BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24457_g4_i1 len=991 path=[23157:0-435 17269:436-437 13920:438-461
17294:462-534 17367:535-545 24679:546-563 18067:564-990]

Length=991
                                                                      Score     E

ref|XP_009606258.1|  PREDICTED: polygalacturonase QRT2-like             400   3e-134   
ref|XP_009767751.1|  PREDICTED: polygalacturonase QRT2-like             400   5e-134   
ref|XP_006345284.1|  PREDICTED: polygalacturonase QRT2-like             395   5e-132   
ref|XP_011093565.1|  PREDICTED: probable polygalacturonase At1g80170    392   3e-131   
ref|XP_004252072.1|  PREDICTED: polygalacturonase QRT2                  392   4e-131   
ref|XP_011078329.1|  PREDICTED: polygalacturonase QRT2-like isofo...    385   7e-130   
ref|XP_011078326.1|  PREDICTED: polygalacturonase QRT2-like isofo...    387   2e-129   
ref|XP_011078321.1|  PREDICTED: polygalacturonase QRT2-like isofo...    387   2e-129   
gb|EYU23048.1|  hypothetical protein MIMGU_mgv1a026845mg                377   8e-126   
ref|XP_010047836.1|  PREDICTED: probable polygalacturonase At1g80170    372   3e-123   
ref|XP_009368885.1|  PREDICTED: polygalacturonase-like                  362   2e-119   
ref|XP_010241947.1|  PREDICTED: polygalacturonase ADPG1-like            359   3e-117   
ref|XP_004287324.1|  PREDICTED: probable polygalacturonase At1g80...    353   1e-115   
ref|XP_008242767.1|  PREDICTED: probable polygalacturonase At1g80170    350   2e-114   
ref|XP_009781155.1|  PREDICTED: probable polygalacturonase At1g80170    337   8e-110   
ref|XP_007203411.1|  hypothetical protein PRUPE_ppa021427mg             330   3e-107   
ref|XP_007013436.1|  F18B13.22 protein isoform 1                        323   4e-104   
ref|XP_011078328.1|  PREDICTED: polygalacturonase-like isoform X3       319   3e-103   
ref|XP_010688006.1|  PREDICTED: probable polygalacturonase At1g80170    320   6e-103   
ref|XP_010533164.1|  PREDICTED: probable polygalacturonase At3g15...    319   2e-102   
ref|XP_007023162.1|  JHL06P13.4 protein, putative                       318   2e-102   
gb|KHG17941.1|  hypothetical protein F383_07844                         318   4e-102   
ref|XP_007013439.1|  F18B13.22 protein isoform 4                        315   4e-102   
ref|XP_007013437.1|  F18B13.22 protein isoform 2                        305   1e-97    
ref|XP_006427258.1|  hypothetical protein CICLE_v10026919mg             300   5e-95    
ref|XP_010250371.1|  PREDICTED: probable polygalacturonase At1g80170    296   3e-93    
ref|XP_010254486.1|  PREDICTED: polygalacturonase ADPG1-like            294   4e-92    
ref|XP_010251986.1|  PREDICTED: polygalacturonase-like                  286   2e-90    
ref|XP_009385170.1|  PREDICTED: polygalacturonase QRT2-like             283   3e-88    
ref|XP_009779799.1|  PREDICTED: polygalacturonase QRT2-like             276   3e-87    
ref|XP_010533165.1|  PREDICTED: probable polygalacturonase At3g15...    271   3e-84    
gb|KGN60675.1|  hypothetical protein Csa_2G006210                       266   6e-83    
ref|XP_007148884.1|  hypothetical protein PHAVU_005G022500g             266   2e-81    
ref|XP_004959073.1|  PREDICTED: polygalacturonase-like                  265   3e-81    
gb|KHN45091.1|  Polygalacturonase                                       263   3e-81    
gb|EMT17063.1|  Polygalacturonase                                       263   4e-81    
ref|XP_004499889.1|  PREDICTED: polygalacturonase QRT2-like             263   1e-80    
ref|XP_003545985.2|  PREDICTED: polygalacturonase-like                  263   2e-80    
gb|EEC81719.1|  hypothetical protein OsI_25337                          263   2e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_010548804.1|  PREDICTED: polygalacturonase QRT2                  262   3e-80    
dbj|BAC57279.1|  putative polygalacturonase PG1                         262   3e-80    Oryza sativa Japonica Group [Japonica rice]
dbj|BAC57273.1|  putative polygalacturonase PG1                         261   4e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010250372.1|  PREDICTED: polygalacturonase ADPG1-like            262   1e-79    
ref|XP_004172064.1|  PREDICTED: polygalacturonase QRT2-like             257   1e-79    
ref|XP_004981339.1|  PREDICTED: polygalacturonase-like                  263   2e-79    
ref|XP_011007737.1|  PREDICTED: probable polygalacturonase At1g80170    259   3e-79    
gb|EAZ39077.1|  hypothetical protein OsJ_23509                          261   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465486.1|  PREDICTED: probable polygalacturonase At3g15...    267   4e-79    
gb|KHM99207.1|  Polygalacturonase                                       259   5e-79    
ref|XP_003537159.2|  PREDICTED: polygalacturonase-like                  259   6e-79    
ref|XP_006664897.1|  PREDICTED: polygalacturonase-like                  259   6e-79    
gb|KDO45211.1|  hypothetical protein CISIN_1g041224mg                   257   1e-78    
ref|XP_010088223.1|  Polygalacturonase QRT2                             257   2e-78    
ref|XP_002466241.1|  hypothetical protein SORBIDRAFT_01g004190          258   2e-78    Sorghum bicolor [broomcorn]
ref|XP_006427250.1|  hypothetical protein CICLE_v10027074mg             256   4e-78    
ref|XP_010557796.1|  PREDICTED: polygalacturonase QRT2-like             258   4e-78    
ref|XP_010654934.1|  PREDICTED: probable polygalacturonase At3g15720    255   6e-78    
emb|CDY07963.1|  BnaC03g35600D                                          256   1e-77    
ref|XP_010431659.1|  PREDICTED: probable polygalacturonase At1g80170    251   1e-77    
ref|XP_006427249.1|  hypothetical protein CICLE_v10027366mg             255   2e-77    
gb|KCW79829.1|  hypothetical protein EUGRSUZ_C01172                     248   2e-77    
ref|XP_006345498.1|  PREDICTED: polygalacturonase QRT2-like             254   2e-77    
ref|XP_011048121.1|  PREDICTED: polygalacturonase                       256   2e-77    
ref|XP_004135935.1|  PREDICTED: polygalacturonase QRT2-like             255   3e-77    
ref|XP_011020366.1|  PREDICTED: polygalacturonase-like                  255   3e-77    
ref|XP_003566989.1|  PREDICTED: polygalacturonase-like                  254   3e-77    
ref|XP_002282772.1|  PREDICTED: polygalacturonase                       255   3e-77    Vitis vinifera
ref|XP_003566446.1|  PREDICTED: polygalacturonase-like                  254   4e-77    
ref|XP_002282759.1|  PREDICTED: polygalacturonase                       254   5e-77    Vitis vinifera
ref|XP_006658431.1|  PREDICTED: polygalacturonase-like                  253   6e-77    
gb|EMS53068.1|  Polygalacturonase                                       253   6e-77    
ref|XP_002463688.1|  hypothetical protein SORBIDRAFT_01g004230          254   6e-77    Sorghum bicolor [broomcorn]
emb|CAN64004.1|  hypothetical protein VITISV_043286                     253   1e-76    Vitis vinifera
emb|CDP18643.1|  unnamed protein product                                253   1e-76    
ref|XP_009800089.1|  PREDICTED: polygalacturonase-like                  253   1e-76    
ref|XP_010671219.1|  PREDICTED: probable polygalacturonase At3g15720    254   1e-76    
ref|XP_003632658.2|  PREDICTED: polygalacturonase                       253   2e-76    
ref|XP_008240888.1|  PREDICTED: polygalacturonase                       253   2e-76    
ref|XP_002277214.2|  PREDICTED: polygalacturonase isoform X1            252   3e-76    Vitis vinifera
ref|XP_010464443.1|  PREDICTED: polygalacturonase QRT2-like             252   3e-76    
ref|XP_006657550.1|  PREDICTED: polygalacturonase-like                  251   3e-76    
ref|XP_009135014.1|  PREDICTED: polygalacturonase QRT2-like isofo...    252   4e-76    
ref|XP_002308956.2|  hypothetical protein POPTR_0006s05120g             252   4e-76    Populus trichocarpa [western balsam poplar]
ref|XP_006421419.1|  hypothetical protein CICLE_v10005317mg             249   5e-76    
ref|XP_002889308.1|  hypothetical protein ARALYDRAFT_316947             249   5e-76    
ref|XP_004231118.1|  PREDICTED: polygalacturonase-like                  251   6e-76    
ref|XP_010545772.1|  PREDICTED: probable polygalacturonase At3g15...    249   6e-76    
ref|XP_010486374.1|  PREDICTED: polygalacturonase QRT2                  251   9e-76    
emb|CDP07789.1|  unnamed protein product                                251   9e-76    
ref|XP_010472981.1|  PREDICTED: probable polygalacturonase At3g15...    249   9e-76    
emb|CDY37571.1|  BnaA02g19990D                                          248   2e-75    
emb|CAN83753.1|  hypothetical protein VITISV_026267                     250   2e-75    Vitis vinifera
ref|XP_010545769.1|  PREDICTED: probable polygalacturonase At3g15...    250   2e-75    
ref|XP_002277234.1|  PREDICTED: polygalacturonase                       249   3e-75    Vitis vinifera
ref|XP_004289976.1|  PREDICTED: polygalacturonase-like                  249   4e-75    
emb|CDY38648.1|  BnaC02g23310D                                          247   5e-75    
ref|XP_009147011.1|  PREDICTED: polygalacturonase QRT2-like             249   5e-75    
ref|XP_007203487.1|  hypothetical protein PRUPE_ppa022427mg             248   6e-75    
ref|XP_010667059.1|  PREDICTED: polygalacturonase-like isoform X1       248   6e-75    
emb|CDX74019.1|  BnaA03g30280D                                          249   6e-75    
gb|EMT24271.1|  Polygalacturonase                                       248   8e-75    
gb|KGN52445.1|  hypothetical protein Csa_5G635400                       248   8e-75    
ref|XP_002466242.1|  hypothetical protein SORBIDRAFT_01g004220          249   8e-75    Sorghum bicolor [broomcorn]
ref|XP_006465488.1|  PREDICTED: uncharacterized protein LOC102623476    257   8e-75    
ref|XP_006292816.1|  hypothetical protein CARUB_v10019065mg             248   9e-75    
gb|EAZ03178.1|  hypothetical protein OsI_25331                          248   9e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_008665635.1|  PREDICTED: polygalacturonase-like                  248   1e-74    
ref|XP_004986167.1|  PREDICTED: polygalacturonase-like                  248   1e-74    
gb|EMS52449.1|  Polygalacturonase                                       247   2e-74    
ref|XP_003595746.1|  Polygalacturonase                                  248   2e-74    
gb|KFK38249.1|  hypothetical protein AALP_AA3G088700                    247   2e-74    
gb|KCW90200.1|  hypothetical protein EUGRSUZ_A02373                     246   2e-74    
ref|XP_006489947.1|  PREDICTED: polygalacturonase-like                  248   2e-74    
gb|KCW66098.1|  hypothetical protein EUGRSUZ_G03373                     246   2e-74    
ref|XP_008665639.1|  PREDICTED: polygalacturonase ADPG2-like            248   2e-74    
emb|CAD21651.2|  endo polygalacturonase                                 247   2e-74    Brassica rapa subsp. rapa
ref|XP_006299494.1|  hypothetical protein CARUB_v10015662mg             247   2e-74    
gb|AAF21207.1|AC013483_31  putative polygalacturonase                   247   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187454.2|  polygalacturonase QRT2                                247   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461801.1|  PREDICTED: polygalacturonase-like                  247   3e-74    
ref|XP_011093353.1|  PREDICTED: polygalacturonase QRT2-like             247   3e-74    
emb|CBI36303.3|  unnamed protein product                                246   3e-74    
ref|XP_008665637.1|  PREDICTED: polygalacturonase ADPG1-like isof...    247   3e-74    
ref|XP_002313308.2|  hypothetical protein POPTR_0009s06520g             246   4e-74    Populus trichocarpa [western balsam poplar]
ref|XP_007013438.1|  F18B13.22 protein isoform 3                        241   5e-74    
ref|XP_010024123.1|  PREDICTED: polygalacturonase                       245   8e-74    
ref|XP_002517823.1|  Polygalacturonase precursor, putative              246   9e-74    Ricinus communis
ref|XP_010067866.1|  PREDICTED: polygalacturonase-like                  246   9e-74    
gb|KGN52885.1|  hypothetical protein Csa_4G004940                       245   1e-73    
ref|XP_006407776.1|  hypothetical protein EUTSA_v10020758mg             245   1e-73    
ref|XP_011025443.1|  PREDICTED: polygalacturonase QRT2-like             246   1e-73    
ref|XP_002878158.1|  endo-polygalacturonase 1                           245   1e-73    
ref|XP_002882564.1|  predicted protein                                  245   1e-73    
ref|XP_004149736.1|  PREDICTED: polygalacturonase-like                  245   1e-73    
ref|XP_009396710.1|  PREDICTED: polygalacturonase ADPG1-like            244   1e-73    
ref|XP_010695185.1|  PREDICTED: polygalacturonase QRT2                  246   2e-73    
ref|XP_010523935.1|  PREDICTED: polygalacturonase ADPG2-like            245   2e-73    
ref|XP_010663872.1|  PREDICTED: probable polygalacturonase At3g15720    244   2e-73    
ref|NP_001234256.1|  polygalacturonase                                  245   2e-73    
ref|XP_010257197.1|  PREDICTED: polygalacturonase                       245   2e-73    
gb|KGN58587.1|  hypothetical protein Csa_3G690840                       245   3e-73    
ref|XP_009379633.1|  PREDICTED: polygalacturonase                       245   3e-73    
ref|XP_009135015.1|  PREDICTED: polygalacturonase QRT2-like isofo...    244   3e-73    
ref|XP_004986166.1|  PREDICTED: polygalacturonase-like                  246   3e-73    
ref|XP_004506353.1|  PREDICTED: polygalacturonase-like                  244   3e-73    
ref|NP_178131.1|  pectin lyase-like protein                             241   4e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003599234.1|  Polygalacturonase                                  244   4e-73    
ref|XP_003607885.1|  hypothetical protein MTR_4g084050                  243   4e-73    
gb|AAD55472.1|AC009322_12  Similar to polygalacturonases                242   5e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KHN46507.1|  Polygalacturonase                                       244   5e-73    
ref|NP_191310.1|  polygalacturonase ADPG1                               243   6e-73    Arabidopsis thaliana [mouse-ear cress]
gb|EMT24418.1|  Polygalacturonase                                       241   6e-73    
ref|XP_010653828.1|  PREDICTED: polygalacturonase isoform X2            243   6e-73    
ref|XP_009354806.1|  PREDICTED: polygalacturonase                       243   6e-73    
gb|KHG04134.1|  hypothetical protein F383_30138                         243   6e-73    
emb|CDY14791.1|  BnaC04g47880D                                          243   6e-73    
ref|XP_007032441.1|  Polygalacturonase-like protein, putative           244   7e-73    
ref|XP_004498026.1|  PREDICTED: probable polygalacturonase At3g15...    242   8e-73    
ref|XP_009142016.1|  PREDICTED: polygalacturonase ADPG2-like            243   8e-73    
ref|XP_006364199.1|  PREDICTED: probable polygalacturonase At1g80...    244   8e-73    
ref|XP_006389759.1|  hypothetical protein EUTSA_v10019484mg             240   8e-73    
ref|XP_003561199.1|  PREDICTED: polygalacturonase ADPG1-like            244   1e-72    
ref|XP_010266762.1|  PREDICTED: probable polygalacturonase At3g15720    243   1e-72    
ref|XP_003559272.2|  PREDICTED: polygalacturonase ADPG1-like            242   1e-72    
emb|CAA65072.1|  polygalacturonase                                      242   2e-72    Brassica napus [oilseed rape]
ref|XP_010102536.1|  hypothetical protein L484_018006                   243   2e-72    
ref|XP_004498018.1|  PREDICTED: probable polygalacturonase At3g15...    241   2e-72    
ref|XP_009802084.1|  PREDICTED: probable polygalacturonase At1g80170    243   2e-72    
ref|NP_001140231.1|  uncharacterized protein LOC100272271 precursor     243   2e-72    Zea mays [maize]
ref|XP_006439105.1|  hypothetical protein CICLE_v10033386mg             241   2e-72    
ref|XP_004152352.1|  PREDICTED: probable polygalacturonase At3g15...    241   2e-72    
ref|XP_009420908.1|  PREDICTED: polygalacturonase-like                  241   2e-72    
ref|XP_002322711.2|  polygalacturonase family protein                   243   2e-72    Populus trichocarpa [western balsam poplar]
emb|CDX75843.1|  BnaC03g39260D                                          243   2e-72    
ref|XP_006483679.1|  PREDICTED: polygalacturonase-like                  242   2e-72    
ref|XP_004164154.1|  PREDICTED: polygalacturonase-like                  246   3e-72    
ref|XP_010419394.1|  PREDICTED: probable polygalacturonase At3g15720    241   3e-72    
gb|KDO45212.1|  hypothetical protein CISIN_1g047738mg                   240   3e-72    
ref|XP_011078892.1|  PREDICTED: polygalacturonase                       242   3e-72    
ref|NP_001284447.1|  polygalacturonase QRT2 precursor                   242   4e-72    
ref|XP_009613568.1|  PREDICTED: polygalacturonase-like                  242   4e-72    
ref|XP_011024398.1|  PREDICTED: probable polygalacturonase At1g80170    241   4e-72    
ref|XP_002529616.1|  Polygalacturonase precursor, putative              242   6e-72    Ricinus communis
emb|CDY58462.1|  BnaA03g57500D                                          241   6e-72    
ref|XP_006402870.1|  hypothetical protein EUTSA_v10005982mg             241   6e-72    
ref|XP_004139416.1|  PREDICTED: probable polygalacturonase At1g80...    236   7e-72    
ref|XP_006301655.1|  hypothetical protein CARUB_v10022105mg             238   7e-72    
ref|XP_007018009.1|  Pectin lyase-like superfamily protein, putative    239   8e-72    
ref|XP_010030771.1|  PREDICTED: probable polygalacturonase At1g80170    240   8e-72    
ref|XP_004156878.1|  PREDICTED: probable polygalacturonase At3g15...    240   9e-72    
ref|NP_001237524.1|  polygalacturonase precursor                        241   9e-72    
ref|XP_009135455.1|  PREDICTED: probable polygalacturonase At3g15720    241   1e-71    
ref|XP_010435969.1|  PREDICTED: probable polygalacturonase At1g80170    239   1e-71    
ref|XP_002266543.3|  PREDICTED: probable polygalacturonase At3g15720    238   2e-71    Vitis vinifera
gb|EYU29034.1|  hypothetical protein MIMGU_mgv1a022147mg                239   2e-71    
ref|XP_008375262.1|  PREDICTED: polygalacturonase-like                  239   2e-71    
ref|XP_007219828.1|  hypothetical protein PRUPE_ppa026655mg             238   2e-71    
emb|CDY06902.1|  BnaA04g24130D                                          239   2e-71    
ref|XP_010032438.1|  PREDICTED: polygalacturonase                       239   2e-71    
gb|KFK35000.1|  hypothetical protein AALP_AA5G221100                    239   2e-71    
gb|KHN08870.1|  Polygalacturonase                                       238   2e-71    
ref|XP_010445667.1|  PREDICTED: probable polygalacturonase At1g80170    239   3e-71    
ref|XP_010417741.1|  PREDICTED: probable polygalacturonase At1g80170    239   3e-71    
emb|CAA11846.1|  polygalacturonase                                      236   4e-71    Rubus idaeus [European raspberry]
ref|XP_011033319.1|  PREDICTED: polygalacturonase-like                  239   4e-71    
gb|ACJ06505.1|  polygalacturonase                                       239   4e-71    Diospyros kaki [Japanese persimmon]
ref|XP_009418868.1|  PREDICTED: polygalacturonase ADPG1-like            237   5e-71    
gb|ACJ06506.1|  polygalacturonase                                       239   5e-71    Diospyros kaki [Japanese persimmon]
ref|XP_010554840.1|  PREDICTED: polygalacturonase ADPG2-like            238   5e-71    
gb|EMT22808.1|  Polygalacturonase ADPG1                                 238   5e-71    
ref|XP_006356262.1|  PREDICTED: probable polygalacturonase At1g80...    238   6e-71    
sp|P35336.1|PGLR_ACTDE  RecName: Full=Polygalacturonase; Short=PG...    239   7e-71    Actinidia deliciosa [Chinese gooseberry]
gb|KFK42419.1|  hypothetical protein AALP_AA2G253800                    238   7e-71    
emb|CBI36307.3|  unnamed protein product                                237   9e-71    
gb|AAL30418.1|AF434714_1  dehiscence-related endopolygalaturonase       238   1e-70    Glycine max [soybeans]
ref|XP_003537285.1|  PREDICTED: polygalacturonase-like                  238   1e-70    
ref|XP_010450754.1|  PREDICTED: probable polygalacturonase At1g80170    237   1e-70    
ref|XP_009802467.1|  PREDICTED: polygalacturonase-2-like                238   1e-70    
gb|EAZ03180.1|  hypothetical protein OsI_25333                          236   1e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_004497875.1|  PREDICTED: probable polygalacturonase At3g15...    236   1e-70    
emb|CDX72025.1|  BnaC08g28490D                                          237   1e-70    
ref|XP_009146202.1|  PREDICTED: probable polygalacturonase At3g15...    238   1e-70    
ref|XP_010654779.1|  PREDICTED: probable polygalacturonase At3g15720    237   1e-70    
ref|XP_009146201.1|  PREDICTED: probable polygalacturonase At3g15...    238   1e-70    
emb|CAC05657.1|  endopolygalacturonase                                  237   1e-70    Brassica napus [oilseed rape]
ref|XP_006406925.1|  hypothetical protein EUTSA_v10020740mg             237   2e-70    
emb|CBI15273.3|  unnamed protein product                                236   2e-70    
gb|KHG17940.1|  hypothetical protein F383_07843                         236   2e-70    
gb|AHG12641.1|  polygalacturonase                                       238   2e-70    
ref|XP_010034237.1|  PREDICTED: polygalacturonase-like                  236   2e-70    
ref|XP_009594191.1|  PREDICTED: probable polygalacturonase At1g80170    237   2e-70    
ref|XP_004308193.1|  PREDICTED: probable polygalacturonase At3g15...    238   3e-70    
ref|XP_010254484.1|  PREDICTED: probable polygalacturonase At3g15720    232   3e-70    
ref|XP_009799918.1|  PREDICTED: probable polygalacturonase At1g80170    237   3e-70    
gb|KHG01626.1|  hypothetical protein F383_22075                         235   3e-70    
ref|XP_006838303.1|  hypothetical protein AMTR_s00103p00121270          237   3e-70    
ref|XP_010254483.1|  PREDICTED: probable polygalacturonase At3g15720    236   4e-70    
gb|AAX09642.1|  polygalacturonase                                       231   4e-70    Malus domestica [apple tree]
ref|NP_001045783.1|  Os02g0130200                                       238   5e-70    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ39079.1|  hypothetical protein OsJ_23511                          234   5e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003546050.2|  PREDICTED: probable polygalacturonase At1g80...    235   5e-70    
gb|ACJ06507.1|  polygalacturonase                                       236   5e-70    Diospyros kaki [Japanese persimmon]
dbj|BAD07736.1|  putative polygalacturonase                             237   5e-70    Oryza sativa Japonica Group [Japonica rice]
gb|KHN22454.1|  Putative polygalacturonase                              235   6e-70    
ref|XP_009334648.1|  PREDICTED: probable polygalacturonase At3g15720    234   6e-70    
gb|EEC72414.1|  hypothetical protein OsI_05716                          237   6e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_004241700.1|  PREDICTED: probable polygalacturonase At1g80170    236   7e-70    
ref|XP_007131458.1|  hypothetical protein PHAVU_011G015100g             236   7e-70    
emb|CDX97704.1|  BnaA05g23750D                                          236   7e-70    
ref|XP_006595163.1|  PREDICTED: probable polygalacturonase At3g15...    234   7e-70    
ref|NP_565232.1|  putative polygalacturonase                            236   7e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CBI24903.3|  unnamed protein product                                235   7e-70    
dbj|BAC57275.1|  putative polygalacturonase precursor                   234   8e-70    Oryza sativa Japonica Group [Japonica rice]
gb|KEH41561.1|  endo polygalacturonase                                  236   8e-70    
emb|CDX69569.1|  BnaA10g19180D                                          235   8e-70    
ref|XP_010429999.1|  PREDICTED: probable polygalacturonase At1g80170    236   8e-70    
ref|XP_003633562.2|  PREDICTED: polygalacturonase-like isoform X1       236   8e-70    
ref|XP_009336112.1|  PREDICTED: polygalacturonase-like                  236   8e-70    
gb|KHN44172.1|  Putative polygalacturonase                              234   9e-70    
ref|XP_009104062.1|  PREDICTED: polygalacturonase ADPG1                 235   9e-70    
gb|AER27666.1|  polygalacturonase                                       236   1e-69    
ref|XP_009121648.1|  PREDICTED: polygalacturonase At1g48100 isofo...    235   1e-69    
ref|XP_009142785.1|  PREDICTED: polygalacturonase ADPG2-like            235   1e-69    
ref|XP_010472976.1|  PREDICTED: probable polygalacturonase At1g80170    235   1e-69    
ref|XP_008231271.1|  PREDICTED: polygalacturonase                       235   1e-69    
ref|XP_008349824.1|  PREDICTED: polygalacturonase                       234   1e-69    
ref|XP_009619865.1|  PREDICTED: probable polygalacturonase At3g15720    234   1e-69    
ref|XP_010937534.1|  PREDICTED: polygalacturonase-like                  240   1e-69    
ref|XP_008337027.1|  PREDICTED: probable polygalacturonase At3g15720    233   2e-69    
gb|KDP43482.1|  hypothetical protein JCGZ_16769                         234   2e-69    
emb|CBI36306.3|  unnamed protein product                                236   2e-69    
ref|XP_003581528.1|  PREDICTED: polygalacturonase-2                     234   2e-69    
ref|XP_010465559.1|  PREDICTED: probable polygalacturonase At3g15...    234   2e-69    
ref|XP_006367078.1|  PREDICTED: probable polygalacturonase At1g80...    233   2e-69    
ref|XP_010487406.1|  PREDICTED: probable polygalacturonase At3g15...    234   2e-69    
ref|XP_010551910.1|  PREDICTED: polygalacturonase At1g48100 isofo...    235   2e-69    
ref|XP_002885106.1|  glycoside hydrolase family 28 protein              235   2e-69    
ref|XP_006845770.1|  hypothetical protein AMTR_s00019p00250890          233   2e-69    
ref|XP_010061913.1|  PREDICTED: probable polygalacturonase At3g15720    233   2e-69    
ref|XP_007163810.1|  hypothetical protein PHAVU_001G266200g             233   2e-69    
emb|CDY35976.1|  BnaA05g29740D                                          234   3e-69    
ref|XP_010487407.1|  PREDICTED: probable polygalacturonase At3g15...    234   3e-69    
emb|CDY48768.1|  BnaC04g02210D                                          234   3e-69    
gb|KHG25769.1|  hypothetical protein F383_09976                         233   3e-69    
ref|XP_004952014.1|  PREDICTED: probable polygalacturonase At1g80...    236   3e-69    
ref|XP_010551909.1|  PREDICTED: polygalacturonase At1g48100 isofo...    234   3e-69    
emb|CDY28005.1|  BnaC05g44070D                                          233   3e-69    
ref|NP_001234200.1|  polygalacturonase                                  232   3e-69    
ref|XP_010465560.1|  PREDICTED: probable polygalacturonase At3g15...    234   3e-69    
ref|XP_010537987.1|  PREDICTED: probable polygalacturonase At1g80...    233   3e-69    
ref|XP_004486686.1|  PREDICTED: probable polygalacturonase At1g80...    234   3e-69    
ref|XP_003545181.1|  PREDICTED: probable polygalacturonase At3g15...    233   4e-69    
gb|AAF71160.1|AF152758_1  polygalacturonase A                           234   5e-69    
ref|XP_006648280.1|  PREDICTED: probable polygalacturonase At1g80...    235   5e-69    
ref|XP_010659392.1|  PREDICTED: polygalacturonase-like                  234   5e-69    
ref|XP_003540568.1|  PREDICTED: probable polygalacturonase At3g15...    232   6e-69    
emb|CDY30107.1|  BnaC05g37550D                                          234   6e-69    
ref|XP_011081272.1|  PREDICTED: probable polygalacturonase At1g80170    234   6e-69    
ref|XP_009790843.1|  PREDICTED: probable polygalacturonase At3g15720    232   6e-69    
emb|CDY09873.1|  BnaC09g42880D                                          233   6e-69    
ref|XP_006369284.1|  hypothetical protein POPTR_0001s20650g             229   7e-69    
ref|XP_006291145.1|  hypothetical protein CARUB_v10017263mg             233   7e-69    
ref|XP_008359552.1|  PREDICTED: polygalacturonase-like                  234   8e-69    
ref|XP_010537985.1|  PREDICTED: probable polygalacturonase At1g80...    233   8e-69    
ref|XP_002966507.1|  hypothetical protein SELMODRAFT_85947              232   9e-69    
emb|CBI24904.3|  unnamed protein product                                233   1e-68    
ref|XP_006655543.1|  PREDICTED: probable polygalacturonase At1g80...    232   1e-68    
ref|XP_002448332.1|  hypothetical protein SORBIDRAFT_06g025345          231   1e-68    
sp|P48978.1|PGLR_MALDO  RecName: Full=Polygalacturonase; Short=PG...    233   1e-68    
ref|XP_010691173.1|  PREDICTED: probable polygalacturonase At1g80170    232   1e-68    
ref|XP_008365049.1|  PREDICTED: probable polygalacturonase At1g80170    233   1e-68    
ref|XP_006296610.1|  hypothetical protein CARUB_v10013685mg             233   1e-68    
ref|XP_003534372.1|  PREDICTED: polygalacturonase-like                  232   2e-68    
dbj|BAC22688.1|  polygalacturonase                                      233   2e-68    
ref|XP_007011881.1|  Pectin lyase-like superfamily protein, putative    232   2e-68    
ref|XP_010487405.1|  PREDICTED: probable polygalacturonase At3g15...    233   2e-68    
gb|KDP29312.1|  hypothetical protein JCGZ_19407                         231   2e-68    
gb|AAA32914.1|  polygalacturonase                                       232   2e-68    
ref|XP_007023876.1|  Pectin lyase-like superfamily protein              232   2e-68    
gb|KHM99814.1|  Polygalacturonase                                       231   2e-68    
ref|XP_006364702.1|  PREDICTED: probable polygalacturonase At1g80...    233   2e-68    
dbj|BAJ92381.1|  predicted protein                                      234   2e-68    
ref|XP_009614195.1|  PREDICTED: probable polygalacturonase At3g15720    230   2e-68    
ref|XP_002468269.1|  hypothetical protein SORBIDRAFT_01g042735          231   2e-68    
emb|CDY30105.1|  BnaC05g37570D                                          232   2e-68    
ref|XP_004292991.1|  PREDICTED: probable polygalacturonase At3g15...    232   2e-68    
ref|XP_009365411.1|  PREDICTED: probable polygalacturonase At3g15720    235   2e-68    
emb|CAA54448.1|  polygalacturonase                                      232   2e-68    
gb|KHG14133.1|  hypothetical protein F383_04081                         227   3e-68    
ref|XP_006427256.1|  hypothetical protein CICLE_v10027137mg             230   3e-68    
gb|EMT24270.1|  Polygalacturonase                                       231   3e-68    
ref|XP_010254365.1|  PREDICTED: probable polygalacturonase At1g80170    231   3e-68    
emb|CDY61868.1|  BnaCnng38530D                                          234   4e-68    
ref|XP_010420111.1|  PREDICTED: polygalacturonase At1g48100-like        231   4e-68    
ref|XP_008356211.1|  PREDICTED: polygalacturonase                       231   4e-68    
emb|CAN62658.1|  hypothetical protein VITISV_039094                     231   4e-68    
ref|XP_003518118.1|  PREDICTED: polygalacturonase-like                  232   4e-68    
ref|XP_004305760.1|  PREDICTED: probable polygalacturonase At3g15...    229   4e-68    
ref|XP_009121649.1|  PREDICTED: polygalacturonase At1g48100 isofo...    231   5e-68    
ref|XP_003601689.1|  hypothetical protein MTR_3g084360                  229   5e-68    
gb|KCW68966.1|  hypothetical protein EUGRSUZ_F02531                     229   5e-68    
ref|XP_006840713.1|  hypothetical protein AMTR_s00096p00099360          231   5e-68    
gb|AES71940.2|  polygalacturonase/glycoside hydrolase family protein    229   5e-68    
ref|XP_002517618.1|  polygalacturonase, putative                        238   6e-68    
dbj|BAF42033.1|  polygalacturonase2                                     231   6e-68    
ref|XP_006411455.1|  hypothetical protein EUTSA_v10016680mg             230   6e-68    
gb|EEC76383.1|  hypothetical protein OsI_13998                          230   7e-68    
gb|KEH25592.1|  polygalacturonase                                       229   9e-68    
ref|NP_001289214.1|  polygalacturonase precursor                        231   9e-68    
ref|XP_006427234.1|  hypothetical protein CICLE_v10027523mg             229   1e-67    
ref|NP_001051647.1|  Os03g0808000                                       230   1e-67    
ref|NP_566524.1|  probable polygalacturonase                            230   1e-67    
ref|XP_002982348.1|  hypothetical protein SELMODRAFT_116336             229   1e-67    
ref|NP_001056198.1|  Os05g0542800                                       229   1e-67    
ref|XP_009765216.1|  PREDICTED: probable polygalacturonase At3g15720    232   1e-67    
ref|XP_010663873.1|  PREDICTED: polygalacturonase-like                  227   1e-67    
ref|NP_001280857.1|  polygalacturonase precursor                        230   1e-67    
gb|KDO61713.1|  hypothetical protein CISIN_1g037736mg                   228   2e-67    
dbj|BAK07253.1|  predicted protein                                      229   2e-67    
ref|NP_196969.1|  pectin lyase-like superfamily protein                 229   2e-67    
gb|ABK26513.1|  unknown                                                 229   2e-67    
ref|XP_010508675.1|  PREDICTED: polygalacturonase ADPG2-like            229   2e-67    
ref|XP_010507688.1|  PREDICTED: polygalacturonase ADPG2                 228   2e-67    
ref|XP_011072232.1|  PREDICTED: probable polygalacturonase At1g80...    230   2e-67    
ref|XP_008659542.1|  PREDICTED: polygalacturonase At1g48100-like        227   2e-67    
ref|XP_009362540.1|  PREDICTED: probable polygalacturonase At1g80170    229   2e-67    
ref|XP_009362523.1|  PREDICTED: probable polygalacturonase At1g80170    229   2e-67    
ref|XP_009338342.1|  PREDICTED: probable polygalacturonase At1g80170    229   3e-67    
ref|XP_010453593.1|  PREDICTED: polygalacturonase At1g48100-like        229   3e-67    
ref|XP_009116451.1|  PREDICTED: polygalacturonase ADPG1 isoform X1      229   3e-67    
ref|XP_010527120.1|  PREDICTED: probable polygalacturonase At3g15720    227   3e-67    
emb|CDX97703.1|  BnaA05g23760D                                          229   3e-67    
ref|NP_850359.1|  polygalacturonase ADPG2                               228   4e-67    
ref|XP_010051183.1|  PREDICTED: probable polygalacturonase At3g15720    228   4e-67    
gb|AAU43991.1|  unknown protein                                         228   4e-67    
ref|XP_011039731.1|  PREDICTED: probable polygalacturonase At3g15720    226   4e-67    
ref|XP_010492279.1|  PREDICTED: polygalacturonase At1g48100-like        229   4e-67    
ref|XP_006399978.1|  hypothetical protein EUTSA_v10013501mg             229   5e-67    
ref|XP_006350265.1|  PREDICTED: polygalacturonase-like                  227   5e-67    
ref|XP_009146203.1|  PREDICTED: probable polygalacturonase At3g15720    228   5e-67    
gb|EEC79626.1|  hypothetical protein OsI_20838                          228   5e-67    
ref|XP_011096240.1|  PREDICTED: probable polygalacturonase At1g80170    229   5e-67    
gb|AFK43754.1|  unknown                                                 227   5e-67    
ref|XP_007207616.1|  hypothetical protein PRUPE_ppa019727mg             226   6e-67    
ref|XP_006465356.1|  PREDICTED: probable polygalacturonase At1g80...    228   7e-67    
gb|ACF88280.1|  unknown                                                 227   7e-67    
ref|NP_001275837.1|  polygalacturonase precursor                        228   8e-67    
gb|ABR18059.1|  unknown                                                 229   8e-67    
ref|XP_010472980.1|  PREDICTED: probable polygalacturonase At3g15...    226   8e-67    
ref|XP_007028788.1|  Pectin lyase-like superfamily protein              228   8e-67    
ref|XP_010472982.1|  PREDICTED: probable polygalacturonase At3g15...    226   8e-67    
gb|KDO45233.1|  hypothetical protein CISIN_1g013309mg                   228   8e-67    
ref|XP_009398429.1|  PREDICTED: probable polygalacturonase At1g80170    228   8e-67    
ref|XP_004515677.1|  PREDICTED: probable polygalacturonase At3g15...    226   9e-67    
ref|XP_003558488.1|  PREDICTED: polygalacturonase                       227   9e-67    
gb|EYU22774.1|  hypothetical protein MIMGU_mgv1a006357mg                228   9e-67    
ref|NP_001151886.1|  polygalacturonase precursor                        227   1e-66    
gb|ACF80870.1|  unknown                                                 227   1e-66    
ref|XP_010427630.1|  PREDICTED: polygalacturonase ADPG1-like            227   1e-66    
gb|EYU44763.1|  hypothetical protein MIMGU_mgv1a018728mg                227   1e-66    
ref|XP_008446196.1|  PREDICTED: probable polygalacturonase At1g80170    229   1e-66    
ref|XP_010088887.1|  hypothetical protein L484_020875                   236   1e-66    
ref|XP_006450449.1|  hypothetical protein CICLE_v10010440mg             226   1e-66    
emb|CDO98133.1|  unnamed protein product                                228   1e-66    
gb|AAD55489.1|AC009322_29  Similar to polygalacturonases                228   1e-66    
gb|KHG24563.1|  Polygalacturonase                                       225   1e-66    
ref|XP_003559271.2|  PREDICTED: polygalacturonase ADPG1-like            226   2e-66    
ref|XP_008231375.1|  PREDICTED: probable polygalacturonase At3g15720    228   2e-66    
ref|XP_010504680.1|  PREDICTED: polygalacturonase ADPG1                 226   2e-66    
ref|XP_006364236.1|  PREDICTED: probable polygalacturonase At3g15...    226   2e-66    
emb|CDX74418.1|  BnaA04g09710D                                          226   2e-66    
emb|CDY56952.1|  BnaC04g56090D                                          226   2e-66    
ref|XP_002299032.1|  hypothetical protein POPTR_0001s46730g             228   2e-66    
ref|XP_010906940.1|  PREDICTED: probable polygalacturonase At2g43860    230   2e-66    
ref|XP_010659391.1|  PREDICTED: polygalacturonase-like isoform X2       227   2e-66    
ref|XP_009598055.1|  PREDICTED: probable polygalacturonase At3g15720    227   2e-66    
ref|XP_006585946.1|  PREDICTED: probable polygalacturonase At1g80...    227   2e-66    
ref|XP_002299601.2|  hypothetical protein POPTR_0001s17180g             227   2e-66    
ref|XP_009801987.1|  PREDICTED: probable polygalacturonase At3g15720    225   2e-66    
ref|XP_007157814.1|  hypothetical protein PHAVU_002G100400g             225   2e-66    
dbj|BAF32144.1|  pollen allergen                                        226   2e-66    
ref|XP_010318778.1|  PREDICTED: probable polygalacturonase At3g15720    225   2e-66    
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          224   3e-66    
gb|AES71942.2|  polygalacturonase/glycoside hydrolase family protein    225   3e-66    
ref|XP_008782487.1|  PREDICTED: polygalacturonase At1g48100             228   3e-66    
ref|XP_006296029.1|  hypothetical protein CARUB_v10025174mg             226   3e-66    
ref|XP_010516364.1|  PREDICTED: polygalacturonase ADPG1-like            226   3e-66    
ref|XP_007216032.1|  hypothetical protein PRUPE_ppa014982mg             226   3e-66    
gb|KHN23204.1|  Putative polygalacturonase                              226   3e-66    
ref|XP_007203070.1|  hypothetical protein PRUPE_ppa023489mg             226   3e-66    
ref|XP_002517603.1|  Polygalacturonase precursor, putative              226   3e-66    
ref|XP_003601691.1|  Polygalacturonase                                  225   3e-66    
ref|XP_006389764.1|  hypothetical protein EUTSA_v10018548mg             226   3e-66    
ref|XP_009355876.1|  PREDICTED: probable polygalacturonase At3g15720    225   3e-66    
ref|XP_003551209.1|  PREDICTED: probable polygalacturonase At1g80...    226   3e-66    
ref|XP_010413001.1|  PREDICTED: polygalacturonase ADPG2-like            224   3e-66    
ref|XP_006483708.1|  PREDICTED: probable polygalacturonase At3g15...    227   3e-66    
ref|XP_007052517.1|  Pectin lyase-like superfamily protein, putative    228   3e-66    
gb|AFW78960.1|  polygalacturonase                                       227   3e-66    
ref|XP_009139940.1|  PREDICTED: polygalacturonase QRT2                  225   4e-66    
ref|XP_009595647.1|  PREDICTED: probable polygalacturonase At3g15...    223   4e-66    
gb|EMT04458.1|  Polygalacturonase                                       226   5e-66    
dbj|BAA88472.1|  polygalacturonase                                      226   5e-66    
ref|XP_008235620.1|  PREDICTED: polygalacturonase-like                  226   5e-66    
gb|EMS53069.1|  Polygalacturonase                                       225   5e-66    
ref|XP_002324855.2|  hypothetical protein POPTR_0018s01610g             224   5e-66    
ref|XP_009595648.1|  PREDICTED: probable polygalacturonase At3g15...    223   6e-66    
gb|KGN51795.1|  hypothetical protein Csa_5G600960                       226   6e-66    
gb|EPS71906.1|  hypothetical protein M569_02851                         219   6e-66    
ref|NP_001233795.1|  polygalacturonase precursor                        224   6e-66    
ref|XP_004513766.1|  PREDICTED: polygalacturonase-like                  226   7e-66    
ref|XP_007212964.1|  hypothetical protein PRUPE_ppa021095mg             229   7e-66    
gb|AAC28903.1|  polygalacturonase 1                                     224   7e-66    
ref|XP_006597127.1|  PREDICTED: probable polygalacturonase At1g80...    225   7e-66    
ref|XP_002307031.2|  hypothetical protein POPTR_0005s00720g             226   7e-66    
ref|XP_004959739.1|  PREDICTED: polygalacturonase-like                  226   8e-66    
gb|KFK37027.1|  hypothetical protein AALP_AA4G202700                    224   8e-66    
ref|XP_010251216.1|  PREDICTED: probable polygalacturonase At1g80170    226   8e-66    
gb|ABW38780.1|  dehiscence polygalacturonase                            224   9e-66    
ref|XP_008243707.1|  PREDICTED: probable polygalacturonase At1g80170    226   9e-66    
ref|XP_009595646.1|  PREDICTED: probable polygalacturonase At3g15...    224   9e-66    
gb|AAL84942.1|  At2g41850/T11A7.5                                       224   1e-65    
ref|XP_010100420.1|  Polygalacturonase                                  226   1e-65    
ref|XP_011039286.1|  PREDICTED: probable polygalacturonase At1g80170    226   1e-65    
gb|ACN40008.1|  unknown                                                 225   1e-65    
ref|XP_002515526.1|  Polygalacturonase-2 precursor, putative            223   1e-65    
ref|XP_004961348.1|  PREDICTED: probable polygalacturonase At1g80...    226   1e-65    
ref|XP_003546932.1|  PREDICTED: probable polygalacturonase At1g80...    225   1e-65    
ref|XP_009375163.1|  PREDICTED: polygalacturonase At1g48100-like        226   1e-65    
ref|XP_008645203.1|  PREDICTED: probable polygalacturonase At1g80170    226   1e-65    
gb|ABK23977.1|  unknown                                                 224   1e-65    
ref|XP_004302967.1|  PREDICTED: probable polygalacturonase At1g80...    225   1e-65    
gb|ADN33827.1|  polygalacturonase                                       229   1e-65    
ref|XP_004248040.1|  PREDICTED: probable polygalacturonase At1g80170    227   1e-65    
ref|XP_009392186.1|  PREDICTED: probable polygalacturonase At1g80...    224   1e-65    
ref|XP_006597125.1|  PREDICTED: probable polygalacturonase At1g80...    225   1e-65    
gb|KHN39536.1|  Putative polygalacturonase                              222   2e-65    
ref|XP_003618193.1|  Polygalacturonase                                  224   2e-65    
ref|XP_006290192.1|  hypothetical protein CARUB_v10003877mg             224   2e-65    
ref|XP_011039005.1|  PREDICTED: polygalacturonase At1g48100-like        225   2e-65    
gb|AFK47772.1|  unknown                                                 224   2e-65    
ref|XP_010468191.1|  PREDICTED: probable polygalacturonase At3g15720    218   2e-65    
ref|XP_003597864.1|  hypothetical protein MTR_2g103410                  224   2e-65    
ref|XP_002869071.1|  glycoside hydrolase family 28 protein              223   2e-65    
gb|AFW89186.1|  polygalacturonase                                       224   2e-65    
ref|XP_010250040.1|  PREDICTED: probable polygalacturonase At1g80170    224   2e-65    
ref|XP_011085051.1|  PREDICTED: polygalacturonase-like                  222   2e-65    
gb|ACL53778.1|  unknown                                                 224   3e-65    
ref|XP_010070078.1|  PREDICTED: polygalacturonase At1g48100-like        224   3e-65    
ref|XP_008809418.1|  PREDICTED: probable polygalacturonase At1g80170    222   3e-65    
ref|XP_007150743.1|  hypothetical protein PHAVU_005G177000g             223   3e-65    
emb|CDX72553.1|  BnaC07g45750D                                          223   3e-65    
ref|XP_006493141.1|  PREDICTED: polygalacturonase-like                  222   3e-65    
ref|XP_004500601.1|  PREDICTED: probable polygalacturonase At3g15...    222   3e-65    
ref|XP_004486687.1|  PREDICTED: probable polygalacturonase At1g80...    223   4e-65    
gb|EYU24653.1|  hypothetical protein MIMGU_mgv1a022836mg                223   4e-65    
ref|XP_009765961.1|  PREDICTED: probable polygalacturonase At1g80170    224   4e-65    
emb|CAH18929.1|  polygalacturonase                                      224   4e-65    
ref|XP_002453250.1|  hypothetical protein SORBIDRAFT_04g002530          225   4e-65    
ref|XP_007044724.1|  Pectin lyase-like superfamily protein              224   4e-65    



