGLLASLDIKKITLVKALLAARNTLVEE  234

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+SK I   IDV+DF+S  +D  +F S  Q+     +  VSG    + Q+  +K N  
Sbjct  235   LQKISKGIEHTIDVSDFASNVDDVSMFDSIVQANLVTADVAVSGH--GKPQNGLEKANST  292

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              DF+++ + H  SK  +V +FHS G Q+ YLWSIFL+FHRA++T
Sbjct  293   IDFQSDNLPHISSKAAIVNIFHSLGAQLSYLWSIFLQFHRANKT  336



>ref|XP_011031520.1| PREDICTED: protein FAM135B-like isoform X2 [Populus euphratica]
Length=764

 Score =   348 bits (892),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 238/344 (69%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M + V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+ +Y S+ TP+RVVQYEAPD G +N
Sbjct  1     MFETVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDSEYTSLATPARVVQYEAPDLGGEN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + G+W IDDTDNS+ TQPFRIKYARQDI LS+++SF L L + E      +SAVILKFEL
Sbjct  61    LYGIWRIDDTDNSFLTQPFRIKYARQDIRLSIMISFTLPLGENE---GPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             + API +    L A  D    AVHEFR+PPKALLGLHSYCPVHFDAFH+VLVD SVHI L
Sbjct  118   MQAPITDTMVELLAYPDASSVAVHEFRIPPKALLGLHSYCPVHFDAFHSVLVDVSVHISL  177

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKA------------KQVVLIKGFLTARDILLEE  1494
             LK G      KV SGS   DA+S+  D++            K++ L+K  L AR+ L+EE
Sbjct  178   LKAGSFL---KVLSGSNGQDATSKISDESHQALGLLASLDIKKITLVKALLAARNTLVEE  234

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+SK I   IDV+DF+S  +D  +F S  Q+     +  VSG    + Q+  +K N  
Sbjct  235   LQKISKGIEHTIDVSDFASNVDDVSMFDSIVQANLVTADVAVSGH--GKPQNGLEKANST  292

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              DF+++ + H  SK  +V +FHS G Q+ YLWSIFL+FHRA++T
Sbjct  293   IDFQSDNLPHISSKAAIVNIFHSLGAQLSYLWSIFLQFHRANKT  336



>ref|XP_004498451.1| PREDICTED: protein FAM135B-like isoform X2 [Cicer arietinum]
Length=760

 Score =   347 bits (890),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 238/333 (71%), Gaps = 14/333 (4%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M +AV EI++YIHRFHNLDLF QGWYQ+K+T+RWE+ +  S G P+RVVQYEAPD G  
Sbjct  11    AMFEAVQEISIYIHRFHNLDLFHQGWYQLKVTIRWEDNENMSFGIPARVVQYEAPDLGPG  70

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W IDD DNS+ TQPFRIKYARQDI L ++VSFNLSLS+++ L    ++AVILKFE
Sbjct  71    SIYGIWRIDDIDNSFSTQPFRIKYARQDIHLCMMVSFNLSLSRFKGLP---TTAVILKFE  127

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+Y P +EN  +LQASLD Y AAVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD SVH+ 
Sbjct  128   LMYTPTVENSADLQASLDAYLAAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDVSVHVS  187

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LL+   +  + K      S D         K V+L+K  LTARDILLEEL+K+SKA+ Q 
Sbjct  188   LLRAASYPSALKGLGEVASVD--------LKDVMLLKALLTARDILLEELQKLSKAVGQT  239

Query  1528  IDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             I++++F SK  + ++  S  Q+     + E+S Q     Q+  ++ N   D    E LHS
Sbjct  240   IELSEFLSKLNNVEILNSVVQANQFATDVEISVQ--GNPQNGLERENAAVDLLTAEKLHS  297

Query  1705  LSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             LSK EL+   HS G+Q+ YLW+IFLKFHR ++T
Sbjct  298   LSKSELLDCCHSVGDQLLYLWNIFLKFHRDNKT  330



>ref|XP_004498450.1| PREDICTED: protein FAM135B-like isoform X1 [Cicer arietinum]
Length=781

 Score =   347 bits (890),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 244/346 (71%), Gaps = 19/346 (5%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M +AV EI++YIHRFHNLDLF QGWYQ+K+T+RWE+ +  S G P+RVVQYEAPD G  
Sbjct  11    AMFEAVQEISIYIHRFHNLDLFHQGWYQLKVTIRWEDNENMSFGIPARVVQYEAPDLGPG  70

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G+W IDD DNS+ TQPFRIKYARQDI L ++VSFNLSLS+++ L    ++AVILKFE
Sbjct  71    SIYGIWRIDDIDNSFSTQPFRIKYARQDIHLCMMVSFNLSLSRFKGLP---TTAVILKFE  127

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+Y P +EN  +LQASLD Y AAVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD SVH+ 
Sbjct  128   LMYTPTVENSADLQASLDAYLAAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDVSVHVS  187

Query  1348  LLKRGVHTLSSKVASGSCSD----DASSEDFDKA---------KQVVLIKGFLTARDILL  1488
             LL+   +  + KV S S +     D S +  +           K V+L+K  LTARDILL
Sbjct  188   LLRAASYPSALKVPSNSRNAEVIVDKSYDTLNHGLGEVASVDLKDVMLLKALLTARDILL  247

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             EEL+K+SKA+ Q I++++F SK  + ++  S  Q+     + E+S Q     Q+  ++ N
Sbjct  248   EELQKLSKAVGQTIELSEFLSKLNNVEILNSVVQANQFATDVEISVQ--GNPQNGLEREN  305

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                D    E LHSLSK EL+   HS G+Q+ YLW+IFLKFHR ++T
Sbjct  306   AAVDLLTAEKLHSLSKSELLDCCHSVGDQLLYLWNIFLKFHRDNKT  351



>ref|XP_008464799.1| PREDICTED: protein FAM135B-like isoform X2 [Cucumis melo]
Length=797

 Score =   347 bits (890),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 232/341 (68%), Gaps = 24/341 (7%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD V EIA+YIHRFHNLDLFQQGWYQIK+TMRWE+ +Y SVGTP+RVVQYE  D GS 
Sbjct  35    AMLDTVQEIAIYIHRFHNLDLFQQGWYQIKLTMRWEDSEYTSVGTPARVVQYE--DLGSG  92

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             N  GVW IDDTDNS+ TQPF+IKYARQDILLS+++SFN  L KYE      +SAVILKFE
Sbjct  93    NSYGVWKIDDTDNSFSTQPFKIKYARQDILLSIMISFNFPLVKYEA---PSTSAVILKFE  149

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAPILE G  LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD S+HIC
Sbjct  150   LMYAPILEAGPELQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSIHIC  209

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQ---------VVLIKGFLTARDILLEELR  1500
             LL+        K +S    ++ ++  FD   Q         V LIK  LTARDILLEE +
Sbjct  210   LLRS---YTPGKRSSELHKENLAARHFDPQNQVGASRDEKDVTLIKALLTARDILLEEFQ  266

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF  1680
              +SKAI+Q +D  DF S  +D   +      S +DN  V G+   Q       +NG+   
Sbjct  267   NLSKAIDQTVDFTDFISGMDDTK-YVDVLIPSKRDN--VKGEAAGQ----GNPQNGLERT  319

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                + LH  +   +   FHS G+Q+ YLWS FLKFHRA +T
Sbjct  320   NGGDQLHQRAGSHMSHRFHSLGDQLLYLWSTFLKFHRASKT  360



>ref|XP_006491850.1| PREDICTED: protein FAM135B-like isoform X2 [Citrus sinensis]
Length=804

 Score =   347 bits (890),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 239/332 (72%), Gaps = 28/332 (8%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  60    LDAVQEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  119

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+ LSV+++FNL +SKYEVL    +SAVILKFE
Sbjct  120   DFSGVWRIDDAENSFSTQPFRIKYARQDVHLSVMIAFNLYVSKYEVLS---TSAVILKFE  176

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  177   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  236

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  237   LLKASSSTAPPKSDFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  292

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  293   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  337

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHR
Sbjct  338   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHR  369



>gb|KDO50636.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=804

 Score =   347 bits (890),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 239/332 (72%), Gaps = 28/332 (8%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  60    LDAVQEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  119

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+ LSV+++FNL +SKYEVL    +SAVILKFE
Sbjct  120   DFSGVWRIDDAENSFSTQPFRIKYARQDVHLSVMIAFNLYVSKYEVLS---TSAVILKFE  176

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  177   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  236

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  237   LLKASSSTAPPKSEFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  292

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  293   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  337

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHR
Sbjct  338   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHR  369



>ref|XP_010671310.1| PREDICTED: protein FAM135B-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010671311.1| PREDICTED: protein FAM135B-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=769

 Score =   344 bits (883),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 240/343 (70%), Gaps = 17/343 (5%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD  +E+A+Y+HRFHNLDLFQQGWYQIKI+M+WE+GD   VG PSRVVQYEAP  GSD+
Sbjct  1     MLDTFHEVAIYLHRFHNLDLFQQGWYQIKISMKWEDGDGTYVGIPSRVVQYEAPKMGSDD  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD+DNS+ TQPF+I+YARQD+ LSV+++FN+SLS  EV      S VI+KFEL
Sbjct  61    SYGVWRIDDSDNSFSTQPFKIRYARQDVPLSVMIAFNVSLSNREV---PAKSGVIIKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +Y+P+LE G  LQA L T  AAVHEFR+PPKALLGLHSYCPV FDAFH+ LVD S+HI L
Sbjct  118   IYSPLLEKGSELQAILSTSAAAVHEFRIPPKALLGLHSYCPVLFDAFHSALVDISIHISL  177

Query  1351  LKRGVHTLSSKVASGSCS--------DDASSEDFDK-AKQVVLIKGFLTARDILLEELRK  1503
             LK    T   K+ S S +         D S++ F K  K+V+L+K  LTARDILLEE +K
Sbjct  178   LKTVAQTFQKKLPSNSFTVENIDGKFPDKSTKGFGKVVKEVLLVKSLLTARDILLEEAQK  237

Query  1504  VSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPS--QKQSVSQKRNGIT  1674
             + +AI+Q ID  +F S+ +D  LF S  Q+  S  +++  G+ P     Q   +K +   
Sbjct  238   LGRAIDQTIDFTEFISQLDDTKLFGSLLQADVSSTSSD--GKRPEFDDSQKSKEKESLFL  295

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             DFR+   L SLS+D L+   H+ GNQ  YLW+ FL FHRA++T
Sbjct  296   DFRSNGALQSLSRDSLLHFAHTIGNQNHYLWNTFLNFHRANKT  338



>gb|KHN39182.1| Protein FAM135B-like protein [Glycine soja]
Length=542

 Score =   337 bits (864),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 237/334 (71%), Gaps = 7/334 (2%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMRWE+G+    G P+RVVQYEAP+ GSDN
Sbjct  39    VLDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRWEDGEGSYPGIPARVVQYEAPEVGSDN  98

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF IKYARQD+ LS+++SF LS  + E      SSAVILKFEL
Sbjct  99    LCRVWMIDDTDNSFSTPPFHIKYARQDVFLSIMISFYLSFGECE----GQSSAVILKFEL  154

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API+E G  L  SLD Y A+VHE+++PPKAL GLHSYCPVHFDAFHAVLV+ S+HI L
Sbjct  155   MHAPIIETGPELLGSLDAYAASVHEYKIPPKALQGLHSYCPVHFDAFHAVLVETSIHISL  214

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LK   HT   KV+S S  S+ A  ED+  + +V+LIK  + A DILLE+LR++S  I +A
Sbjct  215   LKASYHTSRQKVSSDSRGSEGAYVEDYVGSNKVMLIKALMAAYDILLEDLRRISTGIGKA  274

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             ID+ + +S+ +  +LF S      K  + + S Q+  + Q  ++K     +   E+    
Sbjct  275   IDLTEMTSESDATELFASTPPACVKSIDVQSSLQLSDRPQVSAEKAAHHVNNLFEKSPQP  334

Query  1705  LSKDE-LVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              S D+ L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  335   FSWDDHLLISFQSLGNQLLCLWNIFLKFHRENKT  368



>ref|XP_009416893.1| PREDICTED: protein FAM135B-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=804

 Score =   344 bits (882),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/409 (48%), Positives = 265/409 (65%), Gaps = 48/409 (12%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  R+R++I GLN   P T + L   +ARP  +                           
Sbjct  1     MFRRMRYLI-GLNPKTPPTKRLL---DARPRRVKF---------------------QPPD  35

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+    S GTPSRV+QYEAP+T SD+
Sbjct  36    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDSSLHSCGTPSRVIQYEAPNTVSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + GVW IDD D+S+ TQPF+IKYARQD+ LSV+VSFN ++ K E   +   SAVILKFEL
Sbjct  96    LLGVWRIDDADHSFSTQPFKIKYARQDVPLSVMVSFNFAIGKDEKPLI---SAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D  P AVHEF++PP+AL GLHSYCPVHFDAFHAVLVD SVHI  
Sbjct  153   MYAPILENGHEIQASFDMIPVAVHEFKIPPRALFGLHSYCPVHFDAFHAVLVDLSVHIVY  212

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDK-----------AKQVVLIKGFLTARDILLEEL  1497
             LK G  T   K++S S + +  S+++ +           +K V +IK  L +R++LLEE+
Sbjct  213   LKAGAST-QEKLSSASVTMEHISDEYHEEHNHLVGQGWSSKAVEIIKSLLVSRELLLEEI  271

Query  1498  RKVSKAINQAIDVNDFSSKHEDKDLF--TSRQSTSSKDNAEVS------GQMPSQKQSVS  1653
             + +SKA+ Q+ID   F+  +  +  F  +S ++  S  N+ +S      G +    Q++ 
Sbjct  272   KNLSKALGQSIDDLQFADLNLGRFEFIDSSLRNDLSTANSVISGSKVGVGHLAGMLQNIL  331

Query  1654  QKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +K NG  DF N+ + +SLSKDEL+ LF + GNQ+ +LW+ FLKFHR +R
Sbjct  332   EKSNGTVDFGNDVIFYSLSKDELLDLFFTLGNQLSFLWNTFLKFHRVNR  380



>ref|XP_010241697.1| PREDICTED: protein FAM135B-like isoform X2 [Nelumbo nucifera]
Length=802

 Score =   342 bits (878),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 247/349 (71%), Gaps = 24/349 (7%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +ML+A+ E+A+YIHRFHNLDLFQQGWYQIKI+MRWE+G Y S GTP+RVVQYEA + G D
Sbjct  31    AMLEALQEVAVYIHRFHNLDLFQQGWYQIKISMRWEDGSYTSPGTPARVVQYEASEVGPD  90

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G W IDDTDNS+ TQPFRIKYARQD+LLSV+VSF  SL K E      +SAVILKFE
Sbjct  91    DILGGWRIDDTDNSFCTQPFRIKYARQDVLLSVMVSFIFSLYKCE---GPSTSAVILKFE  147

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLYAPILE G ++QASLD  PAAVHEFRLPPKALLGLHSYCPV FDAFHAVLVD S+H+ 
Sbjct  148   LLYAPILEKGSDMQASLDAIPAAVHEFRLPPKALLGLHSYCPVIFDAFHAVLVDLSIHV-  206

Query  1348  LLKRGVHTLSSKVASG--SCSDDA------SSEDFDK-----AKQVVLIKGFLTARDILL  1488
             +LK G H  S  V+S   S  D A      S++  D+     + Q+  +K  L ARDILL
Sbjct  207   VLKAGAHGSSQMVSSDYYSVGDVAGENCVGSNKALDQRDSVHSYQIAFLKELLVARDILL  266

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS--RQSTSSKDNAEVSGQMPSQKQSVSQKR  1662
             EEL+K+SKAI+Q ID+ D  S   D  L ++  ++  S  D  +V+    + + + +  +
Sbjct  267   EELQKLSKAIDQTIDLTDVMSNLGDFKLISTYLQEDLSIVDAEDVT---VTARHAAAMPQ  323

Query  1663  NGIT--DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             NG    +   +E+L SLSKD L+  F+S G Q+ +LW+ FLKFHR ++T
Sbjct  324   NGFEKPNHAIDEMLQSLSKDNLLSTFNSVGKQLSFLWNAFLKFHRDNKT  372



>ref|XP_009416894.1| PREDICTED: protein FAM135B-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=789

 Score =   342 bits (876),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 197/403 (49%), Positives = 262/403 (65%), Gaps = 51/403 (13%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  R+R++I GLN   P T + L   +ARP  +                           
Sbjct  1     MFRRMRYLI-GLNPKTPPTKRLL---DARPRRVKF---------------------QPPD  35

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+    S GTPSRV+QYEAP+T SD+
Sbjct  36    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDSSLHSCGTPSRVIQYEAPNTVSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + GVW IDD D+S+ TQPF+IKYARQD+ LSV+VSFN ++ K E   +   SAVILKFEL
Sbjct  96    LLGVWRIDDADHSFSTQPFKIKYARQDVPLSVMVSFNFAIGKDEKPLI---SAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D  P AVHEF++PP+AL GLHSYCPVHFDAFHAVLVD SVHI  
Sbjct  153   MYAPILENGHEIQASFDMIPVAVHEFKIPPRALFGLHSYCPVHFDAFHAVLVDLSVHIVY  212

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDK-----------AKQVVLIKGFLTARDILLEEL  1497
             LK G  T   K++S S + +  S+++ +           +K V +IK  L +R++LLEE+
Sbjct  213   LKAGAST-QEKLSSASVTMEHISDEYHEEHNHLVGQGWSSKAVEIIKSLLVSRELLLEEI  271

Query  1498  RKVSKAINQAIDVNDFSSKHEDKDLF--TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             + +SKA+ Q+ID   F+  +  +  F  +S ++  S  N+ +SG         S+K NG 
Sbjct  272   KNLSKALGQSIDDLQFADLNLGRFEFIDSSLRNDLSTANSVISG---------SKKSNGT  322

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              DF N+ + +SLSKDEL+ LF + GNQ+ +LW+ FLKFHR +R
Sbjct  323   VDFGNDVIFYSLSKDELLDLFFTLGNQLSFLWNTFLKFHRVNR  365



>ref|XP_010241696.1| PREDICTED: protein FAM135B-like isoform X1 [Nelumbo nucifera]
Length=814

 Score =   342 bits (878),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 247/349 (71%), Gaps = 24/349 (7%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +ML+A+ E+A+YIHRFHNLDLFQQGWYQIKI+MRWE+G Y S GTP+RVVQYEA + G D
Sbjct  31    AMLEALQEVAVYIHRFHNLDLFQQGWYQIKISMRWEDGSYTSPGTPARVVQYEASEVGPD  90

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G W IDDTDNS+ TQPFRIKYARQD+LLSV+VSF  SL K E      +SAVILKFE
Sbjct  91    DILGGWRIDDTDNSFCTQPFRIKYARQDVLLSVMVSFIFSLYKCE---GPSTSAVILKFE  147

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLYAPILE G ++QASLD  PAAVHEFRLPPKALLGLHSYCPV FDAFHAVLVD S+H+ 
Sbjct  148   LLYAPILEKGSDMQASLDAIPAAVHEFRLPPKALLGLHSYCPVIFDAFHAVLVDLSIHV-  206

Query  1348  LLKRGVHTLSSKVASG--SCSDDA------SSEDFDK-----AKQVVLIKGFLTARDILL  1488
             +LK G H  S  V+S   S  D A      S++  D+     + Q+  +K  L ARDILL
Sbjct  207   VLKAGAHGSSQMVSSDYYSVGDVAGENCVGSNKALDQRDSVHSYQIAFLKELLVARDILL  266

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS--RQSTSSKDNAEVSGQMPSQKQSVSQKR  1662
             EEL+K+SKAI+Q ID+ D  S   D  L ++  ++  S  D  +V+    + + + +  +
Sbjct  267   EELQKLSKAIDQTIDLTDVMSNLGDFKLISTYLQEDLSIVDAEDVT---VTARHAAAMPQ  323

Query  1663  NGIT--DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             NG    +   +E+L SLSKD L+  F+S G Q+ +LW+ FLKFHR ++T
Sbjct  324   NGFEKPNHAIDEMLQSLSKDNLLSTFNSVGKQLSFLWNAFLKFHRDNKT  372



>ref|XP_009403472.1| PREDICTED: uncharacterized protein LOC103987005 isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009403480.1| PREDICTED: uncharacterized protein LOC103987005 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=701

 Score =   339 bits (869),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 239/350 (68%), Gaps = 26/350 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+G  ES GTPSRV+QYEAP+  SD+
Sbjct  36    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDGSLESCGTPSRVIQYEAPNIVSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I  VW IDD D+S+FT PF+IKYARQD+ LS++VSFN +  KYE      SSA ILKFEL
Sbjct  96    IFAVWRIDDADHSFFTHPFKIKYARQDVPLSIMVSFNFATGKYE---RPASSAAILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP+ ENG  +QAS++ +P AVHEFR+PPKAL GLHSYCPVHFDAFHAVLVD SVHI  
Sbjct  153   MYAPMFENGNEIQASIEMFPTAVHEFRIPPKALHGLHSYCPVHFDAFHAVLVDLSVHIVF  212

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVV----------LIKGFLTARDILLEELR  1500
             LK G  ++  KV+S S   +  ++++  + Q++          ++K    +R+IL+EE+R
Sbjct  213   LKSGT-SIQEKVSSTSLMVENIADEYYGSNQILGQGWSPKAIEIVKSLFVSREILMEEIR  271

Query  1501  KVSKAINQAI------DVN----DFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSV  1650
              +SKAI Q I      D+N    +F       DL T+    S        G +    Q++
Sbjct  272   NLSKAIGQKIDDLHNADLNLGKFEFIGSSLRTDLSTANTGISGSSMG--VGHLAGMLQNI  329

Query  1651  SQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              +K NG  +F N+ +L+SLSK+EL+ ++ + GNQ+ +LW+ FL FHR +R
Sbjct  330   LEKSNGTVNFENDVMLYSLSKEELLDVYFTMGNQLSFLWNTFLNFHRINR  379



>gb|KDO50635.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=794

 Score =   341 bits (874),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 228/335 (68%), Gaps = 41/335 (12%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSD  987
             LDAV EIA+YIHRFHNLDLFQQGWYQIKIT+RWE+ +Y S  VGTP+RVVQYEAP  G D
Sbjct  60    LDAVQEIAIYIHRFHNLDLFQQGWYQIKITLRWEDSEYSSSAVGTPARVVQYEAPQLGFD  119

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD +NS+ TQPFRIKYARQD+                 L +  +SAVILKFE
Sbjct  120   DFSGVWRIDDAENSFSTQPFRIKYARQDVH----------------LSVLSTSAVILKFE  163

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHFD+ HAVLVD SVH+ 
Sbjct  164   LMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHFDSLHAVLVDVSVHVS  223

Query  1348  LLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             LLK    T   K   VA    S  AS +    + Q++LIK   +ARDILLE+L+++SKAI
Sbjct  224   LLKASSSTAPPKSEFVAQKIWSQLASVD----STQLMLIKALFSARDILLEDLKEISKAI  279

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-VSQKRNGITDFRNEEV  1695
             +QAID++D         LF S        + EV  Q+    Q+ V +K +G  D +++ +
Sbjct  280   DQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGVERKADGAKDLQSDGL  324

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  325   SHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  359



>ref|XP_004299845.1| PREDICTED: protein FAM135B-like [Fragaria vesca subsp. vesca]
Length=802

 Score =   341 bits (874),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 245/349 (70%), Gaps = 25/349 (7%)
 Frame = +1

Query  796   RNSQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPD  975
             R   +MLD+V EIA+YIHRFHNLDLFQQGWYQIKITMR E+ D    GTP+RVVQYEAPD
Sbjct  34    RPPLAMLDSVQEIAIYIHRFHNLDLFQQGWYQIKITMRREDSDV--WGTPARVVQYEAPD  91

Query  976   TGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVI  1155
              GSD++ GVW IDDTDNS+ TQPFRIKYARQD+ LS+++SFNLSL+ YE      SSAV+
Sbjct  92    LGSDDVYGVWRIDDTDNSFSTQPFRIKYARQDVFLSIMISFNLSLAGYE---GQSSSAVL  148

Query  1156  LKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDAS  1335
             LKFEL++API  N  +LQA+LD  PAAVHEFR+PPKALLGLHSYCPVHFDAFH+VLVD S
Sbjct  149   LKFELMHAPISGNRSDLQAALDANPAAVHEFRIPPKALLGLHSYCPVHFDAFHSVLVDIS  208

Query  1336  VHICLLKRGVHTLSSKVA------------SGSCSDDASSEDFDKAKQVVLIKGFLTARD  1479
             +HI LLK   +   SKV+            S   ++  +S D +    ++L+K  L AR 
Sbjct  209   IHISLLKAPSYKHPSKVSRIAEDVGGETSESNQAAEQVASADLNG---IMLLKKLLAARS  265

Query  1480  ILLEELRKVSKAINQAIDVNDFSSKHED-KDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQ  1656
             ILLEEL+ +SKAI+Q ID+ DF SK +D  D        ++ D  +VSGQ   + Q+  +
Sbjct  266   ILLEELQTLSKAIDQEIDLTDFISKMDDMNDSLLPENLVAAND--KVSGQ--GKPQNGLE  321

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             K N  +D    E+  SLSK  ++  F+  G+Q+FYLW+ FL+FHR H+T
Sbjct  322   KANSASDSSTGELTRSLSKGAVLNSFNLLGDQLFYLWNTFLQFHRFHKT  370



>gb|KEH31286.1| serine esterase family protein, putative [Medicago truncatula]
Length=790

 Score =   340 bits (873),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 188/396 (47%), Positives = 253/396 (64%), Gaps = 39/396 (10%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  R RW + GLN+    T + +N+ +  PT                         N   
Sbjct  1     MFRRFRWFV-GLNQKNLSTKRLVNADQPGPTRP-----------------------NHLP  36

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
              LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMR E G+    G P+RVVQYEAP+ GSDN
Sbjct  37    NLDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRLEVGEDSYPGIPARVVQYEAPEVGSDN  96

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF+I+YARQD+ LS+++SF L+   YE      S+AVILKFEL
Sbjct  97    LCRVWMIDDTDNSFSTPPFQIRYARQDVFLSIMISFYLAFGDYE----GESTAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++AP+   G +LQ SLD   A+VHE+++PPKALLGLHSYCP+HFDAFHAV+VD SVHI L
Sbjct  153   MHAPMTATGSDLQGSLDACSASVHEYKIPPKALLGLHSYCPIHFDAFHAVMVDTSVHISL  212

Query  1351  LKRGVHTLSSKVASGSCSDDAS--SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQ  1524
             LK   HT+  KV S  C D     +ED+  + +V+LIK  + A DILLE+LR++S  I+Q
Sbjct  213   LKASYHTIRQKVPS-DCRDSEGNYAEDYVGSNKVMLIKALMAAHDILLEDLRRISTGIDQ  271

Query  1525  AIDVNDFSSKHEDKDLF--TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             AID+ + + + +D   F  T      S D  E S Q+P +++  +   N +T    EE +
Sbjct  272   AIDLTEITFESDDTKWFDLTPAARVQSID-GEQSLQLPDREEDATHNINYLT----EESV  326

Query  1699  HSLS-KDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                S  D L+  F S  NQ+ YLW++FLKFHR ++T
Sbjct  327   QPFSWDDHLLNSFQSLANQLLYLWNVFLKFHRENKT  362



>ref|XP_009403464.1| PREDICTED: protein FAM135B-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=806

 Score =   339 bits (869),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 239/350 (68%), Gaps = 26/350 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+G  ES GTPSRV+QYEAP+  SD+
Sbjct  36    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDGSLESCGTPSRVIQYEAPNIVSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I  VW IDD D+S+FT PF+IKYARQD+ LS++VSFN +  KYE      SSA ILKFEL
Sbjct  96    IFAVWRIDDADHSFFTHPFKIKYARQDVPLSIMVSFNFATGKYE---RPASSAAILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP+ ENG  +QAS++ +P AVHEFR+PPKAL GLHSYCPVHFDAFHAVLVD SVHI  
Sbjct  153   MYAPMFENGNEIQASIEMFPTAVHEFRIPPKALHGLHSYCPVHFDAFHAVLVDLSVHIVF  212

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVV----------LIKGFLTARDILLEELR  1500
             LK G  ++  KV+S S   +  ++++  + Q++          ++K    +R+IL+EE+R
Sbjct  213   LKSGT-SIQEKVSSTSLMVENIADEYYGSNQILGQGWSPKAIEIVKSLFVSREILMEEIR  271

Query  1501  KVSKAINQAI------DVN----DFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSV  1650
              +SKAI Q I      D+N    +F       DL T+    S        G +    Q++
Sbjct  272   NLSKAIGQKIDDLHNADLNLGKFEFIGSSLRTDLSTANTGISGSSMG--VGHLAGMLQNI  329

Query  1651  SQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              +K NG  +F N+ +L+SLSK+EL+ ++ + GNQ+ +LW+ FL FHR +R
Sbjct  330   LEKSNGTVNFENDVMLYSLSKEELLDVYFTMGNQLSFLWNTFLNFHRINR  379



>ref|XP_009403456.1| PREDICTED: protein FAM135B-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=805

 Score =   339 bits (869),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 239/350 (68%), Gaps = 26/350 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+G  ES GTPSRV+QYEAP+  SD+
Sbjct  36    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDGSLESCGTPSRVIQYEAPNIVSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I  VW IDD D+S+FT PF+IKYARQD+ LS++VSFN +  KYE      SSA ILKFEL
Sbjct  96    IFAVWRIDDADHSFFTHPFKIKYARQDVPLSIMVSFNFATGKYE---RPASSAAILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP+ ENG  +QAS++ +P AVHEFR+PPKAL GLHSYCPVHFDAFHAVLVD SVHI  
Sbjct  153   MYAPMFENGNEIQASIEMFPTAVHEFRIPPKALHGLHSYCPVHFDAFHAVLVDLSVHIVF  212

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVV----------LIKGFLTARDILLEELR  1500
             LK G  ++  KV+S S   +  ++++  + Q++          ++K    +R+IL+EE+R
Sbjct  213   LKSGT-SIQEKVSSTSLMVENIADEYYGSNQILGQGWSPKAIEIVKSLFVSREILMEEIR  271

Query  1501  KVSKAINQAI------DVN----DFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSV  1650
              +SKAI Q I      D+N    +F       DL T+    S        G +    Q++
Sbjct  272   NLSKAIGQKIDDLHNADLNLGKFEFIGSSLRTDLSTANTGISGSSMG--VGHLAGMLQNI  329

Query  1651  SQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              +K NG  +F N+ +L+SLSK+EL+ ++ + GNQ+ +LW+ FL FHR +R
Sbjct  330   LEKSNGTVNFENDVMLYSLSKEELLDVYFTMGNQLSFLWNTFLNFHRINR  379



>gb|KEH39721.1| serine esterase family protein, putative [Medicago truncatula]
Length=886

 Score =   340 bits (871),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 238/333 (71%), Gaps = 14/333 (4%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M +AV EIA+YIHRFHNLDL  QGWYQ+K+TMRWE+ +  S G P+RVVQYEAPD G  
Sbjct  137   AMFEAVQEIAIYIHRFHNLDLLHQGWYQLKVTMRWEDNENMSFGIPARVVQYEAPDQGPC  196

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ G+W IDDTDNS+ TQPFRIKYARQD+ L ++VSFNLSLS+++ L    ++AVILKFE
Sbjct  197   SLYGIWRIDDTDNSFSTQPFRIKYARQDVHLCMMVSFNLSLSRFKGLP---TTAVILKFE  253

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAP +ENG +LQASLD YPAAVHEFR+PPKALLGLHSYCPVHFDAFHA LVD SVH  
Sbjct  254   LVYAPTVENGADLQASLDDYPAAVHEFRIPPKALLGLHSYCPVHFDAFHAALVDVSVHAS  313

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LL+   +  + K      S D         K V L+K  LTAR+ILL+EL+K+SKA++Q 
Sbjct  314   LLRAAPYPSALKAKGEVASID--------MKNVTLLKALLTAREILLQELQKLSKAVDQT  365

Query  1528  IDVNDFSSK-HEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             I++++F SK + +K L     +        +S Q    +Q+  ++ NG  D    E L+S
Sbjct  366   IEISEFLSKLNNEKILNYVAHANQFATAVGISAQ--GNQQNGLERGNGALDLLIAEKLNS  423

Query  1705  LSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             LS+ +L+   HS G+Q+FYLW+ FLKFHR ++T
Sbjct  424   LSESDLLHCCHSVGDQLFYLWNTFLKFHRDNKT  456



>ref|XP_006584994.1| PREDICTED: protein FAM135B-like isoform X2 [Glycine max]
Length=781

 Score =   337 bits (863),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 237/334 (71%), Gaps = 7/334 (2%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMRWE+G+    G P+RVVQYEAP+ GSDN
Sbjct  39    VLDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRWEDGEGSYPGIPARVVQYEAPEVGSDN  98