>ref|XP_009606258.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
 ref|XP_009606259.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
Length=420

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/269 (70%), Positives = 224/269 (83%), Gaps = 0/269 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G DASQWLAF+ V+GL V+G G IDGQG+ WWDQSCRYHPD++GCT+LAPTA+KF+ C+ 
Sbjct  117  GQDASQWLAFRNVSGLIVDGSGTIDGQGQGWWDQSCRYHPDMEGCTRLAPTALKFIFCSQ  176

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SS+SNI+F +S QTH LI  CNGF V +V +ESPG+SPNTDGIHI +S +++IT S IS 
Sbjct  177  SSISNIYFGNSAQTHILIERCNGFKVDSVMIESPGNSPNTDGIHIQSSQYVAITNSKISS  236

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGDYTSN++I N+QCGPGHGISIGSLGK GNF QVE+IHV N  F GTTNGARI
Sbjct  237  GDDCISIGDYTSNVQIYNIQCGPGHGISIGSLGKGGNFAQVENIHVSNAFFYGTTNGARI  296

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVR+V FENL+   V NPIIIDQNYCDVRGACKE+ +GV+ISNV+Y+ I GT
Sbjct  297  KTWQVGRGYVRDVIFENLEFNSVKNPIIIDQNYCDVRGACKEMVTGVQISNVIYQNIFGT  356

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            +S   AINLNCS SVPCT I M+ I +T+
Sbjct  357  SSTNIAINLNCSMSVPCTDITMQLIQLTS  385



>ref|XP_009767751.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
 ref|XP_009767752.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
Length=418

 Score =   400 bits (1027),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 225/269 (84%), Gaps = 0/269 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G DASQWLAF+ V+GL V+G G IDGQG+ WWDQSCRYHPD++GCT+LAPTA+KF+ C+ 
Sbjct  117  GEDASQWLAFRNVSGLIVDGSGTIDGQGQGWWDQSCRYHPDMEGCTRLAPTALKFIFCSQ  176

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SS+SNI+F +S QTH LI  CNGF V +V +ESPG+SPNTDGIHI +S +++IT S IS 
Sbjct  177  SSISNIYFGNSAQTHILIERCNGFKVDSVLIESPGNSPNTDGIHIQSSQYVAITNSKIST  236

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGDY+SN++I N+QCGPGHGISIGSLGK GNF QVE+IHV N  F GTTNGARI
Sbjct  237  GDDCISIGDYSSNVQIYNIQCGPGHGISIGSLGKGGNFAQVENIHVSNAFFYGTTNGARI  296

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVR+V FENL+   V NPIIIDQNYCDVRGACKE+ +GV+ISNV+Y+ I GT
Sbjct  297  KTWQVGRGYVRDVIFENLEFNSVKNPIIIDQNYCDVRGACKEMVTGVQISNVIYQNIFGT  356

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            +S + AINLNCS SVPCT I M+ I +T+
Sbjct  357  SSTDIAINLNCSMSVPCTDITMQLIQLTS  385



>ref|XP_006345284.1| PREDICTED: polygalacturonase QRT2-like [Solanum tuberosum]
Length=439

 Score =   395 bits (1016),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 224/268 (84%), Gaps = 0/268 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D+SQWLAF  V+GL V+G G IDGQGK WWDQSCRYHP+++GCT+LAPTA+KF+ C+ 
Sbjct  141  GQDSSQWLAFNNVSGLVVDGSGTIDGQGKGWWDQSCRYHPEMEGCTRLAPTALKFILCSQ  200

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SS+SN++F +S QTH LI  CNGFNV+NV ++SPG+SPNTDGIHI +S +++IT S IS 
Sbjct  201  SSISNMYFANSAQTHILIERCNGFNVNNVMIQSPGNSPNTDGIHIQSSQNVAITNSKISS  260

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGDY+SNI+I N+QCGPGHGISIGSLGK G+  QVE+IHV    F GTTNGARI
Sbjct  261  GDDCISIGDYSSNIQIYNIQCGPGHGISIGSLGKGGHSAQVENIHVNTVFFYGTTNGARI  320

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVR+VTFENLQ   V NPIIIDQNYCDVRGACKE+ +GV+ISNVVY+ I GT
Sbjct  321  KTWQVGRGYVRDVTFENLQFNSVKNPIIIDQNYCDVRGACKEMGTGVQISNVVYQNIYGT  380

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +S   AINLNCS+SVPCT I M+ I +T
Sbjct  381  SSTAIAINLNCSKSVPCTDITMQLIQLT  408



>ref|XP_011093565.1| PREDICTED: probable polygalacturonase At1g80170 [Sesamum indicum]
Length=406

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 219/269 (81%), Gaps = 0/269 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G DASQWL FK V+GL V+G G IDGQGK WWDQSCRYHP L  CTKLAPTA+KF+SCN 
Sbjct  109  GKDASQWLGFKDVSGLNVDGFGSIDGQGKAWWDQSCRYHPQLINCTKLAPTALKFISCNG  168

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SS+SN++F++S QTH L+ GCN FN++NV ++SP +SPNTDGIHIH+S  L IT S I  
Sbjct  169  SSVSNLNFVNSSQTHILVTGCNSFNINNVLIDSPQNSPNTDGIHIHSSQQLVITNSRIRS  228

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGD+ SNI+I NV+CGPGHGISIGSLGKS N+V VE IHV N  FN TTNGARI
Sbjct  229  GDDCISIGDHNSNIQIANVECGPGHGISIGSLGKSRNYVNVEKIHVTNAFFNRTTNGARI  288

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVR+V FENL  + V NPIIIDQNYCDVR AC+E  +GV+ISNV Y+ I GT
Sbjct  289  KTWQVGRGYVRDVVFENLVFYSVKNPIIIDQNYCDVRDACREQVTGVQISNVSYKEIYGT  348

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            ++ + AINLNCSRSVPC GI MESI +T+
Sbjct  349  STTDIAINLNCSRSVPCRGIWMESIQLTS  377



>ref|XP_004252072.1| PREDICTED: polygalacturonase QRT2 [Solanum lycopersicum]
Length=416

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 222/268 (83%), Gaps = 0/268 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D+SQWLAF+ V+GL V G G IDGQGKKWWDQSCRYHP+L GCTKLAPTA+KF+ C+ 
Sbjct  118  GQDSSQWLAFRNVSGLVVGGSGTIDGQGKKWWDQSCRYHPELDGCTKLAPTALKFIFCSQ  177

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SS+SN++F +S QTH LI  CNGFNV+NV ++SPG+SPNTDGIHI AS +++IT S IS 
Sbjct  178  SSISNMYFANSAQTHILIERCNGFNVNNVMIQSPGNSPNTDGIHIQASQNVAITNSKISS  237

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGDY+SN++I N+QCGPGHGISIGSLGK G+  QV +IHV N  F GTTNGARI
Sbjct  238  GDDCISIGDYSSNVQIYNIQCGPGHGISIGSLGKGGHSAQVSNIHVNNVFFYGTTNGARI  297

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRG+VR+VTFENLQ   V NPIIIDQ+YCDVRGACKE  +GV+ISNVVY+ I GT
Sbjct  298  KTWQVGRGFVRDVTFENLQFNSVKNPIIIDQHYCDVRGACKETGTGVQISNVVYQNIYGT  357

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +  + AINLNCS SVPCT I M+ I +T
Sbjct  358  SITDVAINLNCSMSVPCTDITMQLIQLT  385



>ref|XP_011078329.1| PREDICTED: polygalacturonase QRT2-like isoform X4 [Sesamum indicum]
Length=322

 Score =   385 bits (990),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 186/271 (69%), Positives = 222/271 (82%), Gaps = 2/271 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGG--IIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G DASQWL FK VNGLKV+G G  +IDGQGK WWDQSCRYHP LK CT LAPTA+KF+SC
Sbjct  23   GGDASQWLGFKNVNGLKVDGFGFGLIDGQGKGWWDQSCRYHPRLKQCTTLAPTALKFVSC  82

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
            N SS+SN+ F +S QTH L+ GCN F++ NV +ESPG+SPNTDGIHI +S H+ IT S I
Sbjct  83   NESSVSNMKFTNSAQTHILVRGCNSFSIDNVMIESPGNSPNTDGIHIQSSQHVLITNSRI  142

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
            + GDDC+SIGD+TSNIEI NV+CGPGHGISIGSLG+ GN+VQV++I V +  FNGTTNGA
Sbjct  143  ATGDDCVSIGDHTSNIEIENVECGPGHGISIGSLGRGGNYVQVQNILVTDAFFNGTTNGA  202

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ GRGYVR+VTF+NL    V NPIIIDQNYC+VR ACKE  +GV+ISNV Y+ + 
Sbjct  203  RIKTWQVGRGYVRDVTFQNLLFNHVQNPIIIDQNYCNVRNACKEQETGVQISNVNYKEVL  262

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDITA  184
            GT++ + AIN+NCSRSVPC GI MESI + +
Sbjct  263  GTSTTDIAININCSRSVPCFGISMESIQLLS  293



>ref|XP_011078326.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Sesamum indicum]
 ref|XP_011078327.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Sesamum indicum]
Length=376

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 221/269 (82%), Gaps = 2/269 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGG--IIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G DASQWL FK VNGLKV+G G  +IDGQGK WWDQSCRYHP LK CT LAPTA+KF+SC
Sbjct  77   GGDASQWLGFKNVNGLKVDGFGFGLIDGQGKGWWDQSCRYHPRLKQCTTLAPTALKFVSC  136

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
            N SS+SN+ F +S QTH L+ GCN F++ NV +ESPG+SPNTDGIHI +S H+ IT S I
Sbjct  137  NESSVSNMKFTNSAQTHILVRGCNSFSIDNVMIESPGNSPNTDGIHIQSSQHVLITNSRI  196

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
            + GDDC+SIGD+TSNIEI NV+CGPGHGISIGSLG+ GN+VQV++I V +  FNGTTNGA
Sbjct  197  ATGDDCVSIGDHTSNIEIENVECGPGHGISIGSLGRGGNYVQVQNILVTDAFFNGTTNGA  256

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ GRGYVR+VTF+NL    V NPIIIDQNYC+VR ACKE  +GV+ISNV Y+ + 
Sbjct  257  RIKTWQVGRGYVRDVTFQNLLFNHVQNPIIIDQNYCNVRNACKEQETGVQISNVNYKEVL  316

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDI  190
            GT++ + AIN+NCSRSVPC GI MESI +
Sbjct  317  GTSTTDIAININCSRSVPCFGISMESIQL  345



>ref|XP_011078321.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078322.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078324.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078325.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
Length=408

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 221/269 (82%), Gaps = 2/269 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGG--IIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G DASQWL FK VNGLKV+G G  +IDGQGK WWDQSCRYHP LK CT LAPTA+KF+SC
Sbjct  109  GGDASQWLGFKNVNGLKVDGFGFGLIDGQGKGWWDQSCRYHPRLKQCTTLAPTALKFVSC  168

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
            N SS+SN+ F +S QTH L+ GCN F++ NV +ESPG+SPNTDGIHI +S H+ IT S I
Sbjct  169  NESSVSNMKFTNSAQTHILVRGCNSFSIDNVMIESPGNSPNTDGIHIQSSQHVLITNSRI  228

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
            + GDDC+SIGD+TSNIEI NV+CGPGHGISIGSLG+ GN+VQV++I V +  FNGTTNGA
Sbjct  229  ATGDDCVSIGDHTSNIEIENVECGPGHGISIGSLGRGGNYVQVQNILVTDAFFNGTTNGA  288

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ GRGYVR+VTF+NL    V NPIIIDQNYC+VR ACKE  +GV+ISNV Y+ + 
Sbjct  289  RIKTWQVGRGYVRDVTFQNLLFNHVQNPIIIDQNYCNVRNACKEQETGVQISNVNYKEVL  348

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDI  190
            GT++ + AIN+NCSRSVPC GI MESI +
Sbjct  349  GTSTTDIAININCSRSVPCFGISMESIQL  377



>gb|EYU23048.1| hypothetical protein MIMGU_mgv1a026845mg, partial [Erythranthe 
guttata]
Length=383

 Score =   377 bits (969),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 215/267 (81%), Gaps = 0/267 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G DASQWL F+ V+GLK++G G+ DG+G+ WWDQSCRYHP LK CTK APTA+KFL C  
Sbjct  85   GRDASQWLGFEHVDGLKIDGYGVFDGRGQPWWDQSCRYHPQLKQCTKTAPTALKFLWCKE  144

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SS+ N+  ++S QTH L+  CN F + N+ + SPG+SPNTDGIHI ASH ++IT S I+C
Sbjct  145  SSVRNMKLMNSAQTHILVKDCNNFKIENLMINSPGNSPNTDGIHIQASHSVTITNSQIAC  204

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGDY SN++I NV CGPGHGISIGSLGK GN+VQVE+I V +  FNGTTNGARI
Sbjct  205  GDDCISIGDYISNVQIANVVCGPGHGISIGSLGKGGNYVQVENIRVTDAFFNGTTNGARI  264

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVRNV FENL+   V NPIIIDQNYC VR ACKE  +GV++S+VVY+ ISGT
Sbjct  265  KTWQVGRGYVRNVVFENLKFNNVKNPIIIDQNYCFVRDACKEEETGVQVSSVVYKEISGT  324

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            ++ + AINLNCS +VPC GI M+SI+I
Sbjct  325  STTDIAINLNCSNAVPCFGISMQSINI  351



>ref|XP_010047836.1| PREDICTED: probable polygalacturonase At1g80170 [Eucalyptus grandis]
Length=406

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/267 (66%), Positives = 212/267 (79%), Gaps = 0/267 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D S W+ F G++ L+V G G IDGQG KWW+QSCRYHP L+GCT LAPTAMKFLSC+ SS
Sbjct  110  DPSSWMTFHGIDQLRVSGFGTIDGQGSKWWNQSCRYHPHLEGCTSLAPTAMKFLSCSASS  169

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            L+NI  ++SPQTH LI GC  F++ N+ +E+PG SPNTDGIHI +S H+SI  + I  GD
Sbjct  170  LNNIKLVNSPQTHVLIRGCRFFDIGNLLIEAPGTSPNTDGIHIQSSQHVSIANAVIGTGD  229

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIGDYTSNI +++V CGPGHG+SIGSLG+ GNFVQVE+IHV N  F  TTNGARIKT
Sbjct  230  DCISIGDYTSNIYVSSVTCGPGHGVSIGSLGRRGNFVQVENIHVSNVQFKHTTNGARIKT  289

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+GYVR +TFE L+   V NPIIIDQNYC +RGACKE+ +GV ISNV Y  +SGT+S
Sbjct  290  WQVGKGYVRRITFEYLKFDSVKNPIIIDQNYCSIRGACKEMPTGVHISNVAYVGLSGTSS  349

Query  264  RETAINLNCSRSVPCTGIRMESIDITA  184
             + AINLNCSRSV CT I +ESI++ +
Sbjct  350  TDVAINLNCSRSVACTRIVLESIELMS  376



>ref|XP_009368885.1| PREDICTED: polygalacturonase-like [Pyrus x bretschneideri]
Length=414

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 211/263 (80%), Gaps = 0/263 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D SQWLAFK V+GLKV G G I+G+GK WWDQSCR HP LKGCT LAPTA+KF+SCNNSS
Sbjct  118  DQSQWLAFKRVSGLKVVGPGRINGRGKGWWDQSCRDHPGLKGCTVLAPTAVKFVSCNNSS  177

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +S +HF++S Q H LI GC G ++ NV +E+P  SPNTDGIHI ASH++ +T + I+ GD
Sbjct  178  ISEVHFVNSSQVHVLIEGCEGIHIENVLIEAPERSPNTDGIHISASHYVFVTNAIIATGD  237

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SIGD+TSNI ++ V+CGPGHGISIGSLG+SGNFVQVE+IHV      GTTNGARIKT
Sbjct  238  DCVSIGDHTSNIVVSYVKCGPGHGISIGSLGRSGNFVQVENIHVTQVYLQGTTNGARIKT  297

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+GYVR VTFE++    V NPIIIDQNYC  RGACKEL +GV IS+V +  + GT+S
Sbjct  298  WQAGKGYVRRVTFEHMFFRSVKNPIIIDQNYCSKRGACKELDTGVHISDVSFNNLYGTSS  357

Query  264  RETAINLNCSRSVPCTGIRMESI  196
             + AINLNCSRSV CTG+ ++SI
Sbjct  358  SQVAINLNCSRSVACTGVFLKSI  380



>ref|XP_010241947.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=488

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/269 (62%), Positives = 208/269 (77%), Gaps = 1/269 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D S W+AF  V+GL+V G G+IDG+G  WWDQSCRYHP   GCTKLAPT MKFL CN 
Sbjct  190  GIDQSLWMAFTSVSGLRVSGSGVIDGRGSGWWDQSCRYHPG-NGCTKLAPTTMKFLKCNQ  248

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              LSN+ FI+SPQTH L+ GC GF ++ +++ SPG SPNTDGIHI ++  + I ++ IS 
Sbjct  249  IHLSNVQFINSPQTHVLVMGCTGFYINGIAINSPGHSPNTDGIHIQSAQDMLIQHTKISS  308

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGDYTSNI IN+V CGPGHGISIGSLGK G+F +VE+IHV N +F  TTNG RI
Sbjct  309  GDDCISIGDYTSNIVINDVICGPGHGISIGSLGKDGSFSKVENIHVRNASFTNTTNGVRI  368

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQTG+GY + ++F+ +    V+NPIIIDQNYC VRGACKEL +G++IS+V Y  + GT
Sbjct  369  KTWQTGKGYCKKISFKGINFSNVENPIIIDQNYCSVRGACKELPTGIQISDVQYADMVGT  428

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            +S E AIN NCS S PCTGI ++SI +++
Sbjct  429  SSTEVAINFNCSSSFPCTGISLKSIKLSS  457



>ref|XP_004287324.1| PREDICTED: probable polygalacturonase At1g80170-like [Fragaria 
vesca subsp. vesca]
Length=408

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 206/263 (78%), Gaps = 0/263 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QWLAF+GVNGL++ G G I+G+G  WW+QSCRYHP L+GCT LAPTA+K LSC N  
Sbjct  112  DPGQWLAFRGVNGLEIAGPGTINGRGSGWWNQSCRYHPKLEGCTTLAPTALKVLSCKNIW  171

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            L +IHFI+S Q+H LI GC+G  + N+ +E+PG+SPNTDGIHIHASH++ I  + I+ GD
Sbjct  172  LRDIHFINSSQSHILIEGCDGIKIENLMIEAPGNSPNTDGIHIHASHNVIINNTIIASGD  231

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIGD+ SNI I+ ++CGPGHGISIGSLGKSGN VQVE++HV   T  GTTNGARIKT
Sbjct  232  DCISIGDHISNIAISYIKCGPGHGISIGSLGKSGNVVQVENVHVSKVTLQGTTNGARIKT  291

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+G VR V FE+  L  V NPIIIDQNYC VRGAC+EL +GV IS+V ++   GT+S
Sbjct  292  WQVGQGNVRGVRFEDFFLDSVKNPIIIDQNYCKVRGACEELPTGVHISDVSFKNFYGTSS  351

Query  264  RETAINLNCSRSVPCTGIRMESI  196
               AINLNCS SVPCT I M+SI
Sbjct  352  TNIAINLNCSLSVPCTEILMKSI  374



>ref|XP_008242767.1| PREDICTED: probable polygalacturonase At1g80170 [Prunus mume]
Length=406

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/263 (64%), Positives = 205/263 (78%), Gaps = 0/263 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D SQWLAF GV+GL + G G I+G+GK WWDQSCR HP L GC+ LAPTA+K +SC NSS
Sbjct  112  DPSQWLAFNGVSGLNIAGPGRINGRGKAWWDQSCRDHPRLVGCSTLAPTAVKLVSCKNSS  171

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +S IHF++S QTH LI  C+G N+ NV +E+P  SPNTDGIHI ASH++ IT + I  GD
Sbjct  172  ISEIHFVNSSQTHVLIRDCDGINIENVLIEAPERSPNTDGIHISASHNVVITNAIIGTGD  231

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SIGD+TSNI I+ V+CGPGHGISIGSLG+SGNFVQVE+IHV      GTTNGARIKT
Sbjct  232  DCVSIGDHTSNIAISYVKCGPGHGISIGSLGRSGNFVQVENIHVSKVYLQGTTNGARIKT  291

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ GRGYVR VTFE++    V NPIIIDQNYC+   ACKE+ +GV I++V + ++ GT+S
Sbjct  292  WQVGRGYVRRVTFEHIFFRSVKNPIIIDQNYCNKSDACKEMETGVHITDVSFNQLYGTSS  351

Query  264  RETAINLNCSRSVPCTGIRMESI  196
               A+NLNCSRSV CT I ++SI
Sbjct  352  SRVAVNLNCSRSVACTSIYLKSI  374



>ref|XP_009781155.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=391

 Score =   337 bits (864),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 202/257 (79%), Gaps = 9/257 (4%)
 Frame = -2

Query  954  VNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNIHFISSP  775
            +NGL V+G G IDGQGK+WWDQSCR+HP++         AMKFLSCN SS+SNI+FI+S 
Sbjct  127  LNGLYVDGLGSIDGQGKEWWDQSCRHHPNM---------AMKFLSCNKSSISNINFINSS  177

Query  774  QTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCISIGDYTS  595
            QTH L+ GCN F V +V ++SP  SPN DGIHI +S  ++IT SNIS G+DCISIGD++S
Sbjct  178  QTHTLVRGCNDFMVEHVFIQSPRYSPNNDGIHIQSSQFVTITNSNISTGNDCISIGDHSS  237

Query  594  NIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTGRGYVRN  415
             I I+++ CGPGHGISIGSLGK GN  QVE+I+V N  F+GTTNGARIKTWQ G GYVR+
Sbjct  238  YINISDIHCGPGHGISIGSLGKGGNLTQVENINVSNSFFSGTTNGARIKTWQVGTGYVRD  297

Query  414  VTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETAINLNCS  235
            V FENL+   VDNPIIIDQNYCDVRGACKE+  GV ISNVVYE + GT+S + AINLNCS
Sbjct  298  VRFENLEFNSVDNPIIIDQNYCDVRGACKEMPIGVHISNVVYENMKGTSSTDIAINLNCS  357

Query  234  RSVPCTGIRMESIDITA  184
             SVPCT I ++ I +T+
Sbjct  358  NSVPCTDITLQQIRLTS  374



>ref|XP_007203411.1| hypothetical protein PRUPE_ppa021427mg, partial [Prunus persica]
 gb|EMJ04610.1| hypothetical protein PRUPE_ppa021427mg, partial [Prunus persica]
Length=383

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 199/263 (76%), Gaps = 9/263 (3%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D SQWLAF GV+GL + G G I+G+GK WWDQSCR HP L         A+K +SC NSS
Sbjct  96   DPSQWLAFNGVSGLNIAGPGRINGRGKAWWDQSCRDHPRL---------AVKLVSCKNSS  146

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +S IHF++S QTH LI  C+G N+ NV +E+P  SPNTDGIHI ASH++ IT + I  GD
Sbjct  147  ISEIHFLNSSQTHVLIRDCDGINIENVLIEAPERSPNTDGIHISASHNVVITNAIIGTGD  206

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SIGD+TSNI I+ V+CGPGHGISIGSLG+SGNFVQVE+IHV      GTTNGARIKT
Sbjct  207  DCVSIGDHTSNIVISYVKCGPGHGISIGSLGRSGNFVQVENIHVSKVYLQGTTNGARIKT  266

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ GRGYVR VTFE++    V NPIIIDQNYC+  GACKE+ +GV I++V + ++ GT+S
Sbjct  267  WQVGRGYVRRVTFEHIFFGSVKNPIIIDQNYCNKSGACKEMETGVHITDVSFNQLYGTSS  326

Query  264  RETAINLNCSRSVPCTGIRMESI  196
               A+NLNCSRSV CT I ++SI
Sbjct  327  SRVAMNLNCSRSVACTSIYLKSI  349



>ref|XP_007013436.1| F18B13.22 protein isoform 1 [Theobroma cacao]
 gb|EOY31055.1| F18B13.22 protein isoform 1 [Theobroma cacao]
Length=408

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 198/266 (74%), Gaps = 1/266 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDL-KGCTKLAPTAMKFLSCN  814
            G D  +WL F GV+GLKV+G G I+G+G  WW+QSCR HP L +GCT LAPTA+ F SC 
Sbjct  109  GLDQGKWLTFYGVSGLKVKGTGEINGRGWGWWNQSCRNHPGLVEGCTSLAPTAITFQSCK  168

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
             SSLS +  I+S QTH LI G + F V +V + +P  SPNTDGIHI ++ ++ I  S I 
Sbjct  169  TSSLSELRIINSSQTHVLIEGSDHFIVKDVIITAPETSPNTDGIHISSASNIVIRNSRIG  228

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDC+SIGD+T+NI+I+ V+CGPGHGISIGSLG++GNFVQV++I V    F GT NGAR
Sbjct  229  TGDDCVSIGDHTTNIDISRVKCGPGHGISIGSLGRAGNFVQVQNIRVSRVAFKGTANGAR  288

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKTWQ GRGYVR VTFENL    V NPIIIDQNYC+VRGACKEL +GV I +V Y  + G
Sbjct  289  IKTWQVGRGYVRGVTFENLFFNSVKNPIIIDQNYCNVRGACKELPTGVHIRDVTYRNLWG  348

Query  273  TASRETAINLNCSRSVPCTGIRMESI  196
            T+S    I +NCS+SV CTG+ ++SI
Sbjct  349  TSSTHVGITMNCSQSVSCTGLLLQSI  374



>ref|XP_011078328.1| PREDICTED: polygalacturonase-like isoform X3 [Sesamum indicum]
Length=349

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  864  KGCTKLAPTAMKFLSCNNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDG  685
            K CT LAPTA+KF+SCN SS+SN+ F +S QTH L+ GCN F++ NV +ESPG+SPNTDG
Sbjct  94   KQCTTLAPTALKFVSCNESSVSNMKFTNSAQTHILVRGCNSFSIDNVMIESPGNSPNTDG  153

Query  684  IHIHASHHLSITYSNISCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVE  505
            IHI +S H+ IT S I+ GDDC+SIGD+TSNIEI NV+CGPGHGISIGSLG+ GN+VQV+
Sbjct  154  IHIQSSQHVLITNSRIATGDDCVSIGDHTSNIEIENVECGPGHGISIGSLGRGGNYVQVQ  213

Query  504  DIHVYNCTFNGTTNGARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKE  325
            +I V +  FNGTTNGARIKTWQ GRGYVR+VTF+NL    V NPIIIDQNYC+VR ACKE
Sbjct  214  NILVTDAFFNGTTNGARIKTWQVGRGYVRDVTFQNLLFNHVQNPIIIDQNYCNVRNACKE  273

Query  324  LASGVEISNVVYERISGTASRETAINLNCSRSVPCTGIRMESIDI  190
              +GV+ISNV Y+ + GT++ + AIN+NCSRSVPC GI MESI +
Sbjct  274  QETGVQISNVNYKEVLGTSTTDIAININCSRSVPCFGISMESIQL  318



>ref|XP_010688006.1| PREDICTED: probable polygalacturonase At1g80170 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 199/273 (73%), Gaps = 5/273 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            HD SQWLAFK V GL+V G G+++GQG  WW+QSC+YHP + GCTKLAPTAMKF+ CN +
Sbjct  95   HDPSQWLAFKEVRGLRVSGSGVVNGQGFGWWNQSCKYHPSMSGCTKLAPTAMKFVKCNET  154

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
            +LS IHFI+S QTH  + GC+ F++ N+ +ESP +SPNTDGIH+    ++ IT   I  G
Sbjct  155  TLSGIHFINSSQTHITLSGCDIFHIDNLLIESPYNSPNTDGIHLQRVRNVIITNIVIGTG  214

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISIGDYTSNI+I+N+ CGPGHGISIGSLG+ GN+VQV +I V N  F GT+NGARIK
Sbjct  215  DDCISIGDYTSNIDISNITCGPGHGISIGSLGRGGNYVQVNNIAVRNVYFKGTSNGARIK  274

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ GRGYVR V FE++    V NP+IIDQ+Y    G+  +   GV IS+V Y+   GT+
Sbjct  275  TWQEGRGYVRRVIFEDIFFNSVKNPVIIDQHYGSTNGSQIKENMGVWISDVAYKHFYGTS  334

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
            + + AINLNCS S  C  + ++SI +     WP
Sbjct  335  TSQVAINLNCSESRGCNHVTLDSIIL-----WP  362



>ref|XP_010533164.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=424

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 199/287 (69%), Gaps = 7/287 (2%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGI--IDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G D  +WL F  V+GL V G G   ++G+G  WW+QSCR HP L+GCT +APTA+ F  C
Sbjct  116  GKDPGKWLEFIDVSGLTVAGLGFGALNGRGLAWWNQSCRDHPRLQGCTSVAPTALTFSGC  175

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
            N+SSL++I  ++S QTH LI       VSNV +++P  SPNTDGIHIH+SH + IT S  
Sbjct  176  NSSSLNDIVSLNSSQTHFLIINSKAITVSNVMMQAPELSPNTDGIHIHSSHDVFITNSVF  235

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
            S GDDCISIGDYTSN+ I NV CGPGHGISIGSLG+ GN VQVE+IHV      GTTNG 
Sbjct  236  STGDDCISIGDYTSNVVITNVICGPGHGISIGSLGRGGNSVQVENIHVSRSYLKGTTNGL  295

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ GRGYVRNV F+++    V NPIIIDQNYC  +G CKE+ +GV I+NV Y ++ 
Sbjct  296  RIKTWQVGRGYVRNVLFQDITFDSVQNPIIIDQNYCSEKGLCKEMPTGVHITNVTYTKMV  355

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKV  136
            G++S   AIN +C RSVPCTG+ +  I +     WP+   +    K+
Sbjct  356  GSSSTAVAINFDCDRSVPCTGLNLRYIYL-----WPVPTDLDGTSKI  397



>ref|XP_007023162.1| JHL06P13.4 protein, putative [Theobroma cacao]
 gb|EOY25784.1| JHL06P13.4 protein, putative [Theobroma cacao]
Length=413

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 193/270 (71%), Gaps = 0/270 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D S WLAF+ VNGL ++G G +DG GK WWD+SC+ HP  +GC +LAPT +KF  CNN  
Sbjct  115  DLSTWLAFQDVNGLTIDGPGTMDGSGKGWWDRSCKLHPGHQGCIRLAPTVLKFARCNNIH  174

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +SNI F +SPQTH L+ GC   +   ++V++PG SPNTDGIHI  S ++SI  S I  GD
Sbjct  175  MSNIKFQNSPQTHVLVLGCQDVDFGFLTVQAPGTSPNTDGIHIQISRNVSIYNSQIGDGD  234

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIGD TS+I I N+ CGPGHG+SIGSLGK G   QV++I+V    F GTTNG RIKT
Sbjct  235  DCISIGDLTSDINITNINCGPGHGVSIGSLGKDGGEAQVKNINVRGVNFRGTTNGVRIKT  294

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQTGRG V +V+F N+    V+NPIIIDQ YCDV  +C E  +GV I+ V+Y ++ GT+ 
Sbjct  295  WQTGRGVVESVSFSNINFTAVENPIIIDQFYCDVPNSCTETNTGVHINGVLYSQLYGTSR  354

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQGR  175
             + AINLNCS + PCTGI +E+I + +  R
Sbjct  355  TQVAINLNCSDNFPCTGITLENIQLASATR  384



>gb|KHG17941.1| hypothetical protein F383_07844 [Gossypium arboreum]
Length=402

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 197/267 (74%), Gaps = 1/267 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D S WLAF+GVNGL + G G IDG+GK WWD+SCRYHP  +GC  LAPTA++F +CNN  
Sbjct  106  DLSTWLAFEGVNGLSISGFGTIDGRGKGWWDRSCRYHPG-QGCFTLAPTALRFQNCNNLK  164

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N +F +SPQTH L+ GC    +  ++++SPG SPNTDGIHI    ++SI  S I+ GD
Sbjct  165  MLNTNFHNSPQTHVLLLGCQNVELGFLNIQSPGTSPNTDGIHIQFGRNVSIHNSQIADGD  224

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIGD T +I+IN+++CGPGHG+SIGSLG+ G  VQV +I V   +F+GTTNG RIKT
Sbjct  225  DCISIGDKTYDIKINDIKCGPGHGVSIGSLGRDGEAVQVNNIKVKRVSFHGTTNGVRIKT  284

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQTGRG V+NVTF N+    V+NPIIIDQ YCD   +CK   +GV I +V Y ++ GT+ 
Sbjct  285  WQTGRGLVQNVTFTNINFTAVENPIIIDQYYCDKLDSCKPTDTGVRIHDVRYSKLIGTSQ  344

Query  264  RETAINLNCSRSVPCTGIRMESIDITA  184
             E AINLNCS +VPCTGI ++++ + +
Sbjct  345  TEVAINLNCSNNVPCTGITLDNVRLVS  371



>ref|XP_007013439.1| F18B13.22 protein isoform 4, partial [Theobroma cacao]
 gb|EOY31058.1| F18B13.22 protein isoform 4, partial [Theobroma cacao]
Length=329

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 202/289 (70%), Gaps = 12/289 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D  +WL F GV+GLKV+G G I+G+G  WW+QSCR HP L     LAPTA+ F SC  
Sbjct  35   GLDQGKWLTFYGVSGLKVKGTGEINGRGWGWWNQSCRNHPGLA----LAPTAITFQSCKT  90

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SSLS +  I+S QTH LI G + F V +V + +P  SPNTDGIHI ++ ++ I  S I  
Sbjct  91   SSLSELRIINSSQTHVLIEGSDHFIVKDVIITAPETSPNTDGIHISSASNIVIRNSRIGT  150

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC+SIGD+T+NI+I+ V+CGPGHGISIGSLG++GNFVQV++I V    F GT NGARI
Sbjct  151  GDDCVSIGDHTTNIDISRVKCGPGHGISIGSLGRAGNFVQVQNIRVSRVAFKGTANGARI  210

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVR VTFENL    V NPIIIDQNYC+VRGACKEL +GV I +V Y  + GT
Sbjct  211  KTWQVGRGYVRGVTFENLFFNSVKNPIIIDQNYCNVRGACKELPTGVHIRDVTYRNLWGT  270

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKVLWCL  124
            +S    I +NCS+SV CTG+ ++SI       W L  AM   R +  C+
Sbjct  271  SSTHVGITMNCSQSVSCTGLLLQSI-------W-LKSAMAGKRVISSCI  311



>ref|XP_007013437.1| F18B13.22 protein isoform 2 [Theobroma cacao]
 gb|EOY31056.1| F18B13.22 protein isoform 2 [Theobroma cacao]
Length=374

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/289 (55%), Positives = 198/289 (69%), Gaps = 17/289 (6%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D  +WL F GV+GLKV+G G I+G+G  WW+QSCR HP L         A+ F SC  
Sbjct  85   GLDQGKWLTFYGVSGLKVKGTGEINGRGWGWWNQSCRNHPGL---------AITFQSCKT  135

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SSLS +  I+S QTH LI G + F V +V + +P  SPNTDGIHI ++ ++ I  S I  
Sbjct  136  SSLSELRIINSSQTHVLIEGSDHFIVKDVIITAPETSPNTDGIHISSASNIVIRNSRIGT  195

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC+SIGD+T+NI+I+ V+CGPGHGISIGSLG++GNFVQV++I V    F GT NGARI
Sbjct  196  GDDCVSIGDHTTNIDISRVKCGPGHGISIGSLGRAGNFVQVQNIRVSRVAFKGTANGARI  255

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ GRGYVR VTFENL    V NPIIIDQNYC+VRGACKEL +GV I +V Y  + GT
Sbjct  256  KTWQVGRGYVRGVTFENLFFNSVKNPIIIDQNYCNVRGACKELPTGVHIRDVTYRNLWGT  315

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKVLWCL  124
            +S    I +NCS+SV CTG+ ++SI       W L  AM   R +  C+
Sbjct  316  SSTHVGITMNCSQSVSCTGLLLQSI-------W-LKSAMAGKRVISSCI  356



>ref|XP_006427258.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
 gb|ESR40498.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
Length=406

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 189/265 (71%), Gaps = 1/265 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D S+W   + V+ L+++G G IDG+GK WWD SC+ +   +GC KLAPT +KF  CNN  
Sbjct  113  DKSKWFDIQSVDSLQIDGSGTIDGRGKAWWDISCKINKK-EGCVKLAPTVLKFDRCNNLR  171

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            ++N++FI+SPQTH  + GC G     +S+++PG SPNTDGIHI AS ++ I  ++IS GD
Sbjct  172  MNNMNFINSPQTHVTVMGCIGVEFGFLSIQAPGTSPNTDGIHIQASSNVYIHNAHISNGD  231

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIGD TSNI I  V CGPGHG+SIGSLGK G  V VE+I V N  F GTTNGARIKT
Sbjct  232  DCISIGDNTSNINITQVDCGPGHGVSIGSLGKDGGEVHVENITVSNINFKGTTNGARIKT  291

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+G V+++ F NL    V+NPIIIDQ+YCDV  +CKE  +GV I + +Y +  GT+ 
Sbjct  292  WQVGKGTVKHIVFSNLNFTDVENPIIIDQHYCDVADSCKETDTGVHIDDALYAQSFGTSK  351

Query  264  RETAINLNCSRSVPCTGIRMESIDI  190
             E AINLNCS S PCT I +++I +
Sbjct  352  TEVAINLNCSSSSPCTNIIVDTIQL  376



>ref|XP_010250371.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=452

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 185/269 (69%), Gaps = 9/269 (3%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D S W+ F  V+GL V G G +DG+G  WWDQSCRYH            A++F SC  
Sbjct  160  GKDQSTWIRFAKVSGLSVSGPGTVDGRGSAWWDQSCRYH---------HVQAIRFDSCKG  210

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              L NIH I+S QTH LI GC+ F++  + + SP  SPNTDGIHI +S H+ I+ +NI+ 
Sbjct  211  CQLYNIHIINSAQTHVLIIGCDWFHLDTIIINSPDFSPNTDGIHIQSSQHVFISRANIAS  270

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCIS+GD+TS++ I  + CGPGHGISIGSLG  G++VQVEDI+V +  F  TTNG RI
Sbjct  271  GDDCISVGDHTSDVSIKGIFCGPGHGISIGSLGNGGSYVQVEDIYVGHAYFFNTTNGVRI  330

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G+GY + +TFEN+    V+NPIIIDQ YC++   CK++ +GV+IS V Y  + GT
Sbjct  331  KTWQGGKGYAQRITFENINFTTVENPIIIDQYYCNIPYGCKDMPTGVKISQVTYNGMIGT  390

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            +  E AINLNCS    CTGIR+ESI + A
Sbjct  391  SRSEVAINLNCSDRAACTGIRLESIKLEA  419



>ref|XP_010254486.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=466

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 187/265 (71%), Gaps = 1/265 (0%)
 Frame = -2

Query  978  SQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLS  799
            ++W+AF  V+GL V G G IDG+G  WW+ SCR HP  KGCT LAPT+M+F +CN   LS
Sbjct  120  ARWMAFNNVSGLSVSGSGTIDGRGSDWWNNSCRDHPG-KGCTTLAPTSMEFQNCNECHLS  178

Query  798  NIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDC  619
            N+ F++SPQ H L++ CNG  +  + + SP +SPNTDGIHI A  ++ I  ++I  GDDC
Sbjct  179  NLRFVNSPQVHILVYQCNGIYIDGIVIRSPENSPNTDGIHIQAVDNMFIQRADIGAGDDC  238

Query  618  ISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQ  439
            ISIGD+TSNI + ++ CGPGHGISIGSLG  G   +VE+I+V N T   T NG RIKTW+
Sbjct  239  ISIGDFTSNINVKDIICGPGHGISIGSLGMGGTSSKVENINVNNVTLTNTMNGVRIKTWE  298

Query  438  TGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRE  259
             G+GY R +TFE+++L  V NPIIIDQ+Y      CK+L +G  ISNV +  + GT+S  
Sbjct  299  EGQGYCRGITFEHIRLTNVQNPIIIDQHYFCWVAGCKDLPTGTHISNVTFSDVMGTSSTP  358

Query  258  TAINLNCSRSVPCTGIRMESIDITA  184
             AIN+NCS +VPC+ I ++S+ + +
Sbjct  359  VAINMNCSSAVPCSEISLDSVQLVS  383



>ref|XP_010251986.1| PREDICTED: polygalacturonase-like [Nelumbo nucifera]
Length=352

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 169/217 (78%), Gaps = 0/217 (0%)
 Frame = -2

Query  834  MKFLSCNNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLS  655
            MKFL CN   LSN+ FI+SPQTH L+ GC GF ++ +++ SPG SPNTDGIHI ++  + 
Sbjct  105  MKFLKCNQIHLSNVQFINSPQTHVLVMGCTGFYINGIAINSPGHSPNTDGIHIQSAQDML  164

Query  654  ITYSNISCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFN  475
            I ++ IS GDDCISIGDYTSNI IN+V CGPGHGISIGSLGK G+F +VE+IHV N +F 
Sbjct  165  IQHTKISSGDDCISIGDYTSNIVINDVICGPGHGISIGSLGKDGSFSKVENIHVRNASFT  224

Query  474  GTTNGARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNV  295
             TTNG RIKTWQTG+GY + ++F+ +    V+NPIIIDQNYC VRGACKEL +G++IS+V
Sbjct  225  NTTNGVRIKTWQTGKGYCKKISFKRINFNNVENPIIIDQNYCSVRGACKELPTGIQISDV  284

Query  294  VYERISGTASRETAINLNCSRSVPCTGIRMESIDITA  184
             Y  + GT+S E AIN NCS S PCTGI ++SI +++
Sbjct  285  QYADMVGTSSTEVAINFNCSSSFPCTGISLKSIKLSS  321



>ref|XP_009385170.1| PREDICTED: polygalacturonase QRT2-like [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 187/272 (69%), Gaps = 3/272 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKV--EGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            DAS W+ FK V+GL++   G G+ DG+G  WW QSC+  P  KGCT LAPTA+KF+ CN+
Sbjct  107  DASLWIQFKSVDGLRLTSSGFGLFDGRGSNWWRQSCKLDPR-KGCTSLAPTAVKFVQCND  165

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
             ++S++ FI+SPQTH LI   N   V+N+++ +PG SPNTDGIHIHAS H+ I  + I  
Sbjct  166  LAVSSLRFINSPQTHILIIDSNRVYVTNLNITAPGTSPNTDGIHIHASRHVYIQDTIIGT  225

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGD TS+I +  + CGPGHGIS+GSLG+ G+ V VE I V    F  TTNGARI
Sbjct  226  GDDCISIGDRTSDIVVTRITCGPGHGISVGSLGRGGSNVSVERIQVSYVNFFNTTNGARI  285

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ   GY ++++FE ++   V NPIIIDQNY           + V+ISNV Y   +GT
Sbjct  286  KTWQGATGYAKSMSFEKIKFNNVQNPIIIDQNYGAKANNYTIQQNAVQISNVRYAYCAGT  345

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            A  + AINLNCS++VPCT I+ ++++I    R
Sbjct  346  AKTDIAINLNCSQTVPCTDIQFDNVNIPVTSR  377



>ref|XP_009779799.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
Length=308

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 170/236 (72%), Gaps = 11/236 (5%)
 Frame = -2

Query  801  SNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDD  622
            SNI+F +S QTH LI  CNGF V +V +ESPG+SPNTDGIHI +S +++IT S IS GDD
Sbjct  21   SNIYFGNSAQTHILIEKCNGFKVDSVMIESPGNSPNTDGIHIQSSQYVAITNSKISTGDD  80

Query  621  CISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTW  442
            CISIGDY+SN++  N+QCGPGHG       K GNF QVE+IHV N  F GTTNGARIKTW
Sbjct  81   CISIGDYSSNVQRYNIQCGPGHG-------KGGNFAQVENIHVSNAFFYGTTNGARIKTW  133

Query  441  QTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASR  262
            Q GRGYVR+V FENL+   V NPIIIDQNYCDVRGACKE+  GV+ISNV+Y+ I GT S 
Sbjct  134  QVGRGYVRDVIFENLEFNSVKNPIIIDQNYCDVRGACKEMVIGVQISNVIYQNIFGTPST  193

Query  261  ETAINLNCSRSVPCTGIRMESIDI---TAQGRWPLI-VAMLADRKVLWCLGLVSNN  106
              AI LN S SVPC  I M+ I +   TA    PL+ V ML  + ++  L LVS N
Sbjct  194  AIAIKLNRSMSVPCIDITMQLIQLTSATAGTATPLLTVGMLMAKNIVLNLVLVSQN  249



>ref|XP_010533165.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 177/287 (62%), Gaps = 42/287 (15%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGI--IDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G D  +WL F  V+GL V G G   ++G+G  WW+QSCR HP L+GCT +APT +     
Sbjct  116  GKDPGKWLEFIDVSGLTVAGLGFGALNGRGLAWWNQSCRDHPRLQGCTSVAPTGVN----  171

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
                               IFG            +P  SPNTDGIHIH+SH + IT S  
Sbjct  172  -------------------IFG------------APELSPNTDGIHIHSSHDVFITNSVF  200

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
            S GDDCISIGDYTSN+ I NV CGPGHGISIGSLG+ GN VQVE+IHV      GTTNG 
Sbjct  201  STGDDCISIGDYTSNVVITNVICGPGHGISIGSLGRGGNSVQVENIHVSRSYLKGTTNGL  260

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ GRGYVRNV F+++    V NPIIIDQNYC  +G CKE+ +GV I+NV Y ++ 
Sbjct  261  RIKTWQVGRGYVRNVLFQDITFDSVQNPIIIDQNYCSEKGLCKEMPTGVHITNVTYTKMV  320

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKV  136
            G++S   AIN +C RSVPCTG+ +  I +     WP+   +    K+
Sbjct  321  GSSSTAVAINFDCDRSVPCTGLNLRYIYL-----WPVPTDLDGTSKI  362



>gb|KGN60675.1| hypothetical protein Csa_2G006210 [Cucumis sativus]
Length=316

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 182/272 (67%), Gaps = 23/272 (8%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGI--IDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G D S WLA +G++ L++ G GI  IDG+G  WW+QSCR HP+L+GCT +APTAMK +SC
Sbjct  35   GTDKSLWLALEGISRLRINGSGIGKIDGRGTGWWNQSCRDHPNLEGCTSIAPTAMKIISC  94

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
            N+ +LSN+HFI+S Q   L+ GC    + N+ + +P  SPNTDGIHIH+SH++ I  + I
Sbjct  95   NDPNLSNLHFINSSQALVLLMGCIRTEIKNLVITAPERSPNTDGIHIHSSHNIIIRNTTI  154

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
              GDDC+SIGDYTS + I++++CGPGHGISIGSLG+ GNFVQVEDI V N  F GTTNGA
Sbjct  155  GTGDDCVSIGDYTSRMNISHIKCGPGHGISIGSLGRGGNFVQVEDISVSNIYFKGTTNGA  214

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ       N +  + Q F + +                   SGV I+NV  + + 
Sbjct  215  RIKTWQFS---ALNYSAYSAQKFFIFSK-----------------QSGVHIANVSIKNLF  254

Query  276  GTASRETAINLNCSRSVPCTG-IRMESIDITA  184
            GT+    AINLNCSRSV CTG I ++SI + +
Sbjct  255  GTSMSNVAINLNCSRSVACTGSILLKSIQLQS  286



>ref|XP_007148884.1| hypothetical protein PHAVU_005G022500g [Phaseolus vulgaris]
 gb|ESW20878.1| hypothetical protein PHAVU_005G022500g [Phaseolus vulgaris]
Length=440

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 173/265 (65%), Gaps = 2/265 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ +  L+V+GGG I+G G+KWW+ SC+ + +L    K APTA+ F  CNN  ++N+
Sbjct  150  WIMFQNLTNLRVDGGGTINGNGRKWWENSCKTNENLP--CKHAPTAVTFFGCNNLIVTNL  207

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H     CN    SN+ + +PG+SPNTDGIH+  + ++ I+ S+I  GDDCIS
Sbjct  208  RLKNAQQMHVRFQKCNNVTASNLILRAPGNSPNTDGIHVTETKNIMISNSSIGTGDDCIS  267

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N+ + +V CGPGHGISIGSLG   +  QV ++ V   T  GTTNG RIKTWQ G
Sbjct  268  IVSGSQNVRVTDVTCGPGHGISIGSLGAGNSKAQVSNVLVNRATITGTTNGVRIKTWQGG  327

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GY +N+ FEN+ +  V NPII+DQNYCD    CKE  S V++SN+VY+ I GT++ E A
Sbjct  328  SGYAKNIKFENIAMRNVTNPIIVDQNYCDQEKPCKEKVSAVQVSNIVYQNIRGTSASEVA  387

Query  252  INLNCSRSVPCTGIRMESIDITAQG  178
            I   CS+S PC GI  E + +T  G
Sbjct  388  IKFECSKSFPCKGIHFEDVVLTPHG  412



>ref|XP_004959073.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=417

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 172/266 (65%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F  V+GL + GGG IDG GK WW  SC+ +   +   K APTA+ F SC N  L N
Sbjct  125  HWIMFNDVDGLTIAGGGTIDGNGKIWWQNSCKTNS--RPPCKQAPTALTFYSCKNLKLEN  182

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C+   ++ +S+ +PG SPNTDGIHI  S H+ +    I  GDDC+
Sbjct  183  LKLVNSQQIHMSVEDCSHVKIARLSITAPGTSPNTDGIHITRSKHVQVRDCTIKTGDDCM  242

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+  +N+ CGPGHGISIGSLG  G+   V ++ V      GT NGARIKTWQ 
Sbjct  243  SIEDGTENLHASNIVCGPGHGISIGSLGDRGSRAHVVNVTVDTAWLYGTANGARIKTWQG  302

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY +N+ FEN+ +  V NPI+IDQNYCD    C++  S VE+SNV+++ I GT++ + 
Sbjct  303  GRGYAKNIVFENMVMGDVRNPIVIDQNYCDSATPCRKQKSAVEVSNVLFKNIRGTSASKE  362

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L CS SVPC GI +E++ +T +G
Sbjct  363  AIKLRCSTSVPCHGITLENVKLTLKG  388



>gb|KHN45091.1| Polygalacturonase [Glycine soja]
Length=388

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 177/269 (66%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F+ V  L+V+GGG I+G G+KWW+ SC+ + +L    K APTA+ F  CNN 
Sbjct  92   NDRLHWIKFENVTNLRVDGGGTINGNGRKWWENSCKRNENLP--CKPAPTAVTFYQCNNL  149

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     CN    SN+ V +PG+SPNTDGIH+  + ++ I+ S I  G
Sbjct  150  RVTNLRFKNAQQMHIRFQKCNNVTASNLIVRAPGNSPNTDGIHVTETRNILISNSIIGTG  209

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   +V+CGPGHGISIGSLG   +  QV ++ V   TF GTTNG RIK
Sbjct  210  DDCISIVSGSQNVRAIDVKCGPGHGISIGSLGAGDSKAQVSNVLVNRATFTGTTNGVRIK  269

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY +NV F N+ +  V NPII+DQNYCD    C E  S V++SN+VY+ I GT+
Sbjct  270  TWQGGSGYAKNVKFVNITMRNVTNPIIVDQNYCDQDKPCHEKDSAVKLSNIVYQNIRGTS  329

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            + E AI  +CS++VPC GI ++ + +T +
Sbjct  330  ASEVAIKFDCSKTVPCKGIYLQDVILTPE  358



>gb|EMT17063.1| Polygalacturonase [Aegilops tauschii]
Length=385

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 171/265 (65%), Gaps = 2/265 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F+ V GL V GGG IDG GK WW  SC+ +  L    + APTA+ F SC N  ++N
Sbjct  93   HWILFRSVRGLTVTGGGTIDGNGKIWWQNSCKVNSKLP--CRQAPTALTFYSCTNLEVNN  150

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C+   +S +S+ +PG SPNTDGIHI  S  + +    I  GDDC+
Sbjct  151  LELLNSQQIHISVEHCSDVRMSRLSITAPGTSPNTDGIHIAHSKDVKVMDCAIKTGDDCM  210

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ +NN+ CGPGHGISIGSLG   +  QV +I +      GTTNGARIKTWQ 
Sbjct  211  SIEDGTENLHVNNIVCGPGHGISIGSLGDRNSQAQVANITIDGARLRGTTNGARIKTWQG  270

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY +N+ F+N+ +  V NPIIIDQNYCD    C E  S VE+SNV+++ I GT++   
Sbjct  271  GWGYAKNIVFQNMMMDNVQNPIIIDQNYCDSATPCNEQKSAVEVSNVLFKNIRGTSASRE  330

Query  255  AINLNCSRSVPCTGIRMESIDITAQ  181
            AI L+CSR+VPC GI + ++ +T +
Sbjct  331  AIKLSCSRAVPCHGIALHNVRLTLK  355



>ref|XP_004499889.1| PREDICTED: polygalacturonase QRT2-like [Cicer arietinum]
Length=422

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 174/269 (65%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D S W+ F  V  L V+GGG IDG G+ WW+ SC+ +  L    K APTA+ F  CNN  
Sbjct  131  DRSLWIMFDNVTNLIVDGGGTIDGNGRIWWENSCKVNESLP--CKPAPTAVTFNECNNLR  188

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+ F ++ Q H     CN    SN+ V++PG SPNTDGIH+  S ++ I+ S I  GD
Sbjct  189  VENMKFKNAQQMHIRFQHCNNVGASNLIVKAPGHSPNTDGIHVTHSQNVIISNSIIGTGD  248

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + NI   ++ CGPGHGISIGSLG+  +  +V ++ V   TF GTTNG RIKT
Sbjct  249  DCISIVSGSKNIRATDIICGPGHGISIGSLGEGNSEAKVSNVQVNRATFKGTTNGVRIKT  308

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY +++ F N+ +  V NPIIIDQNYCD + AC E  S VE+SNVVY+ I GT++
Sbjct  309  WQGGSGYAKDIKFINIAMQNVTNPIIIDQNYCDQKKACHEQDSAVELSNVVYQNIKGTSA  368

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             E AI   CS++VPC GI ++ + +T QG
Sbjct  369  SEVAIKFECSKTVPCKGIHVQDVILTPQG  397



>ref|XP_003545985.2| PREDICTED: polygalacturonase-like [Glycine max]
Length=439

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 177/269 (66%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F+ V  L+V+GGG I+G G+KWW+ SC+ + +L    K APTA+ F  CNN 
Sbjct  143  NDRLHWIKFENVTNLRVDGGGTINGNGRKWWENSCKRNENLP--CKPAPTAVTFYQCNNL  200

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     CN    SN+ V +PG+SPNTDGIH+  + ++ I+ S I  G
Sbjct  201  RVTNLRFKNAQQMHIRFQKCNNVTASNLIVRAPGNSPNTDGIHVTETRNILISNSIIGTG  260

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   +V+CGPGHGISIGSLG   +  QV ++ V   TF GTTNG RIK
Sbjct  261  DDCISIVSGSQNVRAIDVKCGPGHGISIGSLGAGDSKAQVSNVLVNRATFTGTTNGVRIK  320

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY +NV F N+ +  V NPII+DQNYCD    C E  S V++SN+VY+ I GT+
Sbjct  321  TWQGGSGYAKNVKFVNITMRNVTNPIIVDQNYCDQDKPCHEKDSAVKLSNIVYQNIRGTS  380

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            + E AI  +CS++VPC GI ++ + +T +
Sbjct  381  ASEVAIKFDCSKTVPCKGIYLQDVILTPE  409



>gb|EEC81719.1| hypothetical protein OsI_25337 [Oryza sativa Indica Group]
Length=429

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 175/266 (66%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV GL V+GGG +DG GK WW  SC+ +  L  CT+ +PTA+ F SC+N  + N
Sbjct  135  HWIMFNGVIGLTVDGGGTVDGNGKIWWQNSCKTNAKL-ACTE-SPTALTFYSCSNLKVEN  192

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +S +++ +PG SPNTDGIHI  S ++ +T   I  GDDC+
Sbjct  193  LKLLNSQQIHMSVEDCTNVRISGLTITAPGTSPNTDGIHITRSKNVQVTGCTIKTGDDCM  252

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ +      GTTNGARIKTWQ 
Sbjct  253  SIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEAHVNNVTIGTVRLYGTTNGARIKTWQG  312

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY + + F+N+ +  V NP+IIDQNYCD    CK+  S V+ISNVV++ I GT++ + 
Sbjct  313  GRGYAKYIVFQNMIMENVWNPVIIDQNYCDSATPCKKQTSAVQISNVVFKNIRGTSASKE  372

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CSR+VPC GI +  + +T +G
Sbjct  373  AIKLDCSRNVPCQGITLNDVKLTVKG  398



>ref|XP_010548804.1| PREDICTED: polygalacturonase QRT2, partial [Tarenaya hassleriana]
Length=430

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 172/268 (64%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ VN L+VEGGGIIDG G+ WW +SC+ +P L    K APTA+ F  C N  
Sbjct  140  DRRYWIVFESVNNLRVEGGGIIDGNGQIWWKKSCKINPSLP--CKEAPTAVTFEECKNLI  197

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +S I   ++ Q H     C       + V SPG+SPNTDGIH+ A+ ++ I+ S +  GD
Sbjct  198  VSKIRLQNAQQMHLTFKDCENVKAFGIMVTSPGNSPNTDGIHVTATKNILISDSVVRTGD  257

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+    + CGPGHGISIGSLG+  +   V ++ V   T  GTTNG RIKT
Sbjct  258  DCISIVSGSVNVRATGITCGPGHGISIGSLGEGNSEAYVSNVVVNKATIIGTTNGVRIKT  317

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ GRGY +N+ F+++ +  V NPIIIDQNYCD  G+C E AS V +SNVVY  I GT+S
Sbjct  318  WQGGRGYAKNIVFQDIIMKNVTNPIIIDQNYCDRDGSCPEQASAVRVSNVVYRNIQGTSS  377

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
              TA+  +CS+S+PC GI M+++ +  Q
Sbjct  378  TPTAVKFDCSKSIPCRGISMQNVKLKDQ  405



>dbj|BAC57279.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 dbj|BAD30173.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 gb|EEE66781.1| hypothetical protein OsJ_23515 [Oryza sativa Japonica Group]
Length=429

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 174/266 (65%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV GL V GGG +DG GK WW  SC+ +  L  CT+ +PTA+ F SC+N  + N
Sbjct  135  HWIMFNGVIGLTVAGGGTVDGNGKIWWQNSCKTNAKL-ACTE-SPTALTFYSCSNLKVEN  192

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +S +++ +PG SPNTDGIHI  S ++ +T   I  GDDC+
Sbjct  193  LKLLNSQQIHMSVEDCTNVRISGLTITAPGTSPNTDGIHITRSKNVQVTGCTIKTGDDCM  252

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ +      GTTNGARIKTWQ 
Sbjct  253  SIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEAHVNNVTIGTVRLYGTTNGARIKTWQG  312

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY + + F+N+ +  V NP+IIDQNYCD    CK+  S V+ISNVV++ I GT++ + 
Sbjct  313  GRGYAKYIVFQNMIMENVWNPVIIDQNYCDSATPCKKQTSAVQISNVVFKNIRGTSASKE  372