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF IKYARQD+ LS+++SF LS  + E      SSAVILKFEL
Sbjct  99    LCRVWMIDDTDNSFSTPPFHIKYARQDVFLSIMISFYLSFGECE----GQSSAVILKFEL  154

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API+E G  L  SLD Y A+VHE+++PPKAL GLHSYCPVHFDAFHAVLV+ S+HI L
Sbjct  155   MHAPIIETGPELLGSLDAYAASVHEYKIPPKALQGLHSYCPVHFDAFHAVLVETSIHISL  214

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LK   HT   KV+S S  S+ A  ED+  + +V+LIK  + A DILLE+LR++S  I +A
Sbjct  215   LKASYHTSRQKVSSDSRGSEGAYVEDYVGSNKVMLIKALMAAYDILLEDLRRISTGIGKA  274

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             ID+ + +S+ +  +LF S      K  + + S Q+  + Q  ++K     +   E+    
Sbjct  275   IDLTEMTSESDATELFASTPPACVKSIDVQSSLQLSDRPQVSAEKAAHHVNNLFEKSPQP  334

Query  1705  LSKDE-LVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              S D+ L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  335   FSWDDHLLISFQSLGNQLLCLWNIFLKFHRENKT  368



>ref|XP_006584995.1| PREDICTED: protein FAM135B-like isoform X3 [Glycine max]
Length=764

 Score =   336 bits (862),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 237/334 (71%), Gaps = 7/334 (2%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMRWE+G+    G P+RVVQYEAP+ GSDN
Sbjct  39    VLDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRWEDGEGSYPGIPARVVQYEAPEVGSDN  98

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF IKYARQD+ LS+++SF LS  + E      SSAVILKFEL
Sbjct  99    LCRVWMIDDTDNSFSTPPFHIKYARQDVFLSIMISFYLSFGECE----GQSSAVILKFEL  154

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API+E G  L  SLD Y A+VHE+++PPKAL GLHSYCPVHFDAFHAVLV+ S+HI L
Sbjct  155   MHAPIIETGPELLGSLDAYAASVHEYKIPPKALQGLHSYCPVHFDAFHAVLVETSIHISL  214

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LK   HT   KV+S S  S+ A  ED+  + +V+LIK  + A DILLE+LR++S  I +A
Sbjct  215   LKASYHTSRQKVSSDSRGSEGAYVEDYVGSNKVMLIKALMAAYDILLEDLRRISTGIGKA  274

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             ID+ + +S+ +  +LF S      K  + + S Q+  + Q  ++K     +   E+    
Sbjct  275   IDLTEMTSESDATELFASTPPACVKSIDVQSSLQLSDRPQVSAEKAAHHVNNLFEKSPQP  334

Query  1705  LSKDE-LVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              S D+ L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  335   FSWDDHLLISFQSLGNQLLCLWNIFLKFHRENKT  368



>ref|XP_003532627.1| PREDICTED: protein FAM135B-like isoform X1 [Glycine max]
Length=798

 Score =   337 bits (864),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 237/334 (71%), Gaps = 7/334 (2%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMRWE+G+    G P+RVVQYEAP+ GSDN
Sbjct  39    VLDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRWEDGEGSYPGIPARVVQYEAPEVGSDN  98

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF IKYARQD+ LS+++SF LS  + E      SSAVILKFEL
Sbjct  99    LCRVWMIDDTDNSFSTPPFHIKYARQDVFLSIMISFYLSFGECE----GQSSAVILKFEL  154

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API+E G  L  SLD Y A+VHE+++PPKAL GLHSYCPVHFDAFHAVLV+ S+HI L
Sbjct  155   MHAPIIETGPELLGSLDAYAASVHEYKIPPKALQGLHSYCPVHFDAFHAVLVETSIHISL  214

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             LK   HT   KV+S S  S+ A  ED+  + +V+LIK  + A DILLE+LR++S  I +A
Sbjct  215   LKASYHTSRQKVSSDSRGSEGAYVEDYVGSNKVMLIKALMAAYDILLEDLRRISTGIGKA  274

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHS  1704
             ID+ + +S+ +  +LF S      K  + + S Q+  + Q  ++K     +   E+    
Sbjct  275   IDLTEMTSESDATELFASTPPACVKSIDVQSSLQLSDRPQVSAEKAAHHVNNLFEKSPQP  334

Query  1705  LSKDE-LVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              S D+ L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  335   FSWDDHLLISFQSLGNQLLCLWNIFLKFHRENKT  368



>ref|XP_002325960.2| hypothetical protein POPTR_0019s10640g [Populus trichocarpa]
 gb|EEF00342.2| hypothetical protein POPTR_0019s10640g [Populus trichocarpa]
Length=778

 Score =   336 bits (861),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 233/346 (67%), Gaps = 20/346 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M + V EIA+YIHRFHNLDLFQQGWYQ+KI+MRWE+ +Y S+ TP+RVVQYEAPD G +N
Sbjct  1     MFETVQEIAVYIHRFHNLDLFQQGWYQMKISMRWEDSEYTSLATPARVVQYEAPDLGGEN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I G+W IDDTDNS+ TQPFRIKYARQDI LS+++SF L L + E      +SAVILKFEL
Sbjct  61    IYGIWRIDDTDNSFLTQPFRIKYARQDIRLSIMISFTLPLGENE---GPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             + AP+ +    L A  D    AVHEFR+PPKALLGLHSYCPVHFDAFH+VLVD SVHI L
Sbjct  118   MQAPMTDTMVELLAYPDASSVAVHEFRIPPKALLGLHSYCPVHFDAFHSVLVDVSVHISL  177

Query  1351  LKRG----VHTLSSKVASGSCSDDASSEDFDK----------AKQVVLIKGFLTARDILL  1488
             LK G    V    +  AS   S    +  F             K++ L+K  L AR+ LL
Sbjct  178   LKAGSFLKVLRFCTVQASNGLSGLTVTIFFSNHSLVFLASLDIKKITLVKALLAARNTLL  237

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             EEL+K+SK I + IDV+DF+S  +D  +F S  Q+     +  VSG    + Q+  +K N
Sbjct  238   EELQKISKGIERTIDVSDFASNVDDVSMFDSIVQANLVTADVAVSGH--GKPQNGLEKAN  295

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                DF+++ + H  SK  +V +FHS G Q+ YLWSIFL+FHRA++T
Sbjct  296   STIDFQSDNLPHISSKAAVVNIFHSLGAQLSYLWSIFLQFHRANKT  341



>ref|XP_003532974.2| PREDICTED: protein FAM135B-like isoform X1 [Glycine max]
 ref|XP_006585464.1| PREDICTED: protein FAM135B-like isoform X2 [Glycine max]
Length=796

 Score =   335 bits (860),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 187/396 (47%), Positives = 252/396 (64%), Gaps = 35/396 (9%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  RL W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRRLGWFV-GLNQTNLSTKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IKIT+RWE+GD    G P+RVVQYEAP+ G
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKITLRWEDGDDSHPGVPARVVQYEAPEVG  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +DN+CGVWMIDD DNS+ T  FRI+YARQD++L++++SF LS  +YE      SSAVILK
Sbjct  95    ADNLCGVWMIDDKDNSFSTPSFRIRYARQDVILAIMISFYLSYGRYE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E    LQ+S++   A+ HE+R+PPKALLGLHSYCPVHFDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMRPELQSSVNGCAASFHEYRIPPKALLGLHSYCPVHFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             I LLK G  T   KV S S +   +  E+  ++ +  LIK  + ARDILL++LR++SK  
Sbjct  211   ISLLKSGYLTPQLKVPSDSLASKGTYGEECVRSSKAALIKALMAARDILLDDLRRISKGT  270

Query  1519  NQAIDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEV  1695
             NQAID+   +   ++ K L ++  +     + EVS Q+    Q  ++K     +   EE+
Sbjct  271   NQAIDLTGITFEPYDTKSLNSTSTAHEKSTDDEVSLQLSDGTQISAEKVTQYINHVTEEL  330

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                 S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  331   SQPFSWDDMLNSFQFIGNQLLYLWNTFLKFHRENKT  366



>ref|XP_006300307.1| hypothetical protein CARUB_v10019821mg [Capsella rubella]
 gb|EOA33205.1| hypothetical protein CARUB_v10019821mg [Capsella rubella]
Length=614

 Score =   331 bits (848),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 180/344 (52%), Positives = 226/344 (66%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQ+KITMRWE+GD  + G PSRVVQYEAPD+GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQVKITMRWEDGDNVTRGIPSRVVQYEAPDSGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDNDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N       LD  P AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCMDNTPG--KHLDASPVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +     LSS V++      ++++ F KA         K V  +K  L AR+ILLE
Sbjct  210   LKSAAYKRPANLSSGVSTSKNVGGSTAQSFKKALGLLASADKKLVSFVKALLGAREILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID++DF S   +  L           N+ V G    ++Q+  +K N  
Sbjct  270   EMQRLSKAVGQPIDLSDFVSNMNNVPL----------SNSTVDGSGQGKEQNSLEKLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++E LH L KD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  320   FDLGSDEWLHELPKDHLSRLFHLLGTQLHYLWTTFLGFHRDNHT  363



>gb|KHG18911.1| Uncharacterized protein F383_24156 [Gossypium arboreum]
Length=785

 Score =   335 bits (859),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 227/346 (66%), Gaps = 34/346 (10%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD + EIA+YIHRFHNLDLFQQGWY++KITMRWEN    S+G PSRV+QYEAP+ GSD+
Sbjct  36    MLDTIQEIAIYIHRFHNLDLFQQGWYRLKITMRWENDQQTSIGAPSRVMQYEAPNVGSDD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + GVW IDDTDNS+ T+PFRIKYA+QD+LLS+L                 SSAVILKFEL
Sbjct  96    VYGVWRIDDTDNSFATRPFRIKYAKQDVLLSILGPL--------------SSAVILKFEL  141

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P+LE G   Q S D  PAAVHEFR+PPKALLGLHSYCPV+FD+FHAVLVD SVHICL
Sbjct  142   LYSPVLEKGSEFQPSSDGCPAAVHEFRIPPKALLGLHSYCPVYFDSFHAVLVDVSVHICL  201

Query  1351  LKRGVHTLSSKVASGSCSD---------DASSEDFDKA-----KQVVLIKGFLTARDILL  1488
             LK G    + KV S   S          D SS+  DK      K   L+K    ARD LL
Sbjct  202   LKVGSRKGAKKVPSVPYSAPNAVAGETIDGSSQALDKVACTDLKHATLVKALFDARDTLL  261

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
              EL++    IN+ ID+ +F+S   +  L  S  Q+  +  +AEV GQ   + Q+  +   
Sbjct  262   VELQRFGNGINRVIDLTEFTSTMNETKLSDSILQANPATAHAEVPGQ--GKPQNGLEGVG  319

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G  D R   +L +LSKD+ + LF+ +G QV YLW+ FL FHR ++T
Sbjct  320   GRLDVR---LLQNLSKDDKIKLFNLWGEQVSYLWNTFLNFHRENKT  362



>gb|EYU42501.1| hypothetical protein MIMGU_mgv1a019105mg [Erythranthe guttata]
Length=747

 Score =   334 bits (856),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 238/332 (72%), Gaps = 19/332 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+AV+EI +YIHRFHNLDLF+QGWYQIKITM+WEN D  SVGTP+RV QY APD GSD+
Sbjct  1     MLEAVHEIGIYIHRFHNLDLFKQGWYQIKITMKWENEDCGSVGTPARVAQYAAPDLGSDD  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + G+W IDD D+S+ TQPFRI+YA+QDILLS++VSFNLS    EV     +SAVILKFEL
Sbjct  61    VYGIWRIDDRDHSFSTQPFRIRYAKQDILLSMMVSFNLSPINLEV---PSASAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY P+L+N  N+Q SL+   A+VHEFRLPPK+LLGLH+YCPVHFD++H+VLVD +VH+ L
Sbjct  118   LYTPVLDNRSNIQDSLNN-TASVHEFRLPPKSLLGLHAYCPVHFDSYHSVLVDITVHVSL  176

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             LK   ++ S KV           + + +   V+L+    +A DIL EEL K+S+AINQ I
Sbjct  177   LKSAAYSFSEKVPRFLL------KYYAELTHVMLVHALSSASDILKEELLKLSQAINQPI  230

Query  1531  DVNDFSSKHEDKDLF-TSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSL  1707
             D+ + +S     +LF  + +S     NAEVS ++P    +VS+   G  DFRN   L+ L
Sbjct  231   DIKEITS----NELFGAALRSDPEVVNAEVSNELP----NVSENPIGEVDFRNNVFLNML  282

Query  1708  SKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             S+D+L+ L    GNQ+FYLWSIFL FHRA+ T
Sbjct  283   SEDKLLKLIDLIGNQMFYLWSIFLNFHRANIT  314



>ref|XP_006433706.1| hypothetical protein CICLE_v10000361mg [Citrus clementina]
 gb|ESR46946.1| hypothetical protein CICLE_v10000361mg [Citrus clementina]
Length=767

 Score =   333 bits (853),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 240/342 (70%), Gaps = 22/342 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M   V EI +YIHRFHNLDLFQQGWYQIKI+MR+E+ D   +GTP+RVVQYEAP+ G D+
Sbjct  1     MFKTVQEIGVYIHRFHNLDLFQQGWYQIKISMRYEDSDI--LGTPTRVVQYEAPELGYDD  58

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD DNS+ TQPFRIKYARQDILLS+L+SF LS  KYE L    +SAVILKFEL
Sbjct  59    IYGVWRIDDRDNSFSTQPFRIKYARQDILLSILISFTLSPGKYEGLP---TSAVILKFEL  115

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API E G  LQASL + PAAVHEFR+PPKALLGLHSYCPVHFDAFH VLVD S+H+ L
Sbjct  116   MHAPITEYGSELQASLHSSPAAVHEFRIPPKALLGLHSYCPVHFDAFHVVLVDVSIHVSL  175

Query  1351  LKRGVHTLSSKVASGSCSD-------DASSEDFDKAKQVV-----LIKGFLTARDILLEE  1494
             LK G HT SSKV S S S        D SS    +   VV     L+K  + + + LLE+
Sbjct  176   LKAGSHTPSSKVPSHSGSKAIAGGSTDGSSRALGQVASVVVKPHMLVKALVDSFNTLLED  235

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+S+ IN AID+ +F+S+ +  +LF    ++       +VS ++P   Q+  +K    
Sbjct  236   LQKLSEGINGAIDMTEFASRMDGINLFHPILKANIGTVVGDVSEELP---QNDFEKATAT  292

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
              + ++  +LH+LS D+L+ +F   G+QVFYLW+ FL FHRA+
Sbjct  293   LELQS-GLLHTLSDDDLLNVFDFLGDQVFYLWNNFLNFHRAN  333



>gb|KDO81354.1| hypothetical protein CISIN_1g004223mg [Citrus sinensis]
Length=767

 Score =   332 bits (851),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 240/342 (70%), Gaps = 22/342 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M   V EI +YIHRFHNLDLFQQGWYQIKI+MR+E+ D   +GTP+RVVQYEAP+ G D+
Sbjct  1     MFKTVQEIGVYIHRFHNLDLFQQGWYQIKISMRYEDSDI--LGTPTRVVQYEAPELGYDD  58

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD DNS+ TQPFRIKYARQDILLS+L+SF LS  KYE L    +SAVILKFEL
Sbjct  59    IYGVWRIDDRDNSFSTQPFRIKYARQDILLSILISFTLSPGKYEGLP---TSAVILKFEL  115

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API E G  LQASL + PAAVHEFR+PPKALLGLHSYCPVHFDAFH VLVD S+H+ L
Sbjct  116   MHAPITEYGSELQASLHSSPAAVHEFRIPPKALLGLHSYCPVHFDAFHVVLVDVSIHVSL  175

Query  1351  LKRGVHTLSSKVASGSCSD-------DASSEDFDKAKQVV-----LIKGFLTARDILLEE  1494
             LK G HT SSKV S S S        D SS    +   VV     L+K  + + + LLE+
Sbjct  176   LKAGSHTPSSKVPSHSGSKAIAGGSTDGSSRALGQVASVVVKPHMLVKALVDSFNTLLED  235

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+S+ IN AID+ +F+S+ +  +LF    ++       +VS ++P   Q+  +K    
Sbjct  236   LQKLSEGINGAIDMTEFASRMDGINLFHPILKANIGIVVGDVSEELP---QNDFEKATAT  292

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
              + ++  +LH+LS D+L+ +F   G+QVFYLW+ FL FHRA+
Sbjct  293   LELQS-GLLHTLSDDDLLNVFDFLGDQVFYLWNNFLNFHRAN  333



>ref|XP_006376124.1| hypothetical protein POPTR_0013s10030g [Populus trichocarpa]
 gb|ERP53921.1| hypothetical protein POPTR_0013s10030g [Populus trichocarpa]
Length=807

 Score =   332 bits (852),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 231/343 (67%), Gaps = 23/343 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M + V EIA+ IHRFHNLDLFQQGWYQIKI+MRWE+  Y S+ TP+RVVQYEAPD G +N
Sbjct  1     MFETVQEIAVCIHRFHNLDLFQQGWYQIKISMRWEDRGYTSLATPARVVQYEAPDLGGEN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I G+W IDDTDNS+ TQPFRIKYARQDI LS+++SF L L + E      +SAVILKFEL
Sbjct  61    IYGIWKIDDTDNSFLTQPFRIKYARQDIRLSIMISFTLPLGENE---GPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             + API EN   + A  +    +VHEFR+PPKALLGLHSYCPVHFDAFH VLVDASVH  L
Sbjct  118   MQAPITEN--MVMAYPNASSVSVHEFRIPPKALLGLHSYCPVHFDAFHYVLVDASVHTSL  175

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDK------------AKQVVLIKGFLTARDILLEE  1494
             +  G      KV SGS   D + +  D              K+++L+K  L +RD LLEE
Sbjct  176   MTAGSFM---KVPSGSYGQDVAGKISDGISQALGEVASLDTKKIMLVKALLVSRDALLEE  232

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+SK I  AID++DF S  +D  +F S  Q      + EVSGQ   +  +  +K NG 
Sbjct  233   LQKISKGIGHAIDLSDFISNMDDMRMFDSIMQENLGTADGEVSGQ--GKPHNGLEKANGT  290

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              DF+++ + H  +K  +V +FHS G Q+ YLW IFL+FHRA++
Sbjct  291   ADFQSDNLPHISTKAVVVNIFHSLGAQLSYLWKIFLQFHRANK  333



>ref|XP_006472989.1| PREDICTED: protein FAM135B-like [Citrus sinensis]
Length=794

 Score =   332 bits (851),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 240/342 (70%), Gaps = 22/342 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M   V EI +YIHRFHNLDLFQQGWYQIKI+MR+E+ D   +GTP+RVVQYEAP+ G D+
Sbjct  28    MFKTVQEIGVYIHRFHNLDLFQQGWYQIKISMRYEDSDI--LGTPTRVVQYEAPELGYDD  85

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD DNS+ TQPFRIKYARQDILLS+L+SF LS  KYE L    +SAVILKFEL
Sbjct  86    IYGVWRIDDRDNSFSTQPFRIKYARQDILLSILISFTLSPGKYEGLP---TSAVILKFEL  142

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++API E G  LQASL + PAAVHEFR+PPKALLGLHSYCPVHFDAFH VLVD S+H+ L
Sbjct  143   MHAPITEYGSELQASLHSSPAAVHEFRIPPKALLGLHSYCPVHFDAFHVVLVDVSIHVSL  202

Query  1351  LKRGVHTLSSKVASGSCSD-------DASSEDFDKAKQVV-----LIKGFLTARDILLEE  1494
             LK G HT SSKV S S S        D SS    +   VV     L+K  + + + LLE+
Sbjct  203   LKAGSHTPSSKVPSHSGSKAIAGGSTDGSSRALGQVASVVVKPHMLVKALVDSFNTLLED  262

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+S+ IN AID+ +F+S+ +  +LF    ++       +VS ++P   Q+  +K    
Sbjct  263   LQKLSEGINGAIDMTEFASRMDGINLFHPILKANIGIVVGDVSEELP---QNDFEKATAT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
              + ++  +LH+LS D+L+ +F   G+QVFYLW+ FL FHRA+
Sbjct  320   LELQS-GLLHTLSDDDLLNVFDFLGDQVFYLWNNFLNFHRAN  360



>gb|KHG27392.1| Uncharacterized protein F383_03647 [Gossypium arboreum]
Length=761

 Score =   331 bits (848),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 242/347 (70%), Gaps = 21/347 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD  +EIA+Y+HRFHNLDLFQQGWYQ+KIT+RW+N  + +   PSRV+QYEAP+ G + 
Sbjct  1     MLDTSHEIAIYLHRFHNLDLFQQGWYQLKITVRWDNDAHATTAMPSRVLQYEAPNFGCEG  60

Query  991   IC-GVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
                GVW ID+ DNS+ TQPFRIKYARQD+LL  +V+F+L L   E      +SAV+LKFE
Sbjct  61    GGYGVWRIDEKDNSFLTQPFRIKYARQDVLLFTMVAFDLPLKGNE---GPSTSAVVLKFE  117

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLYAP+L+NG   QAS D+ PAAVHEFR+P KALLGLHSYCPV+FDAFHAVLVD SVHI 
Sbjct  118   LLYAPLLDNGSEFQASPDSCPAAVHEFRIPSKALLGLHSYCPVYFDAFHAVLVDVSVHIT  177

Query  1348  LLKRGVHTLSSKVASGSC---------SDDASSEDFDKA-----KQVVLIKGFLTARDIL  1485
             LLK G +  S KV+S S          S   S++  ++A     KQV+L+K  L AR+ L
Sbjct  178   LLKAGSYHDSMKVSSNSRTATADVAHESTGGSTQALNQAAPSDLKQVMLVKALLDARETL  237

Query  1486  LEELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKR  1662
             + EL+K+  AIN+ +D+ +++S+  D  LF S  Q+     + EVSGQ   + Q+  +K 
Sbjct  238   IVELQKLGSAINRTVDLTEYTSRMNDTKLFDSFLQANQVTADNEVSGQ--GKPQNGPEKA  295

Query  1663  NGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             NG  DF+++ +  +LSKD++  +F+  G+QV +LWS FL FHR ++T
Sbjct  296   NGGLDFQSDRLPQNLSKDDVTRMFNISGDQVLHLWSTFLTFHRDNKT  342



>ref|XP_006585465.1| PREDICTED: protein FAM135B-like isoform X3 [Glycine max]
Length=782

 Score =   330 bits (846),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 186/395 (47%), Positives = 250/395 (63%), Gaps = 47/395 (12%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  RL W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRRLGWFV-GLNQTNLSTKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IKIT+RWE+GD    G P+RVVQYEAP+ G
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKITLRWEDGDDSHPGVPARVVQYEAPEVG  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +DN+CGVWMIDD DNS+ T  FRI+YARQD++L++++SF LS  +YE      SSAVILK
Sbjct  95    ADNLCGVWMIDDKDNSFSTPSFRIRYARQDVILAIMISFYLSYGRYE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E    LQ+S++   A+ HE+R+PPKALLGLHSYCPVHFDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMRPELQSSVNGCAASFHEYRIPPKALLGLHSYCPVHFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             I LLK G  T   KV S S +   +  E+  ++ +  LIK  + ARDILL++LR++SK  
Sbjct  211   ISLLKSGYLTPQLKVPSDSLASKGTYGEECVRSSKAALIKALMAARDILLDDLRRISKGT  270

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             NQAID+   + +  D         T S ++   + +  +  + V+Q  N +T    EE+ 
Sbjct  271   NQAIDLTGITFEPYD---------TKSLNSTSTAHEKSTDDEKVTQYINHVT----EELS  317

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  318   QPFSWDDMLNSFQFIGNQLLYLWNTFLKFHRENKT  352



>ref|XP_011003969.1| PREDICTED: protein FAM135B-like isoform X2 [Populus euphratica]
Length=668

 Score =   327 bits (838),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 232/343 (68%), Gaps = 23/343 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M + V EIA+ IHRFHNLDLFQQGWYQI+I+MRWE+  Y S+ TP+RVVQYEAPD G +N
Sbjct  1     MFETVQEIAVCIHRFHNLDLFQQGWYQIRISMRWEDRGYTSLATPARVVQYEAPDLGGEN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + G+W IDDTDNS+ TQPFRIKYARQDI LS+++SF L L + E      +SAVILKFEL
Sbjct  61    VYGIWKIDDTDNSFLTQPFRIKYARQDIRLSIMISFTLPLGENE---GPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             + A I E+     A  +    +VHEFR+PPKALLGLHSYCPVHFDAFH VLVDASVH  L
Sbjct  118   MQASITES--MFMAYPNASSVSVHEFRIPPKALLGLHSYCPVHFDAFHYVLVDASVHTTL  175

Query  1351  LKRGVHTLSSKVASGSCSDDAS---SEDFDKA---------KQVVLIKGFLTARDILLEE  1494
             +  G      KV SGS   D +   S+  ++A         K+++L+K  L +RD LLEE
Sbjct  176   MTAGSFM---KVPSGSYGQDVAGKISDGINQALGEVASLDTKKIMLVKALLVSRDTLLEE  232

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+SK I  AID++DF S  +D  +F S  Q      + EVSGQ   +  +  +K NG 
Sbjct  233   LQKISKGIGHAIDLSDFISNMDDMRMFDSIMQGNLGTADGEVSGQ--GKPHNGLEKANGT  290

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              DF+++ + H  +K  +V +FHS G Q+ YLW IFL+FHRA++
Sbjct  291   ADFQSDNLPHISTKAVVVNIFHSLGAQLSYLWKIFLRFHRANK  333



>gb|KHN33483.1| Protein FAM135B-like protein [Glycine soja]
Length=784

 Score =   329 bits (844),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/396 (48%), Positives = 252/396 (64%), Gaps = 35/396 (9%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  RL W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRRLGWFV-GLNQNNLATKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IK+T+RWE+G+    G P+RVVQYEAP+ G
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKVTLRWEDGEDSYPGIPARVVQYEAPEVG  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +DN+CGVWMIDD DNS+ T  FRI+YARQD+ L++++SF LS   YE      SSAVILK
Sbjct  95    ADNLCGVWMIDDKDNSFSTPSFRIRYARQDVFLAIMISFYLSYGGYE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E    LQ+SLD   A+VHE+R+PPKALLGLHSYCPVHFDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMRPELQSSLDGCAASVHEYRIPPKALLGLHSYCPVHFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             I LLK G HT   KV S S +   +  ED+ ++ +  LIK  + A DILL++LR++SK I
Sbjct  211   ISLLKSGYHTPQLKVPSYSLASKGTYGEDYVRSNKAALIKALIAAHDILLDDLRRISKGI  270

Query  1519  NQAIDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEV  1695
             NQAID+   +   +  K L ++  +     + E S Q+    Q  ++K     +   EE+
Sbjct  271   NQAIDLTGITFEPYVTKSLNSTSPAHEKSADDEASLQLSDGTQISAEKVIQYINHVTEEL  330

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               S S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  331   CQSFSWDDMLNFFQFIGNQLLYLWNTFLKFHRENKT  366



>ref|XP_010414739.1| PREDICTED: protein FAM135B-like isoform X1 [Camelina sativa]
Length=796

 Score =   329 bits (844),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 230/344 (67%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LD  P AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCIDNESGKQ--LDASPVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHITV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      ++++ F KA         K V  +K  L ARDILLE
Sbjct  210   LKSAAYKRSASLSSGVSNSKNVSGSTAQSFKKALGLLASADKKLVSFVKALLGARDILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             +++++S+A  Q+ID++DF S   +  L        S    + SGQ   ++Q+  +K N  
Sbjct  270   DMQRLSEAAGQSIDLSDFVSNMNNVPL--------SNSTVDSSGQ--GKEQNNLEKLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++E LH L KD+L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  320   FDLASDEWLHELPKDQLSRLFHLLGTQLHYLWTTFLGFHRDNHT  363



>ref|XP_006300308.1| hypothetical protein CARUB_v10019821mg [Capsella rubella]
 gb|EOA33206.1| hypothetical protein CARUB_v10019821mg [Capsella rubella]
Length=796

 Score =   329 bits (844),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 180/344 (52%), Positives = 226/344 (66%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQ+KITMRWE+GD  + G PSRVVQYEAPD+GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQVKITMRWEDGDNVTRGIPSRVVQYEAPDSGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDNDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N       LD  P AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCMDNTPG--KHLDASPVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +     LSS V++      ++++ F KA         K V  +K  L AR+ILLE
Sbjct  210   LKSAAYKRPANLSSGVSTSKNVGGSTAQSFKKALGLLASADKKLVSFVKALLGAREILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID++DF S   +  L           N+ V G    ++Q+  +K N  
Sbjct  270   EMQRLSKAVGQPIDLSDFVSNMNNVPL----------SNSTVDGSGQGKEQNSLEKLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++E LH L KD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  320   FDLGSDEWLHELPKDHLSRLFHLLGTQLHYLWTTFLGFHRDNHT  363



>ref|XP_006578252.1| PREDICTED: protein FAM135B-like isoform X4 [Glycine max]
Length=790

 Score =   329 bits (843),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 241/358 (67%), Gaps = 29/358 (8%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YIHRFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVQEIGVYIHRFHNLDLFKQGWYRIKITVRWEDSESLSFGIPASVVQYEAPDLD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               ++ GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSVYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSRSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP  E+G N+QASLD   AA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD SVH
Sbjct  126   FELIYAPATEDGVNMQASLDDSSAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSVH  185

Query  1342  ICLLKRGVHTLSSKVASGSCSDD-------ASSEDFDKA----------------KQVVL  1452
             + LLK   ++ + K  S S + +        S ++ DK+                  V L
Sbjct  186   VTLLKAVSYSSALKFLSNSANSEVIIDKSSVSKKNIDKSCDTLNQGFGGVAFLDTGNVSL  245

Query  1453  IKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQM  1629
             +K  LT+RDIL+EEL+K+SKAIN+A+D+++F S   +  L  S  Q      + EV GQ 
Sbjct  246   VKALLTSRDILVEELQKISKAINEALDISEFVSIMSNMKLLNSVLQVNQFAIDVEVVGQ-  304

Query  1630  PSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               + Q+  +  N   DF + E LHSLS++EL+  FHS G+Q+ YLW IFLKFHR +++
Sbjct  305   -GKPQNGLKGGNEALDFLDVEKLHSLSQNELLECFHSLGDQLIYLWKIFLKFHRDNKS  361



>ref|XP_003523761.1| PREDICTED: protein FAM135B-like isoform X1 [Glycine max]
 ref|XP_006578250.1| PREDICTED: protein FAM135B-like isoform X2 [Glycine max]
 ref|XP_006578251.1| PREDICTED: protein FAM135B-like isoform X3 [Glycine max]
Length=791

 Score =   329 bits (843),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 241/358 (67%), Gaps = 29/358 (8%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YIHRFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVQEIGVYIHRFHNLDLFKQGWYRIKITVRWEDSESLSFGIPASVVQYEAPDLD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               ++ GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSVYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSRSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP  E+G N+QASLD   AA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD SVH
Sbjct  126   FELIYAPATEDGVNMQASLDDSSAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSVH  185

Query  1342  ICLLKRGVHTLSSKVASGSCSDD-------ASSEDFDKA----------------KQVVL  1452
             + LLK   ++ + K  S S + +        S ++ DK+                  V L
Sbjct  186   VTLLKAVSYSSALKFLSNSANSEVIIDKSSVSKKNIDKSCDTLNQGFGGVAFLDTGNVSL  245

Query  1453  IKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQM  1629
             +K  LT+RDIL+EEL+K+SKAIN+A+D+++F S   +  L  S  Q      + EV GQ 
Sbjct  246   VKALLTSRDILVEELQKISKAINEALDISEFVSIMSNMKLLNSVLQVNQFAIDVEVVGQ-  304

Query  1630  PSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               + Q+  +  N   DF + E LHSLS++EL+  FHS G+Q+ YLW IFLKFHR +++
Sbjct  305   -GKPQNGLKGGNEALDFLDVEKLHSLSQNELLECFHSLGDQLIYLWKIFLKFHRDNKS  361



>ref|XP_010912436.1| PREDICTED: uncharacterized protein LOC105038350 isoform X3 [Elaeis 
guineensis]
Length=754

 Score =   328 bits (840),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 247/348 (71%), Gaps = 22/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+    S GTP+RV+QYEAPD   D+
Sbjct  41    MLDTVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDNQI-SCGTPARVIQYEAPDVAPDD  99

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E      +SAVILKFEL
Sbjct  100   IFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDES---PLTSAVILKFEL  156

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCP+HFDAFHAVLVD S+H+  
Sbjct  157   MYAPILENGPEMQASFDAVSAAFHEFRIPPKALLGLHSYCPIHFDAFHAVLVDLSIHVVF  216

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK   +T + KV+S S    + + E  ++  Q++          LIK  L +R+++L EL
Sbjct  217   LKAATYTRAQKVSSTSHVVGNHAEEHHEEPNQILGQTWTLKAVKLIKLLLASRELILGEL  276