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CSR+VPC GI +  + +T +G
Sbjct  373  AIKLDCSRNVPCQGITLNDVKLTVKG  398



>dbj|BAC57273.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 dbj|BAD30433.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
Length=422

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 176/266 (66%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV+GL V GGG +D  GK WW  SC+ +  L  CT+ APTA+ F SC+N  + N
Sbjct  135  HWIMFNGVSGLTVAGGGTVDENGKIWWQNSCKTNAKLP-CTE-APTALTFYSCSNLKVEN  192

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +S++++ +PG SPNTDGIHI  S ++ +T   I  GDDC+
Sbjct  193  LKLLNSQQIHMSVEDCTDVRISSLTITAPGTSPNTDGIHITRSKNVQVTGCIIKTGDDCM  252

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ V      GTTNGARIKTWQ 
Sbjct  253  SIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEAHVNNVTVDTVRLYGTTNGARIKTWQG  312

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY +N+ F+N+ +  V NPIIIDQNYCD    CKE  S V++SNVV++ I GT++ + 
Sbjct  313  GWGYAKNIVFQNMIMENVWNPIIIDQNYCDSATPCKEQTSAVQVSNVVFKNIRGTSASKE  372

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CSR+VPC GI ++ + +T +G
Sbjct  373  AIKLDCSRNVPCQGITLKDVKLTIKG  398



>ref|XP_010250372.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=494

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 179/283 (63%), Gaps = 17/283 (6%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTA--------  835
            G D   WLAFK V+GL ++G G I+G+G  WWDQSCR  P   GCT  APT         
Sbjct  159  GKDIDLWLAFKDVHGLWMDGTGWINGRGYNWWDQSCRNKPK-PGCTTQAPTVGTKLHNLY  217

Query  834  ------MKFLSCNNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIH  673
                      SC+   +SN+ FI+SPQ H  +   N  + + + + SP  SPNTDGIHI 
Sbjct  218  VKHVQMFSIYSCSEVFVSNLKFINSPQFHIKVGWSNKIHFTKLLINSPETSPNTDGIHIE  277

Query  672  ASHHLSITYSNISCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHV  493
            A+ H++I  + I+ GDDCISIG+ TS+I I+N+ CGPGHGISIGSLG+ G+ V V+ I V
Sbjct  278  ATSHVNIHGAVIAAGDDCISIGNGTSDINISNIICGPGHGISIGSLGRGGSTVTVDHISV  337

Query  492  YNCTFNGTTNGARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASG  313
             N  F  TTNGARIKTWQ GRGY  N+ FE L+   V NPIIIDQ YCD +  CK +  G
Sbjct  338  TNVKFLRTTNGARIKTWQGGRGYASNIKFEQLEFTEVQNPIIIDQYYCDKQ--CKNVTEG  395

Query  312  VEISNVVYERISGTASRETAINLNCSRSVPCTGIRMESIDITA  184
            V+IS++ Y    GT+    AI+LNC  +V C GI ME+I IT+
Sbjct  396  VQISDISYREAFGTSKTPIAISLNCDETVGCKGIFMENIKITS  438



>ref|XP_004172064.1| PREDICTED: polygalacturonase QRT2-like, partial [Cucumis sativus]
Length=314

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 170/270 (63%), Gaps = 2/270 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ + GL+VEG GII+G G+KWW  SC+ +  L    K APTA+ F  C N  
Sbjct  17   DRRHWIIFQNLLGLRVEGKGIINGNGRKWWLNSCKVNKTLP--CKEAPTAVTFFQCTNLR  74

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +  + F ++ Q H     CN     N+ + SPG+SPNTDGIH+  +  + I    I  GD
Sbjct  75   VEGLRFRNAQQMHLSFQKCNNVKALNLWIHSPGNSPNTDGIHVTGTQFIVIKNCLIMTGD  134

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+    + CGPGHGISIGSLG      +V ++ V    F+GTTNG RIKT
Sbjct  135  DCISIVSGSKNVRAKGITCGPGHGISIGSLGAGKTEAEVSNVVVDTAKFSGTTNGVRIKT  194

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+GY +N+ F+N+ +  V NPIIIDQNYCD +  C + A  VE+SNVVY+ I GT++
Sbjct  195  WQGGKGYAQNIIFQNIVMDNVTNPIIIDQNYCDQKEPCTQQADAVEVSNVVYQNIRGTSA  254

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQGR  175
             E A+  NCS+S+PC GI ++ I++  +G+
Sbjct  255  SEVAVKFNCSKSIPCQGILLQDINLVHKGK  284



>ref|XP_004981339.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=529

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 171/262 (65%), Gaps = 2/262 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F+ V+ L V+GGG +DG G+ WW  SC+ +PDL    K APTA+ F  C N  + +
Sbjct  228  HWIVFRRVDRLTVDGGGAVDGNGETWWKHSCKINPDLP--CKGAPTALSFHLCKNLRVED  285

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    ++ +S+ +P  SPNTDGIHI  S  + +T   I  GDDC+
Sbjct  286  LKIVNSQQIHVSVEDCTNVQLARLSITAPHSSPNTDGIHITRSKDVKVTNCKIRTGDDCV  345

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ ++ V CGPGHGISIGSLG   ++ QV  I +      GTTNGARIKT+Q 
Sbjct  346  SIEDGTHNLHVSKVVCGPGHGISIGSLGDHNSWAQVSGITIDTVQLYGTTNGARIKTYQG  405

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY +++TF+N+ +  VDNPIIIDQNYCD    C+E  S VE+SNVV++ I GT   + 
Sbjct  406  GSGYAKDITFQNMIMHAVDNPIIIDQNYCDKATPCEEQRSAVEVSNVVFKNIRGTTMTKD  465

Query  255  AINLNCSRSVPCTGIRMESIDI  190
            AI LNCS SVPC GI +++ID+
Sbjct  466  AIKLNCSMSVPCHGITLQNIDL  487



>ref|XP_011007737.1| PREDICTED: probable polygalacturonase At1g80170 [Populus euphratica]
Length=406

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 177/271 (65%), Gaps = 4/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D S WL FK +  L V G  ++DG+G+ WWD SCRY P  KGC  L PTA++F  C + 
Sbjct  114  RDLSTWLRFKDIAWLTVSGSRLLDGRGEGWWDASCRYRPG-KGCFILMPTAVRFEGCEHL  172

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + +I+ ++SPQ H  ++G     +  + ++SP  SPNTDGIHI +S+ +++  S I  G
Sbjct  173  QVDHINIVNSPQFHITLWGSRNAELRFLDIQSPESSPNTDGIHISSSNDVTVHDSIIGSG  232

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISIGDYTSNI I +V CGPGHGISIGS G+  N V+VE I V    F+GTTNGARIK
Sbjct  233  DDCISIGDYTSNITILDVSCGPGHGISIGSFGRGRNEVEVEGIFVSRANFSGTTNGARIK  292

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ  RG VR+V F +L    V+NPIIIDQ+Y D +   ++  +GV IS+V Y R  GT 
Sbjct  293  TWQGARGNVRDVHFSDLIFTEVENPIIIDQHYGDPQ---EKNQTGVHISDVSYSRAQGTT  349

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
                AIN NCS SV CT I +++I + +  R
Sbjct  350  KTAVAINFNCSSSVACTNIALDNIQLKSSIR  380



>gb|EAZ39077.1| hypothetical protein OsJ_23509 [Oryza sativa Japonica Group]
Length=498

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 176/266 (66%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV+GL V GGG +D  GK WW  SC+ +  L  CT+ APTA+ F SC+N  + N
Sbjct  135  HWIMFNGVSGLTVAGGGTVDENGKIWWQNSCKTNAKLP-CTE-APTALTFYSCSNLKVEN  192

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +S++++ +PG SPNTDGIHI  S ++ +T   I  GDDC+
Sbjct  193  LKLLNSQQIHMSVEDCTDVRISSLTITAPGTSPNTDGIHITRSKNVQVTGCIIKTGDDCM  252

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ V      GTTNGARIKTWQ 
Sbjct  253  SIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEAHVNNVTVDTVRLYGTTNGARIKTWQG  312

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY +N+ F+N+ +  V NPIIIDQNYCD    CKE  S V++SNVV++ I GT++ + 
Sbjct  313  GWGYAKNIVFQNMIMENVWNPIIIDQNYCDSATPCKEQTSAVQVSNVVFKNIRGTSASKE  372

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CSR+VPC GI ++ + +T +G
Sbjct  373  AIKLDCSRNVPCQGITLKDVKLTIKG  398



>ref|XP_006465486.1| PREDICTED: probable polygalacturonase At3g15720-like [Citrus 
sinensis]
Length=715

 Score =   267 bits (682),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D S+W   +GV+ L+++G G IDG+GK WWD SC+ +   +GC KLAPT +KF  CNN  
Sbjct  108  DKSKWFEIQGVDSLQIDGSGTIDGRGKAWWDISCKINKK-EGCIKLAPTVLKFDRCNNLR  166

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            ++N++FI+SPQTH  + GCNG     +S+++PG SPNTDGIHI AS ++ I  ++IS GD
Sbjct  167  MNNMNFINSPQTHVTLMGCNGVEFGFLSIQAPGTSPNTDGIHIQASSNVYIHNAHISDGD  226

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIGD TSNI I  V CGPGHG+SIGSLGK G  V VE+I V N  F GTTNGARIKT
Sbjct  227  DCISIGDNTSNINITQVDCGPGHGVSIGSLGKDGGEVHVENITVSNINFKGTTNGARIKT  286

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKE  325
            WQ G+G V+++ F NL    V+NPIIIDQ+YCDV  +CKE
Sbjct  287  WQVGKGTVKHIVFSNLNFTDVENPIIIDQHYCDVADSCKE  326


 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 158/269 (59%), Gaps = 15/269 (6%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D   WL F  VNG  V G G IDGQG +WW              KL   A+ F  C +
Sbjct  433  GKDRRSWLYFVNVNGFTVNGNGEIDGQGSQWW--------------KLCSDALVFEKCTS  478

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              +S +  I+S + H  +  C    +SN+ + +P  SPNTDGI I AS ++ I  SNI+ 
Sbjct  479  FQVSGLKHINSQKNHISLDNCQDATLSNLHISAPESSPNTDGIDISASQNIHILNSNIAT  538

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC++I   +S I +  + CGPGHGISIGSLGK G    VE++HV NCT N T NG RI
Sbjct  539  GDDCVAINTGSSQINVTGLTCGPGHGISIGSLGKQGEAAAVEEVHVKNCTLNATQNGLRI  598

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY R +TF ++ L  VDNPIIIDQ YC     C    + V+IS+V Y  I GT
Sbjct  599  KTWQGGSGYARKITFNDITLTDVDNPIIIDQFYCP-HEQCSNETNAVKISDVSYTGIHGT  657

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            +  + AI LNCSR+V C  I +E I IT+
Sbjct  658  SITQDAIALNCSRTVGCDNIVLEHIHITS  686



>gb|KHM99207.1| Polygalacturonase [Glycine soja]
Length=436

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 175/270 (65%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F+ V  L+V+GGG I+G G+KWW+ SC+ + +L    K APTA+ F  CNN 
Sbjct  141  NDRLHWIKFENVTNLRVDGGGTINGNGRKWWENSCKRNKNLP--CKPAPTAVTFYQCNNL  198

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     CN    SN+ V +PG+SPNTDGIH+  + ++ I+ S I  G
Sbjct  199  KVTNLRFKNAQQMHIRFQKCNNVAASNLVVRAPGNSPNTDGIHVTETKNILISNSIIGTG  258

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   +++CGPGHGISIGSLG   +  QV ++ V   T   TTNG RIK
Sbjct  259  DDCISIVSGSQNVRAIDIKCGPGHGISIGSLGAGDSKAQVSNVLVNRATLTRTTNGVRIK  318

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY  N+ F N+ +  V NPII+DQNYCD    C E  S V++SN++Y+ I GT+
Sbjct  319  TWQGGSGYAENIIFVNIAMRNVTNPIIVDQNYCDQEKPCHEKDSAVKLSNIMYQNIRGTS  378

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + E AI  NCS++VPC GI ++ + +T +G
Sbjct  379  ASEVAIKFNCSKTVPCKGIYLQDVILTPEG  408



>ref|XP_003537159.2| PREDICTED: polygalacturonase-like [Glycine max]
Length=438

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 175/270 (65%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F+ V  L+V+GGG I+G G+KWW+ SC+ + +L    K APTA+ F  CNN 
Sbjct  143  NDRLHWIKFENVTNLRVDGGGTINGNGRKWWENSCKRNKNLP--CKPAPTAVTFYQCNNL  200

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     CN    SN+ V +PG+SPNTDGIH+  + ++ I+ S I  G
Sbjct  201  KVTNLRFKNAQQMHIRFQKCNNVAASNLVVRAPGNSPNTDGIHVTETKNILISNSIIGTG  260

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   +++CGPGHGISIGSLG   +  QV ++ V   T   TTNG RIK
Sbjct  261  DDCISIVSGSQNVRAIDIKCGPGHGISIGSLGAGDSKAQVSNVLVNRATLTRTTNGVRIK  320

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY  N+ F N+ +  V NPII+DQNYCD    C E  S V++SN++Y+ I GT+
Sbjct  321  TWQGGSGYAENIIFVNIAMRNVTNPIIVDQNYCDQEKPCHEKDSAVKLSNIMYQNIRGTS  380

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + E AI  NCS++VPC GI ++ + +T +G
Sbjct  381  ASEVAIKFNCSKTVPCKGIYLQDVILTPEG  410



>ref|XP_006664897.1| PREDICTED: polygalacturonase-like [Oryza brachyantha]
Length=426

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 172/266 (65%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV GL V G G I+G GK WW  SC+ +  L  CTK APTA+ F SC+N  + N
Sbjct  134  HWIMFNGVRGLTVAGHGAINGNGKIWWQNSCKTNSKLT-CTK-APTALTFSSCSNLKVEN  191

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +  +++ +PG SPNTDGIHI  S  + +T   I  GDDC+
Sbjct  192  LKLVNSQQIHMSVEDCTDVRILGLTITAPGTSPNTDGIHITRSKKVHVTGCTIKTGDDCM  251

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ +  + CGPGHGISIGSLG   +  +V ++ V N    GTTNGARIKTWQ 
Sbjct  252  SIEDGTENLHVKKIVCGPGHGISIGSLGDHNSKARVNNVTVDNVRLYGTTNGARIKTWQG  311

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY +N+ F+N+ +  V NPIIIDQNYCD    CK+  S V++SNV ++ I GT++ + 
Sbjct  312  GRGYAKNIVFQNMIMENVWNPIIIDQNYCDSATPCKKQTSAVQVSNVSFKNIRGTSASKE  371

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CSR+VPC  I ++ + +T +G
Sbjct  372  AIKLDCSRNVPCQDINLKDVKLTVKG  397



>gb|KDO45211.1| hypothetical protein CISIN_1g041224mg [Citrus sinensis]
Length=400

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 167/268 (62%), Gaps = 10/268 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            GHD  +WL F  VNGL V G G IDG+G  WW       P          TA+ F SCNN
Sbjct  111  GHDKKKWLLFSNVNGLTVNGNGKIDGKGASWWSNKQNQRP----------TALSFGSCNN  160

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
                 +  + SP  H  ++GCN  ++SN+ + +P  SPNTDGI I  S ++ I    I+ 
Sbjct  161  LVFRGLTHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIAT  220

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC++IG  TSNI +  V CGPGHGISIGSLG +G    VED+HV +CTF GT NGARI
Sbjct  221  GDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARI  280

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+ R ++FE ++L   DNPIIIDQ YC   G CK   S V++S+V Y    GT
Sbjct  281  KTWQGGSGHARRISFERIRLESSDNPIIIDQYYCGPNGDCKNQTSAVKVSDVSYIGFQGT  340

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +S E A+ L+CS SV CT I++ +IDIT
Sbjct  341  SSTEEAVQLSCSESVGCTDIKINNIDIT  368



>ref|XP_010088223.1| Polygalacturonase QRT2 [Morus notabilis]
 gb|EXB32775.1| Polygalacturonase QRT2 [Morus notabilis]
Length=406

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 168/268 (63%), Gaps = 9/268 (3%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ V  L+VEGGG IDG G+KWW  SC+ +  L         A+ FL CNN  
Sbjct  122  DRLHWIQFENVQNLRVEGGGTIDGNGRKWWRNSCKINDSL---------AVTFLECNNLV  172

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            ++N+ F ++ Q H +I  C      N+ V +PG+SPNTDGIH+  S ++ I  S I  GD
Sbjct  173  VANLRFKNAQQMHLIIQKCVNVKAMNLRVIAPGNSPNTDGIHVTESQNIQIMNSVIRTGD  232

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+   ++ CGPGHGISIGSLG   +   V ++ V   TF+GTTNG RIKT
Sbjct  233  DCISIVSGSKNVRATDITCGPGHGISIGSLGADNSEAVVSNVMVNRATFSGTTNGVRIKT  292

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY +N+ F+N+ +  V NPIIIDQNYCD   AC E  S V+ISNV+Y  I GT+ 
Sbjct  293  WQGGSGYAKNIIFQNISMRNVSNPIIIDQNYCDQDEACHEQGSAVQISNVIYSNIKGTSD  352

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
             + A+  +CSR+ PC GI ++++D   +
Sbjct  353  SKVAVKFDCSRTFPCKGISLQNVDFAPE  380



>ref|XP_002466241.1| hypothetical protein SORBIDRAFT_01g004190 [Sorghum bicolor]
 gb|EER93239.1| hypothetical protein SORBIDRAFT_01g004190 [Sorghum bicolor]
Length=455

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/270 (47%), Positives = 173/270 (64%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F+ +N L + GGG IDG G KWW  SC+ +  L    K APTA+ F  C N 
Sbjct  139  RDRRLWIVFRSINKLTLNGGGAIDGNGHKWWPYSCKINKGLP--CKEAPTALSFHYCTNL  196

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+  ++S Q H  +       ++ +S+ +PG SPNTDGIHI  S  + +T   I  G
Sbjct  197  RVDNLKIVNSQQIHMSVEDSTNVQLAKLSITAPGTSPNTDGIHITRSKDVRVTNCKIKTG  256

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI D T  + ++NV CGPGHGISIGSLG   +  QV  I + +   +GTTNGARIK
Sbjct  257  DDCISIEDGTHKLHVSNVVCGPGHGISIGSLGDDNSRAQVSGITIDSVQLHGTTNGARIK  316

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            T+Q G GY +++TF+N+ ++ V NPIIIDQNYCD    C+E  S V+ISNVV++ I GT 
Sbjct  317  TYQGGSGYAKDITFQNMIMYNVKNPIIIDQNYCDKAKPCREQRSAVQISNVVFKNIRGTT  376

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
              + AI ++CS++VPC GI +++ID+  QG
Sbjct  377  ITKDAIKMHCSKNVPCQGITLQNIDLKMQG  406



>ref|XP_006427250.1| hypothetical protein CICLE_v10027074mg [Citrus clementina]
 gb|ESR40490.1| hypothetical protein CICLE_v10027074mg [Citrus clementina]
Length=400

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 168/268 (63%), Gaps = 10/268 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            GHD  +WL F  VNGL V G G IDG+G  WW  S + H          PTA+ F SCNN
Sbjct  111  GHDKKKWLLFSNVNGLTVNGNGKIDGKGASWW--SNKQH--------QRPTALSFGSCNN  160

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
                 +  + SP  H  ++GCN  ++SN+ + +P  SPNTDGI I  S ++ I    I+ 
Sbjct  161  LVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIAT  220

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC++IG  TSNI +  V CGPGHGISIGSLG +G    VED+HV +CTF GT NGARI
Sbjct  221  GDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARI  280

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+ R ++FE ++L   DNPIIIDQ YC     CK   S V++S+V Y    GT
Sbjct  281  KTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGT  340

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +S E A+ L+CS SV CT I++  IDIT
Sbjct  341  SSTEEAVQLSCSESVGCTDIKINDIDIT  368



>ref|XP_010557796.1| PREDICTED: polygalacturonase QRT2-like [Tarenaya hassleriana]
Length=456

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 169/269 (63%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V+ L+VEGGG IDG GK WW +SC+ +P L    K APTA+ F +C N 
Sbjct  165  RDRRHWIVFDTVHNLRVEGGGRIDGNGKIWWQKSCKINPSLP--CKEAPTAVTFTACKNL  222

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +  I   ++ Q H     C       +SV SPG+SPNTDGIH+  + ++ I+ S +  G
Sbjct  223  MVRQIRLQNAQQMHISFQDCENVKAVGLSVASPGNSPNTDGIHVSGTKNILISDSVVRTG  282

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+    + CGPGHGISIGSLGK  +   V ++ V   T  G TNG RIK
Sbjct  283  DDCISIVSGSENVRATGITCGPGHGISIGSLGKGNSEAYVSNVVVNKATIIGATNGVRIK  342

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ GRGY +N+ F+++ +  V NPIIIDQNYCD  G+C E  S V++SNVVY  I GT+
Sbjct  343  TWQGGRGYAKNIVFQDVVMKNVTNPIIIDQNYCDRDGSCPEQTSAVQVSNVVYRNIQGTS  402

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            S  TA+  +CS+S+PC G+ M+++ +  Q
Sbjct  403  STPTAVKFDCSKSIPCRGVSMQNVKLRGQ  431



>ref|XP_010654934.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=399

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 176/272 (65%), Gaps = 4/272 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCR---YHPDLKGCTKLAPTAMKFLS  820
            G     WL F  +NGL V G G I+GQG  WW Q  +   +HP L G +   P A+ F+ 
Sbjct  99   GQSVDNWLIFFRINGLIVNGKGTINGQGSIWWQQLPKNNLFHP-LDGVSNKGPDALSFVG  157

Query  819  CNNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSN  640
            CNN  L +++ I+SP+ H +IF  NG  +SN+++ +P +SPNTDGI I  S ++ + Y N
Sbjct  158  CNNLKLDHLNLINSPRRHVVIFNINGATISNLNIIAPKESPNTDGIDIGQSTNIQLHYCN  217

Query  639  ISCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNG  460
            I  GDDCI+IG  +  I I+N+ CGPGHGISIGSLG +G   +VE++ V +CTF GT NG
Sbjct  218  IKTGDDCIAIGPSSFYINISNIACGPGHGISIGSLGLNGRTDKVEEVQVRDCTFTGTRNG  277

Query  459  ARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERI  280
             RIKTW+ G GY R + FE + L   DNPIIIDQ YC      K+  SGV++S++ + R+
Sbjct  278  VRIKTWEGGSGYARKILFEGITLNAADNPIIIDQYYCPNNMCSKQSTSGVKLSDISFTRV  337

Query  279  SGTASRETAINLNCSRSVPCTGIRMESIDITA  184
             GT + + AINL+CS+SV CT I +  ++I +
Sbjct  338  IGTTTTKNAINLSCSKSVACTNILLNHVNIKS  369



>emb|CDY07963.1| BnaC03g35600D [Brassica napus]
Length=438

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 171/264 (65%), Gaps = 2/264 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V+ L+VEGGG IDG GK WW +SC+ +P+L  C + APTA+ F+ CNN  + NI
Sbjct  150  WIVFQTVDNLRVEGGGRIDGNGKIWWPKSCKINPELP-CQE-APTAVTFVECNNLMVRNI  207

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +  C      N+ V SPGDSPNTDGIH+  + ++ I  S I  GDDCIS
Sbjct  208  RLENAQQMHMRVQNCENVKALNLMVTSPGDSPNTDGIHVTGTRNILIQDSIIRTGDDCIS  267

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N+    + CGPGHGISIGSLG   +   V ++ V   T  GTTNG RIKTWQ G
Sbjct  268  IVSGSENVRATGITCGPGHGISIGSLGAHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGG  327

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G  +N+ F+++ +  V NPIII+QNYCD   AC E  S V++SNV+Y+ I GT+SR  A
Sbjct  328  HGMAKNIIFQDILMKNVTNPIIINQNYCDQTKACPEQKSAVQVSNVLYKNIHGTSSRPEA  387

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I   CS+S+PC GI ++++++  Q
Sbjct  388  IKFECSKSIPCQGISLQNVELVDQ  411



>ref|XP_010431659.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=309

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 174/263 (66%), Gaps = 3/263 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+GL + G G+++GQGK WWD  CR HP    C  LAPT M F +C N +L ++
Sbjct  20   WLIFDQVDGLAIVGRGMLNGQGKAWWDIHCRDHPG-PNCIWLAPTMMTFSNCGNVTLKSL  78

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F  S QTH L+ G     +S++ + SP  SPNTDGIHI +S  +SI++S+I+ GDDC+S
Sbjct  79   RFRDSAQTHVLVMGSQNVYISDIKITSPEASPNTDGIHITSSTAVSISHSDIAAGDDCVS  138

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +++ ++ V CGPGHG+SIGSLG+ G  V VE+I V +  F GTTNGARIKTW  G
Sbjct  139  IGDQVNSVTVSFVNCGPGHGVSIGSLGRGGTEVAVENIRVSHVNFTGTTNGARIKTWPGG  198

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPIIIDQ Y      C + + GV I  V Y ++SGT++ + A
Sbjct  199  TGYVRGIEFFDIRFSSVQNPIIIDQFY-GCSPNCPQTSKGVHIDKVRYMKMSGTSATKVA  257

Query  252  INLNCS-RSVPCTGIRMESIDIT  187
            + L+CS  +VPC+ + M  ID++
Sbjct  258  MKLDCSGLTVPCSNLFMRDIDLS  280



>ref|XP_006427249.1| hypothetical protein CICLE_v10027366mg [Citrus clementina]
 gb|ESR40489.1| hypothetical protein CICLE_v10027366mg [Citrus clementina]
Length=415

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 175/267 (66%), Gaps = 9/267 (3%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +  +W+ F  + GL + G G  DG G+KWWDQSC++HP           A+ F+ CNN  
Sbjct  126  EIERWIVFGNITGLNINGRGHFDGNGQKWWDQSCKHHPG---------KAVSFIQCNNVH  176

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            ++ I+   SPQ H ++      +  ++ ++SP  SPNTDGIHI  SH +S+  S I+ GD
Sbjct  177  INEIYVERSPQVHIVVDYSQDVHFKSLIIDSPETSPNTDGIHIARSHDVSVHTSIIAAGD  236

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI D TSNI +  V CGPGHGISIGSLGK+G  V+VE+I V +  F  TTNGARIKT
Sbjct  237  DCISISDQTSNISVTYVNCGPGHGISIGSLGKNGEEVKVENITVRHVNFCKTTNGARIKT  296

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+G V++V F  +    V NPIIIDQ YCD +  C + ++GV IS+V Y   +GT++
Sbjct  297  WQAGKGQVQHVEFSYMNFTEVQNPIIIDQYYCDQKDVCAKTSTGVHISDVRYLNATGTSA  356

Query  264  RETAINLNCSRSVPCTGIRMESIDITA  184
             + AINL+CS +V CT I++E+I++ +
Sbjct  357  TDVAINLDCSNNVACTDIKLENIELQS  383



>gb|KCW79829.1| hypothetical protein EUGRSUZ_C01172 [Eucalyptus grandis]
Length=214

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  717  ESPGDSPNTDGIHIHASHHLSITYSNISCGDDCISIGDYTSNIEINNVQCGPGHGISIGS  538
            ++PG SPNTDGIHI +S H+SI  + I  GDDCISIGDYTSNI +++V CGPGHG+SIGS
Sbjct  7    DTPGTSPNTDGIHIQSSQHVSIANAVIGTGDDCISIGDYTSNIYVSSVTCGPGHGVSIGS  66

Query  537  LGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQ  358
            LG+ GNFVQVE+IHV N  F  TTNGARIKTWQ G+GYVR +TFE L+   V NPIIIDQ
Sbjct  67   LGRRGNFVQVENIHVSNVQFKHTTNGARIKTWQVGKGYVRRITFEYLKFDSVKNPIIIDQ  126

Query  357  NYCDVRGACKELASGVEISNVVYERISGTASRETAINLNCSRSVPCTGIRMESIDITA  184
            NYC +RGACKE+ +GV ISNV Y  +SGT+S + AINLNCSRSV CT I +ESI++ +
Sbjct  127  NYCSIRGACKEMPTGVHISNVAYVGLSGTSSTDVAINLNCSRSVACTRIVLESIELMS  184



>ref|XP_006345498.1| PREDICTED: polygalacturonase QRT2-like [Solanum tuberosum]
Length=402

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 171/272 (63%), Gaps = 2/272 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKL--APTAMKFLSCN  814
             D   WL F+ +    VEG G IDG G+ WW  SC+    +   T+    PTAM F +C 
Sbjct  96   EDKRHWLLFQNMENFIVEGIGSIDGNGQVWWKSSCKVDKTIPCNTQTLTVPTAMSFYNCT  155

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  + N+ F +  + H  I       VS + + +P DSPNTDGIH+  +  + I +S I 
Sbjct  156  NLKVRNLEFKNPQKMHLTITKSELVEVSRLKITAPADSPNTDGIHVSGTKDIDIHHSYIE  215

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI + ++N+    + CGPGHGISIGSLGK+     V +I+V++ T  GTTNG R
Sbjct  216  TGDDCISIVNGSTNVRARYIHCGPGHGISIGSLGKNKEEDVVSNIYVHDATLRGTTNGLR  275

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IK+WQ GRGY +++ F+N+Q+  V NPIIIDQ YCD    CKE    V +SN++++ I G
Sbjct  276  IKSWQGGRGYAKDILFQNIQMVNVTNPIIIDQFYCDQDKPCKEQKEAVHVSNIMFKNIKG  335

Query  273  TASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            T+S +TAI L CS++VPC GI+ME+++I  +G
Sbjct  336  TSSTQTAIKLKCSKTVPCKGIQMENVNIRHEG  367



>ref|XP_011048121.1| PREDICTED: polygalacturonase [Populus euphratica]
Length=456

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 176/292 (60%), Gaps = 4/292 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F  V  L+VEGGG IDG GK WW  SC+    L    K APTA+ F  C N 
Sbjct  165  EDGRHWLVFDSVQNLQVEGGGTIDGNGKIWWQNSCKVDKTLP--CKDAPTAITFYECQNL  222

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H      NG  VSN++V SP  SPNTDGIH+  + ++ IT S I  G
Sbjct  223  VVKNLKIQNAQQMHVSFEKSNGVQVSNLTVTSPEGSPNTDGIHVTGTQNIQITDSVIGTG  282

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++ +++ CGPGHGISIGSLG   +   V  + V    F+GTTNG RIK
Sbjct  283  DDCISIVSGSQNVQASDITCGPGHGISIGSLGVHNSEDYVSGVTVNGAKFSGTTNGVRIK  342

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G  RN+ F N+++  V NPIIIDQNYCD   AC+E  S V++ NVVYE I GT+
Sbjct  343  TWQGGSGSARNIKFLNIEMNNVTNPIIIDQNYCDQDEACEEQRSAVQVKNVVYENIKGTS  402

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKVLWCLGLVS  112
            + E AI  +CS++ PC GI M  +++  +G    I +   +   L  LG+VS
Sbjct  403  ASEVAIKFDCSKTYPCGGILMHDVNLEREGAIKAIAS--CNNVKLAELGVVS  452



>ref|XP_004135935.1| PREDICTED: polygalacturonase QRT2-like [Cucumis sativus]
Length=458

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 170/271 (63%), Gaps = 2/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F+ + GL+VEG GII+G G+KWW  SC+ +  L    K APTA+ F  C N 
Sbjct  160  KDRRHWIIFQNLLGLRVEGKGIINGNGRKWWLNSCKVNKTLP--CKEAPTAVTFFQCTNL  217

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +  + F ++ Q H     CN     N+ + SPG+SPNTDGIH+  +  + I    I  G
Sbjct  218  RVEGLRFRNAQQMHLSFQKCNNVKALNLWIHSPGNSPNTDGIHVTGTQFIVIKNCLIMTG  277

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI   + N+    + CGPGHGISIGSLG      +V ++ V    F+GTTNG RIK
Sbjct  278  DDCLSIVSGSKNVRAKGITCGPGHGISIGSLGAGKTEAEVSNVVVDTAKFSGTTNGVRIK  337

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G+GY +N+ F+N+ +  V NPIIIDQNYCD +  C + A  VE+SNVVY+ I GT+
Sbjct  338  TWQGGKGYAQNIIFQNIVMDNVTNPIIIDQNYCDQKEPCTQQADAVEVSNVVYQNIRGTS  397

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + E A+  NCS+S+PC GI ++ I++  +G+
Sbjct  398  ASEVAVKFNCSKSIPCQGILLQDINLVHKGK  428



>ref|XP_011020366.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=456

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 176/292 (60%), Gaps = 4/292 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F  V  L+VEGGG IDG GK WW  SC+    L    K APTA+ F  C N 
Sbjct  165  EDRRHWLVFDSVQNLQVEGGGTIDGNGKIWWQNSCKVDKTLP--CKDAPTAITFYECQNL  222

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H      NG  VSN++V SP  SPNTDGIH+  + ++ IT S I  G
Sbjct  223  VVKNLKIQNAQQMHVSFEKSNGVQVSNLTVTSPEGSPNTDGIHVTGTQNIQITDSVIGTG  282

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++ +++ CGPGHGISIGSLG   +   V  + V    F+GTTNG RIK
Sbjct  283  DDCISIVSGSQNVQASDITCGPGHGISIGSLGVHNSEDYVSGVTVNGAKFSGTTNGVRIK  342

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G  RN+ F N+++  V NPIIIDQNYCD   AC+E  S V++ NVVYE I GT+
Sbjct  343  TWQGGSGSARNIKFLNIEMNNVTNPIIIDQNYCDQDEACEEQRSAVQVKNVVYENIKGTS  402

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKVLWCLGLVS  112
            + E AI  +CS++ PC GI M  +++  +G    I +   +   L  LG+VS
Sbjct  403  ASEVAIKFDCSKTYPCGGILMHDVNLEREGAIKAIAS--CNNVKLAELGVVS  452



>ref|XP_003566989.1| PREDICTED: polygalacturonase-like [Brachypodium distachyon]
Length=424

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 171/265 (65%), Gaps = 2/265 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ FK V GL V GGG IDG GK WW  SC+ + +L    + +P A+ F SC N  ++N
Sbjct  131  HWILFKAVRGLTVTGGGTIDGNGKIWWQNSCKVNAELP--CRQSPAALTFYSCTNLKVNN  188

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C+   +S +S+ +P  SPNTDGIHI  S  + +    I  GDDC+
Sbjct  189  LELLNSQQIHMSVECCSDVRISRLSITAPSTSPNTDGIHIAHSKDVKVRDCAIKTGDDCM  248

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +  +V +I +     +GTTNGARIKTWQ 
Sbjct  249  SIEDGTKNLHVKNIVCGPGHGISIGSLGDRNSEAEVANITIDGVRLHGTTNGARIKTWQG  308

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY +N+ F+N+ +  V NPIII+QNYCD    CK+  S VE+SNV+++ I GT++   
Sbjct  309  GRGYAKNIVFQNIIMDNVWNPIIINQNYCDSATPCKKQQSAVEVSNVLFKNIRGTSASRE  368

Query  255  AINLNCSRSVPCTGIRMESIDITAQ  181
            AI LNCS +VPC GI + ++ +T +
Sbjct  369  AIKLNCSPTVPCHGIALHNVRLTLK  393



>ref|XP_002282772.1| PREDICTED: polygalacturonase [Vitis vinifera]
 emb|CBI29905.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 169/270 (63%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+ + DL    K APTA+ F +C N 
Sbjct  151  NDMTRWLVFENVQNLAVQGGGTINGNGKTWWENSCKVNDDLP--CKDAPTALTFYNCKNL  208