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVSG------QMPSQKQSVSQ  1656
             +K+SKAI + I D+N+        +  +S ++ SS  + ++SG      Q+     ++ +
Sbjct  277   QKISKAIGETIDDLNNADLNLGRLESISSSRTDSSTASLDISGMNMGVEQLVGILHNILE  336

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LSK+EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  337   KSNGVIEFGNDVMLYTLSKEELLDVFFTVGNQLSFIWNAFLKFHRINR  384



>ref|NP_001185264.1| protein ZW18 [Arabidopsis thaliana]
 gb|AEE33540.1| putative serine esterase family protein [Arabidopsis thaliana]
Length=711

 Score =   327 bits (837),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 227/344 (66%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+G+++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGAND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWKIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LDT P AVHEFR+PPKAL GLHSYCPVHFD  HAVL+D SVHI +
Sbjct  152   MYAPSVDNASAKQ--LDTSPVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLIDVSVHISV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      +S++ F KA         K V  +K  L AR ILLE
Sbjct  210   LKSAAYKRPASLSSGVSNSKNVSGSSAQSFKKALGLLASADKKLVSFVKALLGARGILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID++DF S   +  L           N+  +G    ++Q+  +  N  
Sbjct  270   EMQRLSKAVGQTIDLSDFVSNMNNVQL----------SNSTSTGSGQGKEQNSLENLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH LSKD L  +FH  G Q+ YLW+  L FHR + T
Sbjct  320   FDLTSDDWLHELSKDHLSRIFHLLGTQLHYLWNTLLGFHRDNHT  363



>gb|KHN08199.1| Protein FAM135A-like protein [Glycine soja]
Length=794

 Score =   328 bits (842),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 241/358 (67%), Gaps = 29/358 (8%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YIHRFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVQEIGVYIHRFHNLDLFKQGWYRIKITVRWEDSESLSFGIPASVVQYEAPDLD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               ++ GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSVYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSRSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP  E+G N+QASLD   AA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD SVH
Sbjct  126   FELIYAPATEDGVNMQASLDDSSAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSVH  185

Query  1342  ICLLKRGVHTLSSKVASGSCSDD-------ASSEDFDKA----------------KQVVL  1452
             + LLK   ++ + K  S S + +        S ++ DK+                  V L
Sbjct  186   VTLLKAVSYSSALKFPSNSANSEVIIDKSSVSKKNIDKSCDTLNQGFGGVAFLDTGNVSL  245

Query  1453  IKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQM  1629
             +K  LT+RDIL+EEL+K+SKAIN+A+D+++F S   +  L  S  Q      + EV GQ 
Sbjct  246   VKALLTSRDILVEELQKISKAINEALDISEFVSIMSNMKLLNSVLQVNQFAIDVEVVGQ-  304

Query  1630  PSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               + Q+  +  N   DF + E LHSLS++EL+  FHS G+Q+ YLW IFLKFHR +++
Sbjct  305   -GKPQNGLKGGNEALDFLDVEKLHSLSQNELLECFHSLGDQLIYLWKIFLKFHRDNKS  361



>ref|XP_008378681.1| PREDICTED: protein FAM135B-like isoform X6 [Malus domestica]
Length=327

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 214/286 (75%), Gaps = 17/286 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKITMRW++ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITMRWQDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDSDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCS-DDASSEDFDKAKQ------------VVLIKGFLTARDILL  1488
             LLK   +T   KV S S + ++  +E    + Q            ++L K  L ARDILL
Sbjct  212   LLKAVSYTHPLKVPSDSSTPENVGTEGXSGSNQASTQAAAADVNDIILAKSLLNARDILL  271

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQ  1626
             EEL+K+SKAI+QAID+ DF SK +D      +++  + D+ +VSGQ
Sbjct  272   EELQKLSKAIDQAIDLTDFISKIDDTKFDFLQENWVAADD-KVSGQ  316



>ref|XP_008784168.1| PREDICTED: uncharacterized protein LOC103703178 isoform X3 [Phoenix 
dactylifera]
Length=801

 Score =   328 bits (841),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 248/348 (71%), Gaps = 21/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+ +  S GTP+RV+QYEAP    D+
Sbjct  41    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDTNQVSCGTPARVIQYEAPGVAPDD  100

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFR+KYARQD+LLSV+VSFNL+  K E      +SAVILKFEL
Sbjct  101   IFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMVSFNLTTGKDES---PLTSAVILKFEL  157

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCPVHFDAFHAVLVD S+H+  
Sbjct  158   MYAPILENGPEMQASFDAVSAACHEFRIPPKALLGLHSYCPVHFDAFHAVLVDLSIHVVF  217

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK G +T + KV+S S    + + E  ++  Q++          LIK  L +R+ LLEEL
Sbjct  218   LKAGTYTRAQKVSSTSHMVLNHADEHHEETNQILGQGWISSAIELIKLLLASREYLLEEL  277

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------GQMPSQKQSVSQ  1656
             +K+SKAI++ I D+N+        +  +S ++ SS  + ++S      GQ+     ++ +
Sbjct  278   QKISKAIDETIDDLNNADLNLGRLESVSSSRTDSSTASLDISGMNMGVGQLVGILYNILE  337

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LS++EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  338   KSNGVVEFGNDVMLYTLSQEELLDVFFTVGNQLSFIWNAFLKFHRINR  385



>ref|XP_010912437.1| PREDICTED: uncharacterized protein LOC105038350 isoform X4 [Elaeis 
guineensis]
Length=747

 Score =   327 bits (837),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 247/348 (71%), Gaps = 22/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+    S GTP+RV+QYEAPD   D+
Sbjct  41    MLDTVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDNQI-SCGTPARVIQYEAPDVAPDD  99

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E      +SAVILKFEL
Sbjct  100   IFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDES---PLTSAVILKFEL  156

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCP+HFDAFHAVLVD S+H+  
Sbjct  157   MYAPILENGPEMQASFDAVSAAFHEFRIPPKALLGLHSYCPIHFDAFHAVLVDLSIHVVF  216

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK   +T + KV+S S    + + E  ++  Q++          LIK  L +R+++L EL
Sbjct  217   LKAATYTRAQKVSSTSHVVGNHAEEHHEEPNQILGQTWTLKAVKLIKLLLASRELILGEL  276

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVSG------QMPSQKQSVSQ  1656
             +K+SKAI + I D+N+        +  +S ++ SS  + ++SG      Q+     ++ +
Sbjct  277   QKISKAIGETIDDLNNADLNLGRLESISSSRTDSSTASLDISGMNMGVEQLVGILHNILE  336

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LSK+EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  337   KSNGVIEFGNDVMLYTLSKEELLDVFFTVGNQLSFIWNAFLKFHRINR  384



>ref|XP_008784166.1| PREDICTED: uncharacterized protein LOC103703178 isoform X2 [Phoenix 
dactylifera]
Length=817

 Score =   328 bits (842),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 248/348 (71%), Gaps = 21/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+ +  S GTP+RV+QYEAP    D+
Sbjct  41    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDTNQVSCGTPARVIQYEAPGVAPDD  100

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFR+KYARQD+LLSV+VSFNL+  K E      +SAVILKFEL
Sbjct  101   IFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMVSFNLTTGKDES---PLTSAVILKFEL  157

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCPVHFDAFHAVLVD S+H+  
Sbjct  158   MYAPILENGPEMQASFDAVSAACHEFRIPPKALLGLHSYCPVHFDAFHAVLVDLSIHVVF  217

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK G +T + KV+S S    + + E  ++  Q++          LIK  L +R+ LLEEL
Sbjct  218   LKAGTYTRAQKVSSTSHMVLNHADEHHEETNQILGQGWISSAIELIKLLLASREYLLEEL  277

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------GQMPSQKQSVSQ  1656
             +K+SKAI++ I D+N+        +  +S ++ SS  + ++S      GQ+     ++ +
Sbjct  278   QKISKAIDETIDDLNNADLNLGRLESVSSSRTDSSTASLDISGMNMGVGQLVGILYNILE  337

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LS++EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  338   KSNGVVEFGNDVMLYTLSQEELLDVFFTVGNQLSFIWNAFLKFHRINR  385



>ref|XP_010511081.1| PREDICTED: protein FAM135B-like isoform X1 [Camelina sativa]
Length=797

 Score =   328 bits (840),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 229/344 (67%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LD  P AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCIDNESGKQ--LDASPLAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHITV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      ++++ F KA         K V  +K  L ARDILLE
Sbjct  210   LKSAAYKRPASLSSGVSNSKNVSGSTAQSFKKALGLLASADKKLVSFVKALLGARDILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             +++++S+A  Q++D++DF S   +  L           N+ V G    ++Q+  +K N  
Sbjct  270   DMQRLSEAAGQSLDLSDFVSNMNNVPL----------SNSTVDGSGQGKEQNSLEKLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              +  ++E LH L KD+L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  320   FNVASDEWLHELPKDQLSRLFHLLGTQLHYLWTTFLGFHRDNHT  363



>ref|XP_008784165.1| PREDICTED: uncharacterized protein LOC103703178 isoform X1 [Phoenix 
dactylifera]
Length=818

 Score =   328 bits (841),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 248/348 (71%), Gaps = 21/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+ +  S GTP+RV+QYEAP    D+
Sbjct  41    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDTNQVSCGTPARVIQYEAPGVAPDD  100

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFR+KYARQD+LLSV+VSFNL+  K E      +SAVILKFEL
Sbjct  101   IFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMVSFNLTTGKDES---PLTSAVILKFEL  157

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCPVHFDAFHAVLVD S+H+  
Sbjct  158   MYAPILENGPEMQASFDAVSAACHEFRIPPKALLGLHSYCPVHFDAFHAVLVDLSIHVVF  217

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK G +T + KV+S S    + + E  ++  Q++          LIK  L +R+ LLEEL
Sbjct  218   LKAGTYTRAQKVSSTSHMVLNHADEHHEETNQILGQGWISSAIELIKLLLASREYLLEEL  277

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------GQMPSQKQSVSQ  1656
             +K+SKAI++ I D+N+        +  +S ++ SS  + ++S      GQ+     ++ +
Sbjct  278   QKISKAIDETIDDLNNADLNLGRLESVSSSRTDSSTASLDISGMNMGVGQLVGILYNILE  337

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LS++EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  338   KSNGVVEFGNDVMLYTLSQEELLDVFFTVGNQLSFIWNAFLKFHRINR  385



>ref|XP_006597335.1| PREDICTED: protein FAM135B-like isoform X1 [Glycine max]
Length=796

 Score =   327 bits (839),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/396 (48%), Positives = 252/396 (64%), Gaps = 35/396 (9%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  +L W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRKLGWFV-GLNQNNLATKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IK+T+RWE+G+    G P+RVVQYEAP+ G
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKVTLRWEDGEDSYPGIPARVVQYEAPEVG  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +DN+CGVWMIDD DNS+ T  FRI+YARQD+ L++++SF LS   YE      SSAVILK
Sbjct  95    ADNLCGVWMIDDKDNSFSTPSFRIRYARQDVFLAIMISFYLSYGGYE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E    LQ+SLD   A+VHE+R+PPKALLGLHSYCPVHFDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMRPELQSSLDGCAASVHEYRIPPKALLGLHSYCPVHFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             I LLK G HT   KV S S +   +  ED+ ++ +  LIK  + A DILL++LR++SK I
Sbjct  211   ISLLKSGYHTPQLKVPSYSLASKGTYGEDYVRSNKAALIKALIAAHDILLDDLRRISKGI  270

Query  1519  NQAIDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEV  1695
             NQAID+   +   +  K L ++  +     + E S Q+    Q  ++K     +   EE+
Sbjct  271   NQAIDLTGITFEPYVTKSLNSTSPAHEKSADDEASLQLSDGTQISAEKVIQYINHVTEEL  330

Query  1696  LHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               S S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  331   CQSFSWDDMLNFFQFIGNQLLYLWNTFLKFHRENKT  366



>gb|EPS74264.1| hypothetical protein M569_00489, partial [Genlisea aurea]
Length=767

 Score =   326 bits (836),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 228/333 (68%), Gaps = 8/333 (2%)
 Frame = +1

Query  799   NSQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
             N  SML+A +EI++YIHRFHNLDLFQQGWYQ+KITMRWE GD  S  TP+RVVQY+ P+ 
Sbjct  7     NIWSMLEAAHEISIYIHRFHNLDLFQQGWYQLKITMRWEEGDSGSNATPARVVQYDVPEL  66

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
             GSD++ GVW IDD D+S+ TQPFRIKYARQDILLS++VSFNLSLSK E   +   SAVIL
Sbjct  67    GSDDVYGVWRIDDADHSFSTQPFRIKYARQDILLSMMVSFNLSLSKLEGPSL---SAVIL  123

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFELL+ P+L N  ++ AS    PAAVHEFRLP KALLG+H+YCPVHFDAFHAVLVD +V
Sbjct  124   KFELLFTPVLLNRSDIHASFGICPAAVHEFRLPSKALLGIHAYCPVHFDAFHAVLVDTTV  183

Query  1339  HICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             H  L+    HT S K   G+   D  +   D +KQ  LIK  L+ARDILLEE++K+SK I
Sbjct  184   HASLIGSSFHTSSLKDPRGNKGGD--NRGCDASKQAKLIKSLLSARDILLEEIQKLSKGI  241

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             N+ ID+ D +S      +  S    S  +  E   ++        QK NG  +F + + L
Sbjct  242   NKPIDIEDLTSTEFFNFIPKSEPDVSHHEAPE---ELTWIFFVSPQKSNGDMNFGHADAL  298

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
               +S D     F   GNQ+FY+WS+FL FHRA+
Sbjct  299   QLISDDMRFKSFDFIGNQMFYIWSVFLNFHRAN  331



>ref|NP_564732.1| protein ZW18 [Arabidopsis thaliana]
 ref|NP_001117514.1| protein ZW18 [Arabidopsis thaliana]
 gb|AAF82253.1|AC008051_4 Identical to gene ZW18 from Arabidopsis thaliana gb|AB028199 
[Arabidopsis thaliana]
 dbj|BAA87940.1| ZW18 [Arabidopsis thaliana]
 dbj|BAE98886.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33538.1| putative serine esterase family protein [Arabidopsis thaliana]
 gb|AEE33539.1| putative serine esterase family protein [Arabidopsis thaliana]
Length=794

 Score =   327 bits (837),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 227/344 (66%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+G+++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGAND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWKIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LDT P AVHEFR+PPKAL GLHSYCPVHFD  HAVL+D SVHI +
Sbjct  152   MYAPSVDNASAKQ--LDTSPVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLIDVSVHISV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      +S++ F KA         K V  +K  L AR ILLE
Sbjct  210   LKSAAYKRPASLSSGVSNSKNVSGSSAQSFKKALGLLASADKKLVSFVKALLGARGILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID++DF S   +  L           N+  +G    ++Q+  +  N  
Sbjct  270   EMQRLSKAVGQTIDLSDFVSNMNNVQL----------SNSTSTGSGQGKEQNSLENLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH LSKD L  +FH  G Q+ YLW+  L FHR + T
Sbjct  320   FDLTSDDWLHELSKDHLSRIFHLLGTQLHYLWNTLLGFHRDNHT  363



>ref|XP_011003968.1| PREDICTED: protein FAM135B-like isoform X1 [Populus euphratica]
Length=763

 Score =   326 bits (835),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 232/343 (68%), Gaps = 23/343 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M + V EIA+ IHRFHNLDLFQQGWYQI+I+MRWE+  Y S+ TP+RVVQYEAPD G +N
Sbjct  1     MFETVQEIAVCIHRFHNLDLFQQGWYQIRISMRWEDRGYTSLATPARVVQYEAPDLGGEN  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             + G+W IDDTDNS+ TQPFRIKYARQDI LS+++SF L L + E      +SAVILKFEL
Sbjct  61    VYGIWKIDDTDNSFLTQPFRIKYARQDIRLSIMISFTLPLGENE---GPSTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             + A I E+     A  +    +VHEFR+PPKALLGLHSYCPVHFDAFH VLVDASVH  L
Sbjct  118   MQASITES--MFMAYPNASSVSVHEFRIPPKALLGLHSYCPVHFDAFHYVLVDASVHTTL  175

Query  1351  LKRGVHTLSSKVASGSCSDDAS---SEDFDKA---------KQVVLIKGFLTARDILLEE  1494
             +  G      KV SGS   D +   S+  ++A         K+++L+K  L +RD LLEE
Sbjct  176   MTAGSFM---KVPSGSYGQDVAGKISDGINQALGEVASLDTKKIMLVKALLVSRDTLLEE  232

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L+K+SK I  AID++DF S  +D  +F S  Q      + EVSGQ   +  +  +K NG 
Sbjct  233   LQKISKGIGHAIDLSDFISNMDDMRMFDSIMQGNLGTADGEVSGQ--GKPHNGLEKANGT  290

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              DF+++ + H  +K  +V +FHS G Q+ YLW IFL+FHRA++
Sbjct  291   ADFQSDNLPHISTKAVVVNIFHSLGAQLSYLWKIFLRFHRANK  333



>ref|XP_006581472.1| PREDICTED: protein FAM135B-like isoform X2 [Glycine max]
Length=790

 Score =   326 bits (836),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 240/358 (67%), Gaps = 29/358 (8%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YI RFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVREIGVYIQRFHNLDLFKQGWYRIKITVRWEDSENMSFGIPASVVQYEAPDMD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               +I GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSIYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSCSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL YAP  E G ++QAS D  PAA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD S+H
Sbjct  126   FELRYAPATEVGADMQASPDDSPAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSIH  185

Query  1342  ICLLKRGVHTLSSKVASGSCSDD-------ASSEDFDKA----------------KQVVL  1452
             + LLK   ++ + ++ S S + +        S ++ DK+                K V+L
Sbjct  186   VTLLKAASYSSALELPSNSANSEVIINKSSVSKKNIDKSCNTLNQGFGGVTSLDMKNVLL  245

Query  1453  IKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFT-SRQSTSSKDNAEVSGQM  1629
             +K  LT+RDILLEEL+K SKAIN+++D+++F S   +  L     ++     N EV GQ 
Sbjct  246   VKALLTSRDILLEELQKTSKAINESLDISEFVSIMSNTKLLNFVLRANQFAINVEVVGQ-  304

Query  1630  PSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               + Q+  +  N   DF + E LHSLS++EL+  FHS G+Q+ YLW IFLKFHR ++T
Sbjct  305   -GKPQNGLKAGNEALDFLDVEKLHSLSQNELLDCFHSLGDQLLYLWKIFLKFHRDNKT  361



>ref|XP_010470263.1| PREDICTED: protein FAM135B-like [Camelina sativa]
Length=796

 Score =   326 bits (836),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 228/344 (66%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+GS +
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGSID  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LD+ P +VHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCIDNESGKQ--LDSSPVSVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHITV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      ++++ F KA         K V  +K  L AR ILLE
Sbjct  210   LKSAAYKRPASLSSGVSNSKNVSGSTAQSFKKALGLLASADKKLVSFVKALLGARAILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             +++++S+A  Q+ID++DF S   +  L           N+ V G    ++Q+  +K N  
Sbjct  270   DMQRLSEAAGQSIDLSDFVSNMNNVPL----------SNSTVDGSGQGKEQNSLEKLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++E LH L KD+L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  320   FDLASDEWLHELPKDQLSRLFHLLGTQLHYLWTTFLGFHRDNHT  363



>ref|XP_003527859.1| PREDICTED: protein FAM135B-like isoform X1 [Glycine max]
Length=791

 Score =   326 bits (835),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 240/358 (67%), Gaps = 29/358 (8%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YI RFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVREIGVYIQRFHNLDLFKQGWYRIKITVRWEDSENMSFGIPASVVQYEAPDMD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               +I GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSIYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSCSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL YAP  E G ++QAS D  PAA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD S+H
Sbjct  126   FELRYAPATEVGADMQASPDDSPAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSIH  185

Query  1342  ICLLKRGVHTLSSKVASGSCSDD-------ASSEDFDKA----------------KQVVL  1452
             + LLK   ++ + ++ S S + +        S ++ DK+                K V+L
Sbjct  186   VTLLKAASYSSALELPSNSANSEVIINKSSVSKKNIDKSCNTLNQGFGGVTSLDMKNVLL  245

Query  1453  IKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFT-SRQSTSSKDNAEVSGQM  1629
             +K  LT+RDILLEEL+K SKAIN+++D+++F S   +  L     ++     N EV GQ 
Sbjct  246   VKALLTSRDILLEELQKTSKAINESLDISEFVSIMSNTKLLNFVLRANQFAINVEVVGQ-  304

Query  1630  PSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               + Q+  +  N   DF + E LHSLS++EL+  FHS G+Q+ YLW IFLKFHR ++T
Sbjct  305   -GKPQNGLKAGNEALDFLDVEKLHSLSQNELLDCFHSLGDQLLYLWKIFLKFHRDNKT  361



>ref|XP_010912435.1| PREDICTED: protein FAM135B-like isoform X2 [Elaeis guineensis]
Length=816

 Score =   327 bits (837),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 247/348 (71%), Gaps = 22/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+    S GTP+RV+QYEAPD   D+
Sbjct  41    MLDTVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDNQI-SCGTPARVIQYEAPDVAPDD  99

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E      +SAVILKFEL
Sbjct  100   IFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDES---PLTSAVILKFEL  156

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCP+HFDAFHAVLVD S+H+  
Sbjct  157   MYAPILENGPEMQASFDAVSAAFHEFRIPPKALLGLHSYCPIHFDAFHAVLVDLSIHVVF  216

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK   +T + KV+S S    + + E  ++  Q++          LIK  L +R+++L EL
Sbjct  217   LKAATYTRAQKVSSTSHVVGNHAEEHHEEPNQILGQTWTLKAVKLIKLLLASRELILGEL  276

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVSG------QMPSQKQSVSQ  1656
             +K+SKAI + I D+N+        +  +S ++ SS  + ++SG      Q+     ++ +
Sbjct  277   QKISKAIGETIDDLNNADLNLGRLESISSSRTDSSTASLDISGMNMGVEQLVGILHNILE  336

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LSK+EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  337   KSNGVIEFGNDVMLYTLSKEELLDVFFTVGNQLSFIWNAFLKFHRINR  384



>ref|XP_010912434.1| PREDICTED: protein FAM135B-like isoform X1 [Elaeis guineensis]
Length=817

 Score =   326 bits (836),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 247/348 (71%), Gaps = 22/348 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLD V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE+    S GTP+RV+QYEAPD   D+
Sbjct  41    MLDTVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEDNQI-SCGTPARVIQYEAPDVAPDD  99

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E      +SAVILKFEL
Sbjct  100   IFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDES---PLTSAVILKFEL  156

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCP+HFDAFHAVLVD S+H+  
Sbjct  157   MYAPILENGPEMQASFDAVSAAFHEFRIPPKALLGLHSYCPIHFDAFHAVLVDLSIHVVF  216

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK   +T + KV+S S    + + E  ++  Q++          LIK  L +R+++L EL
Sbjct  217   LKAATYTRAQKVSSTSHVVGNHAEEHHEEPNQILGQTWTLKAVKLIKLLLASRELILGEL  276

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVSG------QMPSQKQSVSQ  1656
             +K+SKAI + I D+N+        +  +S ++ SS  + ++SG      Q+     ++ +
Sbjct  277   QKISKAIGETIDDLNNADLNLGRLESISSSRTDSSTASLDISGMNMGVEQLVGILHNILE  336

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K NG+ +F N+ +L++LSK+EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  337   KSNGVIEFGNDVMLYTLSKEELLDVFFTVGNQLSFIWNAFLKFHRINR  384



>ref|XP_010414740.1| PREDICTED: protein FAM135B-like isoform X2 [Camelina sativa]
Length=795

 Score =   326 bits (835),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 228/344 (66%), Gaps = 29/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LD  P AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCIDNESGKQ--LDASPVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHITV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      ++++ F KA         K V  +K  L ARDILLE
Sbjct  210   LKSAAYKRSASLSSGVSNSKNVSGSTAQSFKKALGLLASADKKLVSFVKALLGARDILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             +++++S+A  Q+ID++DF S   +  L        S    + SGQ    K+  + + N  
Sbjct  270   DMQRLSEAAGQSIDLSDFVSNMNNVPL--------SNSTVDSSGQ---GKEQNNLELNIT  318

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++E LH L KD+L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  319   FDLASDEWLHELPKDQLSRLFHLLGTQLHYLWTTFLGFHRDNHT  362



>ref|XP_006392304.1| hypothetical protein EUTSA_v10023308mg [Eutrema salsugineum]
 gb|ESQ29590.1| hypothetical protein EUTSA_v10023308mg [Eutrema salsugineum]
Length=710

 Score =   323 bits (828),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 229/344 (67%), Gaps = 31/344 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEA ++GS+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEASESGSN-  93

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQPFRIKYARQDI L +++SF L L +YE L    +SA ILKFEL
Sbjct  94    --GVWRIDDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLQRYEGLA---TSAAILKFEL  148

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP +++       L+  PAA+HEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  149   MYAPSMDSSSTRH--LEALPAAIHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  206

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS +++    +  S + F KA         K V  +K  L ARDILL+
Sbjct  207   LKSAAYRRPASLSSDLSNSKNVNGGSVQSFKKALGLLASADKKMVSFVKALLGARDILLQ  266

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++S+A+ Q+ID++DF S   +  L           N+ V+G    ++Q+  +K N  
Sbjct  267   EMQRLSEAVGQSIDLSDFVSNMNNVPL----------SNSAVAGSGQGKEQNSLEKLNIT  316

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH LSKD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  317   FDLASDDWLHELSKDHLSRLFHLLGTQLHYLWNTFLGFHRDNNT  360



>ref|XP_006585466.1| PREDICTED: protein FAM135B-like isoform X4 [Glycine max]
Length=775

 Score =   323 bits (828),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 243/395 (62%), Gaps = 54/395 (14%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  RL W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRRLGWFV-GLNQTNLSTKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IKIT+RWE+GD    G P+RVVQYEAP+ G
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKITLRWEDGDDSHPGVPARVVQYEAPEVG  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +DN+CGVWMIDD DNS+ T  FRI+YARQD++L++++SF LS  +YE      SSAVILK
Sbjct  95    ADNLCGVWMIDDKDNSFSTPSFRIRYARQDVILAIMISFYLSYGRYE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E    LQ+S++   A+ HE+R+PPKALLGLHSYCPVHFDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMRPELQSSVNGCAASFHEYRIPPKALLGLHSYCPVHFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I LLK G  T   K A                    LIK  + ARDILL++LR++SK  N
Sbjct  211   ISLLKSGYLTPQLKAA--------------------LIKALMAARDILLDDLRRISKGTN  250

Query  1522  QAIDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             QAID+   +   ++ K L ++  +     + EVS Q+    Q  ++K     +   EE+ 
Sbjct  251   QAIDLTGITFEPYDTKSLNSTSTAHEKSTDDEVSLQLSDGTQISAEKVTQYINHVTEELS  310

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  311   QPFSWDDMLNSFQFIGNQLLYLWNTFLKFHRENKT  345



>ref|XP_010511082.1| PREDICTED: protein FAM135B-like isoform X2 [Camelina sativa]
Length=796

 Score =   323 bits (828),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 229/344 (67%), Gaps = 29/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEAPD+GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEAPDSGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  LD  P AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPCIDNESGKQ--LDASPLAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHITV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS V++      ++++ F KA         K V  +K  L ARDILLE
Sbjct  210   LKSAAYKRPASLSSGVSNSKNVSGSTAQSFKKALGLLASADKKLVSFVKALLGARDILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             +++++S+A  Q++D++DF S   +  L           N+ V G    ++Q+ S + N  
Sbjct  270   DMQRLSEAAGQSLDLSDFVSNMNNVPL----------SNSTVDGSGQGKEQN-SLELNIT  318

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              +  ++E LH L KD+L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  319   FNVASDEWLHELPKDQLSRLFHLLGTQLHYLWTTFLGFHRDNHT  362



>ref|XP_004504749.1| PREDICTED: protein FAM135B-like isoform X2 [Cicer arietinum]
Length=803

 Score =   322 bits (826),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 181/395 (46%), Positives = 244/395 (62%), Gaps = 33/395 (8%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW + GLN+    T + +N+ +  P                          N Q 
Sbjct  11    MFRRLRWFV-GLNQKNWSTKRLVNADQPVPARP-----------------------NHQP  46

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
              LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMR E+G+    G P+RVVQYEAP+ GSDN
Sbjct  47    ALDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRLEDGEDFYPGIPARVVQYEAPEVGSDN  106

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF+I+YARQD+ LS+++SF L+   YE      SS VILKFEL
Sbjct  107   LCRVWMIDDTDNSFSTPPFQIRYARQDVFLSIMISFYLAFGVYE----GESSDVILKFEL  162

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++AP+   G  L  SLD    + HE+++PPKALLGLHSYCPVHFDAFHAV+VD SVHI L
Sbjct  163   MHAPMSATGSELHGSLDACSVSAHEYKIPPKALLGLHSYCPVHFDAFHAVVVDTSVHISL  222

Query  1351  LKRGVHTLSSKVASGSCSDDASS--EDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQ  1524
             LK    T+  KV S  C D   +  ED+  + +V+LIK  + A +ILLE+LR++S  I+Q
Sbjct  223   LKASYRTVRQKVPS-DCRDSEGTYAEDYVGSNKVMLIKALMAAHNILLEDLRRISAGIDQ  281

Query  1525  AIDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVLH  1701
             AID+   + + +    F S      K  + E S Q+  + +   +     T++  EE + 
Sbjct  282   AIDLTGITFESDVTKWFDSTLPEPVKSIDGEPSLQLSDRDKVSVEDSTHYTNYLTEESVQ  341

Query  1702  SLS-KDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                  D L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  342   PFCWDDHLLNSFQSLGNQLLCLWNIFLKFHRENKT  376



>ref|XP_006417506.1| hypothetical protein EUTSA_v10006833mg [Eutrema salsugineum]
 gb|ESQ35859.1| hypothetical protein EUTSA_v10006833mg [Eutrema salsugineum]
Length=798

 Score =   322 bits (825),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 232/340 (68%), Gaps = 17/340 (5%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSSSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQPFRIKYARQDI L ++VSF + L +YE    S +SAVIL+FEL
Sbjct  95    SYGVWNIDDKDNSFLTQPFRIKYARQDIRLCMMVSFTMPLERYE---GSATSAVILRFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI+EN     +  DT PAAVH+FR+PPKAL GLHSYCPVHFD FHAVL+D SVH+ +
Sbjct  152   LYSPIMENISVTHS--DTCPAAVHDFRIPPKALSGLHSYCPVHFDTFHAVLIDVSVHVSV  209

Query  1351  LKRGVHTLSSKVAS-GSCSDDASSEDFDKAKQVV--------LIKGFLTARDILLEELRK  1503
             +K   +   + ++S  S S + +S +   +K++          +K  L ARD LLEE+++
Sbjct  210   MKSAAYKRPAVLSSDASNSKNLASSNVQSSKKIASADKKLVSFVKALLVARDTLLEEMQR  269

Query  1504  VSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFR  1683
             +SKA+ Q ID+++F S  ++  L     S+S+  + EV G    ++ +  +K +G  D  
Sbjct  270   LSKAVGQTIDLSEFVSSMDNGLL---SDSSSTGKSVEVDGSGQGKQPNNLEKLDGPIDLE  326

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             +++ L + SK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  327   SDDWLRNFSKEHLSRTFHLLGTQLHYLWNTFLSFHRDNNT  366



>gb|KDP30675.1| hypothetical protein JCGZ_15550 [Jatropha curcas]
Length=805

 Score =   321 bits (823),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 246/347 (71%), Gaps = 27/347 (8%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD V EIA+YIHRFHNLDLFQQGWYQ+KIT+RWE+ +Y S+G+P+RV QYE PD GSD
Sbjct  36    AMLDTVQEIAIYIHRFHNLDLFQQGWYQMKITVRWEDSEYTSMGSPARVAQYEPPDLGSD  95

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             N  G+W IDDTDNS+ TQPFRIKYA+QDI LS++VSFNLSL+  +V     +SAVILKFE
Sbjct  96    NAFGIWRIDDTDNSFLTQPFRIKYAKQDIRLSIMVSFNLSLTGSKV---PPTSAVILKFE  152

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL AP+  NG  L A +D    AVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD SVHI 
Sbjct  153   LLQAPMTANGLELLAYIDASTVAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDVSVHIS  212

Query  1348  LLKRGVHTLSSKVASGSCS-DDASSE---DFDKA---------KQVVLIKGFLTARDILL  1488
             LLK   +    KV S   + +D + +   +F++A         KQ++L+K  L AR+ LL
Sbjct  213   LLKTDSYI---KVPSDPYAHEDVAGKKIGEFNQALGQVASADMKQIMLVKAMLFARETLL  269

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTS--RQSTSSKDNAEVSGQMPSQKQSVSQKR  1662
             EEL+ +SKAI QAID+ DF SK +D ++  S   ++  + D  EVSGQ   + Q+V +K 
Sbjct  270   EELKLLSKAIGQAIDLTDFLSKMDDIEMIDSILPENIGTAD-GEVSGQ--GKLQNVLEKA  326