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  209  VVKNLKIQNAQQMHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTG  268

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  269  DDCISIVSGTQNLQATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIK  328

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+++  VDNPIII+Q YCD    C+  +  V++ NV+Y+ I GT+
Sbjct  329  TWQGGSGSASNIKFQNIEMHDVDNPIIINQKYCDDDKPCESESQAVQVQNVLYQNIKGTS  388

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S   AI L+CS   PC GI ++ IDI   G
Sbjct  389  SSSEAIQLDCSSKFPCQGIVLQDIDIETGG  418



>ref|XP_003566446.1| PREDICTED: polygalacturonase-like [Brachypodium distachyon]
Length=424

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 168/265 (63%), Gaps = 2/265 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ FK V GL V G G IDG GK WW  SC+ +  L    + +PTA+ F SC N  ++N
Sbjct  131  HWILFKAVRGLTVTGVGTIDGNGKLWWQNSCKVNSKLP--CRQSPTALTFYSCTNLKVNN  188

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +  +S+ +P  SPNTDGIHI  S  + +    I  GDDC+
Sbjct  189  LKLLNSQQIHMSVERCTDVRIFRLSITAPSSSPNTDGIHIAHSKGVKVRNCMIRTGDDCL  248

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +  QV +I +     +GTTNGARIKTWQ 
Sbjct  249  SIEDGTKNLHVKNIVCGPGHGISIGSLGDQNSEAQVANITIDGVRLHGTTNGARIKTWQG  308

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY +N+ F+N+ +  V NPIIIDQNYCD    CK+  S VE+SNV+++ I GT++   
Sbjct  309  GRGYAKNIVFQNMIMDNVWNPIIIDQNYCDSATPCKKQKSAVEVSNVLFKNIRGTSASRE  368

Query  255  AINLNCSRSVPCTGIRMESIDITAQ  181
            AI L+CSR+ PC GI + ++ +T +
Sbjct  369  AIKLSCSRAAPCHGIALHNVKLTLK  393



>ref|XP_002282759.1| PREDICTED: polygalacturonase [Vitis vinifera]
 emb|CBI29906.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 168/270 (62%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+ + DL    K APTA+ F +C N 
Sbjct  151  NDMTRWLVFENVQNLAVQGGGTINGNGKTWWENSCKVNDDLS--CKDAPTALTFYNCKNL  208

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S +  G
Sbjct  209  VVKNLKIQNAQQMHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVLGTG  268

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  269  DDCISIVSGTQNLQATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIK  328

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+++  V NPIIIDQ YCD    CK  +  V++ NV+Y+ I GT+
Sbjct  329  TWQGGSGSASNIKFQNIEMHNVKNPIIIDQKYCDQDKPCKSQSRAVQVQNVLYQNIKGTS  388

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S   AI L+CS   PC G+ ++ IDI   G
Sbjct  389  SSNEAIQLDCSDKFPCQGVVLQDIDIEIGG  418



>ref|XP_006658431.1| PREDICTED: polygalacturonase-like [Oryza brachyantha]
Length=407

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 169/266 (64%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV  L V GGG IDG GK WW  SC+ +  L  CT+ APTA+ F SC N  + N
Sbjct  115  HWILFSGVTSLTVTGGGTIDGNGKIWWQNSCKTNSKLP-CTQ-APTALTFYSCKNLKVEN  172

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q    +  C    +S +S+ +P  SPNTDGIHI  S  + +    I  GDDC+
Sbjct  173  LKVVNSQQIQISVEDCTHVKMSRLSIFAPETSPNTDGIHITRSRDVQVADCTIKTGDDCM  232

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ V N    GTTNGARIKTWQ 
Sbjct  233  SIEDGTENLHVKNLVCGPGHGISIGSLGDHSSEDHVNNVTVDNVRMYGTTNGARIKTWQG  292

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G+G  +N+ F+N+ +  V NPIIIDQNYCD    CK+  S VE+SNV+++ I GT++ E 
Sbjct  293  GKGSAKNIVFQNMIMDNVWNPIIIDQNYCDSSTPCKQQKSAVEVSNVLFKNIRGTSASEE  352

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CS SVPC  I +E++ +T +G
Sbjct  353  AIMLHCSSSVPCHAITLENVKLTVKG  378



>gb|EMS53068.1| Polygalacturonase [Triticum urartu]
Length=409

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 172/270 (64%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D S+W+  +GV GL V GGG I+G G  WW  SC+ +  L  CTK APTA+ F  C N 
Sbjct  113  NDTSRWIMIQGVTGLTVSGGGTINGNGDVWWTNSCKTNKALP-CTK-APTALTFHLCTNL  170

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+  ++S Q H  +  CN   ++ +S+ +PG SPNTDGIHI  S  + +    I  G
Sbjct  171  QVENLKLVNSQQIHLSVEDCNAVQLARLSITAPGTSPNTDGIHITRSKDVQVKDCVIKTG  230

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI + T N+ ++ V CGPGHGIS+GSLG   +  +V  I + +    GTTNGARIK
Sbjct  231  DDCISIENGTRNLFVSKVVCGPGHGISVGSLGDDNSRAEVSGITIDSVQLYGTTNGARIK  290

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY + +TF+N+ +  V NPIIIDQNYCD    CK   S VE+SNVV++ I GT 
Sbjct  291  TWQGGSGYAKGITFQNMIMDNVQNPIIIDQNYCDSAKPCKSRGSAVEVSNVVFKNIRGTT  350

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
              + AI L+CS S+ C+ I +E+ID+  +G
Sbjct  351  VSKDAIKLSCSNSISCSDIVLENIDLKMEG  380



>ref|XP_002463688.1| hypothetical protein SORBIDRAFT_01g004230 [Sorghum bicolor]
 gb|EER90686.1| hypothetical protein SORBIDRAFT_01g004230 [Sorghum bicolor]
Length=436

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 172/269 (64%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ VN L V GGG IDG G+KWW  SC+ +  L    K+APTA+ F  C N  
Sbjct  141  DRRHWIVFRRVNKLTVNGGGTIDGNGQKWWPHSCKINKTLP--CKVAPTALSFHHCTNLR  198

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+  ++  Q H  +  C    ++ +S+ +P  SPNTDGIHI  S ++ +T   I  GD
Sbjct  199  VDNLKIMNGQQMHMSVEDCTDVVLARLSITAPARSPNTDGIHITRSKNVRVTNCKIKTGD  258

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SI + T N+ ++ V CGPGHGISIGSLG   +  +V  I + +    GTTNGARIKT
Sbjct  259  DCMSIENGTHNLHVSKVVCGPGHGISIGSLGDDNSRAEVSGITIDSVQLYGTTNGARIKT  318

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            +Q G GY +++TF+N+ ++ V NPIIIDQNYCD    C E  S V +SNVV++ I GT  
Sbjct  319  YQGGSGYAKDITFQNMIMYGVKNPIIIDQNYCDKATPCAEQRSAVRVSNVVFKNIRGTTI  378

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             + AI +NCS++VPC GI +++ID+  +G
Sbjct  379  TKHAIKMNCSKNVPCQGITLKNIDMKLKG  407



>emb|CAN64004.1| hypothetical protein VITISV_043286 [Vitis vinifera]
Length=442

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 167/270 (62%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+ + DL    K APTA+ F +C N 
Sbjct  151  NDMTRWLVFENVQNLAVQGGGTINGNGKTWWENSCKVNDDLS--CKDAPTALTFYNCKNL  208

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  209  VVKNLKIQNAQQMHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTG  268

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  269  DDCISIVSGTQNLQATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIK  328

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+++  V NPIIIDQ YCD    CK  +  V++ NV+Y+ I GT+
Sbjct  329  TWQGGSGSASNIKFQNIEMHNVXNPIIIDQKYCDQDKPCKSQSRAVQVQNVLYQNIKGTS  388

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S   AI L+CS   PC G  ++ IDI   G
Sbjct  389  SSXEAIQLDCSBKFPCQGXVLQDIDIEXGG  418



>emb|CDP18643.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 171/271 (63%), Gaps = 2/271 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D  QW+ F  V GL VEGGG+I+G+G  WW  SC+ +  L    K APTA+ F +C N
Sbjct  160  GRDGRQWIRFDSVQGLIVEGGGVINGRGNIWWQNSCKINKALP--CKDAPTAVIFYNCKN  217

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + N+ F  + Q H     C     SN+ V +P +SPNTDGIH+  + ++ I+   I  
Sbjct  218  LVVQNLRFQDAQQIHMAFEKCINVQASNLIVTAPEESPNTDGIHVTNTQNIQISGCTIGT  277

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   + N++  ++ CGPGHGISIGSLG   +   V D+ V+    +GTTNG RI
Sbjct  278  GDDCISIVSGSQNVQATDITCGPGHGISIGSLGSENSEAHVSDVTVHGARLSGTTNGVRI  337

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ   G V N+ F+N+Q+  V NPIIIDQNYCD    C +  + ++ISNV+Y+ I GT
Sbjct  338  KTWQGAAGSVSNIKFQNIQVHDVQNPIIIDQNYCDQATPCTQQHTAIQISNVLYQNIYGT  397

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            ++   AINLNCS+S PC GI ++++++  +G
Sbjct  398  SASAAAINLNCSKSFPCRGIVLQNVNLVGEG  428



>ref|XP_009800089.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=430

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 169/271 (62%), Gaps = 2/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLK--GCTKLAPTAMKFLSCN  814
             D   WL F+ +    VEG G IDG G+ WW  SC+    +     T +APTAM F +C 
Sbjct  125  QDKRHWLLFQNMENFTVEGVGSIDGNGEVWWKHSCKIDKTIPCNAKTLIAPTAMFFNNCT  184

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N ++ N+   +  + H  I       VS + + +P DSPNTDGIH+  +  + I +  I 
Sbjct  185  NVTIRNLELKNPQKMHLTISKSEHVEVSRLRLTAPADSPNTDGIHVSGTKDIDIHHCYIE  244

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI + ++N+    + CGPGHGISIGSLGK+     V +I+V++ T  GTTNG R
Sbjct  245  TGDDCISIVNGSTNVRARYIHCGPGHGISIGSLGKNKEEDAVSNIYVHDATLRGTTNGLR  304

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IK+WQ GRGY +N+ F+++ +  V NPIIIDQ YCD    CKE    V +SN++Y+ I G
Sbjct  305  IKSWQGGRGYAKNILFQDIDMVNVTNPIIIDQYYCDQEKPCKEQKEAVHVSNIMYKNIKG  364

Query  273  TASRETAINLNCSRSVPCTGIRMESIDITAQ  181
            T+S  TAI LNCS++VPC GI+ME+++I  Q
Sbjct  365  TSSTHTAIKLNCSKTVPCQGIQMENVNIRYQ  395



>ref|XP_010671219.1| PREDICTED: probable polygalacturonase At3g15720 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 177/264 (67%), Gaps = 5/264 (2%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDL---KGCTKLAPTAMKFLSCNNSSL  802
            WL F+ V+ L V+G G+IDG+G  WW+++   + D     G +   P A++F SCN   L
Sbjct  188  WLQFEYVDNLIVDGQGVIDGRGSIWWNKASIINHDAMINDGTSCDRPVALRFQSCNGFQL  247

Query  801  SNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDD  622
              +    SP +H  + G N   +SNV++ +P DSPNTDGI I +S +L I +S I+ GDD
Sbjct  248  RGLTHKDSPGSHITLSGANNSTISNVNIIAPEDSPNTDGIDISSSTNLQILHSTIATGDD  307

Query  621  CISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTW  442
            CI++G +TS I I+N+ CGPGHGIS+GSLGK G   +VE+IHV NCTF  ++NGARIKTW
Sbjct  308  CIAMGSHTSQIYISNITCGPGHGISVGSLGKDGAEAKVEEIHVRNCTFINSSNGARIKTW  367

Query  441  QTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASR  262
            Q G GY RN+T++++ L  V+NPIIIDQ YC   G CK     V +SNV +    GT+S 
Sbjct  368  QGGSGYARNITYDDIILTDVNNPIIIDQYYC--FGQCKIQPLAVAVSNVKFSGFHGTSSS  425

Query  261  ETAINLNCSRSVPCTGIRMESIDI  190
            + AI LNCS++VPCT I+M  IDI
Sbjct  426  KAAITLNCSQTVPCTNIQMADIDI  449



>ref|XP_003632658.2| PREDICTED: polygalacturonase [Vitis vinifera]
 gb|AAK81876.1| polygalacturonase PG1 [Vitis vinifera]
 emb|CBI29859.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 170/270 (63%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D + WL F+ V  L V+GGG I+G GK WW+ SC+ + DL    K APTA+ F +C N 
Sbjct  153  NDMTHWLIFENVQNLAVQGGGTINGNGKTWWENSCKVNYDLP--CKGAPTALTFYNCKNL  210

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
            ++ N+   ++ Q H     C G   S +++ +PG+SPNTDGIH+  +  + I+ S I  G
Sbjct  211  AVKNLKIQNAQQMHVSFEKCVGVQASGLTITAPGNSPNTDGIHVSYTKIIQISSSVIGTG  270

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   +  +++N + CGPGHGISIGSLG   +   V D+ V   T +GTTNG RIK
Sbjct  271  DDCISIVSGSQKVQVNGITCGPGHGISIGSLGSGDSEAHVSDVTVNGATLSGTTNGVRIK  330

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+ +  V+NPIIIDQ YCD    CK  +S V++ NV+Y+ I GT+
Sbjct  331  TWQGGSGSASNIKFQNIVMHNVENPIIIDQKYCDQSKPCKSQSSAVQVQNVLYQNIKGTS  390

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S + AI+L+CS   PC GI +  IDI   G
Sbjct  391  SSKEAISLDCSAKFPCQGILLRDIDIKVGG  420



>ref|XP_008240888.1| PREDICTED: polygalacturonase [Prunus mume]
Length=451

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 172/271 (63%), Gaps = 3/271 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D   WL F  V  L VEGGG+I+G G++WW  SC+ +   K C   APTA+ F  C N
Sbjct  158  GQDGRHWLVFDTVRNLLVEGGGVINGNGEQWWQNSCKINKS-KPCED-APTALIFQKCKN  215

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              ++N++   + Q H     C     SN+S+ +P  SPNTDGIH+  + ++ IT S I+ 
Sbjct  216  LRVNNLNVQDAQQIHVSFQKCMNVQASNLSIIAPEKSPNTDGIHVTDTQNILITNSVIAT  275

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC+SI +    ++  N+ CGPGHGISIGSLG   +   V +I V    F+GTTNG RI
Sbjct  276  GDDCLSIVNGCEKVQAKNITCGPGHGISIGSLGSRNSKAYVSEITVNGAVFSGTTNGVRI  335

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G   N+TFEN+++  V NPIIIDQNYCD R  CKE  S V++ NVVY+ ISGT
Sbjct  336  KTWQGGSGSASNITFENIEMHNVSNPIIIDQNYCD-RKTCKEQRSAVQVENVVYKNISGT  394

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            ++ + AI  +CS+S PC GI ++ I++  +G
Sbjct  395  SASDVAIKFDCSKSFPCKGIVLQGINLQREG  425



>ref|XP_002277214.2| PREDICTED: polygalacturonase isoform X1 [Vitis vinifera]
 emb|CBI29907.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 167/270 (62%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+ + DL    K APTA+ F +C N 
Sbjct  151  NDMTRWLVFENVQNLAVQGGGTINGNGKTWWENSCKVNDDLS--CKDAPTALTFYNCKNL  208

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  209  VVKNLKIQNAQQMHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTG  268

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  269  DDCISIVSGTQNLQATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIK  328

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TW  G G   N+ F+N+++  V NPIIIDQ YCD    CK  +  V++ NV+Y+ I GT+
Sbjct  329  TWPGGSGSASNIKFQNIEMHNVKNPIIIDQKYCDGDKPCKSQSRAVQVQNVLYQNIKGTS  388

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S   AI L+CS   PC GI ++ IDI   G
Sbjct  389  SSSEAIQLDCSDKFPCQGIVLQDIDIEIGG  418



>ref|XP_010464443.1| PREDICTED: polygalacturonase QRT2-like [Camelina sativa]
Length=438

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 173/269 (64%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             +   W+ F+ V+ L+VEGGG IDG G  WW +SC+ +P+L  C   APTA+ F+ CNN 
Sbjct  146  RERRHWIVFENVDNLRVEGGGRIDGNGHIWWPKSCKINPELP-CLG-APTAVTFVECNNL  203

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +SNI   ++ Q H     C+     ++ + SPGDSPNTDGIH+  + ++ I  S I  G
Sbjct  204  RVSNIRLENAQQMHLTFQDCHNVKALHLMLTSPGDSPNTDGIHVSGTRNILIQDSIIRTG  263

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+    + CGPGHGISIGSLG   +   V ++ V   T  GTTNG RIK
Sbjct  264  DDCISIVSGSENVRATGITCGPGHGISIGSLGADNSEAYVSNVVVNKATLIGTTNGVRIK  323

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ GRG  +N+ F+N+ +  V NPIII+Q+YCD   +C E  S V++SNV+Y+ I GT+
Sbjct  324  TWQGGRGMAKNIIFQNIIMKNVTNPIIINQDYCDRVESCPEQKSAVQVSNVLYKNIQGTS  383

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            SR  A+N  CS+S+PC GI M+++++  Q
Sbjct  384  SRPVAVNFACSKSIPCRGISMQNVELVDQ  412



>ref|XP_006657550.1| PREDICTED: polygalacturonase-like [Oryza brachyantha]
Length=406

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 165/266 (62%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+   GV  L V GGG IDG G  WW  SC+ +  L  CT+ APTA+ FLSC N  + N
Sbjct  114  HWILISGVTALTVTGGGTIDGNGMIWWQNSCKTNSKLP-CTE-APTALTFLSCKNLKVEN  171

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  + S Q    +  C    VS VS+ +P  SPNTDGIHI  S  + +    I  GDDC+
Sbjct  172  LKVVDSQQIQISVEDCTDVKVSRVSITAPETSPNTDGIHITRSRDVQVMDCTIKTGDDCM  231

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ +      GTTNGARIKTWQ 
Sbjct  232  SIEDGTDNLYVKNIVCGPGHGISIGSLGDHNSEAHVNNVTIDTVRLYGTTNGARIKTWQG  291

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G+G  +N+ F+N+ +  V NPIIIDQNYCD    CK+  S VE+SNV+++ I GT++ E 
Sbjct  292  GKGSAKNIVFQNMIMNNVRNPIIIDQNYCDSSTPCKQQKSAVEVSNVLFKNIQGTSASEE  351

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
             I L+CS SVPC G+ +E+I +T + 
Sbjct  352  TIMLHCSSSVPCHGVTLENIKLTLKA  377



>ref|XP_009135014.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Brassica rapa]
Length=437

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 171/264 (65%), Gaps = 2/264 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V+ L+VEGGG +DG GK WW +SC+ +P+L  C + APTA+ F+ CNN  + NI
Sbjct  149  WIVFQTVDNLRVEGGGRVDGNGKIWWPKSCKINPELP-CQE-APTAVTFVECNNLMVRNI  206

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +  C      N+ V+SPGDSPNTDGIH+  + ++ I  S I  GDDCIS
Sbjct  207  RLENAQQMHMRVQKCENVKALNLMVKSPGDSPNTDGIHVTGTRNILIQDSIIRTGDDCIS  266

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N+    + CGPGHGISIGSLG   +   V ++ V   T  GTTNG RIKTWQ G
Sbjct  267  IVSGSENVRATGITCGPGHGISIGSLGAHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGG  326

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G  +N+ F+++ +  V NPIII+QNYCD   AC E  S V++SNV+Y+ I GT+S   A
Sbjct  327  HGMAKNIIFKDILMKNVTNPIIINQNYCDQTKACPEQKSAVQVSNVLYKNIHGTSSSPEA  386

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I   CS+S+PC GI ++++++  Q
Sbjct  387  IKFVCSKSIPCQGISLQNVELVDQ  410



>ref|XP_002308956.2| hypothetical protein POPTR_0006s05120g [Populus trichocarpa]
 gb|EEE92479.2| hypothetical protein POPTR_0006s05120g [Populus trichocarpa]
Length=456

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/292 (45%), Positives = 175/292 (60%), Gaps = 4/292 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F  +  L+VEGGG IDG GK WW  SC+   +L    K APTA+ F  C N 
Sbjct  165  EDGRHWLVFDSIQNLQVEGGGTIDGNGKIWWQNSCKVDKNLP--CKDAPTAITFYECQNL  222

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H      NG  VSN++V SP  SPNTDGIH+  + ++ IT S I  G
Sbjct  223  VVKNLKIQNAQQMHVSFEKSNGVQVSNLTVTSPEGSPNTDGIHVAGTQNIQITDSVIGTG  282

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++ +++ CGPGHGISIGSLG   +   V  + V    F+GTTNG RIK
Sbjct  283  DDCISIVSGSQNVQASDITCGPGHGISIGSLGVHNSEDYVSGVTVNGAKFSGTTNGVRIK  342

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G  RN+ F N+++  V NPIIIDQNYCD    C+E  S V++ NVVY+ I GT 
Sbjct  343  TWQGGSGSARNIEFLNIEMNNVTNPIIIDQNYCDQDEPCEEQRSAVQVKNVVYKNIKGTG  402

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKVLWCLGLVS  112
            + E AI  +CS++ PC GI M  +++  +G    I +   +   L  LG+VS
Sbjct  403  ASEVAIKFDCSKTYPCEGILMHDVNLEREGAGTAIAS--CNNVKLAELGVVS  452



>ref|XP_006421419.1| hypothetical protein CICLE_v10005317mg [Citrus clementina]
 gb|ESR34659.1| hypothetical protein CICLE_v10005317mg [Citrus clementina]
Length=349

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 166/273 (61%), Gaps = 2/273 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V  L VEGGG ++G GK WW+ SC+ +  L    K APTA+ F   NN 
Sbjct  58   KDGRHWIVFDNVQNLVVEGGGTVNGNGKIWWENSCKINKSLP--CKDAPTALTFYKGNNL  115

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +SN+    + Q H     C      N+ V +PGDSPNTDGIH+  + ++ IT S I  G
Sbjct  116  VVSNLKIQDAQQIHVSFQKCKNVLAFNLMVTAPGDSPNTDGIHVTNTQNIRITSSTIGTG  175

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++  ++ CGPGHGISIGSLGK  +   V ++ V     +GT NG RIK
Sbjct  176  DDCISIVSGSQNVQAQDITCGPGHGISIGSLGKGNSNAYVSEVTVDGAKLSGTANGVRIK  235

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY  N+ F+N+ +  V NPIIIDQNYCD    CKE  S V I NVV++ I GT+
Sbjct  236  TWQGGSGYASNIIFQNIDMVNVKNPIIIDQNYCDQDDPCKEQGSAVHIKNVVFKNIRGTS  295

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
            + + A+ L+CS+S PC  I +E+I++ ++   P
Sbjct  296  ASDEAVKLDCSKSYPCEAIVLENINLQSEEDEP  328



>ref|XP_002889308.1| hypothetical protein ARALYDRAFT_316947 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65567.1| hypothetical protein ARALYDRAFT_316947 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 171/264 (65%), Gaps = 5/264 (2%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+GL + G G++DGQGK WWD  CR H     C  LAPT M F +C N +L ++
Sbjct  85   WLIFDQVDGLAIVGRGLLDGQGKSWWDIHCRDHAG-PNCIWLAPTMMTFSNCGNVTLKSL  143

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F +S QTH L+ G     ++++ V SP  SPNTDGIHI +S  +SI +S+I+ GDDC+S
Sbjct  144  RFRNSAQTHVLVMGSQNVYINDIKVTSPEASPNTDGIHITSSTVVSINHSDIATGDDCVS  203

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +N+ +  + CGPGHG SIGSLG+ G  V VE+I V++  F GTTNGARIKTW  G
Sbjct  204  IGDQVNNLNVTFMNCGPGHGDSIGSLGRGGTEVAVENIRVWHVNFTGTTNGARIKTWPGG  263

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNY-CDVRGACKELASGVEISNVVYERISGTASRET  256
             GYVR + F ++    V NPIIIDQ Y C  +  C E   GV I  V Y ++SGT++ + 
Sbjct  264  TGYVRGIEFFDIHFSSVQNPIIIDQFYGCAPK--CVETRKGVHIEKVRYMKMSGTSATKV  321

Query  255  AINLNCS-RSVPCTGIRMESIDIT  187
            A+ L CS  SVPC+ + M  ID++
Sbjct  322  AMKLECSGESVPCSNLLMRDIDLS  345



>ref|XP_004231118.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=425

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 170/272 (63%), Gaps = 2/272 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKL--APTAMKFLSCN  814
             D   WL F+ +    VEG G IDG G+ WW  SC+    +   TK    PTAM F +C 
Sbjct  119  EDKRHWLLFQNMENFIVEGVGSIDGNGQIWWKNSCKVDKTIPCNTKTLTVPTAMSFYNCT  178

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  + N+ F +  + H  I       VS + + +P DSPNTDGIH+  +  + I +S I 
Sbjct  179  NLKVRNLGFKNPQKMHLTITKSELVEVSRLKITAPYDSPNTDGIHVSGTKDIDIHHSYIE  238

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI + ++N+    + CGPGHGISIGSLGK+     V +I+V++ T  GTTNG R
Sbjct  239  TGDDCISIVNGSTNVRARYIHCGPGHGISIGSLGKNKEEDVVSNIYVHDATLRGTTNGLR  298

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IK+WQ GRGY +++ F+N+Q+  V NPIIIDQ YCD    CKE    V +SN++++ I G
Sbjct  299  IKSWQGGRGYAKDILFQNIQMVNVTNPIIIDQFYCDQDKPCKEQKEAVRVSNIMFKNIKG  358

Query  273  TASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            T+  +TAI L CS++VPC GI+ME+++I  +G
Sbjct  359  TSFTQTAIKLKCSKTVPCKGIQMENVNIRHEG  390



>ref|XP_010545772.1| PREDICTED: probable polygalacturonase At3g15720 isoform X3 [Tarenaya 
hassleriana]
Length=377

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/275 (47%), Positives = 168/275 (61%), Gaps = 10/275 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F  ++ L VEG G+IDGQG  WW    +Y  D +      PTA+KF  C N  
Sbjct  37   DNDNWIVFSDIDDLIVEGDGLIDGQGSSWW----KYENDPR------PTALKFKKCKNLQ  86

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            L  +  I SP  H  I  C G  +S++ + +P  SPNTDGI I  S ++ I    I  GD
Sbjct  87   LRGLRHIDSPMAHIHINNCYGVTISDLRITAPESSPNTDGIDIAGSTNVQIQNCFIGTGD  146

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   +S + I+ VQCGPGHGISIGSLGK G    VE+++V NC+F GTTNGARIKT
Sbjct  147  DCIAINSGSSLVNISGVQCGPGHGISIGSLGKDGEKASVEEVYVQNCSFTGTTNGARIKT  206

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY +N+ F  ++L  V NPIIIDQ YC     CK   S V++SNV+Y+   GT+S
Sbjct  207  WQGGSGYAKNIVFRGIKLDKVRNPIIIDQYYCIRGSKCKNQTSAVKVSNVLYDGFVGTSS  266

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQGRWPLIV  160
             E  +  +CS +VPCT I M +IDI ++ R  + V
Sbjct  267  TEIGVTFSCSETVPCTDIYMSNIDIDSEERGEIAV  301



>ref|XP_010486374.1| PREDICTED: polygalacturonase QRT2 [Camelina sativa]
Length=439

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 170/265 (64%), Gaps = 2/265 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F+ V+ L+VEGGG IDG G  WW +SC+ +P L  C   APTA+ F+ CNN  +SN
Sbjct  151  HWIVFENVDNLRVEGGGRIDGNGHIWWPKSCKINPKLP-CLG-APTAVTFVECNNLKVSN  208

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I   ++ Q H     C      ++ V SPGDSPNTDGIH+  + ++ I  S I  GDDCI
Sbjct  209  IRLENAQQMHLTFQDCQNVKALHLMVTSPGDSPNTDGIHVSGTRNILIQDSIIRTGDDCI  268

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI   + N+    + CGPGHGISIGSLG+  +   V ++ V   T  GTTNG RIKTWQ 
Sbjct  269  SIVSGSENVRATGITCGPGHGISIGSLGEGNSKAYVSNVVVNKATLIGTTNGVRIKTWQG  328

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRG  +N+ F+++ +  V NPIII+Q+YCD   +C E  S V++SNV+Y+ I GT+SR  
Sbjct  329  GRGMAKNIIFQDIIMKNVTNPIIINQDYCDRVESCPEQKSAVQVSNVLYKNIQGTSSRPV  388

Query  255  AINLNCSRSVPCTGIRMESIDITAQ  181
            A+N  CS+S+PC GI M+++ +  Q
Sbjct  389  AVNFACSKSIPCRGISMQNVKLVDQ  413



>emb|CDP07789.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 170/275 (62%), Gaps = 3/275 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F+ +    VEGGG+I G G+ WW +SC+   D K     APTAM F  C N 
Sbjct  167  QDRRIWIKFEKLRDFSVEGGGVISGNGQIWWPKSCKV--DKKQPCLGAPTAMTFDKCTNV  224

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+   ++ Q H     C     SN+ V+S G SPNTDGIH+  S ++ I  S+I  G
Sbjct  225  KVTNLRIKNAQQMHLTFRDCTNVEASNLKVKSKGSSPNTDGIHVSGSRNVQILNSDIGTG  284

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   ++ +    ++CGPGHGISIGSLGK+G+   V DI V   TF GTTNG RIK
Sbjct  285  DDCISIVSGSNKVRAAGIKCGPGHGISIGSLGKNGDEDHVSDILVNTATFTGTTNGVRIK  344

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA-CKELASGVEISNVVYERISGT  271
            +WQ GRGY +N+ FEN+ +  V NPIIIDQ YCD +   CKE  + V++++V Y  I GT
Sbjct  345  SWQGGRGYAKNIVFENIVMRNVTNPIIIDQFYCDKKEKDCKEQKNAVQVNSVSYRNIKGT  404

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGRWPL  166
            ++ E  I   CS + PC G+RME++ +T +GR  L
Sbjct  405  SATEKGIIFECSATFPCEGVRMENVQLTHKGRSSL  439



>ref|XP_010472981.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Camelina 
sativa]
Length=397

 Score =   249 bits (637),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 171/263 (65%), Gaps = 3/263 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+GL + G G+++GQGK WWD  CR HP    C  LAPT M F +C N +L ++
Sbjct  108  WLIFDQVDGLAIVGRGLLNGQGKAWWDIHCRDHPG-PNCIWLAPTMMTFSNCGNVTLKSL  166

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F  S QTH L+ G     +S++ + SP  SPNTDGIHI +S  +SI +S+I+ GDDC+S
Sbjct  167  RFRDSAQTHVLVMGSQNVYISDIKITSPEASPNTDGIHITSSTSVSINHSDIAAGDDCVS  226

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +N+ ++ V CGPGHG+S+GSLG+ G  V VE+I V++  F GTTNGARIKTW  G
Sbjct  227  IGDQVNNVTVSFVNCGPGHGVSVGSLGRGGTEVAVENIRVWHVNFTGTTNGARIKTWPGG  286

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPIIIDQ Y      C +    V I  V Y ++SGT++ + A
Sbjct  287  TGYVRGIEFFDIRFSSVQNPIIIDQFY-GCAPNCPQTRKAVHIEKVRYMKMSGTSATKVA  345

Query  252  INLNCS-RSVPCTGIRMESIDIT  187
            + L+CS  SVPC+ + M  I ++
Sbjct  346  MKLDCSGESVPCSILFMRDIALS  368



>emb|CDY37571.1| BnaA02g19990D [Brassica napus]
Length=374

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 166/262 (63%), Gaps = 2/262 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F+ V GL + G G++DGQGK WWD  CR HP    C  LAPT M F +C N  L ++
Sbjct  85   WLIFERVEGLVLSGRGLLDGQGKGWWDIHCRDHPG-PNCIWLAPTMMTFSNCRNVILKSL  143

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F +S Q+H L+ G    ++ +V ++SP  SPNTDG+HI +S  +SIT+S+ + GDDC+S
Sbjct  144  RFRNSAQSHILVMGSQNVHIKDVKIKSPEISPNTDGVHITSSSDVSITHSDFATGDDCVS  203

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD   N+ +  V CGPGHG+S+GSLG+ G  V+VEDI V +  F GTTNGARIKTW  G
Sbjct  204  IGDQVHNLSVTFVNCGPGHGVSVGSLGRGGTEVEVEDIRVAHVNFTGTTNGARIKTWPGG  263

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPIIIDQ Y      C +    V I  V Y ++SGT+  E A
Sbjct  264  TGYVRGIEFFDIRFSNVQNPIIIDQFY-GCAPNCVQTEKAVHIEKVKYMKMSGTSRTEVA  322

Query  252  INLNCSRSVPCTGIRMESIDIT  187
            + L CS    C+ + M  ID++
Sbjct  323  MKLECSGKNACSNVFMRDIDLS  344



>emb|CAN83753.1| hypothetical protein VITISV_026267 [Vitis vinifera]
Length=441

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 172/284 (61%), Gaps = 3/284 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+   DL    K APTA+ F +C N 
Sbjct  150  NDXTRWLVFENVQNLAVQGGGTINGNGKIWWENSCKVDDDLS--CKDAPTALTFYNCKNL  207

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  208  VVKNLKIENAQQIHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTG  267

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  268  DDCISIVSGTQNLQATGITCGPGHGISIGSLGYGNSEALVSDITVNGATLSGTTNGVRIK  327

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TW  G G   N+ F+N+++  VDNPIII+Q YCD    C+  +  V++ NV+Y+ I GT+
Sbjct  328  TWPGGSGSASNIKFQNIEMHDVDNPIIINQKYCDDDKPCESESQAVQVQNVLYQNIKGTS  387

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKV  136
            S   AI L+CS   PC GI ++ IDI   G      A+  D KV
Sbjct  388  SSSEAIQLDCSSKFPCQGIVLQDIDIXTGGG-KAATAVCXDAKV  430



>ref|XP_010545769.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=458

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 172/276 (62%), Gaps = 12/276 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F  ++ L VEG G+IDGQG  WW    +Y  D +      PTA+KF  C N  
Sbjct  118  DNDNWIVFSDIDDLIVEGDGLIDGQGSSWW----KYENDPR------PTALKFKKCKNLQ  167

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            L  +  I SP  H  I  C G  +S++ + +P  SPNTDGI I  S ++ I    I  GD
Sbjct  168  LRGLRHIDSPMAHIHINNCYGVTISDLRITAPESSPNTDGIDIAGSTNVQIQNCFIGTGD  227

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   +S + I+ VQCGPGHGISIGSLGK G    VE+++V NC+F GTTNGARIKT
Sbjct  228  DCIAINSGSSLVNISGVQCGPGHGISIGSLGKDGEKASVEEVYVQNCSFTGTTNGARIKT  287

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA-CKELASGVEISNVVYERISGTA  268
            WQ G GY +N+ F  ++L  V NPIIIDQ YC +RG+ CK   S V++SNV+Y+   GT+
Sbjct  288  WQGGSGYAKNIVFRGIKLDKVRNPIIIDQYYC-IRGSKCKNQTSAVKVSNVLYDGFVGTS  346

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWPLIV  160
            S E  +  +CS +VPCT I M +IDI ++ R  + V
Sbjct  347  STEIGVTFSCSETVPCTDIYMSNIDIDSEERGEIAV  382