Query  1663  NGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                + +  +E    LS+D +V +FHS G Q+ YLWSIFL+F R ++T
Sbjct  327   ---SSYVIDEFPCVLSEDAVVNIFHSLGAQLSYLWSIFLQFQRENKT  370



>ref|XP_010458322.1| PREDICTED: protein FAM135B-like isoform X1 [Camelina sativa]
Length=802

 Score =   321 bits (823),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 229/344 (67%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSNG  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    TNGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P++E+     +  D   AAVHEFR+PPKAL GLHSYCPVHFD FHAVL+D SVHI +
Sbjct  152   LYSPVMEDVSVTHS--DASSAAVHEFRIPPKALSGLHSYCPVHFDTFHAVLIDVSVHISV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLASGNVQSSKKAFAQIASADNKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++ +SKA+ Q +D+++F S  +   L     S S++ + EV G    ++Q+  +K NG 
Sbjct  270   EMQILSKAVGQTMDLSEFVSSMDSALL---SDSASTEKSVEVEGSGQGKQQNSLEKLNGP  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++++LH+LSK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  327   FDLASDDLLHNLSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNYT  370



>ref|XP_004485525.1| PREDICTED: protein FAM135B-like [Cicer arietinum]
Length=776

 Score =   320 bits (820),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 224/332 (67%), Gaps = 24/332 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             MLDAV+E+A+YIHRFHNLDLF+QGWY+IKITMRWE+G+    G P+RVVQYEAP+ G+DN
Sbjct  38    MLDAVHEVAIYIHRFHNLDLFEQGWYRIKITMRWEDGEDSYPGIPARVVQYEAPEVGADN  97

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PFRIKYARQD+ L +++SF LS   Y+      SSAV+LKF+L
Sbjct  98    LCRVWMIDDTDNSFSTPPFRIKYARQDVFLCIMISFYLSYGGYK----GKSSAVMLKFQL  153

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             L+ P  E    LQ+SLD Y  +VHE+R+P KALLGLHSYCPVHFDA HAV+VD +VHI L
Sbjct  154   LHTPTPEIRPELQSSLDAYAVSVHEYRIPSKALLGLHSYCPVHFDASHAVVVDTTVHISL  213

Query  1351  LKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA  1527
             +K   H    KV S S + + +  EDF  + +V+LIK   TA DILLE+LRK+SK IN+A
Sbjct  214   VKPNYHKPQLKVPSDSSACEGTYGEDFVGSNKVMLIKALRTAHDILLEDLRKISKGINKA  273

Query  1528  IDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSL  1707
             ID+   +    + D+  S   TS      ++G+   Q    +Q                +
Sbjct  274   IDLTGTTF---EPDVTKSLHYTSPAHAKSITGEASLQLSDTTQ----------------I  314

Query  1708  SKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             S ++L+    S GNQ+ YLW+ FLKFHR ++T
Sbjct  315   SDEDLLNSLQSSGNQILYLWNSFLKFHRENKT  346



>ref|XP_006306176.1| hypothetical protein CARUB_v10011744mg [Capsella rubella]
 gb|EOA39074.1| hypothetical protein CARUB_v10011744mg [Capsella rubella]
Length=802

 Score =   320 bits (821),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 229/345 (66%), Gaps = 23/345 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  S G PSRVVQYEA D+ S+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNNSCGIPSRVVQYEALDSTSNG  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQPFRIKYARQD+ L ++VSF + L +YE      +SAVILKFEL
Sbjct  95    SNGVWKIDDKDNSFLTQPFRIKYARQDVRLCMMVSFTMPLERYE---GPATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P++E+     +  D  PAAVHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVHI +
Sbjct  152   LYSPLVEDISVTHS--DASPAAVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHISV  209

Query  1351  LKRGVH----------TLSSKVASGSCSDD----ASSEDFDKAKQVVLIKGFLTARDILL  1488
             +K   +          ++   +ASG+        A     DK K V  ++  L ARD LL
Sbjct  210   MKSAAYKRPAILSCDASIGKNLASGNVQSSKKAFAQIASADK-KLVSFVRALLGARDTLL  268

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EEL+ +SKA+ Q ID+++F S  ++  L     S S+  + EV G    ++Q+  +K NG
Sbjct  269   EELKILSKAVGQTIDLSEFVSSMDNALL---SDSASTGKSVEVEGSGQGKQQNNLEKLNG  325

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               D  ++++LH+ SK+ L   FH  G Q+ YLW+IFL FHR + T
Sbjct  326   PFDSASDDLLHNFSKEHLSRTFHLLGTQLHYLWNIFLTFHRDNNT  370



>ref|XP_010480403.1| PREDICTED: protein FAM135B-like [Camelina sativa]
Length=627

 Score =   316 bits (809),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 227/344 (66%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSNG  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    TSGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P++E+     +  D   A+VHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVHI +
Sbjct  152   LYSPVMEDVSVTHS--DASSASVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHISI  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLASGNVQSSKKAFAQIASADNKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             EL+ +SKA+ Q +D+++F S   D  L +   ST      EV G    ++++  +K NG 
Sbjct  270   ELQILSKAVCQTMDLSEFISS-MDSALLSDSASTGKP--LEVEGSEQGKQRNSVEKLNGP  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++++LH+LSK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  327   FDLASDDLLHNLSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNYT  370



>ref|XP_004504748.1| PREDICTED: protein FAM135B-like isoform X1 [Cicer arietinum]
Length=805

 Score =   320 bits (821),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 179/396 (45%), Positives = 244/396 (62%), Gaps = 33/396 (8%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW + GLN+    T + +N+ +  P                          N Q 
Sbjct  11    MFRRLRWFV-GLNQKNWSTKRLVNADQPVPARP-----------------------NHQP  46

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
              LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMR E+G+    G P+RVVQYEAP+ GSDN
Sbjct  47    ALDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRLEDGEDFYPGIPARVVQYEAPEVGSDN  106

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF+I+YARQD+ LS+++SF L+   YE      SS VILKFEL
Sbjct  107   LCRVWMIDDTDNSFSTPPFQIRYARQDVFLSIMISFYLAFGVYE----GESSDVILKFEL  162

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++AP+   G  L  SLD    + HE+++PPKALLGLHSYCPVHFDAFHAV+VD SVHI L
Sbjct  163   MHAPMSATGSELHGSLDACSVSAHEYKIPPKALLGLHSYCPVHFDAFHAVVVDTSVHISL  222

Query  1351  LKRGVHTLSSKV-ASGSCSDDASS--EDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             LK    T+  K+  +  C D   +  ED+  + +V+LIK  + A +ILLE+LR++S  I+
Sbjct  223   LKASYRTVRQKLNCTSDCRDSEGTYAEDYVGSNKVMLIKALMAAHNILLEDLRRISAGID  282

Query  1522  QAIDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             QAID+   + + +    F S      K  + E S Q+  + +   +     T++  EE +
Sbjct  283   QAIDLTGITFESDVTKWFDSTLPEPVKSIDGEPSLQLSDRDKVSVEDSTHYTNYLTEESV  342

Query  1699  HSLS-KDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                   D L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  343   QPFCWDDHLLNSFQSLGNQLLCLWNIFLKFHRENKT  378



>ref|XP_002510012.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52199.1| conserved hypothetical protein [Ricinus communis]
Length=762

 Score =   319 bits (817),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 176/341 (52%), Positives = 233/341 (68%), Gaps = 23/341 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M DAV EIA+YIH+FHNLDLFQQG+YQIK++MRWE+  Y ++GTP+RVVQYEA D GS++
Sbjct  1     MWDAVQEIAIYIHKFHNLDLFQQGFYQIKVSMRWEDNAYTTLGTPARVVQYEANDLGSND  60

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             ICG W I+D DNS+ TQPFRIKYARQD+ LSV+VSF LSLSKY+V     +SAVILKFEL
Sbjct  61    ICGTWRINDIDNSFLTQPFRIKYARQDVCLSVMVSFVLSLSKYKV---PPTSAVILKFEL  117

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++AP+ EN   L A L+    AVHEFR+PPKALLGLHSYCP+HFD FHAVLV+ASVH+ L
Sbjct  118   IHAPMTENRLELLAYLEASSVAVHEFRIPPKALLGLHSYCPIHFDVFHAVLVEASVHLSL  177

Query  1351  LKRGVHTLSSKVASG----------SCSDDASSEDFDKAKQVVLIKGFLTARDILLEELR  1500
             LK G +   S+  +            C     + DF    Q++L+K  L +RD LL EL+
Sbjct  178   LKAGYYPKISRFVTFFYQISNLLLIKCQLLGPA-DFVGMNQIMLVKSLLVSRDALLGELQ  236

Query  1501  KVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNGITD  1677
             ++SK+I+Q ID+ DF +K  D  +F S  ++       EV GQ         +K+N    
Sbjct  237   RLSKSIDQVIDLTDFIAKMNDVKMFDSILRADLGTAYGEVGGQ--------HKKQNDFKV  288

Query  1678  FRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
               ++++ + L K+ +  +FH  G Q+ YLWS FL+FHRA++
Sbjct  289   PNSDKLPYFLPKEAVGDIFHLLGAQISYLWSTFLQFHRANK  329



>ref|XP_002892542.1| hypothetical protein ARALYDRAFT_888257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68801.1| hypothetical protein ARALYDRAFT_888257 [Arabidopsis lyrata subsp. 
lyrata]
Length=802

 Score =   320 bits (819),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 230/344 (67%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD D+S+ TQPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    SYGVWKIDDKDSSFLTQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI+E+     +  D  PAAVHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ +
Sbjct  152   LYSPIIEDIPVTHS--DACPAAVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVSV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLASGNVQSSKKAFTQIASADKKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID+++F S  ++  L     S S+  + EV G    ++Q+  +K NG 
Sbjct  270   EMQRLSKAVGQTIDLSEFVSSMDNALL---SDSASTGKSVEVEGSGQGKQQNNLEKLNGP  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  327   FDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNYT  370



>ref|XP_004504750.1| PREDICTED: protein FAM135B-like isoform X3 [Cicer arietinum]
Length=801

 Score =   319 bits (818),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 180/395 (46%), Positives = 244/395 (62%), Gaps = 35/395 (9%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RLRW + GLN+    T + +N+ +  P                          N Q 
Sbjct  11    MFRRLRWFV-GLNQKNWSTKRLVNADQPVPARP-----------------------NHQP  46

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
              LDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMR E+G+    G P+RVVQYEAP+ GSDN
Sbjct  47    ALDAVHEVAIYIHRFHNLDLFEQGWYKIKVTMRLEDGEDFYPGIPARVVQYEAPEVGSDN  106

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             +C VWMIDDTDNS+ T PF+I+YARQD+ LS+++SF L+   YE      SS VILKFEL
Sbjct  107   LCRVWMIDDTDNSFSTPPFQIRYARQDVFLSIMISFYLAFGVYE----GESSDVILKFEL  162

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             ++AP+   G  L  SLD    + HE+++PPKALLGLHSYCPVHFDAFHAV+VD SVHI L
Sbjct  163   MHAPMSATGSELHGSLDACSVSAHEYKIPPKALLGLHSYCPVHFDAFHAVVVDTSVHISL  222

Query  1351  LKRGVHTLSSKV-ASGSCSDDASS--EDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             LK    T+  K+  +  C D   +  ED+  + +V+LIK  + A +ILLE+LR++S  I+
Sbjct  223   LKASYRTVRQKLNCTSDCRDSEGTYAEDYVGSNKVMLIKALMAAHNILLEDLRRISAGID  282

Query  1522  QAIDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             QAID+   + + +    F S      K  + E S Q+  + +  +   N +T+   E V 
Sbjct  283   QAIDLTGITFESDVTKWFDSTLPEPVKSIDGEPSLQLSDRDKDSTHYTNYLTE---ESVQ  339

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                  D L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  340   PFCWDDHLLNSFQSLGNQLLCLWNIFLKFHRENKT  374



>ref|XP_002886694.1| hypothetical protein ARALYDRAFT_475399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62953.1| hypothetical protein ARALYDRAFT_475399 [Arabidopsis lyrata subsp. 
lyrata]
Length=787

 Score =   318 bits (816),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 225/344 (65%), Gaps = 28/344 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEA ++GS++
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNVTRGIPSRVVQYEATESGSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW I D DNS+ TQPFRIKYARQDI L +++SF L L +YE    S +SA ILKFEL
Sbjct  95    SYGVWRIVDKDNSFLTQPFRIKYARQDIRLCMMISFTLPLERYE---GSATSAAILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N       LD    AVHEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  152   MYAPSVDNAS--AKHLDASSVAVHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  209

Query  1351  LKRGVHT----LSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +     LSS V++      +S++ F KA         K V  +K  L AR ILLE
Sbjct  210   LKSAAYKRPARLSSGVSNSKNVSGSSAQSFKKALGLLASADKKLVSFVKALLGARGILLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID++DF S   +  L           N+ ++G    ++Q+  +K N  
Sbjct  270   EMQRLSKAVGQTIDLSDFVSNMNNIPL----------SNSTINGSGQGKEQNSLEKLNIT  319

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH LSKD L  +FH  G Q+ +LW+ FL FHR + T
Sbjct  320   FDLASDDWLHELSKDHLSRIFHLLGTQLHHLWNTFLGFHRDNHT  363



>ref|XP_010490575.1| PREDICTED: protein FAM135B-like isoform X1 [Camelina sativa]
Length=802

 Score =   319 bits (817),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 227/344 (66%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSNG  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    TNGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P++E+     +  D   AA+HEFR+PPKAL G+HSYCPVHFD FHAVL+D SVHI +
Sbjct  152   LYSPVMEDVSVTHS--DASSAALHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHISI  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLASGNVQSSKKAFAQIASADNKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             EL+ +SKA+ Q +D+++F S  +   L     S S+  + EV G +  ++Q   +K N  
Sbjct  270   ELQILSKAVGQTVDLSEFISSMDSALL---SDSASTGKSVEVEGSIQGKQQDSLEKLNSP  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++++LH+LSKD L   FH  G Q+ YLW+ FL FHR + T
Sbjct  327   FDLASDDLLHNLSKDHLSRTFHLLGTQLHYLWNTFLTFHRDNYT  370



>ref|XP_010458323.1| PREDICTED: protein FAM135B-like isoform X2 [Camelina sativa]
Length=801

 Score =   319 bits (817),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 226/344 (66%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSNG  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    TNGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P++E+     +  D   AAVHEFR+PPKAL GLHSYCPVHFD FHAVL+D SVHI +
Sbjct  152   LYSPVMEDVSVTHS--DASSAAVHEFRIPPKALSGLHSYCPVHFDTFHAVLIDVSVHISV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLASGNVQSSKKAFAQIASADNKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++ +SKA+ Q +D+++F S   D  L +   ST      E SGQ    KQ  S + NG 
Sbjct  270   EMQILSKAVGQTMDLSEFVSS-MDSALLSDSASTEKSVEVEGSGQ---GKQQNSLELNGP  325

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++++LH+LSK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  326   FDLASDDLLHNLSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNYT  369



>ref|XP_008781420.1| PREDICTED: uncharacterized protein LOC103701215 isoform X1 [Phoenix 
dactylifera]
Length=818

 Score =   318 bits (815),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 198/408 (49%), Positives = 271/408 (66%), Gaps = 41/408 (10%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  R R +I GLN  +P  PKRL    ARP +                    +       
Sbjct  1     MFRRARRLI-GLNPKSP-PPKRL--LNARPPTSQRG----------------TTRFTPPD  40

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE  + +S GTP+RVVQYEAPD   D+
Sbjct  41    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEGNNRQSRGTPARVVQYEAPDAAPDD  100

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E   M   SAV+LKFEL
Sbjct  101   IFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDESPSM---SAVMLKFEL  157

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILEN   +QAS D   AAVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD SVH+  
Sbjct  158   MYAPILENSSEMQASFDAVSAAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDLSVHVVF  217

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK G +T + KV+S S   ++ + E +++  Q++          L+K  L +R++LLEEL
Sbjct  218   LKAGAYTHAQKVSSTSQMVENHADEHYEEPDQILGQGWISKAIELVKLLLASRELLLEEL  277

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------GQMPSQKQSVSQ  1656
             +K+SKAI+Q I D+N+        +  +S    SS  + ++S      GQ+     ++ +
Sbjct  278   QKISKAIDQTIEDLNNADLDLGRFESISSSTPDSSTSSLDISGMKMGVGQLVGMLHNILE  337

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K+NG+ +F N+ +L++LSK+EL+ ++ + GNQ+ ++W+ FL+FHR ++
Sbjct  338   KKNGVIEFGNDVMLYTLSKEELLDVYFTVGNQLSFIWNAFLRFHRINK  385



>ref|XP_008781421.1| PREDICTED: uncharacterized protein LOC103701215 isoform X2 [Phoenix 
dactylifera]
Length=817

 Score =   318 bits (815),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 198/408 (49%), Positives = 271/408 (66%), Gaps = 41/408 (10%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  R R +I GLN  +P  PKRL    ARP +                    +       
Sbjct  1     MFRRARRLI-GLNPKSP-PPKRL--LNARPPTSQRG----------------TTRFTPPD  40

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI++RWE  + +S GTP+RVVQYEAPD   D+
Sbjct  41    MLETVHEIAIYIHRFHNLDLFQQGWYQIKISVRWEGNNRQSRGTPARVVQYEAPDAAPDD  100

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
             I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E   M   SAV+LKFEL
Sbjct  101   IFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDESPSM---SAVMLKFEL  157

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAPILEN   +QAS D   AAVHEFR+PPKALLGLHSYCPVHFDAFHAVLVD SVH+  
Sbjct  158   MYAPILENSSEMQASFDAVSAAVHEFRIPPKALLGLHSYCPVHFDAFHAVLVDLSVHVVF  217

Query  1351  LKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDILLEEL  1497
             LK G +T + KV+S S   ++ + E +++  Q++          L+K  L +R++LLEEL
Sbjct  218   LKAGAYTHAQKVSSTSQMVENHADEHYEEPDQILGQGWISKAIELVKLLLASRELLLEEL  277

Query  1498  RKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------GQMPSQKQSVSQ  1656
             +K+SKAI+Q I D+N+        +  +S    SS  + ++S      GQ+     ++ +
Sbjct  278   QKISKAIDQTIEDLNNADLDLGRFESISSSTPDSSTSSLDISGMKMGVGQLVGMLHNILE  337

Query  1657  KRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             K+NG+ +F N+ +L++LSK+EL+ ++ + GNQ+ ++W+ FL+FHR ++
Sbjct  338   KKNGVIEFGNDVMLYTLSKEELLDVYFTVGNQLSFIWNAFLRFHRINK  385



>ref|XP_010544041.1| PREDICTED: protein FAM135B isoform X2 [Tarenaya hassleriana]
Length=797

 Score =   317 bits (813),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 227/344 (66%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLF+QGWYQIKITMRWE+ D +SVG PSRVVQYEAPD+   +
Sbjct  36    MIDTVQEIAIYIHRFHNLDLFKQGWYQIKITMRWEDSDNKSVGIPSRVVQYEAPDSTPGD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQPFRIKYARQD+ L  ++SF L L KY+    + +SAVILKFEL
Sbjct  96    SYGVWRIDDKDNSFSTQPFRIKYARQDVRLCTMISFTLPLEKYQ---GTSTSAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI EN   L   LDT   AVHEFR+PPKAL+GLHSYCPVHFD  HAVL+D SVHI +
Sbjct  153   LYSPIAENV--LAKPLDTSSVAVHEFRIPPKALMGLHSYCPVHFDTLHAVLIDVSVHISV  210

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS  ++G      S +  +KA         K V  +K  L ARD++LE
Sbjct  211   LKSAAYRRPASLSSDTSNGEKVTGGSVQASNKALGQMASTDKKLVSFVKALLRARDVMLE  270

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA++Q I   +F S   D  LF S     S ++ E SGQ    KQ  S ++  +
Sbjct  271   EIQRLSKAVDQTIISTEFISTMNDILLFDSTPMGKSVED-EGSGQ---GKQQNSLEKLDV  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++  L SL+KD L  LF+  G Q+ YLWS FL FHR   T
Sbjct  327   DDLLSDGWLCSLTKDHLSRLFNLLGGQLQYLWSAFLTFHRDSNT  370



>ref|XP_010104541.1| Xylulose kinase [Morus notabilis]
 gb|EXC01142.1| Xylulose kinase [Morus notabilis]
Length=1291

 Score =   325 bits (833),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 218/294 (74%), Gaps = 17/294 (6%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +M D V EIA+YIHRFHNLDLFQQGWYQ+KITMRWE+ +Y SVGTP+RVVQYE PD GSD
Sbjct  35    AMFDTVQEIAIYIHRFHNLDLFQQGWYQLKITMRWEDNEYTSVGTPARVVQYEVPDIGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ TQPFRIKYARQD+ LSV++SFNLSL KYE      +SAVI+KFE
Sbjct  95    DVHGVWRIDDTDNSFSTQPFRIKYARQDVSLSVMISFNLSLGKYE---GPPTSAVIVKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAPI   G +LQASL +  AAVHEFR+PPKAL GLHSYCPVHFDAFHAVLVDAS+HI 
Sbjct  152   LMYAPISLTGSDLQASLSSCSAAVHEFRIPPKALSGLHSYCPVHFDAFHAVLVDASLHIS  211

Query  1348  LLKRGVHTLSSKVASGSCS-DDASSEDFDKAKQV------------VLIKGFLTARDILL  1488
             LLK   +   +K  S SC+ +  ++E FD A Q             +L+K  L ARDILL
Sbjct  212   LLKGDAYAAPTKRPSDSCTVEVVANESFDGAHQAPGQMASADAKCFMLVKSLLAARDILL  271

Query  1489  EELRKVSKAINQAIDVNDFSSKHED-KDLFTSRQSTSSKDNAEVSGQMPSQKQS  1647
             EEL+++SKAI+Q ID+ DF SK +D K   +++Q  +S  + +VS Q   Q ++
Sbjct  272   EELQRLSKAIDQLIDLTDFISKMDDIKFPNSAQQGNASPSDGKVSAQGKQQNEN  325



>ref|XP_010548718.1| PREDICTED: protein FAM135B-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548727.1| PREDICTED: protein FAM135B-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548736.1| PREDICTED: protein FAM135B-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548745.1| PREDICTED: protein FAM135B-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548751.1| PREDICTED: protein FAM135B-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548754.1| PREDICTED: protein FAM135B-like isoform X1 [Tarenaya hassleriana]
Length=804

 Score =   317 bits (813),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 229/346 (66%), Gaps = 26/346 (8%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQ+KITMRWE+ D +S G PSRVVQYEAPD+ S +
Sbjct  36    MIDTVQEIAIYIHRFHNLDLFQQGWYQLKITMRWEDNDNKSSGIPSRVVQYEAPDSSSGD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQ FRIKYARQD+ L  +++F L L KY+    S + AVILKFEL
Sbjct  96    SYGVWRIDDKDNSFLTQAFRIKYARQDVRLCTMITFTLPLEKYQ---GSATCAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P +EN   L   LD  PAAVHEFR+PPKAL G HSYCPVHFDA H+VLVD SVHI +
Sbjct  153   LYSPSMENV--LAKPLDASPAAVHEFRIPPKALTGFHSYCPVHFDALHSVLVDVSVHISV  210

Query  1351  LKRGVH----------TLSSKVASGSCSDDASSEDFDKA-----KQVVLIKGFLTARDIL  1485
             LK   +          +   KV  GS    AS+++  +      K V  +K  L ARDI+
Sbjct  211   LKSAAYRRPAIQSSDASNGEKVTGGSVQ--ASNKELGQMASADKKLVSFVKALLRARDIM  268

Query  1486  LEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             LEE++++SKA  QAID+ +F S   D  LF S  +  S ++ E SGQ   ++Q   +K N
Sbjct  269   LEEMQRLSKAAGQAIDLTEFISTMNDVLLFDSAPTGKSVED-EGSGQ--GKEQVSLEKLN  325

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G  D +++  L SL+KD L  LF+  G Q+ YLWS FL +HR + T
Sbjct  326   G-CDLQSDGWLCSLTKDHLSRLFNLLGGQLQYLWSAFLSYHRDNNT  370



>ref|XP_010544040.1| PREDICTED: protein FAM135B isoform X1 [Tarenaya hassleriana]
Length=800

 Score =   317 bits (813),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 227/344 (66%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLF+QGWYQIKITMRWE+ D +SVG PSRVVQYEAPD+   +
Sbjct  36    MIDTVQEIAIYIHRFHNLDLFKQGWYQIKITMRWEDSDNKSVGIPSRVVQYEAPDSTPGD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQPFRIKYARQD+ L  ++SF L L KY+    + +SAVILKFEL
Sbjct  96    SYGVWRIDDKDNSFSTQPFRIKYARQDVRLCTMISFTLPLEKYQ---GTSTSAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI EN   L   LDT   AVHEFR+PPKAL+GLHSYCPVHFD  HAVL+D SVHI +
Sbjct  153   LYSPIAENV--LAKPLDTSSVAVHEFRIPPKALMGLHSYCPVHFDTLHAVLIDVSVHISV  210

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LSS  ++G      S +  +KA         K V  +K  L ARD++LE
Sbjct  211   LKSAAYRRPASLSSDTSNGEKVTGGSVQASNKALGQMASTDKKLVSFVKALLRARDVMLE  270

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA++Q I   +F S   D  LF S     S ++ E SGQ    KQ  S ++  +
Sbjct  271   EIQRLSKAVDQTIISTEFISTMNDILLFDSTPMGKSVED-EGSGQ---GKQQNSLEKLDV  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++  L SL+KD L  LF+  G Q+ YLWS FL FHR   T
Sbjct  327   DDLLSDGWLCSLTKDHLSRLFNLLGGQLQYLWSAFLTFHRDSNT  370



>ref|XP_010548759.1| PREDICTED: protein FAM135B-like isoform X2 [Tarenaya hassleriana]
Length=800

 Score =   316 bits (809),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 226/346 (65%), Gaps = 30/346 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQ+KITMRWE+ D +S G PSRVVQYEAPD+ S +
Sbjct  36    MIDTVQEIAIYIHRFHNLDLFQQGWYQLKITMRWEDNDNKSSGIPSRVVQYEAPDSSSGD  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ TQ FRIKYARQD+ L  +++F L L KY+    S + AVILKFEL
Sbjct  96    SYGVWRIDDKDNSFLTQAFRIKYARQDVRLCTMITFTLPLEKYQ---GSATCAVILKFEL  152

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P +EN   L   LD  PAAVHEFR+PPKAL G HSYCPVHFDA H+VLVD SVHI +
Sbjct  153   LYSPSMEN--VLAKPLDASPAAVHEFRIPPKALTGFHSYCPVHFDALHSVLVDVSVHISV  210

Query  1351  LKRGVH----------TLSSKVASGSCSDDASSEDFDKA-----KQVVLIKGFLTARDIL  1485
             LK   +          +   KV  GS    AS+++  +      K V  +K  L ARDI+
Sbjct  211   LKSAAYRRPAIQSSDASNGEKVTGGSVQ--ASNKELGQMASADKKLVSFVKALLRARDIM  268

Query  1486  LEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRN  1665
             LEE++++SKA  QAID+ +F S   D  LF S  +  S ++ E SG      Q   QK N
Sbjct  269   LEEMQRLSKAAGQAIDLTEFISTMNDVLLFDSAPTGKSVED-EGSG------QGKEQKLN  321

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             G  D +++  L SL+KD L  LF+  G Q+ YLWS FL +HR + T
Sbjct  322   G-CDLQSDGWLCSLTKDHLSRLFNLLGGQLQYLWSAFLSYHRDNNT  366



>ref|XP_002518844.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43562.1| conserved hypothetical protein [Ricinus communis]
Length=688

 Score =   312 bits (800),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 229/329 (70%), Gaps = 8/329 (2%)
 Frame = +1

Query  817   DAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNIC  996
             + ++E+A+YIHRFHNLDLFQQGWYQIKI+MR ++ +Y+SVGTP+RVVQYEA + GS    
Sbjct  31    ETLHEVAIYIHRFHNLDLFQQGWYQIKISMRLDDSEYKSVGTPARVVQYEAHEQGSIGAH  90

Query  997   GVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELLY  1176
             G+W IDD DNS+ TQPF IKYA+QD+ LS+++SF LSL  + V     +  V+LKFEL+Y
Sbjct  91    GIWTIDDIDNSFSTQPFLIKYAKQDVYLSIMISFILSLHAHGV-EGPPTPGVVLKFELMY  149

Query  1177  APILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLLK  1356
              P L+ G  LQ SL   PAAVHEFRLPPKALLGLHSYCPVHFDAFH+VLVD SVHI  +K
Sbjct  150   TPALKKGSELQGSLSACPAAVHEFRLPPKALLGLHSYCPVHFDAFHSVLVDTSVHIITVK  209

Query  1357  RGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAIDV  1536
                  L  KV   +      S DF+   Q++LIK  + A DILL++LR +S+AI+Q+I++
Sbjct  210   ASWTPL--KVPWFASLRQVGSADFE---QILLIKELVAAHDILLDDLRNISRAIDQSIEL  264

Query  1537  NDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSLSKD  1716
             + F    E+    +  Q  S+   AE   ++ ++ Q+  +K N   + +N+ +LH LS+D
Sbjct  265   SSFVLNLENTKFGSLMQ--SNMGGAEEVLEVLNKPQNGVKKENDTANLQNDGLLHCLSRD  322

Query  1717  ELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             +++   H  G+Q+ +LW+ FL FHRA++T
Sbjct  323   DILDFLHLLGDQILHLWNAFLMFHRANKT  351



>ref|XP_010930972.1| PREDICTED: protein FAM135B-like isoform X1 [Elaeis guineensis]
Length=815

 Score =   315 bits (807),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 254/352 (72%), Gaps = 21/352 (6%)
 Frame = +1

Query  799   NSQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
             NS +ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+ + +S GTP+RVVQYEAPD 
Sbjct  37    NSPNMLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDSNRKSPGTPARVVQYEAPDV  96

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
               D+I GVW IDD D+S+ TQPFR+KYARQD+LLSV++SFNL + + E      +SAVIL
Sbjct  97    ALDDIFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMISFNLPIGEDES---PSTSAVIL  153

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL+YAPILENG  +QAS D   AAVHEFR+PPK LLGLHSYCPVHFDAFHAVLVD SV
Sbjct  154   KFELMYAPILENGSEMQASFDAVSAAVHEFRIPPKGLLGLHSYCPVHFDAFHAVLVDLSV  213

Query  1339  HICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDIL  1485
             H+  LK G +T + KV+S S   ++ + E +++  Q++          L+K  L +R++L
Sbjct  214   HVVFLKAGTYTHAQKVSSTSQMVENHADEHYEEPNQILGQGWISKAIELVKLLLASRELL  273

Query  1486  LEELRKVSKAINQAI-DVNDFS---SKHEDKDLFTSRQSTSSKDNAEVS---GQMPSQKQ  1644
             LEELR++SKAI+Q + D+N+      + E     T   STSS D A +    GQ+     
Sbjct  274   LEELRRISKAIDQTVEDLNNADLNLGRFESISSSTPDSSTSSLDIAGMKMGVGQLVGMLH  333

Query  1645  SVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             ++ +K+NG+ +F N+ +L++LSK+EL+ ++ + G+Q+  +W+ FLKFHR ++
Sbjct  334   NILEKKNGVIEFGNDVILYTLSKEELLDVYFTVGSQLSIIWNAFLKFHRINK  385



>ref|XP_010930973.1| PREDICTED: protein FAM135B-like isoform X2 [Elaeis guineensis]
Length=814

 Score =   315 bits (807),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 254/352 (72%), Gaps = 21/352 (6%)
 Frame = +1

Query  799   NSQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT  978
             NS +ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+ + +S GTP+RVVQYEAPD 
Sbjct  37    NSPNMLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDSNRKSPGTPARVVQYEAPDV  96

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
               D+I GVW IDD D+S+ TQPFR+KYARQD+LLSV++SFNL + + E      +SAVIL
Sbjct  97    ALDDIFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMISFNLPIGEDES---PSTSAVIL  153

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL+YAPILENG  +QAS D   AAVHEFR+PPK LLGLHSYCPVHFDAFHAVLVD SV
Sbjct  154   KFELMYAPILENGSEMQASFDAVSAAVHEFRIPPKGLLGLHSYCPVHFDAFHAVLVDLSV  213

Query  1339  HICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKGFLTARDIL  1485
             H+  LK G +T + KV+S S   ++ + E +++  Q++          L+K  L +R++L
Sbjct  214   HVVFLKAGTYTHAQKVSSTSQMVENHADEHYEEPNQILGQGWISKAIELVKLLLASRELL  273

Query  1486  LEELRKVSKAINQAI-DVNDFS---SKHEDKDLFTSRQSTSSKDNAEVS---GQMPSQKQ  1644
             LEELR++SKAI+Q + D+N+      + E     T   STSS D A +    GQ+     
Sbjct  274   LEELRRISKAIDQTVEDLNNADLNLGRFESISSSTPDSSTSSLDIAGMKMGVGQLVGMLH  333

Query  1645  SVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             ++ +K+NG+ +F N+ +L++LSK+EL+ ++ + G+Q+  +W+ FLKFHR ++
Sbjct  334   NILEKKNGVIEFGNDVILYTLSKEELLDVYFTVGSQLSIIWNAFLKFHRINK  385



>ref|XP_010490582.1| PREDICTED: protein FAM135B-like isoform X2 [Camelina sativa]
Length=801

 Score =   314 bits (805),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 227/344 (66%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S+ 
Sbjct  35    MVDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSNG  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    TNGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+P++E+     +  D   AA+HEFR+PPKAL G+HSYCPVHFD FHAVL+D SVHI +
Sbjct  152   LYSPVMEDVSVTHS--DASSAALHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHISI  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLASGNVQSSKKAFAQIASADNKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             EL+ +SKA+ Q +D+++F S  +   L     S S+  + EV G +  ++Q  S + N  
Sbjct  270   ELQILSKAVGQTVDLSEFISSMDSALL---SDSASTGKSVEVEGSIQGKQQD-SLELNSP  325

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  ++++LH+LSKD L   FH  G Q+ YLW+ FL FHR + T
Sbjct  326   FDLASDDLLHNLSKDHLSRTFHLLGTQLHYLWNTFLTFHRDNYT  369



>emb|CDY53830.1| BnaA09g57220D [Brassica napus]
Length=794

 Score =   313 bits (803),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 231/344 (67%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDY-ESVGTPSRVVQYEAPDTGSD  987
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  +S G PSRVVQYEA D+ S+
Sbjct  33    MVDTVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDGDNNKSCGIPSRVVQYEALDSSSN  92

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD DNS+ TQPFRIKYARQD+ L ++VSF + L +YE      +SAVIL+FE
Sbjct  93    DSSGVWKIDDKDNSFLTQPFRIKYARQDVRLCMMVSFTMPLQRYE---GPATSAVILRFE  149

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLY+PI+EN  +L  S D+ PA+VH+FR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ 
Sbjct  150   LLYSPIVEN-ISLTHSDDS-PASVHDFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVS  207

Query  1348  LLKRGVH----TLSSKVASGSCSDDASSEDFDKA--------KQVVLIKGFLTARDILLE  1491
             ++K   +     LSS  +SG      SS+   KA        K V  +K  L ARD LLE
Sbjct  208   VMKSASYKRPAVLSSDASSGKSLASGSSQSSKKAFAQIAPADKLVSFVKALLGARDTLLE  267

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++K+SKAI+Q ID+++F S   DK L +   ST      E SGQ    KQ  + +    
Sbjct  268   EMQKLSKAIDQTIDLSEFVST-MDKTLLSDSASTEKTVAVEGSGQ---GKQQNNLELKTS  323

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  324   LDLESDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNNT  367



>ref|XP_009118280.1| PREDICTED: protein FAM135B-like isoform X1 [Brassica rapa]
 ref|XP_009118281.1| PREDICTED: protein FAM135B-like isoform X1 [Brassica rapa]
Length=799

 Score =   313 bits (803),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 231/344 (67%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDY-ESVGTPSRVVQYEAPDTGSD  987
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  +S G PSRVVQYEA D+ S+
Sbjct  33    MVDTVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDGDNNKSCGIPSRVVQYEALDSSSN  92

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD DNS+ TQPFRIKYARQD+ L ++VSF + L +YE      +SAVIL+FE
Sbjct  93    DSSGVWKIDDKDNSFLTQPFRIKYARQDVRLCMMVSFTMPLQRYE---GPATSAVILRFE  149

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLY+PI+EN  +L  S D+ PA+VH+FR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ 
Sbjct  150   LLYSPIVEN-ISLTHSDDS-PASVHDFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVS  207

Query  1348  LLKRGVH----TLSSKVASGSCSDDASSEDFDKA--------KQVVLIKGFLTARDILLE  1491
             ++K   +     LSS  +SG      SS+   KA        K V  +K  L ARD LLE
Sbjct  208   VMKSASYKRPAVLSSDASSGKSLASGSSQSSKKAFAQIAPADKLVSFVKALLGARDTLLE  267

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++K+SKAI+Q ID+++F S   DK L +   ST      E SGQ    KQ  + +    
Sbjct  268   EMQKLSKAIDQTIDLSEFVST-MDKTLLSDSASTEKTVAVEGSGQ---GKQQNNLELKTS  323

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  324   LDLESDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNNT  367



>ref|XP_003603667.1| Protein FAM135A [Medicago truncatula]
 gb|AES73918.1| serine esterase family protein, putative [Medicago truncatula]
Length=757

 Score =   312 bits (800),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 230/344 (67%), Gaps = 30/344 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGD-YESVGTPSRVVQYEAPDTGSD  987
             ML+ V EIA+Y+HRFHNLDLF+QGWY+IKI +RWE+ +   S G P+RVVQYEAPD    
Sbjct  1     MLETVQEIAVYLHRFHNLDLFKQGWYRIKIKVRWEDSENINSFGIPARVVQYEAPDLDQS  60

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +I G W IDDT+NS+ TQ FRIKYARQD+ L +++SF+LS S+   L    ++ VILKFE
Sbjct  61    SIYGAWKIDDTENSFSTQTFRIKYARQDVHLCMMISFDLSRSRSMDLT---TNGVILKFE  117

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YA  LE+G +L AS    PAA+HEFR+PPKALLGLHSYCPVHFDA HAVLVD SVH+ 
Sbjct  118   LIYASTLEDGDDLDAS----PAAIHEFRIPPKALLGLHSYCPVHFDALHAVLVDVSVHVS  173

Query  1348  LLKRGVHTLSSKVA-----------SGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEE  1494
             L +   ++ +SKV             G  S D         K ++L++  LT+RD+LLEE
Sbjct  174   LRRAASYSSASKVPRRMFFVPVQRFRGVTSLD--------VKDIMLVRALLTSRDLLLEE  225

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFT-SRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             L K++KAI +AID +DF SK  + DL   + Q+     + EV  Q   + Q+  +  NG 
Sbjct  226   LHKMNKAIGEAIDTSDFVSKMNNADLINFAAQANGFAIDGEVLEQ--GKPQNGLEGGNGA  283

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  N E LHSLS+ EL+  FHS G+Q+ YLW IFLK HR ++T
Sbjct  284   QDIPNAENLHSLSQSELLNCFHSLGDQLHYLWKIFLKIHRENKT  327



>ref|XP_008339057.1| PREDICTED: protein FAM135B-like isoform X1 [Malus domestica]
Length=279

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 187/249 (75%), Gaps = 24/249 (10%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +Y SVGTP+RVVQYEAPD GSD
Sbjct  37    AMLDAVQEIAVYIHRFHNLDLFQQGWYQIKITMRWEDSEYTSVGTPARVVQYEAPDLGSD  96

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ TQPFRIKYARQD+ LS+++SFNLSL+ +E +    SS +ILKFE
Sbjct  97    DVYGVWRIDDTDNSFSTQPFRIKYARQDVFLSIMISFNLSLAGHEGIS---SSPIILKFE  153

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD SVHI 
Sbjct  154   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSVHIS  213

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDK-----------------AKQVVLIKGFLTAR  1476
             LLK   +T  SKV     SD + +ED D                     ++  K  L AR
Sbjct  214   LLKAVSYTHPSKVP----SDSSXAEDVDGEGLSGLNRASTQAAAAVVNDIIRAKSLLNAR  269

Query  1477  DILLEELRK  1503
             DILLEEL+K
Sbjct  270   DILLEELQK  278



>ref|NP_172469.2| putative serine esterase family protein [Arabidopsis thaliana]
 gb|AAL86333.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67554.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44066.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE28524.1| putative serine esterase family protein [Arabidopsis thaliana]
Length=802

 Score =   312 bits (800),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 227/344 (66%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S++
Sbjct  35    MIDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD D+S+ TQPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    SYGVWKIDDKDSSFLTQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI+E+     +  D   AAVHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ +
Sbjct  152   LYSPIMEDIPVTHS--DACAAAVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVSV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLTSGNIQSSKKAFTQIASADKKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q +D+++F S  ++  L     S S+  + EV G    + Q+  +K NG 
Sbjct  270   EMQRLSKAVGQTVDLSEFVSSMDNALL---SDSGSTGKSVEVEGSGQGKLQNNLEKLNGP  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL  HR + T
Sbjct  327   FDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTLHRDNYT  370



>ref|XP_009113319.1| PREDICTED: protein FAM135B isoform X2 [Brassica rapa]
Length=796

 Score =   312 bits (800),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 230/345 (67%), Gaps = 32/345 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V E+A+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEA ++GS+ 
Sbjct  37    MVDTVQEVAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNTTRGIPSRVVQYEALESGSN-  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+FTQPF+IKYARQD+ L +++SF L L +Y+    S +SA ILKFEL
Sbjct  96    --GVWRIDDKDNSFFTQPFQIKYARQDVRLCMMISFTLPLQRYD---GSATSAAILKFEL  150

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  L+  PAA+HEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  151   MYAPAMDNASTKQ--LEALPAAIHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  208

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LS  V++      +S++ F KA         K V+ +K  L ARDILLE
Sbjct  209   LKSAAYRRPPSLSRVVSNSKSVSGSSAQSFKKALGLLASADKKMVLFVKALLGARDILLE  268

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E+ ++S+AI ++ID+++F S   +  L              V+G    ++Q+   ++  I
Sbjct  269   EMTRLSEAIGKSIDLSEFVSDMNNVPL----------SQLPVAGSGQGKEQNSPLEKLHI  318

Query  1672  T-DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             T D  N++ LH LSKD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  319   TFDVANDDWLHELSKDHLTRLFHLLGTQLHYLWNTFLGFHRDNNT  363



>gb|AAC34330.1| Unknown protein [Arabidopsis thaliana]
Length=837

 Score =   313 bits (801),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 227/344 (66%), Gaps = 21/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S++
Sbjct  35    MIDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD D+S+ TQPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    SYGVWKIDDKDSSFLTQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI+E+     +  D   AAVHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ +
Sbjct  152   LYSPIMEDIPVTHS--DACAAAVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVSV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLTSGNIQSSKKAFTQIASADKKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q +D+++F S  ++  L     S S+  + EV G    + Q+  +K NG 
Sbjct  270   EMQRLSKAVGQTVDLSEFVSSMDNALL---SDSGSTGKSVEVEGSGQGKLQNNLEKLNGP  326

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL  HR + T
Sbjct  327   FDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTLHRDNYT  370



>emb|CDY48842.1| BnaA09g14710D [Brassica napus]
Length=798

 Score =   312 bits (799),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 229/345 (66%), Gaps = 32/345 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V E+A+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEA ++GS+ 
Sbjct  37    MVDTVQEVAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNTTRGIPSRVVQYEALESGSN-  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+FTQPF+IKYARQD+ L +++SF L L +Y+    S +SA ILKFEL
Sbjct  96    --GVWRIDDKDNSFFTQPFQIKYARQDVRLCMMISFTLPLQRYD---GSATSAAILKFEL  150

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  L+  PAA+HEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  151   MYAPAMDNASTKQ--LEALPAAIHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  208

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LS  V++      +S++ F KA         K V+ +K  L ARDILLE
Sbjct  209   LKSAAYRRPPSLSRVVSNSKSVSGSSAQSFKKALGLLASADKKMVLFVKALLGARDILLE  268

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E+ ++S+AI ++ID+++F S      L              V+G    ++Q+   ++  I
Sbjct  269   EMTRLSEAIGKSIDLSEFVSDMNSVPL----------SQLPVAGSGQGKEQNSPLEKLHI  318

Query  1672  T-DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             T D  N++ LH LSKD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  319   TFDVANDDWLHELSKDHLTRLFHLLGTQLHYLWNTFLGFHRDNNT  363



>ref|XP_006597336.1| PREDICTED: protein FAM135B-like isoform X2 [Glycine max]
Length=775

 Score =   311 bits (796),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 238/395 (60%), Gaps = 54/395 (14%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  +L W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRKLGWFV-GLNQNNLATKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IK+T+RWE+G+    G P+RVVQYEAP+ G
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKVTLRWEDGEDSYPGIPARVVQYEAPEVG  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +DN+CGVWMIDD DNS+ T  FRI+YARQD+ L++++SF LS   YE      SSAVILK
Sbjct  95    ADNLCGVWMIDDKDNSFSTPSFRIRYARQDVFLAIMISFYLSYGGYE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E    LQ+SLD   A+VHE+R+PPKALLGLHSYCPVHFDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMRPELQSSLDGCAASVHEYRIPPKALLGLHSYCPVHFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I LLK G HT   K A                           A DILL++LR++SK IN
Sbjct  211   ISLLKSGYHTPQLKAALIKALI--------------------AAHDILLDDLRRISKGIN  250

Query  1522  QAIDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             QAID+   +   +  K L ++  +     + E S Q+    Q  ++K     +   EE+ 
Sbjct  251   QAIDLTGITFEPYVTKSLNSTSPAHEKSADDEASLQLSDGTQISAEKVIQYINHVTEELC  310

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              S S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  311   QSFSWDDMLNFFQFIGNQLLYLWNTFLKFHRENKT  345



>emb|CDY22610.1| BnaC08g42440D [Brassica napus]
Length=798

 Score =   311 bits (797),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 230/344 (67%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDY-ESVGTPSRVVQYEAPDTGSD  987
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  +S G PSRVVQYEA D+ S+
Sbjct  37    MVDTVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDGDNNKSCGIPSRVVQYEALDSSSN  96

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  GVW IDD DNS+ TQPFRIKYARQD+ L ++VSF + L +YE      +SAVIL+FE
Sbjct  97    DSSGVWKIDDKDNSFLTQPFRIKYARQDVRLCMMVSFTMPLQRYE---GPATSAVILRFE  153

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLY+PI+EN  +L  S D+ PA+VH+FR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ 
Sbjct  154   LLYSPIVEN-ISLAHSDDS-PASVHDFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVS  211

Query  1348  LLKRGVH----TLSSKVASGSCSDDASSEDFDKA--------KQVVLIKGFLTARDILLE  1491
             ++K   +      SS  +SG      +S+   KA        K V  +K  L ARD LLE
Sbjct  212   VMKSASYKRPAVFSSDASSGKSLSSGNSQSSKKAFAQIAPADKLVSFVKALLGARDTLLE  271

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E+ K+SKAI+Q ID+++F S   DK L +   ST    + E SGQ    KQ  + +    
Sbjct  272   EMPKLSKAIDQTIDLSEFVST-MDKTLLSDAASTEKTVDVEGSGQ---GKQQNNLELKTS  327

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  328   LDLESDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNNT  371



>ref|XP_006851399.1| hypothetical protein AMTR_s00040p00048570 [Amborella trichopoda]
 gb|ERN12980.1| hypothetical protein AMTR_s00040p00048570 [Amborella trichopoda]
Length=810

 Score =   310 bits (794),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 236/350 (67%), Gaps = 28/350 (8%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +ML+ V EIA+YIHRFHNLDLFQQGWYQIK++MRWE+G  E  GTP+RVVQYE P+ GSD
Sbjct  38    AMLETVQEIAVYIHRFHNLDLFQQGWYQIKLSMRWEDGGRELPGTPARVVQYEVPELGSD  97

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
              I  VW IDD D+S+FTQPFRIKY RQD+LLSV++SFNL++   E    S SS+VILKFE
Sbjct  98    EIFMVWRIDDVDHSFFTQPFRIKYVRQDVLLSVMISFNLAVGIDE---SSSSSSVILKFE  154

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+API EN   LQA+LD +PAAVHE R+PPKALLGLH+YCP+HFD++HAVL++ S+H+ 
Sbjct  155   LLHAPISENESVLQAALDAFPAAVHELRVPPKALLGLHTYCPLHFDSYHAVLIELSIHVV  214

Query  1348  LLKRGVHTLSSKVASGSC-----------SDDASSEDFDKA-----KQVVLIKGFLTARD  1479
              LK G +T   KV S S              D + +  D       K++ +IK    +R 
Sbjct  215   RLKAGTNTNQKKVPSDSSLLGVVAGEHDHGKDGNYQVIDGVSYVGTKELAVIKALFASRA  274

Query  1480  ILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQK--QSVS  1653
              LLEEL+K+SKAI+Q ID  D +  + D   F +  S S +  + +     SQK  QS+ 
Sbjct  275   TLLEELQKISKAIDQKID--DLADANLD---FGTNMSISPRTRSYLKTST-SQKLEQSLG  328

Query  1654  QKRNGITDF-RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +K N    +  N  +L SLSK+ELV  F + GNQ+  +W+ FLKFHR +R
Sbjct  329   EKSNEHVGYGSNGMLLPSLSKEELVDAFQTLGNQLSVIWNAFLKFHRNNR  378



>ref|NP_001077501.1| putative serine esterase family protein [Arabidopsis thaliana]
 gb|AEE28525.1| putative serine esterase family protein [Arabidopsis thaliana]
Length=801

 Score =   309 bits (792),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 224/344 (65%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S++
Sbjct  35    MIDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD D+S+ TQPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    SYGVWKIDDKDSSFLTQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI+E+     +  D   AAVHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ +
Sbjct  152   LYSPIMEDIPVTHS--DACAAAVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVSV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLTSGNIQSSKKAFTQIASADKKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q +D+++F S   D  L +   ST      E SGQ   Q    + + NG 
Sbjct  270   EMQRLSKAVGQTVDLSEFVSS-MDNALLSDSGSTGKSVEVEGSGQGKLQN---NLELNGP  325

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL  HR + T
Sbjct  326   FDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTLHRDNYT  369



>dbj|BAF02191.1| hypothetical protein [Arabidopsis thaliana]
Length=801

 Score =   309 bits (792),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 224/344 (65%), Gaps = 22/344 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  S G PSRVVQYEA D+ S++
Sbjct  35    MIDTVQEIAIYIHRFHNLDLFQQGWYQIKISMRWEDGDNNSCGIPSRVVQYEALDSTSND  94

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD D+S+ TQPFRIKYARQD+ L ++VSF + L +YE    S +SAVILKFEL
Sbjct  95    SYGVWKIDDKDSSFLTQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILKFEL  151

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             LY+PI+E+     +  D   AAVHEFR+PPKAL G+HSYCPVHFD FHAVL+D SVH+ +
Sbjct  152   LYSPIMEDIPVTHS--DACAAAVHEFRIPPKALSGVHSYCPVHFDTFHAVLIDVSVHVSV  209

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             +K   +     LSS  ++G      + +   KA         K V  +K  L ARD LLE
Sbjct  210   MKSAAYKRPAILSSDASNGKNLTSGNIQSSKKAFTQIASADKKLVSFVKALLGARDTLLE  269

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q +D+++F S   D  L +   ST      E SGQ   Q    + + NG 
Sbjct  270   EMQRLSKAVGQTVDLSEFVSS-MDNALLSDSGSTGKSVEVEGSGQGKLQN---NLELNGP  325

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL  HR + T
Sbjct  326   FDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTLHRDNYT  369



>ref|XP_009113318.1| PREDICTED: protein FAM135B isoform X1 [Brassica rapa]
Length=797

 Score =   309 bits (791),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 227/346 (66%), Gaps = 33/346 (10%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V E+A+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEA ++GS+ 
Sbjct  37    MVDTVQEVAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNTTRGIPSRVVQYEALESGSN-  95

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+FTQPF+IKYARQD+ L +++SF L L +Y+    S +SA ILKFEL
Sbjct  96    --GVWRIDDKDNSFFTQPFQIKYARQDVRLCMMISFTLPLQRYD---GSATSAAILKFEL  150

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  L+  PAA+HEFR+PPKAL GLHSYCPVHFD  HAVLVD SVHI +
Sbjct  151   MYAPAMDNASTKQ--LEALPAAIHEFRIPPKALTGLHSYCPVHFDTLHAVLVDVSVHISV  208

Query  1351  LKRGVHTLSSKV-----ASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILL  1488
             LK   +     +     ++      +S++ F KA         K V+ +K  L ARDILL
Sbjct  209   LKSAAYRRPPSLSSRVVSNSKSVSGSSAQSFKKALGLLASADKKMVLFVKALLGARDILL  268

Query  1489  EELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EE+ ++S+AI ++ID+++F S   +  L              V+G    ++Q+   ++  
Sbjct  269   EEMTRLSEAIGKSIDLSEFVSDMNNVPL----------SQLPVAGSGQGKEQNSPLEKLH  318

Query  1669  IT-DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             IT D  N++ LH LSKD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  319   ITFDVANDDWLHELSKDHLTRLFHLLGTQLHYLWNTFLGFHRDNNT  364



>emb|CDY42051.1| BnaC09g15360D [Brassica napus]
Length=812

 Score =   309 bits (792),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 226/344 (66%), Gaps = 30/344 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             M+D V E+A+YIHRFHNLDLFQQGWYQIKITMRWE+GD  + G PSRVVQYEA ++GS+ 
Sbjct  58    MVDTVQEVAIYIHRFHNLDLFQQGWYQIKITMRWEDGDNATRGIPSRVVQYEALESGSN-  116

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               GVW IDD DNS+FTQPF+IKYARQD+ L +++SF L L +Y+    S +SA ILKFEL
Sbjct  117   --GVWRIDDKDNSFFTQPFQIKYARQDVRLCMMISFTLPLQRYD---GSATSAAILKFEL  171

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP ++N    Q  L+  PAA+HEFR+PPKAL G+HSYCPVHFD  HAVLVD SVHI +
Sbjct  172   MYAPAMDNSSTRQ--LEALPAAIHEFRIPPKALTGVHSYCPVHFDTLHAVLVDVSVHISV  229

Query  1351  LKRGVH----TLSSKVASGSCSDDASSEDFDKA---------KQVVLIKGFLTARDILLE  1491
             LK   +    +LS  V++      +S++ F KA         K V  +K  L ARDILLE
Sbjct  230   LKSAAYRRPPSLSRVVSNSKSVSGSSAQSFKKALGLLASADKKMVSFVKALLGARDILLE  289

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E+ ++ +AI ++ID++DF S   +  L        S+     SGQ   Q   + +K    
Sbjct  290   EMTRLGEAIGKSIDLSDFVSDMNNVPL--------SQSAVPGSGQGKEQNSPL-EKLQIT  340

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ LH LSKD L  LFH  G Q+ YLW+ FL FHR + T
Sbjct  341   FDLTSDDWLHELSKDHLTRLFHLLGTQLHYLWNTFLGFHRDNNT  384



>ref|XP_007137278.1| hypothetical protein PHAVU_009G113900g [Phaseolus vulgaris]
 gb|ESW09272.1| hypothetical protein PHAVU_009G113900g [Phaseolus vulgaris]
Length=746

 Score =   307 bits (786),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 226/348 (65%), Gaps = 26/348 (7%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAP-DT  978
             S++ LD V EIA+Y+HRFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYE P D 
Sbjct  9     SEASLDTVQEIAVYLHRFHNLDLFKQGWYRIKITVRWEDSENVSFGIPASVVQYEVPPDL  68

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
                NI GVW IDDTDNS+ TQ FRIKYARQD+ L ++  FNL  +K   L    ++AVIL
Sbjct  69    DPSNIYGVWRIDDTDNSFSTQSFRIKYARQDVHLYLMTVFNLPRNKLVDLA---TAAVIL  125

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL+YAP+ E+G +L+  LD   A++HEFR+PPKAL+GLHSYCPVHFD  HAVLVD SV
Sbjct  126   KFELIYAPMTEHGVDLELPLDASCASIHEFRIPPKALVGLHSYCPVHFDTLHAVLVDVSV  185

Query  1339  HICLLKRGVHTLSSKVASGSCSD----DASSEDFDKA---------KQVVLIKGFLTARD  1479
             H  +LK   H+ +SK+ S S +     D +S+  +K          +  +L+K  L +RD
Sbjct  186   HASILKVASHSSASKLPSNSANTEVVVDTNSDTVNKGSGEVASLDVRNAMLVKALLASRD  245

Query  1480  ILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQK  1659
             IL EEL+K+ KA+N A+D +DF S         S     +    EV GQ     Q+  + 
Sbjct  246   ILFEELQKIGKAVNVALDFSDFVS-------IVSNMKQENPLANEVVGQ--GTPQNGLKG  296

Query  1660  RNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              N   D  + E L SLS++EL+  FHS G+Q+ YLW  FLKFHR ++T
Sbjct  297   GNEDLDLLDVEKLCSLSQNELMDCFHSLGDQLSYLWKTFLKFHRDNKT  344



>ref|XP_007137277.1| hypothetical protein PHAVU_009G113900g [Phaseolus vulgaris]
 gb|ESW09271.1| hypothetical protein PHAVU_009G113900g [Phaseolus vulgaris]
Length=766

 Score =   307 bits (786),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 226/348 (65%), Gaps = 26/348 (7%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAP-DT  978
             S++ LD V EIA+Y+HRFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYE P D 
Sbjct  9     SEASLDTVQEIAVYLHRFHNLDLFKQGWYRIKITVRWEDSENVSFGIPASVVQYEVPPDL  68

Query  979   GSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
                NI GVW IDDTDNS+ TQ FRIKYARQD+ L ++  FNL  +K   L    ++AVIL
Sbjct  69    DPSNIYGVWRIDDTDNSFSTQSFRIKYARQDVHLYLMTVFNLPRNKLVDLA---TAAVIL  125

Query  1159  KFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASV  1338
             KFEL+YAP+ E+G +L+  LD   A++HEFR+PPKAL+GLHSYCPVHFD  HAVLVD SV
Sbjct  126   KFELIYAPMTEHGVDLELPLDASCASIHEFRIPPKALVGLHSYCPVHFDTLHAVLVDVSV  185

Query  1339  HICLLKRGVHTLSSKVASGSCSD----DASSEDFDKA---------KQVVLIKGFLTARD  1479
             H  +LK   H+ +SK+ S S +     D +S+  +K          +  +L+K  L +RD
Sbjct  186   HASILKVASHSSASKLPSNSANTEVVVDTNSDTVNKGSGEVASLDVRNAMLVKALLASRD  245

Query  1480  ILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQK  1659
             IL EEL+K+ KA+N A+D +DF S         S     +    EV GQ     Q+  + 
Sbjct  246   ILFEELQKIGKAVNVALDFSDFVS-------IVSNMKQENPLANEVVGQ--GTPQNGLKG  296

Query  1660  RNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              N   D  + E L SLS++EL+  FHS G+Q+ YLW  FLKFHR ++T
Sbjct  297   GNEDLDLLDVEKLCSLSQNELMDCFHSLGDQLSYLWKTFLKFHRDNKT  344



>emb|CDY57934.1| BnaA06g38020D [Brassica napus]
Length=785

 Score =   305 bits (782),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 225/343 (66%), Gaps = 31/343 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYE-SVGTPSRVVQYEAPDTGSD  987
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD   S G PSRVVQYEA D  S+
Sbjct  37    MVDTVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDGDNNNSSGIPSRVVQYEALDATSN  96

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
                GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVIL+FE
Sbjct  97    ESSGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILRFE  153

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLY+PI+E       S+D +PAA H+FR+PPKAL GLHSYCPVHFD  HAVL+D SVH+ 
Sbjct  154   LLYSPIIE-------SIDAFPAAAHDFRIPPKALSGLHSYCPVHFDTLHAVLIDVSVHVS  206

Query  1348  LLKRGVH----TLSS------KVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEEL  1497
             ++K   +     LSS       +ASGS          DK K V  +K  L ARD LL+E+
Sbjct  207   VMKSAAYKRPAVLSSDSSNGKNLASGSVQSSKKIASADK-KLVSFVKSLLEARDTLLQEM  265

Query  1498  RKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITD  1677
             +++SKA+ Q ID+++F S  ++  L        S ++ E SGQ   ++Q+  +K N   D
Sbjct  266   QRLSKAVGQTIDLSEFVSTMDNTLL------PESAEDEEGSGQ--GKQQNNLEKLNSPFD  317

Query  1678  FRN-EEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               N +E L + SK+ L   FH  G Q+ +LW+ FL FHR + T
Sbjct  318   LENDDEWLRNFSKEHLSRTFHLLGTQLHHLWNTFLAFHRENNT  360



>ref|XP_009148317.1| PREDICTED: protein FAM135B-like [Brassica rapa]
 ref|XP_009148318.1| PREDICTED: protein FAM135B-like [Brassica rapa]
Length=790

 Score =   305 bits (781),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 224/343 (65%), Gaps = 31/343 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGD-YESVGTPSRVVQYEAPDTGSD  987
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD   S G PSRVVQYEA D  S+
Sbjct  37    MVDTVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDGDNSSSSGIPSRVVQYEALDATSN  96

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
                GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L +YE    S +SAVIL+FE
Sbjct  97    ESSGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERYE---GSATSAVILRFE  153

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LLY+PI+E       S+D +PAA H+FR+PPKAL GLHSYCPVHFD  HAVL+D SVH+ 
Sbjct  154   LLYSPIIE-------SIDAFPAAAHDFRIPPKALSGLHSYCPVHFDTLHAVLIDVSVHVS  206

Query  1348  LLKRGVH----TLSS------KVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEEL  1497
             ++K   +     LSS       +ASGS          DK K V  +K  L ARD LLEE+
Sbjct  207   VMKSAAYKRPAVLSSDSSNGKNLASGSVQSSKKIASADK-KLVSFVKSLLEARDTLLEEM  265

Query  1498  RKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITD  1677
             +++SKA+ Q ID+++F S  ++  L          ++ E  GQ   ++Q+  +K N   D
Sbjct  266   QRLSKAVGQTIDLSEFVSTMDNTLL------PEPVEDEEGLGQ--GKQQNNLEKLNSPFD  317

Query  1678  FRN-EEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               N +E LH+ SK+ L   FH  G Q+ +LW+ FL FHR + T
Sbjct  318   LENDDEWLHNFSKEHLSRTFHLLGTQLHHLWNTFLAFHRENNT  360



>ref|XP_007148461.1| hypothetical protein PHAVU_006G210700g [Phaseolus vulgaris]
 gb|ESW20455.1| hypothetical protein PHAVU_006G210700g [Phaseolus vulgaris]
Length=779

 Score =   304 bits (778),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 176/395 (45%), Positives = 238/395 (60%), Gaps = 50/395 (13%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             + +RL W + GLN+    T + LN+ +    RP                       NH+ 
Sbjct  1     MFQRLGWFV-GLNQTNLSTKRLLNAHQPPSGRP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IK+TMRWE+      G P+RVVQYEAP+  
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKVTMRWEDDADSYPGIPARVVQYEAPEVT  94

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             ++N CGVWMIDD DNS+ T  FRI+YARQD+ LS+++SF LS   +E      SSAVILK
Sbjct  95    TENFCGVWMIDDKDNSFSTPSFRIRYARQDVFLSIMISFYLSYGVHE----GKSSAVILK  150

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL + P  E G  +Q+SLDT  A+VHE+R+PPKALLGLHSYCPV+FDAFHAVLVD SVH
Sbjct  151   FELFHTPTPEMGPEIQSSLDTCAASVHEYRIPPKALLGLHSYCPVYFDAFHAVLVDTSVH  210

Query  1342  ICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             I LLK G HT   KV S S  S +   ED+ +  +  ++K    A DIL+++L ++S+ I
Sbjct  211   ISLLKSGYHTPQLKVPSNSLASKETCREDYLRLNKAAVVKELRAAHDILVDDLIRISRGI  270

Query  1519  NQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVL  1698
             NQAID+   + + +      S      K   + +    S    +S +             
Sbjct  271   NQAIDLAGINFELDGTKSLNSPSPAHYKSTDDETSLQLSDGTKISAE-------------  317

Query  1699  HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                S D+++  F S GNQ+ ++W+ FLKFHR ++T
Sbjct  318   ---SWDDMLKPFQSVGNQLLHIWNTFLKFHRENKT  349



>ref|XP_004172147.1| PREDICTED: protein FAM135B-like, partial [Cucumis sativus]
Length=239

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLD V EIA+YIHRFHNLDLFQQGWYQIK+TMRWE+ +Y SVGTP+RVVQYEAPD GS 
Sbjct  35    AMLDTVQEIAIYIHRFHNLDLFQQGWYQIKLTMRWEDSEYTSVGTPARVVQYEAPDLGSG  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             N  GVW IDDTDNS+ TQPF+IKYARQDILLS+++SFN  L KYE      +SAVILKFE
Sbjct  95    NSYGVWKIDDTDNSFSTQPFKIKYARQDILLSIMISFNFPLVKYEA---PSTSAVILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             L+YAPILE G  LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD S+HIC
Sbjct  152   LMYAPILEAGPELQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSIHIC  211

Query  1348  LLK  1356
             LL+
Sbjct  212   LLR  214



>ref|XP_008339058.1| PREDICTED: protein FAM135B-like isoform X2 [Malus domestica]
Length=225

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 164/192 (85%), Gaps = 3/192 (2%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ +Y SVGTP+RVVQYEAPD GSD
Sbjct  37    AMLDAVQEIAVYIHRFHNLDLFQQGWYQIKITMRWEDSEYTSVGTPARVVQYEAPDLGSD  96

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDDTDNS+ TQPFRIKYARQD+ LS+++SFNLSL+ +E +    SS +ILKFE
Sbjct  97    DVYGVWRIDDTDNSFSTQPFRIKYARQDVFLSIMISFNLSLAGHEGIS---SSPIILKFE  153