>ref|XP_002277234.1| PREDICTED: polygalacturonase [Vitis vinifera]
 emb|CBI29904.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 167/270 (62%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+   DL    K APTA+ F +C N 
Sbjct  150  NDLTRWLVFENVQNLAVQGGGTINGNGKIWWENSCKVDDDLS--CKDAPTALTFYNCKNL  207

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  208  VVKNLKIENAQQIHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTG  267

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  268  DDCISIVSGTQNLQATGITCGPGHGISIGSLGYGNSEALVSDITVNGATLSGTTNGVRIK  327

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TW  G G   N+ F+N+++  VDNPIII+Q YCD    C+  +  V++ NV+Y+ I GT+
Sbjct  328  TWPGGSGSASNIKFQNIEMHDVDNPIIINQKYCDDDKPCESESQAVQVQNVLYQNIKGTS  387

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S   AI L+CS   PC GI ++ IDI   G
Sbjct  388  SSSEAIQLDCSSKFPCQGIVLQDIDIETGG  417



>ref|XP_004289976.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=449

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 171/267 (64%), Gaps = 2/267 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + W+ F  V  L V+G G I+G G+ WW  SC+   + K C   APTA+ F  CNN 
Sbjct  162  KDLNHWIMFDNVKNLLVQGPGTINGNGQVWWKNSCK-RKETKPCGTHAPTAVTFYKCNNL  220

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+ F  + Q H    GC     S ++V +P  SPNTDGIHI ++ +++I+ SNI  G
Sbjct  221  VVKNLKFQDAQQMHVSFEGCTNVQASYLTVTAPETSPNTDGIHITSTKNMTISNSNIGTG  280

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++ +++ CGPGHGISIGSLGK G+   V  + V    F+GTTNG RIK
Sbjct  281  DDCISIVSGSQNVQASSITCGPGHGISIGSLGKDGSEDYVSKVTVNGAKFSGTTNGVRIK  340

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVR-GACKELASGVEISNVVYERISGT  271
            TWQ G G   N+ F+N+++  V NPIIIDQNYCD   G CK+ +  V++ NV+Y+ I GT
Sbjct  341  TWQGGSGMASNIAFQNIEMKNVYNPIIIDQNYCDTSDGKCKQQSKAVKVRNVLYQNIRGT  400

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            ++ + AI  +CS+S+PC GI ++++ +
Sbjct  401  SASQDAITFDCSKSIPCQGIVLQNVQL  427



>emb|CDY38648.1| BnaC02g23310D [Brassica napus]
Length=374

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 165/262 (63%), Gaps = 2/262 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V GL + G G++DGQGK WWD  CR HP    C  LAPT M F +C N  L ++
Sbjct  85   WLIFDRVEGLVLSGRGLLDGQGKGWWDIHCRDHPG-PNCIWLAPTMMTFSNCRNVILKSL  143

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F +S Q+H L+ G    ++ +V ++SP  SPNTDG+HI +S  +SIT+S+ + GDDC+S
Sbjct  144  RFRNSAQSHILVMGSQNVHIKDVKIKSPEISPNTDGVHITSSSDVSITHSDFATGDDCVS  203

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD   N+ +  V CGPGHG+S+GSLG+ G  V+VEDI V +  F GTTNGARIKTW  G
Sbjct  204  IGDQVHNLSVTFVNCGPGHGVSVGSLGRGGTEVEVEDIRVAHVNFTGTTNGARIKTWPGG  263

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPI+IDQ Y      C +    V I  V Y ++SGT+  E A
Sbjct  264  TGYVRGIEFFDIRFSNVQNPIVIDQFY-GCAPNCVQTEKAVHIEKVKYMKMSGTSRTEVA  322

Query  252  INLNCSRSVPCTGIRMESIDIT  187
            + L CS    C+ + M  ID++
Sbjct  323  MKLECSGKNACSNVFMRDIDLS  344



>ref|XP_009147011.1| PREDICTED: polygalacturonase QRT2-like [Brassica rapa]
Length=438

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 171/270 (63%), Gaps = 2/270 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ VN L+VEGGG IDG G KWW  SC+ +P+L  C   APTA+ F+ C N  +SNI
Sbjct  150  WIVFEAVNNLRVEGGGRIDGNGNKWWPNSCKINPNLP-CLG-APTAVTFVECKNLMVSNI  207

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H     C      N+ V SPG+SPNTDGIH+  + ++ I  S I  GDDCIS
Sbjct  208  RLENAQQMHMTFQDCENVKALNLMVTSPGNSPNTDGIHVTGTRNILIQDSIIRTGDDCIS  267

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N+    + CGPGHGISIGSLG + +   V ++ V   T  GTTNG RIKTWQ G
Sbjct  268  IVSGSENVRATGITCGPGHGISIGSLGANNSEAYVSNVVVNKATLIGTTNGVRIKTWQGG  327

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G  +N+ F+++ +  V NPIII+Q+YCD   +C +  S V++SNV+Y+ I GT+SR  A
Sbjct  328  HGVAKNIIFQDIIMKNVTNPIIINQDYCDRVESCPQQKSAVQVSNVLYKNIQGTSSRPVA  387

Query  252  INLNCSRSVPCTGIRMESIDITAQGRWPLI  163
            +   CS+S+PC GI M+++ +  Q +  ++
Sbjct  388  VKFECSKSIPCQGISMQNVKLVDQTQQDVV  417



>ref|XP_007203487.1| hypothetical protein PRUPE_ppa022427mg, partial [Prunus persica]
 gb|EMJ04686.1| hypothetical protein PRUPE_ppa022427mg, partial [Prunus persica]
Length=431

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 171/271 (63%), Gaps = 3/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F  V  L VEGGG+I+G G++WW  SC+ +   K C K APTA+ F  C N 
Sbjct  137  QDGRHWLVFDTVRNLLVEGGGVINGNGEQWWQNSCKINKS-KPC-KDAPTALIFQKCKNL  194

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N++   + Q H     C     SN+S+ +P  SPNTDGIH+  + ++ IT S I+ G
Sbjct  195  RVNNLNIQDAQQIHVSFQKCMNVQASNLSIIAPEKSPNTDGIHVTDTQNILITNSVIATG  254

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI +    ++  N+ CGPGHGISIGSLG   +   V +I V     +GTTNG RIK
Sbjct  255  DDCLSIVNGCEKVQATNITCGPGHGISIGSLGSGNSKAYVSEITVTGAILSGTTNGVRIK  314

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA-CKELASGVEISNVVYERISGT  271
            TWQ G G   N+TFEN+++  V NPIIIDQNYCD R   CKE  S V++ NVVY+ ISGT
Sbjct  315  TWQGGSGSASNITFENIEMHNVSNPIIIDQNYCDNRKKPCKEQRSAVQVENVVYKNISGT  374

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            ++ + AI  +CS+S PC GI ++ I++  +G
Sbjct  375  SASDVAIKFDCSKSFPCKGIVLQGINLQREG  405



>ref|XP_010667059.1| PREDICTED: polygalacturonase-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 173/279 (62%), Gaps = 9/279 (3%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
             +D+  WL FK +N ++V+GGG+IDG GK WW  SC+     K C K APTA+ F  C N
Sbjct  124  AYDSRHWLVFKKINNIRVQGGGVIDGNGKIWWQNSCKVDK-TKPC-KSAPTALVFNDCEN  181

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              ++N++  ++ Q H    GCN    S +++ SP DSPNTDGIHI ++ ++ +T S+I  
Sbjct  182  LVVNNLNIQNAQQMHLSFNGCNLVKASGLTITSPEDSPNTDGIHITSTKNIQVTSSSIGT  241

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   + ++   ++ CGPGHGISIGSLG   +   V DI V       TTNG RI
Sbjct  242  GDDCISIETGSQSVRAMDITCGPGHGISIGSLGDKESKAHVSDITVNGANLTKTTNGVRI  301

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G   N+ F+N+    V NPIIIDQ YCD    CK+ AS V+I NV+Y+ I+GT
Sbjct  302  KTWQGGSGVASNIIFQNIHFSDVKNPIIIDQQYCDQDTPCKKQASAVQIRNVLYQNITGT  361

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI-------TAQGR  175
            +  + A+  +CS + PC GI M++++I       TAQ R
Sbjct  362  SVSKNAVVFDCSETHPCQGITMQNVEIESSEGDETAQAR  400



>emb|CDX74019.1| BnaA03g30280D [Brassica napus]
Length=437

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 169/264 (64%), Gaps = 2/264 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V+ L+VEGGG IDG GK WW +SC+ +P+L  C + APTA+ F+ CNN  + NI
Sbjct  149  WIVFQTVDNLRVEGGGRIDGNGKIWWPKSCKINPELP-CQE-APTAVTFVECNNLMVRNI  206

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +  C      N+ V SPG SPNTDGIH+  + ++ I  S I  GDDCIS
Sbjct  207  RLENAQQMHMRVQKCENVKALNLMVTSPGHSPNTDGIHVTGTRNILIQDSIIRTGDDCIS  266

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N+    + CGPGHGISIGSLG   +   V ++ V   T  GTTNG RIKTWQ G
Sbjct  267  IVSGSENVRATGITCGPGHGISIGSLGAHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGG  326

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G  +N+ F+++ +  V NPIII+QNYCD   AC E  S V++SNV+Y+ I GT+S   A
Sbjct  327  HGMAKNIIFKDILMKNVTNPIIINQNYCDQTKACPEQKSAVQVSNVLYKNIHGTSSSPEA  386

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I   CS+S+PC GI ++++++  Q
Sbjct  387  IKFVCSKSIPCQGISLQNVELVDQ  410



>gb|EMT24271.1| Polygalacturonase [Aegilops tauschii]
Length=410

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 175/271 (65%), Gaps = 3/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D S+W+  +GVNGL V GGG I+G G  WW  SC+ +  L  CTK APTA+ F  CNN 
Sbjct  113  NDRSRWILIQGVNGLTVSGGGTINGNGDVWWTNSCKVNKALP-CTK-APTALTFHQCNNL  170

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+  ++S Q H  +  C+   ++ +S+ +PG SPNTDGIHI  S  + +    I  G
Sbjct  171  QVENLKLVNSQQIHLSVEDCSAVQLARLSITAPGTSPNTDGIHITRSKDVQVKDCVIKTG  230

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI +   N++++ V CGPGHGIS+GSLG   +  +V  I + +    GTTNGARIK
Sbjct  231  DDCISIENGAHNLDVSKVVCGPGHGISVGSLGDDNSRAEVSGITIDSVQLYGTTNGARIK  290

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGAC-KELASGVEISNVVYERISGT  271
            TWQ G GY + +TF+N+ +  V NPIIIDQ+YCD    C +   S VE+SNV+++ I GT
Sbjct  291  TWQGGSGYAKGITFQNMIMDNVQNPIIIDQSYCDSAKPCNRGHGSAVEVSNVIFKNIRGT  350

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
               + AI L+CS ++ C+GI +E+ID+  +G
Sbjct  351  TVSKDAIKLSCSNTISCSGIVLENIDLKMEG  381



>gb|KGN52445.1| hypothetical protein Csa_5G635400 [Cucumis sativus]
Length=412

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 164/269 (61%), Gaps = 5/269 (2%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G    QW+  K + GL V+G G I+ QG  WWD       + K CT+  PT++       
Sbjct  111  GKQCRQWILLKHMKGLVVKGSGTINAQGNTWWDLCTN---EEKVCTR-RPTSLILEDSEK  166

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + NI F  SPQ H  I       V N+ +E+PGDSPNTDGIHI  S  +SIT S+I  
Sbjct  167  VHIKNIAFKDSPQMHMAIENSKYVFVKNLYIEAPGDSPNTDGIHIQHSRKISITSSSIRT  226

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISIGD +  I I+ + CGPGHGISIGSLGK GN  +VE IHV + TF  TTNG RI
Sbjct  227  GDDCISIGDGSYRINISKIACGPGHGISIGSLGKHGNHEKVEFIHVKDVTFTDTTNGVRI  286

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY RN+ FE +      NPIIIDQ YCD    CK   S V++SNV+Y R+SGT
Sbjct  287  KTWQGGSGYARNIIFEGIVSRGSLNPIIIDQFYCD-HEKCKNQTSAVKVSNVLYNRVSGT  345

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            +  + A+NL CS + PC  I M+ I + +
Sbjct  346  SKSKIAVNLACSETEPCRNILMKDIKLKS  374



>ref|XP_002466242.1| hypothetical protein SORBIDRAFT_01g004220 [Sorghum bicolor]
 gb|EER93240.1| hypothetical protein SORBIDRAFT_01g004220 [Sorghum bicolor]
Length=452

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 174/271 (64%), Gaps = 3/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F+ V+ L V G G +DG G+ WW  SC+ +  L    K APTA+ F  C + 
Sbjct  153  EDRRHWIVFRQVDRLTVNGAGTVDGNGETWWKNSCKINKALP--CKEAPTALSFHFCTSL  210

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + +++ ++S Q H  I  C G  ++ +S+ +PG SPNTDGIHI  S+ + +T   I  G
Sbjct  211  RVQDLNVVNSQQIHMSIEDCTGVQLTGLSITAPGTSPNTDGIHITRSNDVQVTNCKIKTG  270

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI   T N+ ++ V CGPGHGISIGSLG   +  +V  I + +    GTTNGARIK
Sbjct  271  DDCLSIESGTHNLHVSQVVCGPGHGISIGSLGDDNSRAEVSGITIDSVQLYGTTNGARIK  330

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA-CKELASGVEISNVVYERISGT  271
            T+Q G GY +++TF+N+ ++ V NPIIIDQNYCD   A C+   S VE+SNVV++ I GT
Sbjct  331  TYQGGSGYAKDITFQNMVMYDVANPIIIDQNYCDKATAPCELQGSAVEVSNVVFKNIKGT  390

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
               + AI LNCSR+VPC GI +++I++  QG
Sbjct  391  TVTKDAIMLNCSRNVPCLGITLQNINLRMQG  421



>ref|XP_006465488.1| PREDICTED: uncharacterized protein LOC102623476 [Citrus sinensis]
Length=815

 Score =   257 bits (656),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 167/268 (62%), Gaps = 10/268 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            GHD  +WL F  VNGL V G G IDG+G  WW                 PTA+ F SCNN
Sbjct  526  GHDKKKWLLFSNVNGLTVNGNGKIDGKGASWWSNK----------QNQRPTALSFGSCNN  575

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
                 +  + SP  H  ++GCN  ++SN+ + +P  SPNTDGI I  S ++ I    I+ 
Sbjct  576  LVFRGLTHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIAT  635

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC++IG  TSNI +  V CGPGHGISIGSLG +G    VED+HV +CTF GT NGARI
Sbjct  636  GDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARI  695

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+ R ++FE ++L   DNPIIIDQ YC   G CK   S V++S+V Y    GT
Sbjct  696  KTWQGGSGHARRISFERIRLESSDNPIIIDQYYCGPNGDCKNQTSAVKVSDVSYIGFQGT  755

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +S E A+ L+CS SV CT I++ +IDIT
Sbjct  756  SSTEEAVQLSCSESVGCTDIKINNIDIT  783


 Score =   255 bits (652),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 176/264 (67%), Gaps = 9/264 (3%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+AF  + GL + G G+ DG G+KWWDQSC++HP           A+ F+ C+N+ ++ 
Sbjct  120  RWIAFGNITGLNINGRGLFDGNGQKWWDQSCKHHPG---------KAVSFIQCSNAHINE  170

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I+   SPQ H ++      +  ++ + SP  SPNTDGIHI  SH +S+  S I+ GDDCI
Sbjct  171  IYVERSPQVHVVVDYSQDVHFKSLIINSPETSPNTDGIHIAHSHDVSVHTSVIAAGDDCI  230

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D TSNI +  V CGPGHGISIGSLGK+G  V+VE+I V +  F  TTNGARIKTWQ 
Sbjct  231  SISDQTSNISVTYVNCGPGHGISIGSLGKNGEEVKVENITVRHVNFYKTTNGARIKTWQA  290

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G+G V++V F  +    V NPIIIDQ YCD +  C + ++GV I++V Y   +GT++ + 
Sbjct  291  GKGQVQHVEFSYMNFTEVQNPIIIDQYYCDQKDVCAKTSTGVHINDVRYLNATGTSATDV  350

Query  255  AINLNCSRSVPCTGIRMESIDITA  184
            AINL+CS +V CT I++E+I++ +
Sbjct  351  AINLDCSNNVACTDIKLENIELQS  374



>ref|XP_006292816.1| hypothetical protein CARUB_v10019065mg [Capsella rubella]
 gb|EOA25714.1| hypothetical protein CARUB_v10019065mg [Capsella rubella]
Length=433

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 173/268 (65%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D   WL  + VN L ++GG  GII+G GK WW  SC+     K CT  APTA+     N
Sbjct  146  KDKYHWLIIEDVNNLSIDGGSTGIINGNGKIWWQNSCKIDKS-KPCT-TAPTALTLYKLN  203

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N ++ N+    + Q    I  CN  +V NV++ +PGDSPNTDGIHI ++ ++ ++ S+I 
Sbjct  204  NLNVKNLRVRDAQQIQVSIENCNNVDVKNVAITAPGDSPNTDGIHITSTKNIRVSKSDIG  263

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D T N++I+++ CGPGHGISIGSLG   +   V  I+V    F+ + NG R
Sbjct  264  TGDDCISIEDGTQNLQISDLTCGPGHGISIGSLGDDNSKAYVSGIYVDGAKFSESDNGVR  323

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+Q+  V NPIIIDQNYCD +  C+E  S V++ NVVY+ ISG
Sbjct  324  IKTYQGGSGTAKNIKFQNIQMKNVKNPIIIDQNYCD-KAKCEEQDSAVQVKNVVYKNISG  382

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++   AI LNCS   PC GI +E+++I
Sbjct  383  TSATNVAITLNCSEKYPCQGIVLENVNI  410



>gb|EAZ03178.1| hypothetical protein OsI_25331 [Oryza sativa Indica Group]
Length=415

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 171/266 (64%), Gaps = 7/266 (3%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F GV+GL V GGG +D  GK WW  SC+ +  L  CT+ APTA+ F SC+N  + N
Sbjct  135  HWIMFNGVSGLTVAGGGTVDENGKIWWQNSCKTNAKLP-CTE-APTALTFYSCSNLKVEN  192

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C    +S++++ +PG SPNTDGIHI  S ++ +    I  GDDC+
Sbjct  193  LKLLNSQQIHMSVEDCTDVRISSLTITAPGTSPNTDGIHITRSKNVQVAGCIIKTGDDCM  252

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +   V ++ V      GTTNGARIKTWQ 
Sbjct  253  SIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEAHVNNVTVDPVRLYGTTNGARIKTWQG  312

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY +N+ F+N+ +  V NPIIIDQNYCD    CKE     ++SNVV++ I GT++ + 
Sbjct  313  GWGYAKNIVFQNMIMENVWNPIIIDQNYCDSATPCKE-----QVSNVVFKNIRGTSASKE  367

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI L+CSR+VPC GI ++ + I   G
Sbjct  368  AIKLDCSRNVPCQGITLKDVTIKGGG  393



>ref|XP_008665635.1| PREDICTED: polygalacturonase-like [Zea mays]
 ref|XP_008665636.1| PREDICTED: polygalacturonase-like [Zea mays]
 tpg|DAA52075.1| TPA: hypothetical protein ZEAMMB73_445912 [Zea mays]
Length=436

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 172/269 (64%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F+ ++ L V GGG IDG G+KWW  SC+ +  L    K APTA+ F  C + 
Sbjct  140  NDRRHWIVFRSIDKLTVNGGGAIDGNGEKWWPHSCKINKALP--CKEAPTALSFHYCVDL  197

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + ++  ++S Q H  +       ++ +S+ +PG SPNTDGIHI  S  + +T   I  G
Sbjct  198  KVEDLKIVNSQQIHMSVEDSANALLARLSITAPGTSPNTDGIHITRSKDVRVTDCKIKTG  257

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI + T N+ ++ V CGPGHGISIGSLG   +  +V  I + +   +GTTNGARIK
Sbjct  258  DDCMSIENGTHNLHVSKVNCGPGHGISIGSLGDDNSRAEVSGITIDSVQLHGTTNGARIK  317

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            T+Q G GY +++TF+N+ ++ V NPIIIDQNYCD    C E  S V++S VV++ I GT 
Sbjct  318  TYQGGSGYAKDITFQNMVMYDVKNPIIIDQNYCDKAKPCGEQESAVQVSGVVFKNIRGTT  377

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            S + AI +NCS +VPC GI +++ID+  Q
Sbjct  378  STKDAIKMNCSENVPCQGITLQNIDLKMQ  406



>ref|XP_004986167.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=429

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 167/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+GV+ L V GGG +DG G+ WW  SC+ +  +    K APTA+ F  C N  
Sbjct  134  DRRHWIVFRGVDELTVNGGGAVDGNGETWWKHSCKINKAMP--CKEAPTALSFHFCTNLK  191

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +  +  ++S Q H  I  C    +  +S+ + G SPNTDGIHI  S  + +T   I  GD
Sbjct  192  VEGLKVMNSQQIHMSIEDCTNVQLRGLSITASGTSPNTDGIHITRSKDVQVTNCKIRTGD  251

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SI + T N+ ++ V CGPGHGISIGSLG   +  +V  I +      GTTNGARIKT
Sbjct  252  DCMSIENGTHNLHVSKVVCGPGHGISIGSLGDDNSRAEVSGITIDAVQLYGTTNGARIKT  311

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            +Q G GY +++TF+N+ +  V NPIIIDQNYCD    CK   S VE+SNVV++ I GT  
Sbjct  312  YQGGSGYAKDITFQNMIMDNVKNPIIIDQNYCDKAKPCKAQESAVEVSNVVFKNIRGTTI  371

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             + AI LNCSR+VPC GI +++ID+  + 
Sbjct  372  TKDAIKLNCSRNVPCHGITLQNIDLKMEA  400



>gb|EMS52449.1| Polygalacturonase [Triticum urartu]
Length=420

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 168/265 (63%), Gaps = 2/265 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F+ V GL V GGG IDG GK WW  SC+ +  L    + APTA+ F SC N  ++N
Sbjct  128  HWILFRSVRGLTVTGGGTIDGNGKFWWQNSCKVNTKLP--CRQAPTALTFYSCTNLKVNN  185

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +  ++S Q H  +  C+   +S +S+ +P  SPNTDGIHI  S  + +    I  GDDC+
Sbjct  186  LEVLNSQQIHISMERCSDVRMSRLSIRAPSTSPNTDGIHIVHSKDVKVMDCAIKTGDDCM  245

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ + N+ CGPGHGISIGSLG   +  QV +I +     + T NGARIKTWQ 
Sbjct  246  SIEDGTENLHVKNIVCGPGHGISIGSLGDRNSQAQVANITIDGVRLHDTANGARIKTWQG  305

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRGY +N+ F+N+ +  V NPIIIDQNYC+    C +    VE+SN++++ I GT++   
Sbjct  306  GRGYAKNIVFKNMIMDNVRNPIIIDQNYCNSATPCNKQKVAVEVSNLLFKNIRGTSASRE  365

Query  255  AINLNCSRSVPCTGIRMESIDITAQ  181
            AI L+CS++VPC GI + ++ +T +
Sbjct  366  AIKLSCSKAVPCHGIALHNVRLTLK  390



>ref|XP_003595746.1| Polygalacturonase [Medicago truncatula]
 gb|AES65997.1| polygalacturonase [Medicago truncatula]
Length=444

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 164/271 (61%), Gaps = 1/271 (0%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCT-KLAPTAMKFLSCNN  811
             D   W+ F  V+  KV+GGG  +G GKKWW+ SC+Y  +   C  +  PTA+ F  C N
Sbjct  148  EDRQHWIVFDSVSNFKVDGGGTFNGNGKKWWENSCKYSNNNLPCNDEPRPTAVTFYDCKN  207

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + N+ F  S Q H +   C    VSN+ V +P DSPNTDGIH+  + ++ I   +I  
Sbjct  208  LKVKNLRFKDSQQMHVVFERCFNVFVSNLIVRAPEDSPNTDGIHVAETQNIDIINCDIGT  267

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   + N+   ++ CGPGHGISIGSLG   +  +V ++ V      GTTNG RI
Sbjct  268  GDDCISIVSGSKNVRAIDITCGPGHGISIGSLGADNSEAEVSNVVVNRAALTGTTNGVRI  327

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY RN+ F N+++  V NP+IIDQ YCD    C+E    V++S V+Y+ I GT
Sbjct  328  KTWQGGSGYARNIKFMNIKMQNVTNPVIIDQYYCDQTEPCQERNKAVQLSQVLYQNIRGT  387

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            ++ E AI  NCSRSVPC  I ++ + +  +G
Sbjct  388  SASEIAIKFNCSRSVPCREIYLQDVILEPEG  418



>gb|KFK38249.1| hypothetical protein AALP_AA3G088700 [Arabis alpina]
Length=437

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 168/268 (63%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +   W+ F+ V  L+VEGGG IDG GK WW  SC+ +P L  C   APTA+ F+ C N  
Sbjct  146  ERRHWIVFENVTNLRVEGGGRIDGNGKIWWPNSCKINPQLP-CLG-APTAVTFVECKNLR  203

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +SNI   ++ Q H     C      ++ VESPG+SPNTDGIH+  + ++ I  S +  GD
Sbjct  204  VSNIRLENAQQMHMTFQDCQNVKAFHLMVESPGNSPNTDGIHVSGTRNILIQDSIVRTGD  263

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+ +  + CGPGHGISIGSLG   +   V ++ V   T  GTTNG RIKT
Sbjct  264  DCISIVSGSENVRVTGITCGPGHGISIGSLGADNSEAYVSNVVVNKATLIGTTNGVRIKT  323

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G  +N+ F+++ +  V NPIII+Q+YCD   AC E  S V++SNV+Y+ I GT+S
Sbjct  324  WQGGHGMAKNIIFQDIIMKNVTNPIIINQDYCDRPEACPEQKSAVQVSNVLYKNIQGTSS  383

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
            R  A+   CS+S+PC GI M+++ +  Q
Sbjct  384  RPIAVKFVCSKSIPCRGISMQNVKLVDQ  411



>gb|KCW90200.1| hypothetical protein EUGRSUZ_A02373, partial [Eucalyptus grandis]
Length=377

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 166/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F GV  L V+GGG  DG G  WW  SC+ +  L    K APTA+ F +C N  
Sbjct  87   DRRHWIMFDGVKNLVVQGGGTFDGNGLIWWQNSCKINKALP--CKDAPTALTFYNCENLI  144

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
              N+   ++ Q H     C+    +++ V +PG SPNTDGIH+  + ++ I+ S I  GD
Sbjct  145  TRNLKIQNAQQIHVSFDKCSDVQAADLQVIAPGSSPNTDGIHVTGTQNIEISSSIIGTGD  204

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI D + N++  ++ CGPGHGISIGSLG   +   V  + V    F+GTTNG RIKT
Sbjct  205  DCISIVDGSQNVQAMDITCGPGHGISIGSLGSGNSEAHVSGVTVNRANFSGTTNGVRIKT  264

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ F+N+++  V NPIIIDQNYCD    C++  S VE+ NV+Y+ I GT++
Sbjct  265  WQGGSGSASNIKFQNIEMHDVSNPIIIDQNYCDQDEPCEQQRSAVEVRNVMYQNIKGTSA  324

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             + AI  NCS+SVPC GI +++ID+   G
Sbjct  325  SDVAIEFNCSQSVPCKGIVLQNIDMQKTG  353



>ref|XP_006489947.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=467

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 167/273 (61%), Gaps = 2/273 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V  L VEGGG ++G GK WW+ SC+ +  L    K APTA+ F   NN 
Sbjct  169  KDGRHWIVFDNVQNLVVEGGGTVNGNGKIWWENSCKINKSLP--CKDAPTALTFYKGNNL  226

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +SN+    + Q H     C      N+ V +PGDSPNTDGIH+  + ++ IT S I  G
Sbjct  227  VVSNLKIQDAQQIHVSFQKCKNVLAFNLMVTAPGDSPNTDGIHVTNTQNIRITSSTIGTG  286

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++  ++ CGPGHGISIGSLGK  +   V ++ V     + T NG RIK
Sbjct  287  DDCISIVSGSQNVQAQDITCGPGHGISIGSLGKGNSNAYVSEVTVDGAKLSETANGVRIK  346

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GYV N+ F+N+ +  V NPIIIDQNYCD    CKE +S V I NVV++ I GT+
Sbjct  347  TWQGGSGYVSNIIFQNIDMVNVKNPIIIDQNYCDQDDPCKEQSSAVHIKNVVFKNIRGTS  406

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
            + + A+ L+CS+S PC  I +E+I++ ++   P
Sbjct  407  ASDEAVKLDCSKSYPCEAIVLENINLQSEEDEP  439



>gb|KCW66098.1| hypothetical protein EUGRSUZ_G03373 [Eucalyptus grandis]
Length=377

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 167/268 (62%), Gaps = 2/268 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  +   ++EGGG I+G G+KWW  SC+ +  L    K APTAM F  C N 
Sbjct  89   KDRAHWLMFNNLTDFRMEGGGFINGNGRKWWANSCKINKTLP--CKAAPTAMTFYECKNL  146

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++++   ++ Q H L   C      N+ V +P  SPNTDGIH+  + ++ I    I  G
Sbjct  147  RVADLIIQNAQQMHLLFQKCVNVIALNLLVSAPEKSPNTDGIHVTGTQNILIKNCVIRTG  206

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++  ++ CGPGHGISIGSLG   +   V ++ V     +GTTNG RIK
Sbjct  207  DDCISIVSGSKNVQATDIVCGPGHGISIGSLGAGKSTDYVSNVLVNRARLSGTTNGVRIK  266

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY +N+TF+N+ +  V NPIII+QNYCD    C E AS V++SNVVY+ I GT+
Sbjct  267  TWQGGSGYAKNITFQNISMRNVTNPIIINQNYCDQNEPCPEQASAVQVSNVVYKNIKGTS  326

Query  267  SRETAINLNCSRSVPCTGIRMESIDITA  184
            + E AIN +CS+S PC GI +++I + +
Sbjct  327  ASEVAINFDCSKSYPCKGILLQNIGLVS  354



>ref|XP_008665639.1| PREDICTED: polygalacturonase ADPG2-like [Zea mays]
 tpg|DAA52083.1| TPA: hypothetical protein ZEAMMB73_529440 [Zea mays]
Length=475

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 168/272 (62%), Gaps = 5/272 (2%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ V+ L V G G IDG G  WW  SC+ +  L    K APTA+ F  C N  
Sbjct  147  DRRHWIVFRSVDRLTVHGRGSIDGNGHSWWPHSCKINKALP--CKAAPTALSFHYCTNLR  204

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+  ++S Q H  I  C    VS +S+ +PG SPNTDGIHI  S  + +T   I  GD
Sbjct  205  VENLKMMNSQQIHMSIEDCASVQVSRLSITAPGTSPNTDGIHITRSKDVRVTNCKIKTGD  264

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SI D T  + ++ V CGPGHGIS+GSLG   +  +V  I + +   +GTTNGARIKT
Sbjct  265  DCMSIEDGTHGLHVSGVVCGPGHGISVGSLGDDDSRAEVSGITIDSVQLHGTTNGARIKT  324

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA---CKELASGVEISNVVYERISG  274
            +Q G GY R++TF+N+ +  V NPI+IDQ+YCD   A   C+E  S V+IS+VV+  I G
Sbjct  325  YQGGSGYARDITFQNMAMHGVRNPIVIDQSYCDRAEAEPPCREQRSAVQISDVVFRNIRG  384

Query  273  TASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            T     AI ++CSR VPC GI +++ID+  QG
Sbjct  385  TTVTRDAIRMSCSRDVPCRGIVLQNIDLKMQG  416



>emb|CAD21651.2| endo polygalacturonase [Brassica rapa subsp. rapa]
Length=433

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/269 (47%), Positives = 176/269 (65%), Gaps = 5/269 (2%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G+D + WL  + VN L ++GG  GI+DG GK WW  SC+     K CTK APTA+   + 
Sbjct  145  GNDKNHWLILEDVNNLSIDGGSAGIVDGNGKIWWQNSCKIDKS-KPCTK-APTALTLYNL  202

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
             N ++ N+   ++ Q    I  CN  +V NV + +PGDSPNTDGIHI A+ ++ I+ S+I
Sbjct  203  KNLNVKNLRVRNAQQIQISIEKCNNVDVKNVKITAPGDSPNTDGIHIVATKNIRISNSDI  262

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
              GDDCISI D + N++IN++ CGPGHGISIGSLG   +   V  I+V   T + T NG 
Sbjct  263  GTGDDCISIEDGSQNVQINDLTCGPGHGISIGSLGDDNSKAYVSGINVDGATLSETDNGV  322

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKT+Q G G  +N+ F+N+++  V NPIIIDQNYCD +  C++  S V+++NVVY  I 
Sbjct  323  RIKTYQGGSGTAKNIKFQNIRMDNVKNPIIIDQNYCD-KDKCEQQESAVQVNNVVYRNIQ  381

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDI  190
            GT++ + AI  NCS   PC GI +E+++I
Sbjct  382  GTSATDVAIMFNCSVKYPCQGIVLENVNI  410



>ref|XP_006299494.1| hypothetical protein CARUB_v10015662mg [Capsella rubella]
 gb|EOA32392.1| hypothetical protein CARUB_v10015662mg [Capsella rubella]
Length=437

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 166/265 (63%), Gaps = 2/265 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+ F+ V  L+VEGGG IDG G  WW +SC+ +P L  C   APTA+ F+ CNN  +SN
Sbjct  149  RWIVFENVTNLRVEGGGRIDGNGHIWWSKSCKINPKLP-CLG-APTAVMFMECNNLRVSN  206

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I   ++ Q H     C       + V SPGDSPNTDGIH+  S ++ I  S +  GDDCI
Sbjct  207  IRLENAQQMHLTFQNCQNVKALRLRVTSPGDSPNTDGIHVSGSRNILIQDSVVGTGDDCI  266

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI   + N+    + CGPGHGISIGSLG   +   V ++ +   T  GTTNG RIKTWQ 
Sbjct  267  SIVSGSENVRATGITCGPGHGISIGSLGAGNSEAYVSNVVINKATLIGTTNGVRIKTWQG  326

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRG  +N+ F+++ +  V NPI+I+Q+YCD   +C E  S V++SNV+Y+ I GT+S   
Sbjct  327  GRGMAKNIIFQDILMKNVTNPILINQDYCDRVESCPEQKSAVQVSNVLYKNIQGTSSTPV  386

Query  255  AINLNCSRSVPCTGIRMESIDITAQ  181
            A+   CS+S+PC GI M+ +++  Q
Sbjct  387  AVKFQCSKSIPCRGISMQDVELVDQ  411



>gb|AAF21207.1|AC013483_31 putative polygalacturonase [Arabidopsis thaliana]
Length=438

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 168/268 (63%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +   W+ F+ VN L+VEGGG IDG G  WW +SC+ +P L  C   APTA+ F+ CNN  
Sbjct  147  ERRHWIVFENVNNLRVEGGGRIDGNGHIWWPKSCKINPQLP-CLG-APTAVTFVECNNLR  204

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +SNI   ++ Q H     C      N+ V SP DSPNTDGIH+  + ++ I  S +  GD
Sbjct  205  VSNIRLENAQQMHLTFQDCKNVKALNLMVTSPADSPNTDGIHVSGTQNILIQDSIVRTGD  264

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+    + CGPGHGISIGSLG+  +   V ++ V   T  GTTNG RIKT
Sbjct  265  DCISIVSGSENVRATGITCGPGHGISIGSLGEDNSEAYVSNVVVNKATLIGTTNGVRIKT  324