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD SVHI 
Sbjct  154   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDAFHAVLVDVSVHIS  213

Query  1348  LLKRGVHTLSSK  1383
             LLK   +T  SK
Sbjct  214   LLKAVSYTHPSK  225



>ref|XP_004977307.1| PREDICTED: protein FAM135B-like isoform X1 [Setaria italica]
Length=811

 Score =   293 bits (750),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 222/338 (66%), Gaps = 20/338 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G  ++  +P+RVVQYEA D G+D+
Sbjct  56    VMETVHEVAIYIHRFHNLDLFQQGWYQMKISAMWEEGGNKTPASPARVVQYEASDVGADD  115

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  S+ E      +SAV+LKFEL
Sbjct  116   ALGIWKIDDVDNSFYTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASAVMLKFEL  172

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP L+NG  LQAS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH+VLVD ++HI  
Sbjct  173   IYAPTLDNGSELQASSVTSSAAVHEFRIPRRALLGLHSYCPVHFDAFHSVLVDLTLHIVY  232

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             LK G    S KV        +            ++K  LT+R +LLEEL+K+S AI + I
Sbjct  233   LKAGATKPSLKVPDEGLGPVSYH----------IVKALLTSRKMLLEELKKISDAIGKRI  282

Query  1531  DVNDFS----SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDFRNE  1689
             D  D +     K+E  +   S    SSK      +  GQ+        ++ N + +   +
Sbjct  283   DDLDGADLNLGKYEPVNPSNSGLPNSSKVFPATGKGVGQLAGILHDFLERPNDVVNGTED  342

Query  1690  EVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              +L++L K+EL+ LF +   Q+  LW+ FLKFHRA++T
Sbjct  343   SMLYALPKEELLELFLTVSGQLSLLWNAFLKFHRANKT  380



>emb|CDY62730.1| BnaC05g49220D [Brassica napus]
Length=786

 Score =   290 bits (743),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 168/344 (49%), Positives = 226/344 (66%), Gaps = 32/344 (9%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGT---PSRVVQYEAPDTG  981
             M+D V EIA+YIHRFHNLDLFQQGWYQIKI+MRWE+GD  +  +   PSRVVQYEA D+ 
Sbjct  37    MVDTVQEIAVYIHRFHNLDLFQQGWYQIKISMRWEDGDNNNNNSSGIPSRVVQYEALDST  96

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             S++  GVW IDD DNS+ +QPFRIKYARQD+ L ++VSF + L ++E    S +SAVIL+
Sbjct  97    SNDTSGVWKIDDKDNSFLSQPFRIKYARQDVRLCMMVSFTMPLERFE---GSATSAVILR  153

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FELLY+PI+E       S+D + AA H+FR+PPKAL GLHSYCPVHFD  HAVL+D SVH
Sbjct  154   FELLYSPIIE-------SIDAFHAAAHDFRVPPKALSGLHSYCPVHFDTLHAVLIDVSVH  206

Query  1342  ICLLKRGVH----TLSS------KVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLE  1491
             + ++K   +     LSS       +ASGS          DK K V  +K  L ARD LL+
Sbjct  207   VSVMKSAAYKRPAVLSSDASNGKNLASGSVQSSKKIASADK-KLVSFVKSLLEARDTLLQ  265

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGI  1671
             E++++SKA+ Q ID+++F S  ++  L        S ++ E SGQ   ++Q+  +K N  
Sbjct  266   EMQRLSKAVGQTIDLSEFVSTMDNTLL------PESAEDEEGSGQ--GKQQNNLEKLNNP  317

Query  1672  TDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              D  +++ L + SK+ L   FH  G Q+ +LW+ FL FHR + T
Sbjct  318   FDLESDDWLRNFSKEHLSRTFHLLGTQLHHLWNTFLAFHRENNT  361



>ref|XP_003578866.1| PREDICTED: protein FAM135B-like isoform X1 [Brachypodium distachyon]
Length=810

 Score =   288 bits (736),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 224/340 (66%), Gaps = 23/340 (7%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENG--DYESVGTPSRVVQYEAPDTGS  984
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G    ++  +P+RVVQYEAPD G+
Sbjct  54    VMETVHEVAVYIHRFHNLDLFQQGWYQMKISAMWEEGASGGKTPASPARVVQYEAPDVGA  113

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
             D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  ++ E   +S   AVILK+
Sbjct  114   DDALGIWKIDDADNSFYTQPFRIKYARQDIYLSVMVSFNIFNTEEEGPAVS---AVILKY  170

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP LENG ++Q S  T  AAVHEFR+P KALLGLH+YCPVHFDAFHAVLVD ++HI
Sbjct  171   ELIYAPTLENGSDIQGSSVTSSAAVHEFRIPRKALLGLHTYCPVHFDAFHAVLVDLTLHI  230

Query  1345  CLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQ  1524
               LK G +  S K+        +            ++K  LT+R++LLEEL+K+S A+ +
Sbjct  231   VYLKAGANKSSLKIPEQGLHPASHH----------IVKALLTSREMLLEELKKISDAVGK  280

Query  1525  AI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDFR  1683
              I   DV D +  K+E      S    S K      +  G +        ++ NG+ D  
Sbjct  281   TIEDLDVTDLNLGKYESLQPPKSVLPDSGKVFPVTTKGVGHLAGILHDFLERPNGVVD-G  339

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               ++L++LS +EL+ LF +  +Q+  LW+ FLKFHR ++T
Sbjct  340   TSDMLYTLSNEELLELFLTVSSQLSLLWNTFLKFHRINKT  379



>ref|XP_006663851.1| PREDICTED: protein FAM135B-like [Oryza brachyantha]
Length=811

 Score =   287 bits (734),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 223/341 (65%), Gaps = 20/341 (6%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S  +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G  ++  +P+RVVQYEAPD G
Sbjct  53    SPDVMETVHEVAIYIHRFHNLDLFQQGWYQMKISATWEEGGAKAPASPARVVQYEAPDVG  112

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  S+ E      +S++ILK
Sbjct  113   ADDALGIWKIDDADNSFYTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASSIILK  169

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP LENG ++QAS  T  AAVHEFR+P +ALLG HSYCPVHFDAFH+VLVD ++H
Sbjct  170   FELIYAPTLENGSDIQASSATSSAAVHEFRVPRRALLGSHSYCPVHFDAFHSVLVDLTLH  229

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I  LK G    S K+        +            ++K  LT+R++LLEEL+K+S AI 
Sbjct  230   IVYLKAGAAKSSLKIPDQGLGPTSHH----------IVKALLTSREMLLEELKKISDAIG  279

Query  1522  QAI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDF  1680
             + I   D  D S  K+E      S    S+K      +  G +        +K N   D 
Sbjct  280   KTIEDLDAADLSLGKYEAVQPAKSALPNSNKVFPATTKGVGHLAGILHDFLEKPNSAVDG  339

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              N+ +L++L K+EL+ LF +  +Q+  LW+ FLKFHR ++T
Sbjct  340   ANDVMLYTLPKEELLELFLTVSSQLSLLWNAFLKFHRINKT  380



>gb|EAY82379.1| hypothetical protein OsI_37591 [Oryza sativa Indica Group]
Length=806

 Score =   285 bits (729),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 223/341 (65%), Gaps = 20/341 (6%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S  +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G  ++  +P+RVVQYEA D G
Sbjct  54    SPDVMETVHEVAIYIHRFHNLDLFQQGWYQMKISATWEEGGSKTPASPARVVQYEASDVG  113

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  S+ E      +S+VILK
Sbjct  114   ADDALGIWKIDDADNSFYTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASSVILK  170

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP LENG ++QAS  T  AAVHEFR+P +ALLG HSYCPVHFDAFH+VLVD ++H
Sbjct  171   FELIYAPTLENGSDIQASSATSSAAVHEFRVPRRALLGSHSYCPVHFDAFHSVLVDLTLH  230

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I  LK G    S K+        +            ++K  LT+R++LLEEL+K+S AI 
Sbjct  231   IVYLKAGATKSSLKIPDQGLGPTSHH----------IVKALLTSREMLLEELKKISDAIG  280

Query  1522  QAI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDF  1680
             + +   DV D S  K+E      S    S+K      +  G +        +K N   D 
Sbjct  281   KTVEDLDVADLSLGKYEAVQPAKSGLPNSNKVFPATTKGVGHLAGILHDFLEKPNSAVDG  340

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              N+ +L++L K+EL+ LF +  +Q+  LW+ FLKFHR ++T
Sbjct  341   ANDAMLYTLPKEELLELFLTVSSQLSLLWNAFLKFHRINKT  381



>gb|ABA95883.1| ZW18 protein, putative, expressed [Oryza sativa Japonica Group]
Length=811

 Score =   285 bits (728),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 223/341 (65%), Gaps = 20/341 (6%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S  +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G  ++  +P+RVVQYEA D G
Sbjct  54    SPDVMETVHEVAIYIHRFHNLDLFQQGWYQMKISATWEEGGSKTPASPARVVQYEASDVG  113

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  S+ E      +S+VILK
Sbjct  114   ADDALGIWKIDDADNSFYTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASSVILK  170

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL+YAP LENG ++QAS  T  AAVHEFR+P +ALLG HSYCPVHFDAFH+VLVD ++H
Sbjct  171   FELIYAPTLENGSDIQASSATSSAAVHEFRVPRRALLGSHSYCPVHFDAFHSVLVDLTLH  230

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I  LK G    S K+        +            ++K  LT+R++LLEEL+K+S AI 
Sbjct  231   IVYLKAGATKSSLKIPDQGLGPTSHH----------IVKALLTSREMLLEELKKISDAIG  280

Query  1522  QAI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDF  1680
             + +   DV D S  K+E      S    S+K      +  G +        +K N   D 
Sbjct  281   KTVEDLDVADLSLGKYEAVQPAKSGLPNSNKVFPATTKGVGHLAGILHDFLEKPNSAVDG  340

Query  1681  RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              N+ +L++L K+EL+ LF +  +Q+  LW+ FLKFHR ++T
Sbjct  341   ANDAMLYTLPKEELLELFLTVSSQLSLLWNAFLKFHRINKT  381



>ref|XP_002442863.1| hypothetical protein SORBIDRAFT_08g004040 [Sorghum bicolor]
 gb|EES16701.1| hypothetical protein SORBIDRAFT_08g004040 [Sorghum bicolor]
Length=811

 Score =   285 bits (728),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/340 (49%), Positives = 227/340 (67%), Gaps = 20/340 (6%)
 Frame = +1

Query  805   QSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGS  984
             + +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G +++  +P+RVVQYEA D G+
Sbjct  54    RDVMETVHEVAIYIHRFHNLDLFQQGWYQMKISAMWEEGGHKTPASPARVVQYEASDVGA  113

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
             D+  G+W IDD DNS+ TQPFRIKYARQDI LSV+VSFN+  S+ EV     +SAV+LKF
Sbjct  114   DDALGIWRIDDADNSFHTQPFRIKYARQDIYLSVMVSFNIVNSEEEV---PAASAVMLKF  170

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP L+NG  LQAS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH+VLVD ++HI
Sbjct  171   ELIYAPTLDNGSELQASSVTSSAAVHEFRIPRRALLGLHSYCPVHFDAFHSVLVDLTLHI  230

Query  1345  CLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQ  1524
               LK G    S KV        + +          ++K  LT+R +LLEEL K+S AI +
Sbjct  231   VYLKAGAIKSSLKVPDQGLGPTSYN----------IVKALLTSRKMLLEELNKISGAIGK  280

Query  1525  AI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDFR  1683
             A+   DV D +  K+E  +   S  S SSK      +  GQ+        ++ N + +  
Sbjct  281   AVEDLDVADLNLGKYESFNASKSGLSNSSKVFPTTGKGVGQLAGILHDFLERPNDMVNGT  340

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             ++ +L++L ++EL  LF +  +Q+  LW+ FLKFHR ++T
Sbjct  341   DDSMLYTLPQEELFELFLTLSSQLSLLWNAFLKFHRLNKT  380



>dbj|BAJ96339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   284 bits (726),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 164/339 (48%), Positives = 222/339 (65%), Gaps = 22/339 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGS  984
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI++ WE G+  S    +P+RVVQYEAPD G+
Sbjct  52    VMETVHEVAVYIHRFHNLDLFQQGWYQMKISLMWEEGESGSKTPASPARVVQYEAPDVGA  111

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
             D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+     E      +SAVILK+
Sbjct  112   DDALGIWRIDDADNSFYTQPFRIKYARQDIYLSVMVSFNILNGAEE---GPAASAVILKY  168

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP LENG ++Q+S  T  AAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD ++HI
Sbjct  169   ELIYAPTLENGSDIQSSSATSSAAVHEFRIPRKALLGLHSYCPVHFDAFHAVLVDLTLHI  228

Query  1345  CLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQ  1524
               LK G +  S K+        A            ++K  LT+R++LLEEL+K+S A+ +
Sbjct  229   VYLKAGANKSSLKIPDQGLRPTAHQ----------IVKALLTSREMLLEELKKISGAVGK  278

Query  1525  AI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDFR  1683
              I   D  DFS  K+E           S K      +  G +        ++ N + D  
Sbjct  279   TIEDLDDADFSLGKYESLQSSKPVHPDSGKVFPVTTKGVGHLAGILHDFLERPNDVVDGT  338

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             ++ +L++LS +EL+ LF +  +Q+  LW+ FLKFHR ++
Sbjct  339   SDGMLYTLSSEELLELFITVSSQLSLLWNAFLKFHRINK  377



>gb|EMS45160.1| hypothetical protein TRIUR3_28212 [Triticum urartu]
Length=727

 Score =   281 bits (720),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 226/346 (65%), Gaps = 34/346 (10%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGS  984
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G+  S    +P+RVVQYEAPD G+
Sbjct  53    VMETVHEVAVYIHRFHNLDLFQQGWYQMKISAMWEEGESGSKTPASPARVVQYEAPDVGA  112

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
             D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+   + E      +SAVILK+
Sbjct  113   DDALGIWRIDDADNSFYTQPFRIKYARQDIYLSVMVSFNILNGEQE---GPAASAVILKY  169

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP LENG ++Q+S  T  AAVHEFR+P KALLGLHSYCPVHFDAFHAVLVD ++HI
Sbjct  170   ELIYAPTLENGSDIQSSSATSSAAVHEFRIPRKALLGLHSYCPVHFDAFHAVLVDLTLHI  229

Query  1345  CLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQ  1524
               LK G +  S K+        +            +IK  L +R++LLEEL+K+  A+ +
Sbjct  230   VYLKAGANKSSLKIPDQGLRPTSHH----------IIKALLASREMLLEELKKIGGAVGK  279

Query  1525  AIDVNDFSSKHEDKDLFTSRQST--SSKDNAEVSGQM-PSQKQSVS----------QKRN  1665
              I+  D      D DL   +  +   SK     SG++ P   + V           ++ N
Sbjct  280   TIEDLD------DADLSLGKYESLQPSKPAHPDSGKVFPVTTKGVGHLAGILHDFLERPN  333

Query  1666  GITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              + D  ++ +L++LS +EL+ LF +  +Q+ +LW+ FLKFHR ++T
Sbjct  334   DVVDGTSDGMLYTLSSEELLELFVTVSSQLSFLWNAFLKFHRINKT  379



>gb|KDP41550.1| hypothetical protein JCGZ_15957 [Jatropha curcas]
Length=742

 Score =   280 bits (717),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 201/344 (58%), Gaps = 49/344 (14%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDT--GS  984
             M D V +IA+YIHRFHNLDLFQQG+YQIK+TMRWE+ +Y S+GTP+RVVQYE PD   G 
Sbjct  1     MWDTVQQIAIYIHRFHNLDLFQQGFYQIKVTMRWEDSEYASIGTPARVVQYEGPDAIKGG  60

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
                CG      T +  FT                               +  +SAVILKF
Sbjct  61    AFFCG-----STTSKLFT----------------------------TWVVPSTSAVILKF  87

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             ELL API EN   L A L+    AVHEFR+PPKAL GLHSYCP+HFD FHAVLV+ASVH+
Sbjct  88    ELLQAPITENRLELLAYLEASSVAVHEFRIPPKALFGLHSYCPIHFDIFHAVLVEASVHV  147

Query  1345  CLLKRGVHTLSS------KVASGSCSDD-----ASSEDFDKAKQVVLIKGFLTARDILLE  1491
              LLK G H   S      +   G   D+      +S  F    +++LIK  L ARD LLE
Sbjct  148   SLLKAGSHAHKSSDPYHLEDVPGESIDERPNQALASVSFVAMNKIMLIKTLLVARDTLLE  207

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTS-RQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
             EL+++SKAI Q ID  DF+SK  D ++  S R++       EV G+     Q+  +K NG
Sbjct  208   ELQRLSKAIAQVIDFTDFTSKMNDINMLDSIRRADLGTAKGEVGGR--GSLQNGLEKANG  265

Query  1669  ITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             I DF  +++ + LS D L  +FH  G Q+ YLWS FL+FHR ++
Sbjct  266   IPDFEGDKLQYILSNDALENIFHLLGTQLSYLWSTFLQFHRTNK  309



>ref|XP_008378680.1| PREDICTED: protein FAM135B-like isoform X5 [Malus domestica]
Length=329

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 171/215 (80%), Gaps = 4/215 (2%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             +MLDAV E+A+YIHRFHNLDLFQQGWYQIKITMRW++ +Y SVGTP+RVVQYEA D GSD
Sbjct  35    AMLDAVQEVAIYIHRFHNLDLFQQGWYQIKITMRWQDSEYTSVGTPARVVQYEASDLGSD  94

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             ++ GVW IDD+DNS+ +QPFRIKYARQD+ LS+++SFNLSL+  E +    SS +ILKFE
Sbjct  95    DVYGVWRIDDSDNSFSSQPFRIKYARQDVFLSIMISFNLSLAGLEGIS---SSPIILKFE  151

Query  1168  LLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             LL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAVLVD SVHI 
Sbjct  152   LLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAVLVDVSVHIS  211

Query  1348  LLKRGVHTLSSKVASGSCS-DDASSEDFDKAKQVV  1449
             LLK   +T   KV S S + ++  +E    + Q +
Sbjct  212   LLKAVSYTHPLKVPSDSSTPENVGTEGXSGSNQCI  246



>tpg|DAA55595.1| TPA: hypothetical protein ZEAMMB73_390128 [Zea mays]
Length=720

 Score =   273 bits (699),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 217/338 (64%), Gaps = 20/338 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G   +  +P+RVVQYEA D G D+
Sbjct  55    VMETVHEVAIYIHRFHNLDLFQQGWYQMKISALWEEGGNRTPASPARVVQYEASDVGGDD  114

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDD DNS+ TQPFRIKYARQDI LSV+VSFN+  S+ E      +S V++KFEL
Sbjct  115   ALGIWKIDDIDNSFHTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASDVMMKFEL  171

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP L+NG  L AS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH+VLVD ++HI  
Sbjct  172   IYAPTLDNGSELHASSATSSAAVHEFRIPHRALLGLHSYCPVHFDAFHSVLVDLTLHIVY  231

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             LK G    S KV           E   +     ++K  LT+R +LLEEL K+S AI + +
Sbjct  232   LKAGAAKSSLKVP----------EQGLRPTSYHIVKALLTSRKMLLEELNKISGAIGKTV  281

Query  1531  ---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDFRNE  1689
                DV D +  K+E  +   S    SSK   +  +  GQ+        ++ N + +  ++
Sbjct  282   EDLDVADLNLGKYESFNPSKSWLPNSSKVFPETGKGVGQLAGILHDFLERPNDMVNGTDD  341

Query  1690  EVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              +L++L  +EL  LF +   Q+  LW+ FLKFHR ++T
Sbjct  342   SLLYTLPHEELFELFLTLSGQLSLLWNAFLKFHRLNKT  379



>ref|XP_008674445.1| PREDICTED: protein FAM135B-like isoform X1 [Zea mays]
 tpg|DAA55594.1| TPA: hypothetical protein ZEAMMB73_390128 [Zea mays]
Length=809

 Score =   273 bits (698),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 217/338 (64%), Gaps = 20/338 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G   +  +P+RVVQYEA D G D+
Sbjct  55    VMETVHEVAIYIHRFHNLDLFQQGWYQMKISALWEEGGNRTPASPARVVQYEASDVGGDD  114

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDD DNS+ TQPFRIKYARQDI LSV+VSFN+  S+ E      +S V++KFEL
Sbjct  115   ALGIWKIDDIDNSFHTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASDVMMKFEL  171

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP L+NG  L AS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH+VLVD ++HI  
Sbjct  172   IYAPTLDNGSELHASSATSSAAVHEFRIPHRALLGLHSYCPVHFDAFHSVLVDLTLHIVY  231

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             LK G    S KV           E   +     ++K  LT+R +LLEEL K+S AI + +
Sbjct  232   LKAGAAKSSLKVP----------EQGLRPTSYHIVKALLTSRKMLLEELNKISGAIGKTV  281

Query  1531  ---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITDFRNE  1689
                DV D +  K+E  +   S    SSK   +  +  GQ+        ++ N + +  ++
Sbjct  282   EDLDVADLNLGKYESFNPSKSWLPNSSKVFPETGKGVGQLAGILHDFLERPNDMVNGTDD  341

Query  1690  EVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              +L++L  +EL  LF +   Q+  LW+ FLKFHR ++T
Sbjct  342   SLLYTLPHEELFELFLTLSGQLSLLWNAFLKFHRLNKT  379



>gb|EAZ19756.1| hypothetical protein OsJ_35335 [Oryza sativa Japonica Group]
Length=807

 Score =   265 bits (678),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 219/342 (64%), Gaps = 21/342 (6%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S  +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G  ++  +P+RVVQYEA D G
Sbjct  54    SPDVMETVHEVAIYIHRFHNLDLFQQGWYQMKISATWEEGGSKTPASPARVVQYEASDVG  113

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
             +D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  S+ E      +S+VILK
Sbjct  114   ADDALGIWKIDDADNSFYTQPFRIKYARQDIYLSVMVSFNIFNSEEE---GPAASSVILK  170

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSY-CPVHFDAFHAVLVDASV  1338
             FEL+YAP LENG ++QAS  T  AAVHEFR+P +ALLG  ++    HFDAFH+VLVD ++
Sbjct  171   FELIYAPTLENGSDIQASSATSSAAVHEFRVPRRALLGFTTHIVQFHFDAFHSVLVDLTL  230

Query  1339  HICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
             HI  LK G    S K+        +            ++K  LT+R++LLEEL+K+S AI
Sbjct  231   HIVYLKAGATKSSLKIPDQGLGPTSHH----------IVKALLTSREMLLEELKKISDAI  280

Query  1519  NQAI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKRNGITD  1677
              + +   DV D S  K+E      S    S+K      +  G +        +K N   D
Sbjct  281   GKTVEDLDVADLSLGKYEAVQPAKSGLPNSNKVFPATTKGVGHLAGILHDFLEKPNSAVD  340

Query  1678  FRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               N+ +L++L K+EL+ LF +  +Q+  LW+ FLKFHR ++T
Sbjct  341   GANDAMLYTLPKEELLELFLTVSSQLSLLWNAFLKFHRINKT  382



>gb|AFW56158.1| hypothetical protein ZEAMMB73_791038 [Zea mays]
Length=736

 Score =   260 bits (664),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 198/308 (64%), Gaps = 20/308 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +++ V+E+A+YIHRFHNLDLFQQGWYQ+KI+  WE G  ++  +P+RVVQYEA D G+D+
Sbjct  53    VMETVHEVAIYIHRFHNLDLFQQGWYQMKISAMWEEGGNKTPASPARVVQYEASDVGADD  112

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G+W IDD DNS+ TQPFRIKYARQDI LSV+VSFN+   + E      +SAV+LKFEL
Sbjct  113   ALGIWKIDDVDNSFHTQPFRIKYARQDIYLSVMVSFNIFNIEEE---GPAASAVMLKFEL  169

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +YAP LENG  LQAS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH+VLVD ++HI  
Sbjct  170   MYAPTLENGSELQASSVTSSAAVHEFRIPHRALLGLHSYCPVHFDAFHSVLVDLTLHIVY  229

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             LK G    S KV        +            ++K  LT+R +LLEEL+K+S AI + +
Sbjct  230   LKAGATKPSLKVPDQGLGPTSYH----------IVKALLTSRKLLLEELKKISGAIGKTV  279

Query  1531  DVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQM-PSQKQSVSQKRNGITDF--RNEEVLH  1701
             +  D +    D +L        SK     S ++ P+  + V Q    + DF  +N ++++
Sbjct  280   EELDVA----DLNLGRYESFNPSKSGLPNSSKVFPATGKGVGQLTGVLHDFLEKNNDMVN  335

Query  1702  SLSKDELV  1725
                   LV
Sbjct  336   GTDDSMLV  343



>gb|KHN26706.1| Protein FAM135B-like protein [Glycine soja]
Length=775

 Score =   245 bits (626),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 160/410 (39%), Positives = 219/410 (53%), Gaps = 72/410 (18%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTE---ARPTsllsssqkqqsqpmksnsksLSNHRN  801
             +  RL W + GLN+    T + LN+ +   ARP                       NH+ 
Sbjct  1     MFRRLGWFV-GLNQTNLSTKRLLNADQTASARP-----------------------NHQ-  35

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
                MLDAV+E+A+YIHRFHNLDLF+QGWY+IKIT+RWE+GD    G P+RVV     DT 
Sbjct  36    -LPMLDAVHEVAVYIHRFHNLDLFEQGWYRIKITLRWEDGDDSHPGVPARVVH----DTR  90

Query  982   S-DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVIL  1158
             S        +ID+            KY   +                +V     SSAVIL
Sbjct  91    SLQQGLSSSLIDEK-----------KYGWDE------------RISPKVTIQGKSSAVIL  127

Query  1159  KFELLY-------------APILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVH  1299
             KFEL +             +P+L     LQ+S++   A+ HE+R+PPKALLGLHSYCPVH
Sbjct  128   KFELFHTPTPEMRLVNDALSPLLFIKPELQSSVNGCAASFHEYRIPPKALLGLHSYCPVH  187

Query  1300  FDAFHAVLVDASVHICLLKRGVHTLSSKVASGSCSDDAS-SEDFDKAKQVVLIKGFLTAR  1476
             FDAFHAVLVD SVHI LLK G  T   KV S S +   +  E+  ++ +  LIK  + AR
Sbjct  188   FDAFHAVLVDTSVHISLLKSGYLTPQLKVPSDSLASKGTYGEECVRSSKAALIKALMAAR  247

Query  1477  DILLEELRKVSKAINQAIDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVS  1653
             DILL++LR++SK  NQAID+   +   ++ K L ++  +     + EVS Q+    Q  +
Sbjct  248   DILLDDLRRISKGTNQAIDLTGITFEPYDTKSLNSTSTAHEKSTDDEVSLQLSDGTQISA  307

Query  1654  QKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             +K     +   EE+    S D+++  F   GNQ+ YLW+ FLKFHR ++T
Sbjct  308   EKVTQYINHVTEELSQPFSWDDMLNSFQFIGNQLLYLWNTFLKFHRENKT  357



>ref|XP_004980194.1| PREDICTED: uncharacterized protein LOC101768227 [Setaria italica]
Length=831

 Score =   245 bits (626),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 209/340 (61%), Gaps = 22/340 (6%)
 Frame = +1

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +++  +E+A+YI RFHNLDLFQQGWY++KI   WE  ++ +  +P+RV QYEA D G+  
Sbjct  75    VMETAHEVAIYIDRFHNLDLFQQGWYRMKIRALWEADEHRAPISPARVTQYEAVDIGAKG  134

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFEL  1170
               G W IDD DNS+ TQPF +KY+RQDI LSV+VSF +  S+ E      +S+VILKFEL
Sbjct  135   TFGFWKIDDVDNSFCTQPFLVKYSRQDIYLSVMVSFYIPNSEDE---GPATSSVILKFEL  191

Query  1171  LYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICL  1350
             +Y P L NG  ++ S DT    VHEFR+P KALLGLHSYCPVHFDA H+ LVD ++HI  
Sbjct  192   IYIPTLGNGTEVKDSGDTDLVPVHEFRIPHKALLGLHSYCPVHFDALHSALVDLTIHIVY  251

Query  1351  LKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQA-  1527
             LK GV    +K +  S      S+ +D      ++K  L +R+ILLE L K+S AI    
Sbjct  252   LKAGV----TKSSLKSMEQSFGSKLYD------IVKASLISREILLEGLMKISNAIGNTL  301

Query  1528  --IDVNDFS-SKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQ---KRNGIT--DFR  1683
               +D  D +  K+E      S  ST +K     +     Q  S+ +   + +G+   +  
Sbjct  302   EDLDGTDLTLGKYESIQPSKSGLSTCNKGKGTPTKCTTPQLTSILRDFLESSGVMVGNTA  361

Query  1684  NEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             ++ +L++LS++EL  LF    +Q+ ++W+ FLKFHR HR 
Sbjct  362   DDVMLYTLSEEELFELFQIVSSQLSFIWNEFLKFHRTHRV  401



>ref|XP_007159044.1| hypothetical protein PHAVU_002G204000g [Phaseolus vulgaris]
 gb|ESW31038.1| hypothetical protein PHAVU_002G204000g [Phaseolus vulgaris]
Length=774

 Score =   244 bits (624),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 188/286 (66%), Gaps = 7/286 (2%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V   AP+ GSDN+C VW+IDDTDNS+ T PF IKYARQD+ LS+++SF LS    E    
Sbjct  64    VNTAAPEVGSDNLCRVWIIDDTDNSFSTPPFHIKYARQDVYLSIMISFYLSFGVCE----  119

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               SS+VILKFEL++API+  G  LQ SLD Y A+VHE+++PPKAL GLHSYCPVHFDAFH
Sbjct  120   GQSSSVILKFELMHAPIIGTGPELQGSLDAYAASVHEYKIPPKALRGLHSYCPVHFDAFH  179

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVVLIKGFLTARDILLE  1491
             AV+VD S+HI LLK   HT   KV+S S  S+ A  ED+  + +V+LIK  + A DILLE
Sbjct  180   AVVVDTSIHISLLKASYHTSQQKVSSDSRGSEGAYVEDYVWSNKVMLIKALMAAYDILLE  239

Query  1492  ELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNG  1668
             +LR++S  I +AID+ + + + +  + F        K  + E S Q+   + + ++K   
Sbjct  240   DLRRISTGIGKAIDLTEITFESDATEWFAPTPPACVKSVDGEPSLQLSMAQVTSAEKSAY  299

Query  1669  ITDFRNEEVLHSLSKDE-LVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               +   E+ +   S D+ L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  300   YINNLTEKSIQPFSWDDHLLSSFQSLGNQLLCLWNIFLKFHRENKT  345



>ref|XP_003577790.1| PREDICTED: protein FAM135B-like isoform X1 [Brachypodium distachyon]
Length=750

 Score =   243 bits (619),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 206/338 (61%), Gaps = 29/338 (9%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             ++  +E+A+YI RFHNLDLF QGWY++KI+  WE  +  +  +P+RV QYEA D G+   
Sbjct  1     METAHEVAIYIDRFHNLDLFHQGWYRMKISAAWEQDESRAPVSPARVAQYEATDIGAKRA  60

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELL  1173
              G W IDD DNS++TQPFRIKYARQDI LSV+VSF +  S+ E      +S+VILKFELL
Sbjct  61    FGFWKIDDVDNSFYTQPFRIKYARQDIYLSVMVSFYIPNSEDE---GPATSSVILKFELL  117

Query  1174  YAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLL  1353
             Y P L N    + S DTY A VHEFR+P +ALLGLH+YCPVHFDAFH VLVD ++HI  L
Sbjct  118   YVPTLGNRIETEDSDDTYVAPVHEFRIPYRALLGLHTYCPVHFDAFHPVLVDLTIHIVYL  177

Query  1354  KRGVHTLSSK-VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAI  1530
             K GV   S K +  GSCS           K   +IK  LT+R++LL E++K+S A+ + +
Sbjct  178   KAGVTKSSLKALEQGSCS-----------KVYDIIKALLTSRELLLGEVKKISNALGKTL  226

Query  1531  D--------VNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRN  1686
             +        +  + S H   +L  S  +       +  G +    Q + +  +       
Sbjct  227   EDLEGTDLSLGKYESIHP-TNLSLSSYTNGLHATPKCIGHLTGILQDLLETSDDAA----  281

Query  1687  EEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              + L++LSK+EL+ L  +  NQ+  +W+ FLKFHR ++
Sbjct  282   -QRLYTLSKEELLELLETVSNQLSLVWNGFLKFHRTNK  318



>ref|XP_008784169.1| PREDICTED: uncharacterized protein LOC103703178 isoform X4 [Phoenix 
dactylifera]
Length=732

 Score =   241 bits (615),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 202/300 (67%), Gaps = 21/300 (7%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V   AP    D+I GVW IDD D+S+ TQPFR+KYARQD+LLSV+VSFNL+  K E    
Sbjct  3     VGCAAPGVAPDDIFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMVSFNLTTGKDES---  59