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G  +N+ F+++ +  V NPIII+Q+YCD   AC E  S V++SNV+Y+ I GT+S
Sbjct  325  WQGGHGMAKNIIFQDIIMKNVTNPIIINQDYCDRVEACPEQKSAVQVSNVLYKNIQGTSS  384

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
            R  A+   CS+++PC GI M+++ +  Q
Sbjct  385  RPIAVKFVCSKNIPCRGISMQNVKLVDQ  412



>ref|NP_187454.2| polygalacturonase QRT2 [Arabidopsis thaliana]
 sp|Q9SFB7.2|QRT2_ARATH RecName: Full=Polygalacturonase QRT2; Short=AtQRT2; Short=PG 
QRT2; AltName: Full=Pectinase QRT2; AltName: Full=Protein QUARTET 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE74626.1| polygalacturonase QRT2 [Arabidopsis thaliana]
Length=439

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 168/268 (63%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +   W+ F+ VN L+VEGGG IDG G  WW +SC+ +P L  C   APTA+ F+ CNN  
Sbjct  148  ERRHWIVFENVNNLRVEGGGRIDGNGHIWWPKSCKINPQLP-CLG-APTAVTFVECNNLR  205

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +SNI   ++ Q H     C      N+ V SP DSPNTDGIH+  + ++ I  S +  GD
Sbjct  206  VSNIRLENAQQMHLTFQDCKNVKALNLMVTSPADSPNTDGIHVSGTQNILIQDSIVRTGD  265

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+    + CGPGHGISIGSLG+  +   V ++ V   T  GTTNG RIKT
Sbjct  266  DCISIVSGSENVRATGITCGPGHGISIGSLGEDNSEAYVSNVVVNKATLIGTTNGVRIKT  325

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G  +N+ F+++ +  V NPIII+Q+YCD   AC E  S V++SNV+Y+ I GT+S
Sbjct  326  WQGGHGMAKNIIFQDIIMKNVTNPIIINQDYCDRVEACPEQKSAVQVSNVLYKNIQGTSS  385

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
            R  A+   CS+++PC GI M+++ +  Q
Sbjct  386  RPIAVKFVCSKNIPCRGISMQNVKLVDQ  413



>ref|XP_008461801.1| PREDICTED: polygalacturonase-like [Cucumis melo]
Length=446

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 166/270 (61%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   WL F+GV+   VEG GII+G G+KWW  SC+ + +L    K APTA+ F  C N 
Sbjct  156  NDRRHWLKFEGVDNFVVEGNGIINGNGRKWWQNSCKVNKELP--CKRAPTAVTFYQCINL  213

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +SN+ F  + Q H     C      N+ V +PG+SPNTDGIHI  + +  I    I  G
Sbjct  214  VVSNLMFKDAQQMHLTFQKCTNVKALNLRVVAPGNSPNTDGIHITETQNAIIRNCVIGTG  273

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +  +V +I V     +GT+NG RIK
Sbjct  274  DDCISIVSGSRNVRAMDITCGPGHGISIGSLGAENSEAEVSNIRVNRALISGTSNGVRIK  333

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY +N+ F+N+ +  V NPIIIDQNYCD   +C E  S V++SNVVY+ I GT+
Sbjct  334  TWQGGSGYAKNIMFQNVVMKNVSNPIIIDQNYCDKEDSCPEQNSAVKVSNVVYKNIRGTS  393

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + + AI  +CS+S PC  I +  + I  QG
Sbjct  394  ASDDAIKFDCSKSFPCQEISLLGVHIVGQG  423



>ref|XP_011093353.1| PREDICTED: polygalacturonase QRT2-like [Sesamum indicum]
Length=430

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 170/273 (62%), Gaps = 0/273 (0%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V  + V GGG IDG G  WW  SC+        ++ APTA+ F +C N  +SN+
Sbjct  138  WIMFEDVRNMDVFGGGTIDGNGDVWWKNSCKIKKTQPCQSQSAPTALTFKNCTNLRVSNL  197

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
              +++ Q       CN    S +SV +P +SPNTDGIHI  + ++++  S I  GDDC+S
Sbjct  198  KLVNAQQMQVNFQDCNDVEASKLSVVAPAESPNTDGIHITRTTNINVLDSEIRTGDDCVS  257

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I + + N+E+ N+ CGPGHGISIGSLG+  +   V DI V      GT+NG RIKTWQ G
Sbjct  258  IVNGSRNVEVRNIVCGPGHGISIGSLGEDNSEHYVSDISVKGVKMTGTSNGVRIKTWQGG  317

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
            RG  RN+ F+++++  V NPIIIDQ YCD    CKE  S V++ NV+Y  I GT++ + A
Sbjct  318  RGIARNIEFDDIEMRNVSNPIIIDQFYCDKNKNCKEEKSAVQVENVIYRNIRGTSASKIA  377

Query  252  INLNCSRSVPCTGIRMESIDITAQGRWPLIVAM  154
            I+  CS+SVPC  + ++++ +TAQ +   + A 
Sbjct  378  ISFKCSQSVPCRNLMLQNVKLTAQEKGEKVEAF  410



>emb|CBI36303.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 172/272 (63%), Gaps = 12/272 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCR---YHPDLKGCTKLAPTAMKFLS  820
            G     WL F  +NGL V G G I+GQG  WW Q  +   +HP           A+ F+ 
Sbjct  99   GQSVDNWLIFFRINGLIVNGKGTINGQGSIWWQQLPKNNLFHP---------LDALSFVG  149

Query  819  CNNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSN  640
            CNN  L +++ I+SP+ H +IF  NG  +SN+++ +P +SPNTDGI I  S ++ + Y N
Sbjct  150  CNNLKLDHLNLINSPRRHVVIFNINGATISNLNIIAPKESPNTDGIDIGQSTNIQLHYCN  209

Query  639  ISCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNG  460
            I  GDDCI+IG  +  I I+N+ CGPGHGISIGSLG +G   +VE++ V +CTF GT NG
Sbjct  210  IKTGDDCIAIGPSSFYINISNIACGPGHGISIGSLGLNGRTDKVEEVQVRDCTFTGTRNG  269

Query  459  ARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERI  280
             RIKTW+ G GY R + FE + L   DNPIIIDQ YC      K+  SGV++S++ + R+
Sbjct  270  VRIKTWEGGSGYARKILFEGITLNAADNPIIIDQYYCPNNMCSKQSTSGVKLSDISFTRV  329

Query  279  SGTASRETAINLNCSRSVPCTGIRMESIDITA  184
             GT + + AINL+CS+SV CT I +  ++I +
Sbjct  330  IGTTTTKNAINLSCSKSVACTNILLNHVNIKS  361



>ref|XP_008665637.1| PREDICTED: polygalacturonase ADPG1-like isoform X1 [Zea mays]
 tpg|DAA52077.1| TPA: hypothetical protein ZEAMMB73_569322 [Zea mays]
Length=441

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 170/268 (63%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ ++ L V GGG IDG G+KWW  SC+ +  L    K APTA+ F  C    
Sbjct  144  DRRHWIVFRSIDELTVNGGGAIDGNGEKWWPHSCKINKALP--CKEAPTALSFHYCVGLK  201

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + ++  ++S Q H  +       ++ +S+ +PG SPNTDGIHI  S  + +T   I  GD
Sbjct  202  VEDLKIMNSQQIHMSVEDSANVLLARLSITAPGTSPNTDGIHITRSKDVRVTDCKIKTGD  261

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SI + T N+ ++ V CGPGHGISIGSLG   +  +V  I + +   +GTTNGARIKT
Sbjct  262  DCMSIENGTHNLHVSKVTCGPGHGISIGSLGDDNSRAEVSGITIDSVQLHGTTNGARIKT  321

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            +Q G GY +++TF+N+ ++ V NPIIIDQNYCD    C E  S V++S VV++ I GT S
Sbjct  322  YQGGSGYAKDITFQNMVMYDVKNPIIIDQNYCDRAKPCGEQESAVQVSGVVFKNIRGTTS  381

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
             + AI +NCS +VPC GI +++ID+  Q
Sbjct  382  TKDAIKMNCSENVPCQGITLQNIDLEMQ  409



>ref|XP_002313308.2| hypothetical protein POPTR_0009s06520g, partial [Populus trichocarpa]
 gb|EEE87263.2| hypothetical protein POPTR_0009s06520g, partial [Populus trichocarpa]
Length=436

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 171/269 (64%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   WL F+ V   +V GGG IDG GK WW+ SC+ +   + C + APTA+ FL C + 
Sbjct  145  NDRRHWLVFENVQNFRVRGGGTIDGNGKIWWENSCKINKS-QPC-QHAPTAVTFLECKSL  202

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     C      N+ V +PG SPNTDGIH+  + ++ I    I  G
Sbjct  203  IVANLRFQNAQQMHLSFQNCVNVRALNLMVIAPGTSPNTDGIHVTGTQNIRIRNCVIRTG  262

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+E  ++ CGPGHGISIGSLG   +  +V ++ V   T +GTTNG RIK
Sbjct  263  DDCISIVSGSKNVEATDITCGPGHGISIGSLGADNSGAEVSNVFVNRATISGTTNGVRIK  322

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ F+N+ +  V NPIII+QNYCD    C+E  S V+ISNV+Y+ I GT+
Sbjct  323  TWQGGSGYARNIVFQNVVMRNVTNPIIINQNYCDQDSPCEEQTSAVQISNVMYKNIKGTS  382

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            + + A+  +CS+++PC GI ++ ++I  +
Sbjct  383  ASDVAVKFDCSKNIPCRGILLQDVNIALE  411



>ref|XP_007013438.1| F18B13.22 protein isoform 3, partial [Theobroma cacao]
 gb|EOY31057.1| F18B13.22 protein isoform 3, partial [Theobroma cacao]
Length=276

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 144/191 (75%), Gaps = 0/191 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D  +WL F GV+GLKV+G G I+G+G  WW+QSCR HP L+GCT LAPTA+ F SC  
Sbjct  85   GLDQGKWLTFYGVSGLKVKGTGEINGRGWGWWNQSCRNHPGLEGCTSLAPTAITFQSCKT  144

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
            SSLS +  I+S QTH LI G + F V +V + +P  SPNTDGIHI ++ ++ I  S I  
Sbjct  145  SSLSELRIINSSQTHVLIEGSDHFIVKDVIITAPETSPNTDGIHISSASNIVIRNSRIGT  204

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC+SIGD+T+NI+I+ V+CGPGHGISIGSLG++GNFVQV++I V    F GT NGARI
Sbjct  205  GDDCVSIGDHTTNIDISRVKCGPGHGISIGSLGRAGNFVQVQNIRVSRVAFKGTANGARI  264

Query  450  KTWQTGRGYVR  418
            KTWQ GRGYVR
Sbjct  265  KTWQVGRGYVR  275



>ref|XP_010024123.1| PREDICTED: polygalacturonase [Eucalyptus grandis]
Length=420

 Score =   245 bits (626),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 166/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F GV  L V+GGG  DG G  WW  SC+ +  L    K APTA+ F +C N  
Sbjct  130  DRRHWIMFDGVKNLVVQGGGTFDGNGLIWWQNSCKINKALP--CKDAPTALTFYNCENLI  187

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
              N+   ++ Q H     C+    +++ V +PG SPNTDGIH+  + ++ I+ S I  GD
Sbjct  188  TRNLKIQNAQQIHVSFDKCSDVQAADLQVIAPGSSPNTDGIHVTGTQNIEISSSIIGTGD  247

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI D + N++  ++ CGPGHGISIGSLG   +   V  + V    F+GTTNG RIKT
Sbjct  248  DCISIVDGSQNVQAMDITCGPGHGISIGSLGSGNSEAHVSGVTVNRANFSGTTNGVRIKT  307

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ F+N+++  V NPIIIDQNYCD    C++  S VE+ NV+Y+ I GT++
Sbjct  308  WQGGSGSASNIKFQNIEMHDVSNPIIIDQNYCDQDEPCEQQRSAVEVRNVMYQNIKGTSA  367

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             + AI  NCS+SVPC GI +++ID+   G
Sbjct  368  SDVAIEFNCSQSVPCKGIVLQNIDMQKTG  396



>ref|XP_002517823.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF44630.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=446

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 167/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V  L+V+GGG I+G GK WWD SC+     K C   APTA+ F  C N 
Sbjct  156  KDRRHWIVFDNVENLRVKGGGTINGNGKMWWDNSCKIDKS-KPCIG-APTAVTFSDCKNL  213

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     C      N+ V +PG SPNTDGIH+ ++ ++ I    I  G
Sbjct  214  IVANLWFQNAQQMHLTFQKCKNVRALNLIVTAPGKSPNTDGIHVTSTQNIRIRNCVIRTG  273

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI   + N+E  ++ CGPGHGISIGSLG   +  +V ++ V   T +GTTNG RIK
Sbjct  274  DDCLSIESGSKNVEATDIVCGPGHGISIGSLGDGNSEAEVSNVLVNRATLSGTTNGVRIK  333

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G+ +N+ F+N+ +  V NPIIIDQNYCD    C E  S V++SNVVY+ I GT+
Sbjct  334  TWQGGSGFAKNIVFQNIVMNNVTNPIIIDQNYCDQDDPCPEQKSAVQVSNVVYKSIKGTS  393

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            + ETA+  +CS++ PC GI ++ + +  Q
Sbjct  394  ASETAMKFDCSKTFPCQGILLQDVALGNQ  422



>ref|XP_010067866.1| PREDICTED: polygalacturonase-like [Eucalyptus grandis]
Length=435

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 167/267 (63%), Gaps = 2/267 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D + WL F  +   ++EGGG I+G G+KWW  SC+ +  L    K APTAM F  C N  
Sbjct  148  DRAHWLMFNNLTDFRMEGGGFINGNGRKWWANSCKINKTLP--CKAAPTAMTFYECKNLR  205

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            ++++   ++ Q H L   C      N+ V +P  SPNTDGIH+  + ++ I    I  GD
Sbjct  206  VADLIIQNAQQMHLLFQKCVNVIALNLLVSAPEKSPNTDGIHVTGTQNILIKNCVIRTGD  265

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N++  ++ CGPGHGISIGSLG   +   V ++ V     +GTTNG RIKT
Sbjct  266  DCISIVSGSKNVQATDIVCGPGHGISIGSLGAGKSTDYVSNVLVNRARLSGTTNGVRIKT  325

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY +N+TF+N+ +  V NPIII+QNYCD    C E AS V++SNVVY+ I GT++
Sbjct  326  WQGGSGYAKNITFQNISMRNVTNPIIINQNYCDQNEPCPEQASAVQVSNVVYKNIKGTSA  385

Query  264  RETAINLNCSRSVPCTGIRMESIDITA  184
             E AIN +CS+S PC GI +++I + +
Sbjct  386  SEVAINFDCSKSYPCKGILLQNIGLVS  412



>gb|KGN52885.1| hypothetical protein Csa_4G004940 [Cucumis sativus]
Length=414

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 166/265 (63%), Gaps = 10/265 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            DA  WL F  V+ L ++G G IDGQG  WWD+      D  G     PTA+    C+   
Sbjct  128  DAKNWLLFSNVSRLVIQGNGEIDGQGAAWWDR------DSDG----KPTALAIYDCDGLH  177

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +   +SPQ+H  I  CN  ++S +++ +P +SPNTDGI +  S H+ I   NI  GD
Sbjct  178  LSGLTHSNSPQSHMHIVRCNHASISKLNIVAPENSPNTDGIDVAHSSHVKIHNCNIGTGD  237

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I + TSNI I N+QCGPGHGISIGSLGK G    VED+ V NC   GT  GARIKT
Sbjct  238  DCIAISEGTSNIHIANIQCGPGHGISIGSLGKDGTSSSVEDVRVQNCHLKGTMYGARIKT  297

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY R ++F+ + L  V  PI+IDQ YC+ +  CK   S VE+S+V+Y+ + GT++
Sbjct  298  WQGGAGYARKISFQGITLDQVHKPILIDQYYCNGKTDCKNQTSAVEVSDVLYQGLHGTSA  357

Query  264  RETAINLNCSRSVPCTGIRMESIDI  190
             E A+ L+CS +V C  I +E IDI
Sbjct  358  TEVAVELSCSETVGCRNIVLEDIDI  382



>ref|XP_006407776.1| hypothetical protein EUTSA_v10020758mg [Eutrema salsugineum]
 gb|ESQ49229.1| hypothetical protein EUTSA_v10020758mg [Eutrema salsugineum]
Length=437

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 167/268 (62%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +   W+ F+ VN L+VEGGG IDG G  WW +SC+ +P L  C   APTA+ F+ C N  
Sbjct  146  ERRHWIVFETVNNLRVEGGGRIDGNGNIWWPKSCKINPQLP-CLG-APTAVTFVECKNLM  203

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +SNI   ++ Q H     C       + V SPGDSPNTDG+H+  + ++ I  S I  GD
Sbjct  204  VSNIRLENAQQMHMTFQDCENVKALRLMVTSPGDSPNTDGLHVTGTRNILIQDSIIRTGD  263

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+    + CGPGHGISIGSLG+  +   V ++ V   T  GTTNG RIKT
Sbjct  264  DCISIVSGSENVRATGITCGPGHGISIGSLGEDNSEAYVSNVVVNKATLIGTTNGVRIKT  323

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G  +N+ F+++ +  V NPIII+Q+YCD   +C E  S V++SNV+Y+ I GT+S
Sbjct  324  WQGGHGMAKNIIFQDIIMKNVTNPIIINQDYCDRVESCPEQKSAVQVSNVLYKNIQGTSS  383

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
            R  A+   CS+S+PC GI M+++ +  Q
Sbjct  384  RPVAVKFECSKSIPCRGISMQNVRLVDQ  411



>ref|XP_011025443.1| PREDICTED: polygalacturonase QRT2-like [Populus euphratica]
Length=460

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 168/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F+ V   +V GGG IDG GK WW+ SC+ +   + C K APTA+ FL C   
Sbjct  169  EDRRHWLVFENVQKFRVRGGGTIDGNGKIWWENSCKINKS-QPC-KHAPTAVTFLECKGL  226

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F ++ Q H     C      N+ V +P  SPNTDGIH+  + ++ I    I  G
Sbjct  227  IVANLRFQNAQQMHLSFQNCVNVRALNLMVIAPETSPNTDGIHVTGTQNIRIRKCVIRTG  286

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+E  ++ CGPGHGISIGSLG   +  +V ++ V   T +GTTNG RIK
Sbjct  287  DDCISIVSGSKNVEATDITCGPGHGISIGSLGADNSGAEVSNVFVNRATISGTTNGVRIK  346

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ F+N+ +  V NPIII+QNYCD    C+E  S V+ISNV+Y+ I GT+
Sbjct  347  TWQGGSGYARNIIFQNVVMRNVTNPIIINQNYCDQDSPCEEQTSAVQISNVMYKNIKGTS  406

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            + + A+  +CS+S+PC GI ++ ++I  +
Sbjct  407  ASDVAVKFDCSKSIPCRGILLQDVNIALE  435



>ref|XP_002878158.1| endo-polygalacturonase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54417.1| endo-polygalacturonase 1 [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 174/268 (65%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D + WL  + VN L ++GG  GII+G GK WW  SC+     K CTK APTA+   +  
Sbjct  144  KDKNHWLILEDVNNLSIDGGSTGIINGNGKIWWQNSCKIDKS-KPCTK-APTALTLYNLK  201

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N ++ N+   ++ Q    I  CN   VSNV + +PGDSPNTDGIHI  + ++ ++ S+I 
Sbjct  202  NLNVKNLRVRNAQQIQISIEKCNKVEVSNVVITAPGDSPNTDGIHITNTQNIRVSNSDIG  261

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D T N++I ++ CGPGHGISIGSLG   +   V  I+V    F+ + NG R
Sbjct  262  TGDDCISIEDGTQNLQIFDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKFSESDNGVR  321

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+++  V NPIIIDQNYCD +  C+E  S V++ NVVY+ ISG
Sbjct  322  IKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQNYCD-KDKCEEQGSAVQVKNVVYKNISG  380

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI LNCS   PC GI +E+++I
Sbjct  381  TSATDVAITLNCSEKYPCQGIVLENVNI  408



>ref|XP_002882564.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58823.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=439

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 174/283 (61%), Gaps = 2/283 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +   W+ F+ V+ L+VEGGG IDG G  WW  SC+ +P L  C   APTA+ F+ CNN  
Sbjct  148  ERRHWIVFENVDNLRVEGGGRIDGNGHIWWPNSCKINPQLP-CLG-APTAVTFVECNNLR  205

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +SNI   ++ Q H     C      N+ V SP DSPNTDGIH+  + ++ I  S +  GD
Sbjct  206  VSNIRLENAQQMHLTFQDCKNVKALNLMVTSPADSPNTDGIHVTGTQNILIQDSIVRTGD  265

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+    + CGPGHGISIGSLG+  +   V ++ V   T  GTTNG RIKT
Sbjct  266  DCISIVSGSENVRATGITCGPGHGISIGSLGEDNSEAYVSNVVVNKATLIGTTNGVRIKT  325

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G  +N+ F+++ +  V NPIII+Q+YCD   +C E  S V++SNV+Y+ I GT+S
Sbjct  326  WQGGHGMAKNIIFQDIIMKNVTNPIIINQDYCDRVESCPEQKSAVQVSNVLYKNIQGTSS  385

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKV  136
            R  A+   CS+S+PC GI M+++ +  Q +  +  A  ++ K+
Sbjct  386  RPIAVKFVCSKSIPCRGISMQNVKLVDQTQQDVSTASCSNVKL  428



>ref|XP_004149736.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=435

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 165/272 (61%), Gaps = 2/272 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+   VEG GII+G G+KWW  SC+ +  L    K APTA+ F  C N  +SN+
Sbjct  149  WLKFHEVDNFVVEGNGIINGNGRKWWQNSCKVNKGLP--CKRAPTAVTFYQCINLVVSNL  206

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F  + Q H     C      N+ V +PG+SPNTDGIHI  + +  I    I  GDDCIS
Sbjct  207  MFKDAQQMHLTFQKCTNVKALNLRVVAPGNSPNTDGIHITETQNAIIRNCVIGTGDDCIS  266

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N++  ++ CGPGHGISIGSLG   +  +V +I V     +GT+NG RIKTWQ G
Sbjct  267  IVSGSRNVQAMDITCGPGHGISIGSLGADNSEAEVSNIRVNRALISGTSNGVRIKTWQGG  326

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GY +N+ F+N+ +  V NPIIIDQNYCD + +C E  S V++SNVVY+ I GT++   A
Sbjct  327  SGYAKNIMFQNVVMRNVSNPIIIDQNYCDKKESCPEQKSAVKVSNVVYKNIRGTSASGDA  386

Query  252  INLNCSRSVPCTGIRMESIDITAQGRWPLIVA  157
            I  +CS+S PC GI +  I I  QG    + A
Sbjct  387  IKFDCSKSFPCQGISLLGIRIVGQGNEEAVTA  418



>ref|XP_009396710.1| PREDICTED: polygalacturonase ADPG1-like [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 174/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D + W+ F+ V+GL + G G IDGQG+ WW+  C+   +   C   AP A+     +N +
Sbjct  127  DGNYWINFEHVDGLSINGSGKIDGQGEIWWN--CKRSAN---CVT-APNALSISGGSNFT  180

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS + F +S Q H  I+G  G  V  +++ +PGDSPNTDGI+I +  H++++ S I  GD
Sbjct  181  LSGLDFTNSQQKHIGIYGIVGVQVHGINITAPGDSPNTDGIYIRSCQHVTVSNSTIGTGD  240

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIG+ TS++ I  + CGPGHGISIGSLG+      VE +HV +C F  T NG RIKT
Sbjct  241  DCISIGNGTSDVNITQITCGPGHGISIGSLGEEETQAAVEQVHVSSCNFWETQNGVRIKT  300

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY RN+TFEN+    V +PIIIDQ YC+    C  + S V++S+V Y R +GT+S
Sbjct  301  WQGGSGYARNITFENINFTAVYHPIIIDQYYCNGDYDCPNMTSAVQVSDVHYIRATGTSS  360

Query  264  RETAINLNCSRSVPCTGIRMESIDI  190
             + AI+LNCS+++ CTGI ++ +DI
Sbjct  361  SDMAISLNCSQTIACTGITIDGVDI  385



>ref|XP_010695185.1| PREDICTED: polygalacturonase QRT2 [Beta vulgaris subsp. vulgaris]
Length=473

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 173/271 (64%), Gaps = 3/271 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            +  QWL F+ +   KVEGGG IDG+G  WW  SC+ +   K C + APTA+ F+ C N  
Sbjct  179  NRQQWLVFENLRNFKVEGGGTIDGRGHIWWQNSCKVN-KTKPC-QHAPTAVTFIGCKNFI  236

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +  +   ++ Q H     C     SN+ + +PG+SPNTDGIH+  + ++ IT S I  GD
Sbjct  237  VDGLKITNAQQMHLTFQKCAAVRASNIFIRAPGNSPNTDGIHVTETRNIQITRSLIRTGD  296

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DC+SI   + +++++ + CGPGHGISIGSLGK  +   V ++ V     +GT NG RIKT
Sbjct  297  DCVSIVSGSKDVQVSEITCGPGHGISIGSLGKGHSKAHVSNVLVNKARLSGTQNGVRIKT  356

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+GY +NV F+N+ +  V NPIIIDQ+YCD +  C E+ S V + +VVY+ I GT+ 
Sbjct  357  WQGGQGYAKNVVFQNIVMHNVSNPIIIDQHYCDQKTPCPEMKSAVHVQDVVYKNIKGTSF  416

Query  264  RETAINLNCSRSVPCTGIRMESID-ITAQGR  175
             E AI L+CS++  C GI +++ID +T +G+
Sbjct  417  TEAAIKLDCSKNHKCRGIVLQNIDLVTIKGK  447



>ref|XP_010523935.1| PREDICTED: polygalacturonase ADPG2-like [Tarenaya hassleriana]
Length=451

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 168/268 (63%), Gaps = 4/268 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D S WL F  VN L V+GG  G +DG GK WW  SC+ +P  K CTK APTA+ F +  
Sbjct  161  KDKSHWLTFDSVNNLSVDGGATGTVDGNGKIWWQNSCKVNPS-KPCTK-APTALTFYNSK  218

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  ++N+   ++ Q       C+    SNV++ +PGDSPNTDGIHI  + ++ +  S I 
Sbjct  219  NVKVTNLRVRNAQQIQVSFEKCSNVLASNVAITAPGDSPNTDGIHITNTQNIQVINSVIG  278

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI   + N++I  + CGPGHGISIGSLG   +   V  + V     +GT NG R
Sbjct  279  TGDDCISIESGSQNVQIKGITCGPGHGISIGSLGDDNSRAYVSGVTVDGAKLSGTENGVR  338

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G   N+ F N+Q+  V NPIIIDQNYCD    CK+  S V++SNVVY+ I G
Sbjct  339  IKTYQGGSGTASNIKFLNIQMDNVKNPIIIDQNYCDKNKPCKQQKSAVQVSNVVYQNIKG  398

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  +CSR+ PC G+ +++++I
Sbjct  399  TSASDMAIRFDCSRNYPCKGLVLQNVNI  426



>ref|XP_010663872.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=399

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 172/266 (65%), Gaps = 8/266 (3%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+ FK V+GL + G GIIDG GK WW  S   + DL+      P+A++  S N   L+ 
Sbjct  112  KWIHFKRVDGLFINGSGIIDGNGKNWW-SSGYINADLR------PSALEVTSSNKVQLTG  164

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            + F ++P  H +   C+  ++SNVS+++PGDSPNTDGIH+  S H++I + +I  GDDCI
Sbjct  165  LSFRNNPHMHVVFDSCDMVHISNVSIDAPGDSPNTDGIHLKESTHVNIEFCSIRTGDDCI  224

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D  SNI I N++CGPGHGISIGS+G+ G +  VE+I+V +  F G+ +G RIKTWQ 
Sbjct  225  SIVDKCSNITIQNIECGPGHGISIGSMGQYGAYETVENIYVSDVQFKGSLSGVRIKTWQG  284

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G+G+ R + F+ +       PI IDQ YC     C E A  VEIS++ Y  I GT+ R+T
Sbjct  285  GKGHARKMVFKGITSLNTQYPIQIDQFYCP-HAKCDEQADAVEISDISYIDIKGTSMRKT  343

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            A+ L CS SVPC  I M+ I+++ QG
Sbjct  344  AVKLACSESVPCKNIFMQDINLSYQG  369



>ref|NP_001234256.1| polygalacturonase [Solanum lycopersicum]
 gb|AAF61444.1|AF138858_1 polygalacturonase [Solanum lycopersicum]
Length=452

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 167/264 (63%), Gaps = 2/264 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+ F  V  L VEGGGIIDG G++WW +SC+ +     C   APTA+ F  CNN  + N
Sbjct  145  KWIYFFKVKHLTVEGGGIIDGMGQEWWARSCKVN-RTNPCHH-APTALTFHKCNNLKVKN  202

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I   +S Q H    GC    +S + V++PGDSPNTD IHI +S  +++    I  GDDCI
Sbjct  203  IKIFNSQQMHLAFTGCKHVTISQLVVKAPGDSPNTDAIHISSSTQVNVKDCIIGTGDDCI  262

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI   +S I++ ++ CGPGHGISIGSLGKS +F QV ++HV   + + T NG RIKTWQ 
Sbjct  263  SIVGNSSRIKVKDIVCGPGHGISIGSLGKSNSFSQVYNVHVNGASISNTENGVRIKTWQG  322

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G G+V+ V+FEN+ +  V NPIIIDQ YCD R  C    S + I N+ +  I GT++ E 
Sbjct  323  GSGFVKKVSFENVWMENVSNPIIIDQYYCDSRKPCSNKTSNIHIDNISFMGIKGTSATER  382

Query  255  AINLNCSRSVPCTGIRMESIDITA  184
            AI L CS S PC  + +E I +T+
Sbjct  383  AITLACSDSFPCRRLYLEDIQLTS  406



>ref|XP_010257197.1| PREDICTED: polygalacturonase [Nelumbo nucifera]
 ref|XP_010257198.1| PREDICTED: polygalacturonase [Nelumbo nucifera]
Length=457

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 164/270 (61%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   WL F+ +  L VEGGG I+G GK WW  SC+ +  L  C K APTA+ F +CNN 
Sbjct  167  NDRRHWLIFENIKNLLVEGGGTINGNGKTWWQSSCKINKTLP-CKK-APTAVTFYNCNNL  224

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             L N+    + Q H     C+    SN+ + +P  SPNTDGIHI  + ++ I  S I  G
Sbjct  225  GLKNMRIKDAQQIHVSFEKCSNVQASNLMITAPEKSPNTDGIHITNTQNIQIKSSVIGTG  284

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI   +  +E  ++ CGPGHGISIGSLG   +   V D+ V     +GTTNG RIK
Sbjct  285  DDCMSIESGSRTVEATDITCGPGHGISIGSLGDDNSEAHVSDVVVNRAKLSGTTNGVRIK  344

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+ +  V NPIIIDQNYCD    CKE  S V++ +VVY+ I GT+
Sbjct  345  TWQGGSGSASNIKFQNVAMNNVFNPIIIDQNYCDRAEPCKEQKSAVQVRDVVYKNIKGTS  404

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            +   AIN NCS++ PC+ I ++ I +  +G
Sbjct  405  ASSIAINFNCSKTYPCSAILLQDISLVREG  434



>gb|KGN58587.1| hypothetical protein Csa_3G690840 [Cucumis sativus]
Length=448

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 165/272 (61%), Gaps = 2/272 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+   VEG GII+G G+KWW  SC+ +  L    K APTA+ F  C N  +SN+
Sbjct  162  WLKFHEVDNFVVEGNGIINGNGRKWWQNSCKVNKGLP--CKRAPTAVTFYQCINLVVSNL  219

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F  + Q H     C      N+ V +PG+SPNTDGIHI  + +  I    I  GDDCIS
Sbjct  220  MFKDAQQMHLTFQKCTNVKALNLRVVAPGNSPNTDGIHITETQNAIIRNCVIGTGDDCIS  279

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N++  ++ CGPGHGISIGSLG   +  +V +I V     +GT+NG RIKTWQ G
Sbjct  280  IVSGSRNVQAMDITCGPGHGISIGSLGADNSEAEVSNIRVNRALISGTSNGVRIKTWQGG  339

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GY +N+ F+N+ +  V NPIIIDQNYCD + +C E  S V++SNVVY+ I GT++   A
Sbjct  340  SGYAKNIMFQNVVMRNVSNPIIIDQNYCDKKESCPEQKSAVKVSNVVYKNIRGTSASGDA  399

Query  252  INLNCSRSVPCTGIRMESIDITAQGRWPLIVA  157
            I  +CS+S PC GI +  I I  QG    + A
Sbjct  400  IKFDCSKSFPCQGISLLGIRIVGQGNEEAVTA  431



>ref|XP_009379633.1| PREDICTED: polygalacturonase [Pyrus x bretschneideri]
Length=469

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 165/271 (61%), Gaps = 2/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F  V+ L VEGGG I+G GK WW  SC+     K C K APTA+ F  C N 
Sbjct  166  KDGRHWLIFDSVSNLVVEGGGAINGNGKNWWQNSCKTDKS-KPC-KDAPTALTFYKCKNL  223

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+    + Q H     C    VSN+S+ +P  SPNTDGIH+  + ++ IT    + G
Sbjct  224  MVRNLKIQDAQQIHVSFQKCMNVEVSNLSITAPEKSPNTDGIHVTDTQNILITSCVTATG  283

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI + +  ++ +N+ CGPGHGISIGSLG   +   V DI V      GTTNG RIK
Sbjct  284  DDCLSIVNGSKLVQASNITCGPGHGISIGSLGSGNSTAYVSDITVNGAKLYGTTNGVRIK  343

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+++  V NPI+IDQ YCD +  CKE  S VE+ NVVY+ I GT+
Sbjct  344  TWQGGSGSASNIRFQNIEMHNVTNPILIDQYYCDRKKPCKEQRSAVEVKNVVYKNIKGTS  403

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + + AI  +CS+S PC GI ++ I++  +GR
Sbjct  404  ASDIAIKFDCSKSFPCLGIILQDINLQHEGR  434



>ref|XP_009135015.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Brassica rapa]
Length=430

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 166/264 (63%), Gaps = 9/264 (3%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V+ L+VEGGG +DG GK WW +SC+ +P+L         A+ F+ CNN  + NI
Sbjct  149  WIVFQTVDNLRVEGGGRVDGNGKIWWPKSCKINPEL---------AVTFVECNNLMVRNI  199

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +  C      N+ V+SPGDSPNTDGIH+  + ++ I  S I  GDDCIS
Sbjct  200  RLENAQQMHMRVQKCENVKALNLMVKSPGDSPNTDGIHVTGTRNILIQDSIIRTGDDCIS  259

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N+    + CGPGHGISIGSLG   +   V ++ V   T  GTTNG RIKTWQ G
Sbjct  260  IVSGSENVRATGITCGPGHGISIGSLGAHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGG  319

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G  +N+ F+++ +  V NPIII+QNYCD   AC E  S V++SNV+Y+ I GT+S   A
Sbjct  320  HGMAKNIIFKDILMKNVTNPIIINQNYCDQTKACPEQKSAVQVSNVLYKNIHGTSSSPEA  379

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I   CS+S+PC GI ++++++  Q
Sbjct  380  IKFVCSKSIPCQGISLQNVELVDQ  403



>ref|XP_004986166.1| PREDICTED: polygalacturonase-like, partial [Setaria italica]
Length=479