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               +SAVILKFEL+YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCPVHFDAFH
Sbjct  60    PLTSAVILKFELMYAPILENGPEMQASFDAVSAACHEFRIPPKALLGLHSYCPVHFDAFH  119

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKG  1461
             AVLVD S+H+  LK G +T + KV+S S    + + E  ++  Q++          LIK 
Sbjct  120   AVLVDLSIHVVFLKAGTYTRAQKVSSTSHMVLNHADEHHEETNQILGQGWISSAIELIKL  179

Query  1462  FLTARDILLEELRKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------  1620
              L +R+ LLEEL+K+SKAI++ I D+N+        +  +S ++ SS  + ++S      
Sbjct  180   LLASREYLLEELQKISKAIDETIDDLNNADLNLGRLESVSSSRTDSSTASLDISGMNMGV  239

Query  1621  GQMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             GQ+     ++ +K NG+ +F N+ +L++LS++EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  240   GQLVGILYNILEKSNGVVEFGNDVMLYTLSQEELLDVFFTVGNQLSFIWNAFLKFHRINR  299



>ref|XP_010912438.1| PREDICTED: uncharacterized protein LOC105038350 isoform X5 [Elaeis 
guineensis]
Length=732

 Score =   241 bits (615),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 202/300 (67%), Gaps = 21/300 (7%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V   APD   D+I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E    
Sbjct  3     VGCAAPDVAPDDIFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDES---  59

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               +SAVILKFEL+YAPILENG  +QAS D   AA HEFR+PPKALLGLHSYCP+HFDAFH
Sbjct  60    PLTSAVILKFELMYAPILENGPEMQASFDAVSAAFHEFRIPPKALLGLHSYCPIHFDAFH  119

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKG  1461
             AVLVD S+H+  LK   +T + KV+S S    + + E  ++  Q++          LIK 
Sbjct  120   AVLVDLSIHVVFLKAATYTRAQKVSSTSHVVGNHAEEHHEEPNQILGQTWTLKAVKLIKL  179

Query  1462  FLTARDILLEELRKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVSG-----  1623
              L +R+++L EL+K+SKAI + I D+N+        +  +S ++ SS  + ++SG     
Sbjct  180   LLASRELILGELQKISKAIGETIDDLNNADLNLGRLESISSSRTDSSTASLDISGMNMGV  239

Query  1624  -QMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              Q+     ++ +K NG+ +F N+ +L++LSK+EL+ +F + GNQ+ ++W+ FLKFHR +R
Sbjct  240   EQLVGILHNILEKSNGVIEFGNDVMLYTLSKEELLDVFFTVGNQLSFIWNAFLKFHRINR  299



>gb|AFW65627.1| hypothetical protein ZEAMMB73_476369 [Zea mays]
Length=463

 Score =   234 bits (596),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/342 (43%), Positives = 212/342 (62%), Gaps = 30/342 (9%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             ++  +E+A+YI RFHNLDLFQQGWY++KI+  WE+ +  +  +P+RV QYEA D G  + 
Sbjct  1     METAHEVAIYIDRFHNLDLFQQGWYRVKISALWEDDENRAPISPARVTQYEAIDIGVKSS  60

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELL  1173
              G W IDD DNS++TQPF +KY+RQDI LSV+VSF +  S+ E      +S+VILKFEL+
Sbjct  61    FGFWKIDDVDNSFYTQPFLVKYSRQDIYLSVMVSFYIPNSEDE---GPATSSVILKFELI  117

Query  1174  YAPILENG-CNLQ-ASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             Y P L N   ++Q +S DT    VHEFR+P +ALLGLHSYCPVHFDA H+ LVD ++HI 
Sbjct  118   YIPTLGNAWTDVQDSSDDTDLIPVHEFRIPHRALLGLHSYCPVHFDALHSALVDLTIHIV  177

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN--  1521
              LK  V   S K    S            +K   ++K  L +R+ILLEE++K+S A+   
Sbjct  178   YLKAAVTKSSLKPLEQSFG----------SKSYGIVKASLISREILLEEVKKISNAVGST  227

Query  1522  -QAIDVNDFS-SKHED-------KDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGIT  1674
              + +D  D +  K+E           ++  Q T +K + +++G +    +S S    G T
Sbjct  228   LEDLDRTDLTLGKYETVQPSKSASPSYSYGQGTPTKCSPQMTGILRDFLES-SGVVVGST  286

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             D   + +L++LS++EL  LF    +Q+ ++W+ FLKFHR H+
Sbjct  287   D---DILLYTLSEEELFELFQIVSSQLSFIWNEFLKFHRTHK  325



>gb|AAX96483.1| Putative serine esterase (DUF676) [Oryza sativa Japonica Group]
 gb|ABA91702.1| serine esterase family protein, expressed [Oryza sativa Japonica 
Group]
Length=751

 Score =   239 bits (611),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/321 (45%), Positives = 204/321 (64%), Gaps = 25/321 (8%)
 Frame = +1

Query  805   QSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGS  984
             +++++  +E+A+YI RFHNLDLFQQGWY++KI+  WE  +Y +  +P+RVVQYE PD GS
Sbjct  91    EAVMETAHEVAIYIDRFHNLDLFQQGWYRLKISAAWEEDEYRAPVSPARVVQYEVPDIGS  150

Query  985   DNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF  1164
                 G+W IDD DNS++TQPF+IKY+RQDI LSV+VSF +  ++ E      +S+VILKF
Sbjct  151   KGAFGLWKIDDVDNSFYTQPFQIKYSRQDIYLSVMVSFYIPNTEDE---GPATSSVILKF  207

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+Y P LE+   ++   D Y   VHEFR+P KALLGLH+Y PVHFDAFH VLVD ++HI
Sbjct  208   ELIYVPTLEDRTEIEDPSDIY-VPVHEFRIPYKALLGLHAYFPVHFDAFHPVLVDLTMHI  266

Query  1345  CLLKRGVHTLSSKVAS--GSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAI  1518
               LK GV T SS+ AS  G CS           K   +IK  L++R+ILLEE+ K+S  I
Sbjct  267   VYLKAGV-TKSSQKASEQGLCS-----------KSCYIIKALLSSREILLEEVMKMSAGI  314

Query  1519  NQAI-DVNDFS---SKHEDKDLFTSRQSTSSKD---NAEVSGQMPSQKQSVSQKRNGITD  1677
              + + D++D      KHE  D   +     SK      +  G +      + ++ + +  
Sbjct  315   GKTLEDLDDADLTLGKHEPIDSSKAGLPKYSKGLYIPTKCIGHLTGVLHDLIERSDNVVR  374

Query  1678  FRNEEVLHSLSKDELVGLFHS  1740
               N+ +L++LSK++L+ LF +
Sbjct  375   STNDILLYTLSKEDLLELFQA  395



>ref|XP_006581473.1| PREDICTED: protein FAM135B-like isoform X3 [Glycine max]
Length=636

 Score =   233 bits (595),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YI RFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVREIGVYIQRFHNLDLFKQGWYRIKITVRWEDSENMSFGIPASVVQYEAPDMD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               +I GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSIYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSCSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL YAP  E G ++QAS D  PAA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD S+H
Sbjct  126   FELRYAPATEVGADMQASPDDSPAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSIH  185

Query  1342  ICLLK  1356
             + LLK
Sbjct  186   VTLLK  190



>gb|KHN37209.1| Protein FAM135A-like protein [Glycine soja]
Length=639

 Score =   233 bits (594),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = +1

Query  802   SQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTG  981
             S + L+ V EI +YI RFHNLDLF+QGWY+IKIT+RWE+ +  S G P+ VVQYEAPD  
Sbjct  9     SVATLETVREIGVYIQRFHNLDLFKQGWYRIKITVRWEDSENMSFGIPASVVQYEAPDMD  68

Query  982   SDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILK  1161
               +I GVW IDDTDNS+ TQ FRIKYARQD+ L +++ FNLS S++  L    ++AVILK
Sbjct  69    PSSIYGVWRIDDTDNSFSTQSFRIKYARQDVHLYMMIVFNLSCSEFVDLA---TTAVILK  125

Query  1162  FELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             FEL YAP  E G ++QAS D  PAA+HEFR+PPKAL+GLHSYCPVHFDA HAVLVD S+H
Sbjct  126   FELRYAPATEVGADMQASPDDSPAAIHEFRIPPKALIGLHSYCPVHFDALHAVLVDVSIH  185

Query  1342  ICLLK  1356
             + LLK
Sbjct  186   VTLLK  190



>ref|XP_002450339.1| hypothetical protein SORBIDRAFT_05g003960 [Sorghum bicolor]
 gb|EES09327.1| hypothetical protein SORBIDRAFT_05g003960 [Sorghum bicolor]
Length=738

 Score =   233 bits (595),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 152/346 (44%), Positives = 212/346 (61%), Gaps = 33/346 (10%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVG-TPSRVVQYEAPDTG-SD  987
             ++  +E+A+YI RFHNLDLFQQGWY++KI+  WE+ +      +P+RV QYEA D G   
Sbjct  1     METAHELAVYIDRFHNLDLFQQGWYRMKISALWEDEENNRAPISPARVTQYEAIDIGVKS  60

Query  988   NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFE  1167
             +  G W IDD DNS++TQPF +KY+RQDI LSV+VSF ++ S+ E      +S+VILKFE
Sbjct  61    SSFGFWKIDDVDNSFYTQPFLVKYSRQDIYLSVMVSFYITNSEDE---GPATSSVILKFE  117

Query  1168  LLYAPILENGCN--LQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVH  1341
             L+Y P L NG      +S DT    VHEFR+P +ALLGLHSYCPVHFDA H+ LVD +VH
Sbjct  118   LIYIPTLGNGWTEVQDSSDDTDLIPVHEFRIPHRALLGLHSYCPVHFDALHSALVDLTVH  177

Query  1342  ICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN  1521
             I  LK  V T SS + S   S  + S D        ++K  L +R+ILLEE++K+S AI 
Sbjct  178   IVYLKAAV-TKSSSLKSLEQSFGSKSYD--------IVKASLISREILLEEVKKISNAIG  228

Query  1522  QAIDVNDFSSKHEDKDL--FTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDF-----  1680
               ++  D    H D  L  + + Q + S   +  +GQ  S K S  Q    + DF     
Sbjct  229   HTLEDLD----HTDLTLGKYETIQPSKSGSPSYNNGQGASTKCS-PQMTGILRDFLESSG  283

Query  1681  -----RNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                   ++ +L++LS++EL  LF +  +Q+ ++W+ FLKFHR H+ 
Sbjct  284   VVVGSTDDILLYTLSEEELFELFQTVSSQLSFIWNEFLKFHRTHKV  329



>ref|XP_008679700.1| PREDICTED: protein FAM135B-like isoform X2 [Zea mays]
Length=730

 Score =   232 bits (591),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 146/342 (43%), Positives = 212/342 (62%), Gaps = 30/342 (9%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             ++  +E+A+YI RFHNLDLFQQGWY++KI+  WE+ +  +  +P+RV QYEA D G  + 
Sbjct  1     METAHEVAIYIDRFHNLDLFQQGWYRVKISALWEDDENRAPISPARVTQYEAIDIGVKSS  60

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELL  1173
              G W IDD DNS++TQPF +KY+RQDI LSV+VSF +  S+ E      +S+VILKFEL+
Sbjct  61    FGFWKIDDVDNSFYTQPFLVKYSRQDIYLSVMVSFYIPNSEDE---GPATSSVILKFELI  117

Query  1174  YAPILENG-CNLQ-ASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             Y P L N   ++Q +S DT    VHEFR+P +ALLGLHSYCPVHFDA H+ LVD ++HI 
Sbjct  118   YIPTLGNAWTDVQDSSDDTDLIPVHEFRIPHRALLGLHSYCPVHFDALHSALVDLTIHIV  177

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN--  1521
              LK  V   S K    S            +K   ++K  L +R+ILLEE++K+S A+   
Sbjct  178   YLKAAVTKSSLKPLEQSFG----------SKSYGIVKASLISREILLEEVKKISNAVGST  227

Query  1522  -QAIDVNDFS-SKHED-------KDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGIT  1674
              + +D  D +  K+E           ++  Q T +K + +++G +    +S S    G T
Sbjct  228   LEDLDRTDLTLGKYETVQPSKSASPSYSYGQGTPTKCSPQMTGILRDFLES-SGVVVGST  286

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             D   + +L++LS++EL  LF    +Q+ ++W+ FLKFHR H+
Sbjct  287   D---DILLYTLSEEELFELFQIVSSQLSFIWNEFLKFHRTHK  325



>ref|XP_008679699.1| PREDICTED: protein FAM135B-like isoform X1 [Zea mays]
Length=748

 Score =   232 bits (591),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 146/342 (43%), Positives = 212/342 (62%), Gaps = 30/342 (9%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             ++  +E+A+YI RFHNLDLFQQGWY++KI+  WE+ +  +  +P+RV QYEA D G  + 
Sbjct  1     METAHEVAIYIDRFHNLDLFQQGWYRVKISALWEDDENRAPISPARVTQYEAIDIGVKSS  60

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELL  1173
              G W IDD DNS++TQPF +KY+RQDI LSV+VSF +  S+ E      +S+VILKFEL+
Sbjct  61    FGFWKIDDVDNSFYTQPFLVKYSRQDIYLSVMVSFYIPNSEDE---GPATSSVILKFELI  117

Query  1174  YAPILENG-CNLQ-ASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHIC  1347
             Y P L N   ++Q +S DT    VHEFR+P +ALLGLHSYCPVHFDA H+ LVD ++HI 
Sbjct  118   YIPTLGNAWTDVQDSSDDTDLIPVHEFRIPHRALLGLHSYCPVHFDALHSALVDLTIHIV  177

Query  1348  LLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAIN--  1521
              LK  V   S K    S            +K   ++K  L +R+ILLEE++K+S A+   
Sbjct  178   YLKAAVTKSSLKPLEQSFG----------SKSYGIVKASLISREILLEEVKKISNAVGST  227

Query  1522  -QAIDVNDFS-SKHED-------KDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGIT  1674
              + +D  D +  K+E           ++  Q T +K + +++G +    +S S    G T
Sbjct  228   LEDLDRTDLTLGKYETVQPSKSASPSYSYGQGTPTKCSPQMTGILRDFLES-SGVVVGST  286

Query  1675  DFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             D   + +L++LS++EL  LF    +Q+ ++W+ FLKFHR H+
Sbjct  287   D---DILLYTLSEEELFELFQIVSSQLSFIWNEFLKFHRTHK  325



>ref|XP_008781422.1| PREDICTED: uncharacterized protein LOC103701215 isoform X3 [Phoenix 
dactylifera]
Length=732

 Score =   229 bits (584),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 206/300 (69%), Gaps = 21/300 (7%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V   APD   D+I GVW IDD D+S+ TQPFRIKYARQD+LLSV+VSFNL++ K E   M
Sbjct  3     VGCAAPDAAPDDIFGVWRIDDADHSFSTQPFRIKYARQDVLLSVMVSFNLTIGKDESPSM  62

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
             S   AV+LKFEL+YAPILEN   +QAS D   AAVHEFR+PPKALLGLHSYCPVHFDAFH
Sbjct  63    S---AVMLKFELMYAPILENSSEMQASFDAVSAAVHEFRIPPKALLGLHSYCPVHFDAFH  119

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKG  1461
             AVLVD SVH+  LK G +T + KV+S S   ++ + E +++  Q++          L+K 
Sbjct  120   AVLVDLSVHVVFLKAGAYTHAQKVSSTSQMVENHADEHYEEPDQILGQGWISKAIELVKL  179

Query  1462  FLTARDILLEELRKVSKAINQAI-DVNDFSSKHEDKDLFTSRQSTSSKDNAEVS------  1620
              L +R++LLEEL+K+SKAI+Q I D+N+        +  +S    SS  + ++S      
Sbjct  180   LLASRELLLEELQKISKAIDQTIEDLNNADLDLGRFESISSSTPDSSTSSLDISGMKMGV  239

Query  1621  GQMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             GQ+     ++ +K+NG+ +F N+ +L++LSK+EL+ ++ + GNQ+ ++W+ FL+FHR ++
Sbjct  240   GQLVGMLHNILEKKNGVIEFGNDVMLYTLSKEELLDVYFTVGNQLSFIWNAFLRFHRINK  299



>ref|XP_010061589.1| PREDICTED: uncharacterized protein LOC104449216 isoform X3 [Eucalyptus 
grandis]
Length=735

 Score =   209 bits (532),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 155/235 (66%), Gaps = 18/235 (8%)
 Frame = +1

Query  1141  SSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAV  1320
             +SAV+LKFEL+YAPI E+G  LQASLD+  AAVHEFR+PPKALLGLHSYCPVHFDAFHAV
Sbjct  77    TSAVVLKFELMYAPISESGSGLQASLDSCAAAVHEFRIPPKALLGLHSYCPVHFDAFHAV  136

Query  1321  LVDASVHICLLK--------------RGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIK  1458
             LVD +VHI LLK              R V  LS +   G          FD+ +Q+ +++
Sbjct  137   LVDTTVHISLLKSSSVVAPPKVNRDSRNVEELSGENIHGLGQAVGPVSSFDE-RQLSVLR  195

Query  1459  GFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQ  1638
               L +RD+L+EEL+ +SKAI+Q ID+ D ++K +DK L   R     + + +V G  P +
Sbjct  196   ALLASRDLLVEELQNLSKAIDQPIDLTDVTAKVDDKTLIDLRAELGIEVD-KVLG--PDK  252

Query  1639  KQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              Q+  +K N   D RN+ +L+S S+++L   FH  GNQV YLW+ FL+FHRA++T
Sbjct  253   LQNGIEKANQNVDTRNDGLLYSASREDLFHSFHVLGNQVLYLWNTFLQFHRANKT  307


 Score = 53.5 bits (127),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  938   ELHQE*FNMKLLIQVLITYVECG*LMTQTTVTSHNLSG*NMQDRISFSQCWSHLIYLSPN  1117
             EL QE F+MK L  VL TY+  G  M Q TV+ H+  G N + R+ F Q W HLIYL  N
Sbjct  5     ELQQEWFSMKFLTWVLKTYMVFGGSMIQITVSLHSPFGSNTRGRMFFYQSWCHLIYLLEN  64

Query  1118  MRS  1126
             + S
Sbjct  65    LSS  67



>ref|XP_010930976.1| PREDICTED: uncharacterized protein LOC105051999 isoform X4 [Elaeis 
guineensis]
Length=729

 Score =   224 bits (571),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 206/300 (69%), Gaps = 21/300 (7%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V+  APD   D+I GVW IDD D+S+ TQPFR+KYARQD+LLSV++SFNL + + E    
Sbjct  3     VRCAAPDVALDDIFGVWRIDDADHSFSTQPFRVKYARQDVLLSVMISFNLPIGEDES---  59

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               +SAVILKFEL+YAPILENG  +QAS D   AAVHEFR+PPK LLGLHSYCPVHFDAFH
Sbjct  60    PSTSAVILKFELMYAPILENGSEMQASFDAVSAAVHEFRIPPKGLLGLHSYCPVHFDAFH  119

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGS-CSDDASSEDFDKAKQVV----------LIKG  1461
             AVLVD SVH+  LK G +T + KV+S S   ++ + E +++  Q++          L+K 
Sbjct  120   AVLVDLSVHVVFLKAGTYTHAQKVSSTSQMVENHADEHYEEPNQILGQGWISKAIELVKL  179

Query  1462  FLTARDILLEELRKVSKAINQAI-DVNDFS---SKHEDKDLFTSRQSTSSKDNAEVS---  1620
              L +R++LLEELR++SKAI+Q + D+N+      + E     T   STSS D A +    
Sbjct  180   LLASRELLLEELRRISKAIDQTVEDLNNADLNLGRFESISSSTPDSSTSSLDIAGMKMGV  239

Query  1621  GQMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             GQ+     ++ +K+NG+ +F N+ +L++LSK+EL+ ++ + G+Q+  +W+ FLKFHR ++
Sbjct  240   GQLVGMLHNILEKKNGVIEFGNDVILYTLSKEELLDVYFTVGSQLSIIWNAFLKFHRINK  299



>gb|EEC67744.1| hypothetical protein OsI_35253 [Oryza sativa Indica Group]
Length=646

 Score =   223 bits (567),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 188/325 (58%), Gaps = 51/325 (16%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             ++  +E+A+YI RFHNLDLFQQGWY++KI+  WE  +Y +  +P+RVVQYE PD GS   
Sbjct  1     METAHEVAIYIDRFHNLDLFQQGWYRLKISAAWEEDEYRAPVSPARVVQYEVPDIGSKGA  60

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKF---  1164
              G+W IDD DNS++TQPF+IKY+RQDI L                      +V++ F   
Sbjct  61    FGLWKIDDVDNSFYTQPFQIKYSRQDIYL----------------------SVMVSFYIP  98

Query  1165  ----ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDA  1332
                 EL+Y P LE+   ++   D Y   VHEFR+P KALLGLH+Y PVHFDAFH VLVD 
Sbjct  99    NTEDELIYVPTLEDRTEIEDPSDIY-VPVHEFRIPYKALLGLHAYFPVHFDAFHPVLVDL  157

Query  1333  SVHICLLKRGVHTLSSKVAS--GSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKV  1506
             ++HI  LK GV T SS+ AS  G CS           K   +IK  L++R+ILLEE+ K+
Sbjct  158   TMHIVYLKAGV-TKSSQKASEQGLCS-----------KSCYIIKALLSSREILLEEVMKM  205

Query  1507  SKAINQAI-DVNDFS---SKHEDKDLFTSRQSTSSKD---NAEVSGQMPSQKQSVSQKRN  1665
             S  I + + D++D      KHE  D   +     SK      +  G +      + ++ +
Sbjct  206   SAGIGKTLEDLDDADLTLGKHEPIDSSKAGLPKYSKGLYIPTKCFGHLTGVLHDLIERSD  265

Query  1666  GITDFRNEEVLHSLSKDELVGLFHS  1740
              +    N+ +L++LSK++L+ LF +
Sbjct  266   NVVRSTNDILLYTLSKEDLLELFQA  290



>ref|XP_004977308.1| PREDICTED: protein FAM135B-like isoform X2 [Setaria italica]
Length=710

 Score =   215 bits (548),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 134/290 (46%), Positives = 179/290 (62%), Gaps = 20/290 (7%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V   A D G+D+  G+W IDD DNS++TQPFRIKYARQDI LSV+VSFN+  S+ E    
Sbjct  3     VDCAASDVGADDALGIWKIDDVDNSFYTQPFRIKYARQDIYLSVMVSFNIFNSEEE---G  59

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               +SAV+LKFEL+YAP L+NG  LQAS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH
Sbjct  60    PAASAVMLKFELIYAPTLDNGSELQASSVTSSAAVHEFRIPRRALLGLHSYCPVHFDAFH  119

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEE  1494
             +VLVD ++HI  LK G    S KV        +            ++K  LT+R +LLEE
Sbjct  120   SVLVDLTLHIVYLKAGATKPSLKVPDEGLGPVSYH----------IVKALLTSRKMLLEE  169

Query  1495  LRKVSKAINQAIDVNDFS----SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVS  1653
             L+K+S AI + ID  D +     K+E  +   S    SSK      +  GQ+        
Sbjct  170   LKKISDAIGKRIDDLDGADLNLGKYEPVNPSNSGLPNSSKVFPATGKGVGQLAGILHDFL  229

Query  1654  QKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             ++ N + +   + +L++L K+EL+ LF +   Q+  LW+ FLKFHRA++T
Sbjct  230   ERPNDVVNGTEDSMLYALPKEELLELFLTVSGQLSLLWNAFLKFHRANKT  279



>gb|EMT01462.1| hypothetical protein F775_52678 [Aegilops tauschii]
Length=813

 Score =   216 bits (551),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 192/322 (60%), Gaps = 24/322 (7%)
 Frame = +1

Query  796   RNSQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPD  975
             R  +  ++  +E+A+YI RFHNLDL+ QGWY++KI+  WE  D  +  +P+RV QYEA D
Sbjct  148   RPPRGAMETAHEVAIYIDRFHNLDLYHQGWYRMKISAAWEQDDGRAPVSPARVAQYEATD  207

Query  976   TGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVI  1155
              G+   CG W IDD DNS++TQPFRIKYARQDI LS++VSF +  S+ E      +S+V+
Sbjct  208   IGAKRACGFWKIDDVDNSFYTQPFRIKYARQDIYLSLMVSFYIPNSQDE---GPATSSVM  264

Query  1156  LKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDAS  1335
             LKFELL+ P L N    + S D Y   VHEFR+P +ALLGLH+YCPVHFD FH VLVD +
Sbjct  265   LKFELLFIPTLGNRIETEDSNDQYLIPVHEFRIPHRALLGLHTYCPVHFDTFHPVLVDLT  324

Query  1336  VHICLLKRGVHTLSSKV-ASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSK  1512
             +HI  LK GV   S K    GS S           K   ++K  L++R++LLEE++++S 
Sbjct  325   IHIVYLKAGVTKSSLKAFKQGSVS-----------KLYDILKALLSSRELLLEEVKRISN  373

Query  1513  AINQAID--------VNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNG  1668
              I  A+         +  + S H  K  F +  +       +  GQ     Q + ++ + 
Sbjct  374   GIGTALQDLDGADLTLGKYESVHPTKSSFPN-YTNGLPVTPKCIGQQFGILQDLLERSDD  432

Query  1669  ITDFRNEEVLHSLSKDELVGLF  1734
                  N+ +L++LSK+EL+ LF
Sbjct  433   AVQSTNDAMLYTLSKEELLELF  454



>gb|EMT05862.1| hypothetical protein F775_18479 [Aegilops tauschii]
Length=838

 Score =   215 bits (547),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 180/285 (63%), Gaps = 25/285 (9%)
 Frame = +1

Query  883   WYQIKITMRWENGDYES--VGTPSRVVQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIK  1056
             WYQ+KI+  WE G+  S    +P+RVVQYEAPD G+D+  G+W IDD DNS++TQPFRIK
Sbjct  216   WYQMKISAMWEEGESGSKTPASPARVVQYEAPDVGADDALGIWRIDDADNSFYTQPFRIK  275

Query  1057  YARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELLYAPILENGCNLQASLDTYPAA  1236
             YARQDI LSV+VSFN+   + E      +SAVILK+EL+YAP LENG ++Q+S  T  AA
Sbjct  276   YARQDIYLSVMVSFNILNGEQE---GPAASAVILKYELIYAPTLENGSDIQSSSATSSAA  332

Query  1237  VHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLLKRGVHTLSSKVASGSCSDDAS  1416
             VHEFR+P KALLGLHSYCPVHFDAFHAVLVD ++HI  LK G +  S K+        A 
Sbjct  333   VHEFRIPRKALLGLHSYCPVHFDAFHAVLVDLTLHIVYLKAGANKSSLKIPDQGLRPTAH  392

Query  1417  SEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQST-  1593
                        +IK  L +R++LLEEL+K+S A+ ++I+  D      D DL   +  + 
Sbjct  393   H----------IIKALLASREMLLEELKKISGAVGKSIEDLD------DADLSLGKYESL  436

Query  1594  -SSKDNAEVSGQM-PSQKQSVSQKRNGITDFRNEEVLHSLSKDEL  1722
               SK     SG++ P   + V      + DF  E V +S S+ EL
Sbjct  437   QPSKPVHPDSGKVFPVTTKGVGHLAGILHDFL-EPVQNSASRAEL  480



>ref|XP_006491851.1| PREDICTED: protein FAM135B-like isoform X3 [Citrus sinensis]
Length=655

 Score =   210 bits (535),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 155/233 (67%), Gaps = 26/233 (11%)
 Frame = +1

Query  1114  KYEVLRMSHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCP  1293
             KYEVL    +SAVILKFEL+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCP
Sbjct  10    KYEVLS---TSAVILKFELMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCP  66

Query  1294  VHFDAFHAVLVDASVHICLLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGF  1464
             VHFD+ HAVLVD SVH+ LLK    T   K   VA    S  AS +    + Q++LIK  
Sbjct  67    VHFDSLHAVLVDVSVHVSLLKASSSTAPPKSDFVAQKIWSQLASVD----STQLMLIKAL  122

Query  1465  LTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQ  1644
              +ARDILLE+L+++SKAI+QAID++D         LF S        + EV  Q+    Q
Sbjct  123   FSARDILLEDLKEISKAIDQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQ  167

Query  1645  S-VSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             + V +K +G  D +++ + HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  168   NGVERKADGAKDLQSDGLSHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  220



>gb|KDO50638.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=655

 Score =   210 bits (535),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 155/233 (67%), Gaps = 26/233 (11%)
 Frame = +1

Query  1114  KYEVLRMSHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCP  1293
             KYEVL    +SAVILKFEL+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCP
Sbjct  10    KYEVLS---TSAVILKFELMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCP  66

Query  1294  VHFDAFHAVLVDASVHICLLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGF  1464
             VHFD+ HAVLVD SVH+ LLK    T   K   VA    S  AS +    + Q++LIK  
Sbjct  67    VHFDSLHAVLVDVSVHVSLLKASSSTAPPKSEFVAQKIWSQLASVD----STQLMLIKAL  122

Query  1465  LTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQ  1644
              +ARDILLE+L+++SKAI+QAID++D         LF S        + EV  Q+    Q
Sbjct  123   FSARDILLEDLKEISKAIDQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQ  167

Query  1645  S-VSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             + V +K +G  D +++ + HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  168   NGVERKADGAKDLQSDGLSHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  220



>ref|XP_004504751.1| PREDICTED: protein FAM135B-like isoform X4 [Cicer arietinum]
Length=694

 Score =   210 bits (535),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 170/271 (63%), Gaps = 9/271 (3%)
 Frame = +1

Query  1006  MIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELLYAPI  1185
             MIDDTDNS+ T PF+I+YARQD+ LS+++SF L+   YE      SS VILKFEL++AP+
Sbjct  1     MIDDTDNSFSTPPFQIRYARQDVFLSIMISFYLAFGVYE----GESSDVILKFELMHAPM  56

Query  1186  LENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLLKRGV  1365
                G  L  SLD    + HE+++PPKALLGLHSYCPVHFDAFHAV+VD SVHI LLK   
Sbjct  57    SATGSELHGSLDACSVSAHEYKIPPKALLGLHSYCPVHFDAFHAVVVDTSVHISLLKASY  116

Query  1366  HTLSSKV-ASGSCSDDASS--EDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAIDV  1536
              T+  K+  +  C D   +  ED+  + +V+LIK  + A +ILLE+LR++S  I+QAID+
Sbjct  117   RTVRQKLNCTSDCRDSEGTYAEDYVGSNKVMLIKALMAAHNILLEDLRRISAGIDQAIDL  176

Query  1537  NDFSSKHEDKDLFTSRQSTSSKD-NAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSLSK  1713
                + + +    F S      K  + E S Q+  + +   +     T++  EE +     
Sbjct  177   TGITFESDVTKWFDSTLPEPVKSIDGEPSLQLSDRDKVSVEDSTHYTNYLTEESVQPFCW  236

Query  1714  DE-LVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             D+ L+  F S GNQ+  LW+IFLKFHR ++T
Sbjct  237   DDHLLNSFQSLGNQLLCLWNIFLKFHRENKT  267



>gb|KDO50639.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=659

 Score =   208 bits (530),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 154/230 (67%), Gaps = 23/230 (10%)
 Frame = +1

Query  1123  VLRMSHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHF  1302
             VL++  +SAVILKFEL+YA +LEN  +LQ+SLD  PAAVHEFR+PPKALLGLHSYCPVHF
Sbjct  14    VLQVLSTSAVILKFELMYASVLENSPDLQSSLDACPAAVHEFRIPPKALLGLHSYCPVHF  73

Query  1303  DAFHAVLVDASVHICLLKRGVHTLSSK---VASGSCSDDASSEDFDKAKQVVLIKGFLTA  1473
             D+ HAVLVD SVH+ LLK    T   K   VA    S  AS +    + Q++LIK   +A
Sbjct  74    DSLHAVLVDVSVHVSLLKASSSTAPPKSEFVAQKIWSQLASVD----STQLMLIKALFSA  129

Query  1474  RDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQS-V  1650
             RDILLE+L+++SKAI+QAID++D         LF S        + EV  Q+    Q+ V
Sbjct  130   RDILLEDLKEISKAIDQAIDLDDM--------LFGSM-------DGEVPVQLLGMPQNGV  174

Query  1651  SQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
              +K +G  D +++ + HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  175   ERKADGAKDLQSDGLSHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  224



>ref|XP_010260963.1| PREDICTED: uncharacterized protein LOC104599909 isoform X4 [Nelumbo 
nucifera]
Length=424

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 153/243 (63%), Gaps = 27/243 (11%)
 Frame = +1

Query  1141  SSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAV  1320
             +SAVILKFELL++PILENG ++QASLD +PAAVHEF++PPKALLGLHSYCPVHFD FHAV
Sbjct  16    TSAVILKFELLFSPILENGFDMQASLDAFPAAVHEFQIPPKALLGLHSYCPVHFDYFHAV  75

Query  1321  LVDASVHICLLKRGVHTLSSK------------VASGSC--SDDASSE-DFDKAKQVVLI  1455
             LVD SVHI LLK G H    K            +A  +C  S+  S + D   + Q+  +
Sbjct  76    LVDLSVHIVLLKAGAHGPRQKLEYFSDSQSVGDIAGVNCDGSNQVSGQRDSTYSNQIAFL  135

Query  1456  KGFLTARDILLEELRKVSKAINQAIDVNDFSS-----KHEDKDLFTSRQSTSSKDNAEVS  1620
             K  L ARDILL+EL K++KAI+Q ID+   +S     K    +L     +T ++D     
Sbjct  136   KALLVARDILLDELEKLNKAIDQTIDLTHLTSILGDNKFIGTNLRADLHNTGAED-LRKG  194

Query  1621  GQMPSQKQSVSQKRNGITDFRNEEVL--HSLSKDELVGLFHSFGNQVFYLWSIFLKFHRA  1794
              ++ + K     ++NG TD    EVL   SL K+ L+  F+S G+QV +LW+ FL FHR 
Sbjct  195   ARLVASKSKNGFQQNGTTD----EVLQSQSLFKENLLCTFNSLGSQVSFLWNTFLNFHRV  250

Query  1795  HRT  1803
             ++T
Sbjct  251   NKT  253



>ref|XP_008674446.1| PREDICTED: uncharacterized protein LOC103650665 isoform X2 [Zea 
mays]
Length=709

 Score =   196 bits (499),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 130/290 (45%), Positives = 175/290 (60%), Gaps = 20/290 (7%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             V   A D G D+  G+W IDD DNS+ TQPFRIKYARQDI LSV+VSFN+  S+ E    
Sbjct  3     VDCAASDVGGDDALGIWKIDDIDNSFHTQPFRIKYARQDIYLSVMVSFNIFNSEEE---G  59

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               +S V++KFEL+YAP L+NG  L AS  T  AAVHEFR+P +ALLGLHSYCPVHFDAFH
Sbjct  60    PAASDVMMKFELIYAPTLDNGSELHASSATSSAAVHEFRIPHRALLGLHSYCPVHFDAFH  119

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEE  1494
             +VLVD ++HI  LK G    S KV           E   +     ++K  LT+R +LLEE
Sbjct  120   SVLVDLTLHIVYLKAGAAKSSLKVP----------EQGLRPTSYHIVKALLTSRKMLLEE  169

Query  1495  LRKVSKAINQAI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVS  1653
             L K+S AI + +   DV D +  K+E  +   S    SSK   +  +  GQ+        
Sbjct  170   LNKISGAIGKTVEDLDVADLNLGKYESFNPSKSWLPNSSKVFPETGKGVGQLAGILHDFL  229

Query  1654  QKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             ++ N + +  ++ +L++L  +EL  LF +   Q+  LW+ FLKFHR ++T
Sbjct  230   ERPNDMVNGTDDSLLYTLPHEELFELFLTLSGQLSLLWNAFLKFHRLNKT  279



>emb|CAN69922.1| hypothetical protein VITISV_025317 [Vitis vinifera]
Length=626

 Score =   185 bits (470),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 121/154 (79%), Gaps = 5/154 (3%)
 Frame = +1

Query  955   VQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRM  1134
             VQ  AP+ G ++  GVW IDDTDNS+ TQPFRI+YARQD+LLS+++SFNLSL KYE L  
Sbjct  16    VQAAAPELGPEDAYGVWRIDDTDNSFSTQPFRIRYARQDVLLSLMISFNLSLRKYEGLS-  74

Query  1135  SHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
               +SA+ILKFEL+YAP+LENG  LQASLD  PA+VHEFR+PPKALLGLHSYCPVHFD+FH
Sbjct  75    --TSAIILKFELMYAPMLENGSELQASLDACPASVHEFRIPPKALLGLHSYCPVHFDSFH  132

Query  1315  AVLVDASVHICLLK--RGVHTLSSKVASGSCSDD  1410
             AVLVD S+HI LL+   G+  L S     S S D
Sbjct  133   AVLVDISIHITLLRAANGIVELRSDRPLNSLSKD  166


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  1663  NGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             NGI + R++  L+SLSKD+L+  FH  GNQ+ YLW+ FL FHRA++
Sbjct  149   NGIVELRSDRPLNSLSKDDLLNSFHLLGNQILYLWNTFLNFHRANK  194



>ref|XP_009118283.1| PREDICTED: uncharacterized protein LOC103843322 isoform X2 [Brassica 
rapa]
Length=665

 Score =   178 bits (451),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 144/233 (62%), Gaps = 18/233 (8%)
 Frame = +1

Query  1141  SSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAV  1320
             +SAVIL+FELLY+PI+EN  +L  S D+ PA+VH+FR+PPKAL G+HSYCPVHFD FHAV
Sbjct  7     TSAVILRFELLYSPIVEN-ISLTHSDDS-PASVHDFRIPPKALSGVHSYCPVHFDTFHAV  64

Query  1321  LVDASVHICLLKRGVH----TLSSKVASGSCSDDASSEDFDKA--------KQVVLIKGF  1464
             L+D SVH+ ++K   +     LSS  +SG      SS+   KA        K V  +K  
Sbjct  65    LIDVSVHVSVMKSASYKRPAVLSSDASSGKSLASGSSQSSKKAFAQIAPADKLVSFVKAL  124

Query  1465  LTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQ  1644
             L ARD LLEE++K+SKAI+Q ID+++F S   DK L +   ST      E SGQ    KQ
Sbjct  125   LGARDTLLEEMQKLSKAIDQTIDLSEFVST-MDKTLLSDSASTEKTVAVEGSGQ---GKQ  180

Query  1645  SVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               + +     D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL FHR + T
Sbjct  181   QNNLELKTSLDLESDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTFHRDNNT  233



>emb|CAN79530.1| hypothetical protein VITISV_042727 [Vitis vinifera]
Length=357

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 138/236 (58%), Gaps = 30/236 (13%)
 Frame = +1

Query  1114  KYEVLRMSHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCP  1293
             KYE L    +SA++LK EL+YAP+L NG  LQASLDT  A+VHEFR+PPKA LGLHSYCP
Sbjct  38    KYEGLS---TSAIVLKSELMYAPMLGNGSELQASLDTCSASVHEFRIPPKAFLGLHSYCP  94

Query  1294  VHFDAFHAVLVDASVHICLLKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVVLIKGFLT  1470
             VHFD+FHAVLVD  +HI LL+ G+H  SSKV S     +D + E+ D + QV   K    
Sbjct  95    VHFDSFHAVLVDIGLHIPLLRAGIHAPSSKVPSNFHAVEDVAGENLDGSIQV--FKALFA  152

Query  1471  ARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFT----------SRQSTSSKDNAEVS  1620
             A D LLEEL+K+SK INQ ID  DF SK  D  + T          S  S +S  + E+ 
Sbjct  153   ACDRLLEELQKLSKTINQTIDSTDFISKLNDTKMVTFSEISPXLLKSVNSLNSHTSPEIE  212

Query  1621  GQMPSQKQSV------------SQKRNGITDFRNEEVLHSLSK--DELVGLFHSFG  1746
              +  +   SV            SQ+ +G  +F  +    ++ K  DE+ G+  ++G
Sbjct  213   DKGHAWLTSVPPVRSLPHSYEASQRESGYNEFLGKRASETVCKAFDEVYGIELAWG  268



>ref|XP_008679701.1| PREDICTED: uncharacterized protein LOC103654636 isoform X3 [Zea 
mays]
Length=725

 Score =   171 bits (434),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 177/301 (59%), Gaps = 30/301 (10%)
 Frame = +1

Query  937   GTPSRVVQYEAPDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsK  1116
             G+ +  V Y A D G  +  G W IDD DNS++TQPF +KY+RQDI LSV+VSF +  S+
Sbjct  12    GSRNTKVDYAAIDIGVKSSFGFWKIDDVDNSFYTQPFLVKYSRQDIYLSVMVSFYIPNSE  71

Query  1117  YEVLRMSHSSAVILKFELLYAPILENG-CNLQ-ASLDTYPAAVHEFRLPPKALLGLHSYC  1290
              E      +S+VILKFEL+Y P L N   ++Q +S DT    VHEFR+P +ALLGLHSYC
Sbjct  72    DE---GPATSSVILKFELIYIPTLGNAWTDVQDSSDDTDLIPVHEFRIPHRALLGLHSYC  128

Query  1291  PVHFDAFHAVLVDASVHICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLT  1470
             PVHFDA H+ LVD ++HI  LK  V   S K    S            +K   ++K  L 
Sbjct  129   PVHFDALHSALVDLTIHIVYLKAAVTKSSLKPLEQSFG----------SKSYGIVKASLI  178

Query  1471  ARDILLEELRKVSKAIN---QAIDVNDFS-SKHED-------KDLFTSRQSTSSKDNAEV  1617
             +R+ILLEE++K+S A+    + +D  D +  K+E           ++  Q T +K + ++
Sbjct  179   SREILLEEVKKISNAVGSTLEDLDRTDLTLGKYETVQPSKSASPSYSYGQGTPTKCSPQM  238

Query  1618  SGQMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAH  1797
             +G +    +S S    G TD   + +L++LS++EL  LF    +Q+ ++W+ FLKFHR H
Sbjct  239   TGILRDFLES-SGVVVGSTD---DILLYTLSEEELFELFQIVSSQLSFIWNEFLKFHRTH  294

Query  1798  R  1800
             +
Sbjct  295   K  295



>ref|XP_010238687.1| PREDICTED: uncharacterized protein LOC100833444 isoform X2 [Brachypodium 
distachyon]
Length=663

 Score =   164 bits (415),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 136/227 (60%), Gaps = 18/227 (8%)
 Frame = +1

Query  1144  SAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVL  1323
             SAVILK+EL+YAP LENG ++Q S  T  AAVHEFR+P KALLGLH+YCPVHFDAFHAVL
Sbjct  17    SAVILKYELIYAPTLENGSDIQGSSVTSSAAVHEFRIPRKALLGLHTYCPVHFDAFHAVL  76

Query  1324  VDASVHICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRK  1503
             VD ++HI  LK G +  S K+        +            ++K  LT+R++LLEEL+K
Sbjct  77    VDLTLHIVYLKAGANKSSLKIPEQGLHPASHH----------IVKALLTSREMLLEELKK  126

Query  1504  VSKAINQAI---DVNDFS-SKHEDKDLFTSRQSTSSK---DNAEVSGQMPSQKQSVSQKR  1662
             +S A+ + I   DV D +  K+E      S    S K      +  G +        ++ 
Sbjct  127   ISDAVGKTIEDLDVTDLNLGKYESLQPPKSVLPDSGKVFPVTTKGVGHLAGILHDFLERP  186

Query  1663  NGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
             NG+ D    ++L++LS +EL+ LF +  +Q+  LW+ FLKFHR ++T
Sbjct  187   NGVVD-GTSDMLYTLSNEELLELFLTVSSQLSLLWNTFLKFHRINKT  232



>ref|XP_002965112.1| hypothetical protein SELMODRAFT_406265 [Selaginella moellendorffii]
 gb|EFJ33950.1| hypothetical protein SELMODRAFT_406265 [Selaginella moellendorffii]
Length=619

 Score =   158 bits (399),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 153/266 (58%), Gaps = 25/266 (9%)
 Frame = +1

Query  814   LDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDNI  993
             +D   E++LYI RFHNLDL+QQGWY +K+T  WE  D E+ G P+RVVQYE     SD +
Sbjct  1     MDIALEVSLYIERFHNLDLWQQGWYALKVTCAWEGNDREA-GIPTRVVQYEG---ASDGL  56

Query  994   CGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVILKFELL  1173
               VW I DTD+S+ T+PF+IKYARQD+ L+++VSF+L+    E +    +S+ ++KF LL
Sbjct  57    STVWHISDTDHSFCTRPFKIKYARQDVFLAMMVSFSLAFKSVEEIL---NSSALIKFHLL  113

Query  1174  YAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLL  1353
             +AP+          ++    A H +RL P+A+ G H+YCP+HFDA H  LVD  VH  +L
Sbjct  114   FAPLDGFLFFNSMHMELPTVASHCYRLSPRAVHGAHAYCPLHFDASHMALVDVFVHTVIL  173

Query  1354  KRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKV---SKAINQ  1524
                 H +            A++E   +     L+KG    + I +E+L++    +K  +Q
Sbjct  174   STSHHEIEPL--------HAATEGRLQPCYQKLVKGHRAWKCINIEQLQEEITGNKGASQ  225

Query  1525  AID------VNDFSSKH-EDKDLFTS  1581
              ++       N F   H E+KD F +
Sbjct  226   ELEDQLSGLWNLFMKLHRENKDFFCT  251



>emb|CBI39933.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   152 bits (384),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 105/154 (68%), Gaps = 6/154 (4%)
 Frame = +1

Query  1114  KYEVLRMSHSSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCP  1293
             KYE L    +SA++LK EL+YAP+LENG  LQASLD   A+V EF++PPKA LGLHSYCP
Sbjct  112   KYEGL---STSAIVLKSELMYAPMLENGSELQASLDACSASVQEFQIPPKAFLGLHSYCP  168

Query  1294  VHFDAFHAVLVDASVHICLLKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVVLIKGFLT  1470
             +HFD+FHAVLV  S+HI LL+  +H  SSKV +    ++D + E+ D + QV   K    
Sbjct  169   IHFDSFHAVLVGISLHIPLLRAAIHAPSSKVPNNFHATEDVAGENLDGSIQV--FKASFA  226

Query  1471  ARDILLEELRKVSKAINQAIDVNDFSSKHEDKDL  1572
               D LLEE +K+SK INQ ID +DF SK  D  +
Sbjct  227   VSDRLLEEPQKLSKTINQTIDSSDFISKLNDTRM  260



>gb|KHN34258.1| hypothetical protein glysoja_049386 [Glycine soja]
Length=246

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 95/148 (64%), Gaps = 23/148 (16%)
 Frame = +1

Query  631   ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
             +  RL W + GLN+    T + LN+ +   +                     +NH+    
Sbjct  1     MFRRLGWFV-GLNQTNLSTKRLLNADQTASSR--------------------ANHQ--LP  37

Query  811   MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
             +LD V+E+A+YIHRFHNL+LF+QGWY+IKIT+RWE+GD    G P+RVVQYEAP  G+DN
Sbjct  38    ILDVVHEVAVYIHRFHNLNLFEQGWYRIKITLRWEDGDDSHPGVPARVVQYEAPKVGADN  97

Query  991   ICGVWMIDDTDNSYFTQPFRIKYARQDI  1074
             +CGV MIDD DNS+ T  FRI+YARQD+
Sbjct  98    LCGVLMIDDKDNSFSTSSFRIRYARQDV  125



>ref|XP_010548765.1| PREDICTED: uncharacterized protein LOC104820058 isoform X3 [Tarenaya 
hassleriana]
Length=646

 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 123/209 (59%), Gaps = 21/209 (10%)
 Frame = +1

Query  1222  TYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLLKRGVH----------T  1371
             T    VHEFR+PPKAL G HSYCPVHFDA H+VLVD SVHI +LK   +          +
Sbjct  10    TRKIPVHEFRIPPKALTGFHSYCPVHFDALHSVLVDVSVHISVLKSAAYRRPAIQSSDAS  69

Query  1372  LSSKVASGSCSDDASSEDFDKA-----KQVVLIKGFLTARDILLEELRKVSKAINQAIDV  1536
                KV  GS    AS+++  +      K V  +K  L ARDI+LEE++++SKA  QAID+
Sbjct  70    NGEKVTGGSVQ--ASNKELGQMASADKKLVSFVKALLRARDIMLEEMQRLSKAAGQAIDL  127

Query  1537  NDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSLSKD  1716
              +F S   D  LF S  +  S ++ E SGQ   ++Q   +K NG  D +++  L SL+KD
Sbjct  128   TEFISTMNDVLLFDSAPTGKSVED-EGSGQ--GKEQVSLEKLNG-CDLQSDGWLCSLTKD  183

Query  1717  ELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
              L  LF+  G Q+ YLWS FL +HR + T
Sbjct  184   HLSRLFNLLGGQLQYLWSAFLSYHRDNNT  212



>ref|XP_010237907.1| PREDICTED: uncharacterized protein LOC100837726 isoform X2 [Brachypodium 
distachyon]
Length=649

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 130/229 (57%), Gaps = 26/229 (11%)
 Frame = +1

Query  1141  SSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAV  1320
             +S+VILKFELLY P L N    + S DTY A VHEFR+P +ALLGLH+YCPVHFDAFH V
Sbjct  6     TSSVILKFELLYVPTLGNRIETEDSDDTYVAPVHEFRIPYRALLGLHTYCPVHFDAFHPV  65

Query  1321  LVDASVHICLLKRGVHTLSSK-VASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEEL  1497
             LVD ++HI  LK GV   S K +  GSCS           K   +IK  LT+R++LL E+
Sbjct  66    LVDLTIHIVYLKAGVTKSSLKALEQGSCS-----------KVYDIIKALLTSRELLLGEV  114

Query  1498  RKVSKAINQAID--------VNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVS  1653
             +K+S A+ + ++        +  + S H   +L  S  +       +  G +    Q + 
Sbjct  115   KKISNALGKTLEDLEGTDLSLGKYESIHP-TNLSLSSYTNGLHATPKCIGHLTGILQDLL  173

Query  1654  QKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +  +        + L++LSK+EL+ L  +  NQ+  +W+ FLKFHR ++
Sbjct  174   ETSDDAA-----QRLYTLSKEELLELLETVSNQLSLVWNGFLKFHRTNK  217



>emb|CAN63299.1| hypothetical protein VITISV_044137 [Vitis vinifera]
Length=427

 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 88/128 (69%), Gaps = 3/128 (2%)
 Frame = +1

Query  1183  ILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLLKRG  1362
             +LENG  LQASLD   A+V EF++PPKA LGLHSYCP+HFD+FHAVLVD S+HI LL+  
Sbjct  1     MLENGSELQASLDACSASVQEFQIPPKAFLGLHSYCPIHFDSFHAVLVDISLHIPLLRAD  60

Query  1363  VHTLSSKVASG-SCSDDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAIDVN  1539
             +H  SSK+ S     +D + ED D + QV   K    A D LLEE +K+SK INQ ID +
Sbjct  61    IHAPSSKIPSNFHAVEDVAGEDLDGSIQV--FKASFAACDRLLEEPQKLSKTINQTIDSS  118

Query  1540  DFSSKHED  1563
             DF SK  D
Sbjct  119   DFISKLND  126



>ref|XP_010930974.1| PREDICTED: uncharacterized protein LOC105051999 isoform X3 [Elaeis 
guineensis]
Length=732

 Score =   138 bits (348),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 138/208 (66%), Gaps = 18/208 (9%)
 Frame = +1

Query  1231  AAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHICLLKRGVHTLSSKVASGS-CSD  1407
             AAVHEFR+PPK LLGLHSYCPVHFDAFHAVLVD SVH+  LK G +T + KV+S S   +
Sbjct  95    AAVHEFRIPPKGLLGLHSYCPVHFDAFHAVLVDLSVHVVFLKAGTYTHAQKVSSTSQMVE  154

Query  1408  DASSEDFDKAKQVV----------LIKGFLTARDILLEELRKVSKAINQAI-DVNDFS--  1548
             + + E +++  Q++          L+K  L +R++LLEELR++SKAI+Q + D+N+    
Sbjct  155   NHADEHYEEPNQILGQGWISKAIELVKLLLASRELLLEELRRISKAIDQTVEDLNNADLN  214

Query  1549  -SKHEDKDLFTSRQSTSSKDNAEVS---GQMPSQKQSVSQKRNGITDFRNEEVLHSLSKD  1716
               + E     T   STSS D A +    GQ+     ++ +K+NG+ +F N+ +L++LSK+
Sbjct  215   LGRFESISSSTPDSSTSSLDIAGMKMGVGQLVGMLHNILEKKNGVIEFGNDVILYTLSKE  274

Query  1717  ELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             EL+ ++ + G+Q+  +W+ FLKFHR ++
Sbjct  275   ELLDVYFTVGSQLSIIWNAFLKFHRINK  302


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  799  NSQSMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEA  969
            NS +ML+ V+EIA+YIHRFHNLDLFQQGWYQIKI+ RWE+ + +S GTP+RVVQYE 
Sbjct  37   NSPNMLETVHEIAIYIHRFHNLDLFQQGWYQIKISARWEDSNRKSPGTPARVVQYEV  93



>ref|XP_008679702.1| PREDICTED: uncharacterized protein LOC103654636 isoform X4 [Zea 
mays]
 ref|XP_008679703.1| PREDICTED: uncharacterized protein LOC103654636 isoform X4 [Zea 
mays]
 ref|XP_008679704.1| PREDICTED: uncharacterized protein LOC103654636 isoform X4 [Zea 
mays]
Length=664

 Score =   132 bits (332),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 135/233 (58%), Gaps = 27/233 (12%)
 Frame = +1

Query  1141  SSAVILKFELLYAPILENG-CNLQ-ASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFH  1314
             +S+VILKFEL+Y P L N   ++Q +S DT    VHEFR+P +ALLGLHSYCPVHFDA H
Sbjct  16    TSSVILKFELIYIPTLGNAWTDVQDSSDDTDLIPVHEFRIPHRALLGLHSYCPVHFDALH  75

Query  1315  AVLVDASVHICLLKRGVHTLSSKVASGSCSDDASSEDFDKAKQVVLIKGFLTARDILLEE  1494
             + LVD ++HI  LK  V   S K    S            +K   ++K  L +R+ILLEE
Sbjct  76    SALVDLTIHIVYLKAAVTKSSLKPLEQSFG----------SKSYGIVKASLISREILLEE  125

Query  1495  LRKVSKAIN---QAIDVNDFS-SKHED-------KDLFTSRQSTSSKDNAEVSGQMPSQK  1641
             ++K+S A+    + +D  D +  K+E           ++  Q T +K + +++G +    
Sbjct  126   VKKISNAVGSTLEDLDRTDLTLGKYETVQPSKSASPSYSYGQGTPTKCSPQMTGILRDFL  185

Query  1642  QSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +S S    G TD   + +L++LS++EL  LF    +Q+ ++W+ FLKFHR H+
Sbjct  186   ES-SGVVVGSTD---DILLYTLSEEELFELFQIVSSQLSFIWNEFLKFHRTHK  234



>ref|XP_008378702.1| PREDICTED: uncharacterized protein LOC103441782 [Malus domestica]
Length=204

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +1

Query  1141  SSAVILKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAV  1320
             SS +ILKFELL+APIL N  +LQASLD  PAAVHEFR+P KALLGLHSYCPVHFD FHAV
Sbjct  18    SSPIILKFELLHAPILGNRSDLQASLDASPAAVHEFRIPSKALLGLHSYCPVHFDVFHAV  77

Query  1321  LVDASVHICLLKRGVHTLSSKVASGSCS-DDASSEDFDKAKQVV  1449
             LVD SVHI LLK   +T   KV S S + ++  +E    + Q +
Sbjct  78    LVDVSVHISLLKAVSYTHPLKVPSDSSTPENVGTEGXSGSNQCI  121



>emb|CAN73093.1| hypothetical protein VITISV_041305 [Vitis vinifera]
Length=197

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +1

Query  1165  ELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLVDASVHI  1344
             EL+YAP+LENG  L ASLD    +VHEF++PPK+ LGLHSYCP+HFD+FHAVLVD S+HI
Sbjct  88    ELMYAPMLENGSELHASLDACSTSVHEFQIPPKSFLGLHSYCPIHFDSFHAVLVDISLHI  147

Query  1345  CLLKRGVHTLSSKVASG-SCSDDASSEDFDKAKQVVLIKGFLTARDILLEEL  1497
              LL+ G+H  SSKV +     +D + E+ D + QV   K    A D LLE L
Sbjct  148   PLLRAGIHAPSSKVPNNFHVVEDIAGENLDGSIQV--FKASFVACDRLLEGL  197



>emb|CAN75944.1| hypothetical protein VITISV_040742 [Vitis vinifera]
Length=464

 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 70/121 (58%), Gaps = 28/121 (23%)
 Frame = +1

Query  631  ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
            +  RLRW I G+N  A  +PKRL + + +P                             +
Sbjct  1    MFRRLRWFI-GMNHRAAASPKRLANAKPKP---------------------------PPA  32

Query  811  MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSDN  990
            ML+ V EIA+YIHRFHNLDLFQQGWYQIKITMRWE+ ++E  GTP+RVVQYEA   G   
Sbjct  33   MLETVQEIAIYIHRFHNLDLFQQGWYQIKITMRWEDEEFELPGTPARVVQYEADRNGGSK  92

Query  991  I  993
            I
Sbjct  93   I  93



>ref|XP_006432280.1| hypothetical protein CICLE_v10000310mg [Citrus clementina]
 gb|ESR45520.1| hypothetical protein CICLE_v10000310mg [Citrus clementina]
Length=576

 Score = 94.7 bits (234),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 16/123 (13%)
 Frame = +1

Query  1435  AKQVVLIKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAE  1614
             + Q++LIK   +ARDILLE+L+++SKAI+QAID++D         LF S        + E
Sbjct  34    STQLMLIKALFSARDILLEDLKEISKAIDQAIDLDDM--------LFGSM-------DGE  78

Query  1615  VSGQMPSQKQS-VSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHR  1791
             V  Q+    Q+ V +K +G  D +++ + HSL  D+L+  FH+ GNQ+ YLW+ FL FHR
Sbjct  79    VPVQLLGMPQNGVERKADGAKDLQSDGLSHSLPWDDLLNAFHTLGNQILYLWNTFLMFHR  138

Query  1792  AHR  1800
             A+R
Sbjct  139   ANR  141



>ref|XP_007159043.1| hypothetical protein PHAVU_002G203900g [Phaseolus vulgaris]
 gb|ESW31037.1| hypothetical protein PHAVU_002G203900g [Phaseolus vulgaris]
Length=95

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 22/113 (19%)
 Frame = +1

Query  631  ILERLRWIIAGLNRPAPVTPKRLNSTEARPTsllsssqkqqsqpmksnsksLSNHRNSQS  810
            +  RLRW + GLN     T + +N     P                      S   N   
Sbjct  1    MFRRLRWFV-GLNHKNWSTKRLVNVEHQHPG---------------------SARPNQLP  38

Query  811  MLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEA  969
            +LDAV+E+A+YIHRFHNLDLF+QGWY+IKITM+ E+G+    G P+RVVQYE 
Sbjct  39   VLDAVHEVAIYIHRFHNLDLFEQGWYKIKITMKREDGEDSYPGIPARVVQYEG  91



>gb|KDO50640.1| hypothetical protein CISIN_1g003622mg [Citrus sinensis]
Length=539

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 75/119 (63%), Gaps = 16/119 (13%)
 Frame = +1

Query  1447  VLIKGFLTARDILLEELRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQ  1626
             +LIK   +ARDILLE+L+++SKAI+QAID++D         LF S        + EV  Q
Sbjct  1     MLIKALFSARDILLEDLKEISKAIDQAIDLDDM--------LFGSM-------DGEVPVQ  45

Query  1627  MPSQKQS-VSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHR  1800
             +    Q+ V +K +G  D +++ + HSL  D+L+  FH+ GNQ+ YLW+ FL FHRA+R
Sbjct  46    LLGMPQNGVERKADGAKDLQSDGLSHSLPWDDLLNAFHTLGNQILYLWNTFLMFHRANR  104



>ref|XP_004170721.1| PREDICTED: LOW QUALITY PROTEIN: protein FAM135B-like, partial 
[Cucumis sativus]
Length=500

 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 79/150 (53%), Gaps = 13/150 (9%)
 Frame = +1

Query  1360  GVHTLSSKVASGSCS--DDASSEDFDKAKQVVLIKGFLTARDILLEELRKVSKAINQAID  1533
             G HT +  V    C+   +AS ++    K V LIK  LTARDILLEE + +SKAI+Q +D
Sbjct  16    GPHTAAMLVEFCGCALVVEASRDE----KDVTLIKALLTARDILLEEFQNLSKAIDQTVD  71

Query  1534  VNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSLSK  1713
               DF S  +D   +      S +DN +         Q+  ++ NG   F      H  + 
Sbjct  72    FTDFISAMDDTK-YVDVLIPSKRDNVKGEAAGQGNPQNSLKRTNGGDQF------HQRAD  124

Query  1714  DELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
               +   FHS G+Q+ YLWS FLKFHRA++T
Sbjct  125   SHMSHRFHSLGDQLLYLWSTFLKFHRANKT  154



>ref|XP_006596303.1| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic-like 
[Glycine max]
Length=325

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +1

Query  967   APDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSS  1146
             AP+ G+DN+C V MIDD DNS+ T  FRI+YARQD++L++++SF +S  +YE      SS
Sbjct  240   APEVGADNLCEVLMIDDKDNSFSTPSFRIRYARQDVILAIMISFYVSYGRYE----GKSS  295

Query  1147  AVILKFELLYAPILE  1191
             AVIL FEL + P LE
Sbjct  296   AVILNFELFHTPTLE  310



>gb|KHN34458.1| Nucleoside diphosphate kinase 2, chloroplastic [Glycine soja]
Length=233

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +1

Query  967   APDTGSDNICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSS  1146
             AP+ G+DN+C V MIDD DNS+ T  FRI+YARQD++L++++SF +S  +Y+      SS
Sbjct  148   APEVGADNLCEVLMIDDKDNSFSTPSFRIRYARQDVILAIMISFYVSYGRYK----GKSS  203

Query  1147  AVILKFELLYAPILE  1191
             AVIL FEL + P LE
Sbjct  204   AVILNFELFHTPTLE  218



>gb|AAB60753.1| F21M12.37 gene product [Arabidopsis thaliana]
Length=553

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 15/117 (13%)
 Frame = +1

Query  1495  LRKVSKAINQAIDVNDFSSKHEDKDLFTSRQSTSSKDNAEVSGQMPSQKQSV--------  1650
             ++++SKA+ Q +D+++F S   D  L +   ST      E SGQ  S   +V        
Sbjct  1     MQRLSKAVGQTVDLSEFVSS-MDNALLSDSGSTGKSVEVEGSGQEYSIYNTVFCYLLEYK  59

Query  1651  ------SQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFHRAHRT  1803
                   +QK NG  D  +++ LH+ SK+ L   FH  G Q+ YLW+ FL  HR + T
Sbjct  60    LFSPFLTQKLNGPFDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNTFLTLHRDNYT  116



>dbj|BAJ85156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=575

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (55%), Gaps = 7/124 (6%)
 Frame = +1

Query  1450  LIKGFLTARDILLEELRKVSKAINQAI---DVNDFS-SKHEDKDLFTSRQSTSSKD---N  1608
             ++K  LT+R++LLEEL+K+S A+ + I   D  DFS  K+E           S K     
Sbjct  20    IVKALLTSREMLLEELKKISGAVGKTIEDLDDADFSLGKYESLQSSKPVHPDSGKVFPVT  79

Query  1609  AEVSGQMPSQKQSVSQKRNGITDFRNEEVLHSLSKDELVGLFHSFGNQVFYLWSIFLKFH  1788
              +  G +        ++ N + D  ++ +L++LS +EL+ LF +  +Q+  LW+ FLKFH
Sbjct  80    TKGVGHLAGILHDFLERPNDVVDGTSDGMLYTLSSEELLELFITVSSQLSLLWNAFLKFH  139

Query  1789  RAHR  1800
             R ++
Sbjct  140   RINK  143



>ref|XP_003760456.1| PREDICTED: protein FAM135B [Sarcophilus harrisii]
Length=1432

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 96/189 (51%), Gaps = 24/189 (13%)
 Frame = +1

Query  808   SMLDAVYEIALYIHRFHNLDLFQQGWYQIKITMRWENGDYESVGTPSRVVQYEAPDTGSD  987
             S +    E ++ +H+FHN+DLFQ+G YQ+++T++           PSR+    +   G  
Sbjct  2     SEVQGTVEFSVELHKFHNVDLFQRGHYQVRVTLK----------VPSRIPHRLSVKIGGQ  51

Query  988   ----NICGVWMIDDTDNSYFTQPFRIKYARQDIllsvlvsfnlslsKYEVLRMSHSSAVI  1155
                 N+    + D+T NS     F+I Y  ++I+++ L++F + L   +  R+ ++ + +
Sbjct  52    TEVSNLGSASVQDNTGNSRI---FQILYRNEEIVINELMTFRVHLL-LDGERVENALSEV  107

Query  1156  ---LKFELLYAPILENGCNLQASLDTYPAAVHEFRLPPKALLGLHSYCPVHFDAFHAVLV  1326
                LK +L +    +   +L A++ T  +   +    P+   GLH Y PV FD FH  ++
Sbjct  108   DFQLKLDLHFTESEQQARDL-AAMPTISSRTLDLHFQPRK--GLHHYIPVMFDYFHLSVI  164

Query  1327  DASVHICLL  1353
               ++H  L+
Sbjct  165   SMTIHASLV  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5415623577640