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 167/270 (62%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V+ L V GGG +DG G+ WW  SC+ +  +    K APTA+ F  C   
Sbjct  183  RDRRHWIVFSAVDKLTVNGGGAVDGNGETWWKHSCKINKAMP--CKEAPTALSFHYCTGL  240

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + ++  ++S Q H  I  C    ++ +S+ + G SPNTDGIHI  S  + +T   I  G
Sbjct  241  RVQDLKIVNSQQIHMSIEDCTNVQLAGLSITASGTSPNTDGIHITRSKDVQVTNCKIKTG  300

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI + T N+ ++ V CGPGHGISIGSLG   +  +V  I +      GTTNGARIK
Sbjct  301  DDCMSIENGTHNLYVSKVVCGPGHGISIGSLGDDNSRAEVSGITIDTVQLYGTTNGARIK  360

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            T+Q G GY +++TF+N+ +  V NPIIIDQNYCD    CK   S VE+SNVV++ I GT 
Sbjct  361  TYQGGSGYAKDITFQNMIMDNVKNPIIIDQNYCDKAKPCKAQGSAVEVSNVVFKNIRGTT  420

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
              + AI LNCS++VPC GI +++ID+  +G
Sbjct  421  VTKDAIKLNCSKNVPCHGITLQNIDLKMEG  450



>ref|XP_004506353.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=440

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 168/270 (62%), Gaps = 0/270 (0%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V    V+GGGI +G+GKKWW  SC++  +L    +  PTA+ F +C N 
Sbjct  146  EDRLHWIVFDSVTNFNVDGGGIFNGKGKKWWKNSCKFTNNLPCNDEPRPTAVTFYNCKNL  205

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + NI+F  + + H   F C    VSN+ V +P +SPNTDGIH+  S ++ I  SNI  G
Sbjct  206  RVKNINFKDAQKMHVAFFRCFNVFVSNLVVTAPENSPNTDGIHVAESQNIDIRKSNIGTG  265

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+++ ++ CGPGHGISIGSLG + +  +V ++ V   T  GTTNG RIK
Sbjct  266  DDCISIISGSKNVQVIDITCGPGHGISIGSLGANNSEAEVVNVVVNRATLTGTTNGVRIK  325

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ F N+ +  V NPIIIDQ YCD    C+E    V++S+V+Y+ I GT+
Sbjct  326  TWQGGSGYARNIKFMNIVMQNVTNPIIIDQYYCDQTEPCQEQDKAVQLSHVLYQNIRGTS  385

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            +   AI   CSR+VPC  I +  + + +QG
Sbjct  386  ASTVAIKFACSRTVPCREIYLHDVILESQG  415



>ref|NP_178131.1| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AEE36362.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=336

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 165/263 (63%), Gaps = 11/263 (4%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+GL + G G++DGQGK WWD  CR HP            M F +C N +L ++
Sbjct  55   WLIFDQVDGLAIVGRGLLDGQGKSWWDIHCRDHPG---------PMMTFSNCGNVTLKSL  105

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F +S QTH L+ G     + ++ + SP  SPNTDGIHI +S  +SI +S+I+ GDDC+S
Sbjct  106  RFRNSAQTHVLVMGSQNVYIDDIKITSPEASPNTDGIHITSSTAVSINHSDIATGDDCVS  165

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +N+ +  + CGPGHG+SIGSLG+ G  V VE+I V +  F GTTNGARIKTW  G
Sbjct  166  IGDQVNNLNVTFMNCGPGHGVSIGSLGRGGTEVTVENIRVSHVNFTGTTNGARIKTWPGG  225

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPIIIDQ Y      C E   GV I  V Y ++SGT++ + A
Sbjct  226  TGYVRGIEFFDIRFSSVQNPIIIDQFY-GCAPTCVETMKGVHIEKVRYMKMSGTSATKVA  284

Query  252  INLNCS-RSVPCTGIRMESIDIT  187
            + L CS  SVPC+ + M  ID++
Sbjct  285  MKLECSGESVPCSNLFMRDIDLS  307



>ref|XP_003599234.1| Polygalacturonase [Medicago truncatula]
 gb|AES69485.1| polygalacturonase [Medicago truncatula]
Length=437

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 171/270 (63%), Gaps = 2/270 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G D   W+ F+ V  L V+GGG I+G G+ WW+ SC+ +  L    K APTA+ F  CNN
Sbjct  144  GADRKLWIKFENVTNLIVDGGGTINGNGRIWWENSCKVNESLP--CKGAPTAVTFDECNN  201

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              +  I F ++ Q H  I GCN    SN+ V +PG SPNTDGIHI  S ++ IT S I  
Sbjct  202  LKVDKIRFRNAQQMHLRIQGCNNVWASNLIVTAPGHSPNTDGIHITHSQNVFITNSTIGT  261

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   + N+   ++ CGPGHGISIGSLG      +V ++ V   T  GTTNG RI
Sbjct  262  GDDCISIVSGSKNVRATDITCGPGHGISIGSLGGGNTQAEVSNVEVNRATLIGTTNGVRI  321

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY RN+ F N+ +  V NPIIIDQ YCD +  C+E  S VE+SNV+Y+ I GT
Sbjct  322  KTWQGGSGYARNIKFINIVVRNVTNPIIIDQKYCDQKKKCQEQNSAVELSNVMYQNIKGT  381

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQ  181
            ++ E AI L CS++VPC GI ++ + IT +
Sbjct  382  SASEVAIKLECSKAVPCKGIHLQDVKITGE  411



>ref|XP_003607885.1| hypothetical protein MTR_4g084050 [Medicago truncatula]
 gb|ABC75354.1| Glycoside hydrolase, family 28 [Medicago truncatula]
 gb|AES90082.1| polygalacturonase [Medicago truncatula]
Length=394

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 175/272 (64%), Gaps = 17/272 (6%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F  +NGL + GGG +DGQG  WW+ +            + PTA+K L C+N 
Sbjct  105  NDGDYWIKFSNINGLIINGGGTVDGQGDSWWNNNGH----------IRPTALKILECDNL  154

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             L  +  I+SP+ H  I GCN   +SN+ + +P DSPNTDGI I  S ++S+ +S IS G
Sbjct  155  KLGPLKHINSPRNHISIVGCNDALISNLHIIAPKDSPNTDGIDISTSTNISVQHSIISTG  214

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCI+I + T  I I ++QCGPGHGIS+GSLGK G++  VE+IHV N TF  TTNGARIK
Sbjct  215  DDCIAINNGTEFIYITDIQCGPGHGISVGSLGKDGDYSTVEEIHVSNITFRETTNGARIK  274

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVR------GACKELASGVEISNVVYE  286
            TW  G GY R +T+E++ +F V+NP+IIDQ Y  +          + ++  V++S+V++ 
Sbjct  275  TWTGGSGYARKITYEDIIVFKVENPVIIDQQYDALEPLKTKYNVLEGVSKAVKVSDVIFR  334

Query  285  RISGTASRETAINLNCSRSVPCTGIRMESIDI  190
             I GT + + AI+LNC+R + CT I +E IDI
Sbjct  335  NIRGTTNGKDAIDLNCAR-IGCTNIILEDIDI  365



>gb|AAD55472.1|AC009322_12 Similar to polygalacturonases [Arabidopsis thaliana]
Length=381

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 170/270 (63%), Gaps = 10/270 (4%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPT-----AMKFLSCNNS  808
            WL F  V+GL + G G++DGQGK WWD  CR HP    C  LAPT      M F +C N 
Sbjct  85   WLIFDQVDGLAIVGRGLLDGQGKSWWDIHCRDHPG-PNCICLAPTIYFSQMMTFSNCGNV  143

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
            +L ++ F +S QTH L+ G     + ++ + SP  SPNTDGIHI +S  +SI +S+I+ G
Sbjct  144  TLKSLRFRNSAQTHVLVMGSQNVYIDDIKITSPEASPNTDGIHITSSTAVSINHSDIATG  203

Query  627  DDCISIGDYTSNIEINNVQCGPGHGI--SIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
            DDC+SIGD  +N+ +  + CGPGHG+  SIGSLG+ G  V VE+I V +  F GTTNGAR
Sbjct  204  DDCVSIGDQVNNLNVTFMNCGPGHGVRDSIGSLGRGGTEVTVENIRVSHVNFTGTTNGAR  263

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKTW  G GYVR + F +++   V NPIIIDQ Y      C E   GV I  V Y ++SG
Sbjct  264  IKTWPGGTGYVRGIEFFDIRFSSVQNPIIIDQFY-GCAPTCVETMKGVHIEKVRYMKMSG  322

Query  273  TASRETAINLNCS-RSVPCTGIRMESIDIT  187
            T++ + A+ L CS  SVPC+ + M  ID++
Sbjct  323  TSATKVAMKLECSGESVPCSNLFMRDIDLS  352



>gb|KHN46507.1| Polygalacturonase [Glycine soja]
Length=440

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 170/270 (63%), Gaps = 0/270 (0%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V+  +V GGG  +G+GK+WW  SC+ + +L       P A+ F  CNN 
Sbjct  146  EDRQHWIVFDSVSNFRVGGGGTFNGKGKRWWQSSCKVNTNLPCNDGPRPKAVTFYQCNNL  205

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F  +PQ H +  GC    VSN+ + +PGDSPNTDGIH+  + ++ I+ S+I  G
Sbjct  206  KVTNLRFKDAPQMHVVFEGCFNVIVSNLVIRAPGDSPNTDGIHVADTQNIVISNSDIGTG  265

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +  +V ++ V   T  GTTNG RIK
Sbjct  266  DDCISIISGSQNVRATDITCGPGHGISIGSLGADNSEAEVSNVVVNRATLTGTTNGVRIK  325

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ F N+ +  V NPIIIDQ YCD    C+E  S V++SNV+Y+ I GT+
Sbjct  326  TWQGGSGYARNIKFLNIAMQNVTNPIIIDQYYCDQSKPCQEQDSAVQLSNVLYQNIRGTS  385

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + E AI  +CSR+VPC  I ++ + +  QG
Sbjct  386  ASEVAIKFDCSRAVPCRQIYVQDVILEPQG  415



>ref|NP_191310.1| polygalacturonase ADPG1 [Arabidopsis thaliana]
 sp|O23147.1|ADPG1_ARATH RecName: Full=Polygalacturonase ADPG1; Short=AtADPG1; Short=PG 
ADPG1; AltName: Full=Pectinase ADPG1; AltName: Full=Protein 
ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA05525.1| endo-polygalacturonase [Arabidopsis thaliana]
 gb|AAC98923.1| endo-polygalacturonase [Arabidopsis thaliana]
 emb|CAB66108.1| endo-polygalacturonase [Arabidopsis thaliana]
 dbj|BAC42580.1| putative endo-polygalacturonase [Arabidopsis thaliana]
 gb|AAO63440.1| At3g57510 [Arabidopsis thaliana]
 gb|AEE79664.1| polygalacturonase ADPG1 [Arabidopsis thaliana]
Length=431

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 173/268 (65%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D + WL  + VN L ++GG  GII+G GK WW  SC+     K CTK APTA+   +  
Sbjct  144  KDKNHWLILEDVNNLSIDGGSTGIINGNGKTWWQNSCKIDKS-KPCTK-APTALTLYNLK  201

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N ++ N+   ++ Q    I  CN   VSNV + +PGDSPNTDGIHI  + ++ ++ S+I 
Sbjct  202  NLNVKNLRVKNAQQIQISIEKCNKVEVSNVEITAPGDSPNTDGIHITNTQNIRVSNSDIG  261

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D T N++I ++ CGPGHGISIGSLG   +   V  I+V    F+ + NG R
Sbjct  262  TGDDCISIEDGTQNLQIFDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKFSESDNGVR  321

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+++  V NPIIIDQ+YCD +  C++  S V++ NVVY+ ISG
Sbjct  322  IKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQDYCD-KDKCEDQESAVQVKNVVYKNISG  380

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI LNCS   PC GI +E++ I
Sbjct  381  TSATDVAITLNCSEKYPCQGIVLENVKI  408



>gb|EMT24418.1| Polygalacturonase [Aegilops tauschii]
Length=353

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 169/272 (62%), Gaps = 8/272 (3%)
 Frame = -2

Query  978  SQWL------AFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            S WL      + + V GL V  GG IDG GK WW  SC+ +  L    + APTA+ F SC
Sbjct  54   SSWLTDYYNTSCRSVRGLTVTDGGTIDGNGKIWWQNSCKVNTKLP--CRQAPTALTFYSC  111

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
             N  ++N+  ++S Q H  +  C+   +S +S+ +PG SPNTDGIHI  S  + +    I
Sbjct  112  TNLKVNNLEVLNSQQIHISMERCSNVRMSRLSIRAPGTSPNTDGIHITHSKDVKVMDCAI  171

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
              GDDC+SI D T N+ + N+ CGPGHGISIGSLG   +  QV +I +     + TTNGA
Sbjct  172  KTGDDCMSIEDGTENLHVKNIVCGPGHGISIGSLGDRNSQAQVANITIDGVRLHDTTNGA  231

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIK WQ GRGY +N+ F+N+ +  V +PIIIDQNYCD    C +  + VE+SNV+++ I 
Sbjct  232  RIKIWQGGRGYAKNIVFKNMIMDNVRDPIIIDQNYCDSATPCTKQEAAVEVSNVLFKNIR  291

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDITAQ  181
            GT +   AI L+CS++VPC GI + ++ +T +
Sbjct  292  GTRASREAIKLSCSKAVPCHGIALHNVRLTLK  323



>ref|XP_010653828.1| PREDICTED: polygalacturonase isoform X2 [Vitis vinifera]
Length=435

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 163/270 (60%), Gaps = 9/270 (3%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D ++WL F+ V  L V+GGG I+G GK WW+ SC+ + DL         A+ F +C N 
Sbjct  151  NDMTRWLVFENVQNLAVQGGGTINGNGKTWWENSCKVNDDL---------ALTFYNCKNL  201

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H     C G   S ++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  202  VVKNLKIQNAQQMHVSFEKCVGVQASGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTG  261

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   T N++   + CGPGHGISIGSLG   +   V DI V   T +GTTNG RIK
Sbjct  262  DDCISIVSGTQNLQATGITCGPGHGISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIK  321

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TW  G G   N+ F+N+++  V NPIIIDQ YCD    CK  +  V++ NV+Y+ I GT+
Sbjct  322  TWPGGSGSASNIKFQNIEMHNVKNPIIIDQKYCDGDKPCKSQSRAVQVQNVLYQNIKGTS  381

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            S   AI L+CS   PC GI ++ IDI   G
Sbjct  382  SSSEAIQLDCSDKFPCQGIVLQDIDIEIGG  411



>ref|XP_009354806.1| PREDICTED: polygalacturonase [Pyrus x bretschneideri]
Length=423

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 165/265 (62%), Gaps = 2/265 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F  +   +VEGGG I+G G+KWW  SC+ +  L  CT LAP A+ F  CN   
Sbjct  130  DLRHWILFTNLTNFRVEGGGTINGNGRKWWLNSCKVNESLP-CT-LAPNAVTFFGCNTLE  187

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+ F ++ + H     C     SN+ V +PGDSPNTDGIH+ A+ ++ I+   I  GD
Sbjct  188  VDNVRFRNAQRMHLSFQSCVNVKASNLIVTAPGDSPNTDGIHVTATQNIRISNCLIRTGD  247

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+  +++ CGPGHGISIGSLG   +  +V D+ V      GTTNG RIKT
Sbjct  248  DCISIVSGSKNVRADDITCGPGHGISIGSLGAGNSQAEVSDVVVSEAKIIGTTNGLRIKT  307

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY  N+ F+N+ +  V NPIIIDQ YCD    C+E AS V+ISNVVYE + GT++
Sbjct  308  WQGGSGYATNIRFKNVMMANVSNPIIIDQYYCDQDSPCQEQASAVKISNVVYENVKGTSA  367

Query  264  RETAINLNCSRSVPCTGIRMESIDI  190
             + A+  +CS+S  C  I ++ +++
Sbjct  368  SKVAVKFDCSKSFGCQDILLKDVNL  392



>gb|KHG04134.1| hypothetical protein F383_30138 [Gossypium arboreum]
 gb|KHG04901.1| hypothetical protein F383_28766 [Gossypium arboreum]
Length=417

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 168/284 (59%), Gaps = 11/284 (4%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+ F+  +GL ++G G I+GQG KWW  SC+   + K C    PT        N  +  
Sbjct  122  HWIGFENFDGLHIQGSGTINGQGDKWWKLSCK--DNEKSCQHRKPTGFMIGHSKNVDIKG  179

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            + F  SPQ H         + + +++ +PG SPNTDGIHI  S ++SI  S I  GDDCI
Sbjct  180  LTFEDSPQMHIAFESSTLIHATELTIRAPGHSPNTDGIHIQRSTNVSIDNSTIQTGDDCI  239

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SIG+ +  I I+N++CGPGHGISIGSLG  G    VE +HV N TF+GTTNG RIKTWQ 
Sbjct  240  SIGNESKYINISNIKCGPGHGISIGSLGIMGKTEDVEFVHVRNVTFHGTTNGVRIKTWQG  299

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G G+ RN+ FE++       PIIIDQ YC  +  CK   S VEISN+ YE I+GT+ ++ 
Sbjct  300  GHGHARNIKFEDITSHSSTRPIIIDQYYCPHK-QCKNQTSAVEISNIAYENINGTSHKKI  358

Query  255  AINLNCSRSVPCTGIRMESIDITAQGRWPLIVAMLADRKVLWCL  124
            A+ L+CS S+PC  I M+ I+        LI     D+   +CL
Sbjct  359  AVQLSCSESIPCKNITMKDIN--------LIYEKHKDKTSSYCL  394



>emb|CDY14791.1| BnaC04g47880D [Brassica napus]
Length=433

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D S+W+ F GVN L V+GG  G ++G G+ WW+ SC+ + + K CTK APTA+ F +  
Sbjct  144  KDLSKWITFDGVNSLTVDGGATGTVNGNGETWWENSCKRN-EAKKCTK-APTALTFYNSK  201

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  ++N+    + Q    I  C+   VSNV V +P DSPNTDGIHI  + ++ ++ S I 
Sbjct  202  NLRVNNLRVKDAQQIQISIEKCSNVQVSNVEVTAPADSPNTDGIHITNTQNIQVSKSIIG  261

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI   + N++IN++ CGPGHGISIGSLG   +   V  + V     +GT NG R
Sbjct  262  TGDDCISIESGSQNVKINDLTCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDNGVR  321

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G   N+ F+N+Q+  V NPIIIDQ+YCD +  C E  S V+I NVVY  ISG
Sbjct  322  IKTYQGGSGTASNIIFQNIQMENVKNPIIIDQDYCD-KSKCTEQKSAVQIKNVVYRNISG  380

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  NCS++ PC GI ++ ++I
Sbjct  381  TSASDIAITFNCSKNYPCQGIVLDKVNI  408



>ref|XP_007032441.1| Polygalacturonase-like protein, putative [Theobroma cacao]
 gb|EOY03367.1| Polygalacturonase-like protein, putative [Theobroma cacao]
Length=454

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 167/262 (64%), Gaps = 4/262 (2%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            QW+ F+  +GL ++G G I+GQG  WW  SC  + +L  C K A T       NN  +S 
Sbjct  160  QWITFEHFDGLSIQGSGTINGQGTNWWTLSCEDNEEL--CDKKA-TGFVIAHSNNVQISE  216

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            + F  SP+ H  +      N + +++++PGDSPNTDGIHI  S ++SI  S I  GDDC+
Sbjct  217  LTFEDSPKVHISLERSTLINATRLTIQAPGDSPNTDGIHIQHSTNVSIDQSLIQTGDDCV  276

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SIGD +S I+I+N+ CGPGHGISIGSLG++G+   VE +HV + +FN +TNG RIKTWQ 
Sbjct  277  SIGDGSSYIDISNINCGPGHGISIGSLGRNGHNESVEFVHVRDVSFNRSTNGVRIKTWQG  336

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G G+VRN+TFE +       PIIIDQ YC     C    S VEI NV Y +I GT  RET
Sbjct  337  GHGHVRNITFERITSHGARRPIIIDQYYCP-HDHCSNETSAVEIDNVAYSQIEGTTDRET  395

Query  255  AINLNCSRSVPCTGIRMESIDI  190
            A+ L CS S PCT I M+ I++
Sbjct  396  AVQLACSESTPCTNIFMKDINL  417



>ref|XP_004498026.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 180/267 (67%), Gaps = 10/267 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G     W+ F  +NGL + GGG +DGQG  WW+   ++H D    T+  PTA++F +C+N
Sbjct  117  GDVGKSWIQFWHINGLVINGGGTVDGQGAPWWN---KFH-DQTDLTR--PTALRFSNCDN  170

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
             +++ +  I+SP+ H  I  C+G  +SN+ + +P +SPNTDG  I +S ++ I +S IS 
Sbjct  171  LNVATLTHINSPKNHISITSCDGVRISNLHINAPEESPNTDGFDISSSSNILIYHSTIST  230

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   ++ I I +V CGPGHGIS+GSLGK G+F  VE++ V NCTF+GTTNGARI
Sbjct  231  GDDCIAINSGSNFINITDVYCGPGHGISVGSLGKDGDFAMVEEVLVKNCTFSGTTNGARI  290

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTW  GRGY R +TFE+++L+ VD+P+IIDQ Y  +  +  +    V+IS+V Y +I GT
Sbjct  291  KTWVGGRGYARKITFEDIKLYKVDHPVIIDQQYDALLSSTND---AVKISDVTYRKIRGT  347

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            ++   AI LNC+ S+ CT I  E+I I
Sbjct  348  SNDNDAIELNCA-SIGCTNIVFENIYI  373



>ref|XP_009142016.1| PREDICTED: polygalacturonase ADPG2-like [Brassica rapa]
 ref|XP_009142019.1| PREDICTED: polygalacturonase ADPG2-like [Brassica rapa]
Length=433

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D S+W+ F GVN L V+GG  G ++G G+ WW+ SC+ + + K CTK APTA+ F +  
Sbjct  144  EDLSKWITFDGVNSLTVDGGATGTVNGNGETWWENSCKRN-EAKKCTK-APTALTFYNSK  201

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  ++N+    + Q    I  C+   VSNV V +P DSPNTDGIHI  + ++ ++ S I 
Sbjct  202  NLRVNNLRVKDAQQIQISIEKCSNVQVSNVEVTAPADSPNTDGIHITNTQNIQVSNSIIG  261

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI   + N++IN++ CGPGHGISIGSLG   +   V  + V     +GT NG R
Sbjct  262  TGDDCISIESGSQNVKINDLTCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDNGVR  321

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G   N+ F+N+Q+  V NPIIIDQ+YCD +  C E  S V+I NVVY  ISG
Sbjct  322  IKTYQGGSGTASNIIFQNIQMENVKNPIIIDQDYCD-KSKCTEQKSAVQIKNVVYRNISG  380

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  NCS++ PC GI ++ ++I
Sbjct  381  TSASDIAITFNCSKNYPCQGIVLDKVNI  408



>ref|XP_006364199.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=452

 Score =   244 bits (622),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 166/264 (63%), Gaps = 2/264 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +WL F  V  L VEGGGII+G G++WW +SC+ +     C   APTA+ F  CNN  + N
Sbjct  145  KWLYFFRVKHLTVEGGGIINGMGQEWWARSCKVN-RTNPCHH-APTALTFHKCNNLKIKN  202

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I   +S Q H    GC    VS + V++PGDSPNTD IHI +S  +++    I  GDDCI
Sbjct  203  IKIFNSQQMHLAFTGCKHVTVSQLVVKAPGDSPNTDAIHISSSTQVNVKDCTIGTGDDCI  262

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI   +S I++ N+ CGPGHGISIGSLGKS +F QV ++HV   + + T NG RIKTWQ 
Sbjct  263  SIVGNSSRIKVKNIVCGPGHGISIGSLGKSNSFSQVYNVHVNGASISNTENGVRIKTWQG  322

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G G+V+ V+FEN+ +  V NPIIIDQ YCD    C    S + I ++ +  I GT++ E 
Sbjct  323  GSGFVKKVSFENVWMENVSNPIIIDQYYCDSTKPCSNKTSNIRIDSISFMGIKGTSATER  382

Query  255  AINLNCSRSVPCTGIRMESIDITA  184
            A+ L CS S PC  + +E I +T+
Sbjct  383  AVTLACSDSFPCRKLYLEDIQLTS  406



>ref|XP_006389759.1| hypothetical protein EUTSA_v10019484mg [Eutrema salsugineum]
 gb|ESQ27045.1| hypothetical protein EUTSA_v10019484mg [Eutrema salsugineum]
Length=336

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 168/263 (64%), Gaps = 11/263 (4%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V GL + G G++DGQGK WWD  CR HP            M F +C + +L+++
Sbjct  55   WLIFDQVEGLVISGRGLLDGQGKGWWDIHCRDHPG---------PMMTFSNCGSVTLTSL  105

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F +S Q H L+ G    N++++ + SP  SPNTDG+HI +S  +SIT+S+I+ GDDC+S
Sbjct  106  RFRNSAQAHVLVMGSQNVNINDIKIASPEASPNTDGVHITSSSAVSITHSDIATGDDCVS  165

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +N+ +  V CGPGHG+SIGSLG+ G  V VEDI V++  F GTTNGARIKTW  G
Sbjct  166  IGDQVNNVNVTFVNCGPGHGVSIGSLGRGGTNVAVEDIRVWHVNFTGTTNGARIKTWPGG  225

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPIIIDQ Y  V   C E    V I  V Y ++SGT++ + A
Sbjct  226  TGYVRGIEFFDIRFSAVQNPIIIDQFYGCVS-KCAETRKAVHIEKVRYMKMSGTSATKVA  284

Query  252  INLNCS-RSVPCTGIRMESIDIT  187
            + L CS  SVPC+ + M  ID++
Sbjct  285  MKLECSGESVPCSNVFMRDIDLS  307



>ref|XP_003561199.1| PREDICTED: polygalacturonase ADPG1-like [Brachypodium distachyon]
Length=471

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 169/272 (62%), Gaps = 7/272 (3%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+ F  V+GL V G G IDG G+ WW +SCR   +L  CT  APTA+    CNN ++ N
Sbjct  167  RWIMFSKVDGLTVTGDGTIDGSGEIWWKKSCRVDKNLP-CTG-APTALLLYKCNNLTVEN  224

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I  ++S Q H  +  C    +  V + +PGDSPNTDGIHI  +  + +   +I  GDDC+
Sbjct  225  IRLLNSQQMHMSVEDCKDVVLKRVRITAPGDSPNTDGIHIARTKDIQVIDCDIGTGDDCM  284

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI   T N+  + V CGPGHGISIGSLG   +  +V +I +Y     GTTNGARIK+WQ 
Sbjct  285  SIETGTENLYASGVTCGPGHGISIGSLGDDNSEARVSNITIYKARLTGTTNGARIKSWQG  344

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVR-----GACKELASGVEISNVVYERISGT  271
            GRGY R++T+E++ +  V NPII+DQNYC +        C++  S VE S + ++ I GT
Sbjct  345  GRGYARDITYEDMVMEDVKNPIILDQNYCTMADPLRPKPCEKQDSAVEFSGIRFKNIRGT  404

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            ++ + AI L+CS +VPC  I ++ + +T  GR
Sbjct  405  SATKQAIKLDCSDAVPCHDILLQDVKLTFNGR  436



>ref|XP_010266762.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=451

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 167/266 (63%), Gaps = 7/266 (3%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F  +NGL + G G I+GQG  WW+  CR       C+     A++  SCNNS 
Sbjct  162  DKGHWILFDSINGLVISGSGEINGQGSYWWN--CRSDK----CSSTPDAALEVRSCNNSQ  215

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            L  ++F+ SP+ H +   C    +S ++  +P DSPNTDGIHI    ++ +  S I  GD
Sbjct  216  LKGLNFVDSPRMHVVFNHCVNVQISQITATAPKDSPNTDGIHIAGCQYVEVMNSIIQTGD  275

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   +SNI IN V+CGPGHGIS+GSLG SG    VE + V NC FNG+ NG RIKT
Sbjct  276  DCISIETGSSNIYINGVKCGPGHGISVGSLGDSGEEDSVEQVVVSNCNFNGSMNGVRIKT  335

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G GY R + F+N+ +  VD+PI+IDQ YC     CK   S V++SNV +  I GT++
Sbjct  336  WQGGSGYARGIKFQNINVNNVDHPIVIDQYYCG-GNHCKNETSAVKVSNVSFINIHGTST  394

Query  264  RETAINLNCSRSVPCTGIRMESIDIT  187
            RE AI+L CS++V CT I +E+I +T
Sbjct  395  REDAISLACSQTVACTDILLENIQLT  420



>ref|XP_003559272.2| PREDICTED: polygalacturonase ADPG1-like [Brachypodium distachyon]
Length=411

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 167/266 (63%), Gaps = 2/266 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
             W+   GV+GL V GGG IDG G  WW  SC+    L  CT+ APTA+ F  C+N ++ N
Sbjct  119  HWIVLHGVSGLTVTGGGTIDGNGDIWWKNSCKIDKALP-CTE-APTALTFHMCDNLTVEN  176

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I  + S Q +  +  C+   ++ +S+ +PG SPNTDGIHI  S  + +    I  GDDC+
Sbjct  177  IRIVDSQQINLSVEDCSDVRLARLSITAPGTSPNTDGIHITRSKDVQVRDCLIKTGDDCM  236

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D T N+ ++ V CGPGHGISIGSLG   +  +V  I++      GTTNGAR+KT+Q 
Sbjct  237  SIEDGTHNLRVSKVVCGPGHGISIGSLGDDNSRAEVSGIYIDTVQLYGTTNGARVKTYQG  296

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY +++ F+N+ +  V NPIIIDQNYCD    CK     VEISNVV++ I GT   + 
Sbjct  297  GSGYAKDIVFQNIIMDNVQNPIIIDQNYCDSAKPCKNQELAVEISNVVFKNIRGTTVSKD  356

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            AI LNCS SV C+ I +E+I++  +G
Sbjct  357  AIQLNCSNSVSCSDIVLENINLKMEG  382



>emb|CAA65072.1| polygalacturonase [Brassica napus]
 emb|CAA67020.1| endo-polygalacturonidase [Brassica napus]
Length=433

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 173/268 (65%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
            +D + WL  + VN L ++GG  GI+DG G  WW  SC+     K CTK APTA+   +  
Sbjct  146  NDKNHWLILEDVNNLSIDGGSAGIVDGNGNIWWQNSCKIDKS-KPCTK-APTALTLYNLK  203

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N ++ N+   ++ Q    I  CN   V NV + +PGDSPNTDGIHI A+ ++ I+ S+I 
Sbjct  204  NLNVKNLRVRNAQQIQISIEKCNNVGVKNVKITAPGDSPNTDGIHIVATKNIRISNSDIG  263

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D + N++IN++ CGPGHGISIGSLG   +   V  I V   T + T NG R
Sbjct  264  TGDDCISIEDGSQNVQINDLTCGPGHGISIGSLGDDNSKAYVSGIDVDGATLSETDNGVR  323

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+++  V NPIIIDQNYCD +  C++  S V+++NVVY+ I G
Sbjct  324  IKTYQGGSGTAKNIKFQNIRMDNVKNPIIIDQNYCD-KDKCEQQESAVQVNNVVYQNIKG  382

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  NCS   PC GI +E+++I
Sbjct  383  TSATDVAIMFNCSVKYPCQGIVLENVNI  410



>ref|XP_010102536.1| hypothetical protein L484_018006 [Morus notabilis]
 gb|EXB93622.1| hypothetical protein L484_018006 [Morus notabilis]
Length=458

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 162/267 (61%), Gaps = 2/267 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D  QWL F GV+ L V GGG I+G GK WW  SC+ + DL    K APTA+ F  C N 
Sbjct  164  EDERQWLMFDGVDNLVVSGGGTINGNGKIWWKNSCKINEDLP--CKGAPTAITFYECKNL  221

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + +++   + Q H     C      N+SV +P  SPNTDGIH+  + ++ I+   I  G
Sbjct  222  VVKDLNIRDAQQMHTSFEKCVNVQAYNLSVTAPEKSPNTDGIHVTNTQNMQISDCVIGTG  281

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+++ ++ CGPGHGISIGSLG   +   V  + V      GTTNG RIK
Sbjct  282  DDCISIVSGSKNVQVTDITCGPGHGISIGSLGARNSEAYVSGVTVKRAKLTGTTNGVRIK  341

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY  N+TF N+++  V NPIII+QNYCD    CK+    V++ NV+Y+ I GT+
Sbjct  342  TWQGGSGYASNITFANIEMKDVYNPIIINQNYCDQDEPCKQQRKAVQVKNVLYKNIKGTS  401

Query  267  SRETAINLNCSRSVPCTGIRMESIDIT  187
            +   A+  +CS++ PC G+ ++ ID+T
Sbjct  402  ASSMAVKFDCSKAFPCQGVTLQDIDLT  428



>ref|XP_004498018.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 179/267 (67%), Gaps = 10/267 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G     W+ F  +NGL + GGG +DGQG  WW+   ++H D    T+  PTA++F +C+N
Sbjct  117  GDVGKSWIQFWHINGLVINGGGTVDGQGAPWWN---KFH-DQTDLTR--PTALRFSNCDN  170

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
             +++ +  I+SP+ H  I  CNG  +SN+ + +P +SPNTDG  I +S ++ I +S IS 
Sbjct  171  LNVATLTHINSPKNHISITSCNGVRISNLHINAPEESPNTDGFDISSSSNILIYHSTISI  230

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   ++ I I +V CGPGHGIS+GSLGK G+F  VE+I V NCT +GTTNGARI
Sbjct  231  GDDCIAINSGSNFINITDVYCGPGHGISVGSLGKDGDFAMVEEILVKNCTISGTTNGARI  290

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTW  GRGY R +TFE+++L+ VD+P+IIDQ Y  +  +  +    V+IS+V Y +I GT
Sbjct  291  KTWVGGRGYARKITFEDIKLYKVDHPVIIDQQYDALLSSTND---AVKISDVTYRKIRGT  347

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            ++   AI LNC+ S+ CT I  E+I I
Sbjct  348  SNDNDAIELNCA-SIGCTNIVFENIYI  373



>ref|XP_009802084.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=455

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 168/275 (61%), Gaps = 2/275 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G +  +WL F+ V  L +EGGG I+G G++WW +SC+   +L    + APTA+ F  CNN
Sbjct  143  GLNPRKWLYFRSVKYLTIEGGGAINGMGQEWWSRSCKV--NLTNPCQHAPTALTFHKCNN  200

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + NI  ++S Q H     C     S +SV +P DSPNTDGIHI +S  ++I    I  
Sbjct  201  LKVRNIKILNSQQMHLAFTDCKHVAASRLSVLAPADSPNTDGIHISSSKQVNIKDCTIGT  260

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   +S I++ N+ CGPGHGISIGSLGK  +  QV ++HV   + + T NG RI
Sbjct  261  GDDCISIVGNSSRIKVRNIVCGPGHGISIGSLGKFNSMSQVYNVHVNGASISNTENGVRI  320

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+VR +TFEN+ +  V NPIIIDQ YCD    C    S + I N+ +  I GT
Sbjct  321  KTWQGGTGFVRKITFENVWMENVSNPIIIDQYYCDSLLPCSNKTSNIRIDNISFVGIKGT  380

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGRWPL  166
            ++ E AI + CS S PC  + +E + +T+    P+
Sbjct  381  SATEKAITVACSDSFPCRKLYLEDVQLTSFSGEPI  415



>ref|NP_001140231.1| uncharacterized protein LOC100272271 precursor [Zea mays]
 gb|ACF83387.1| unknown [Zea mays]
Length=472

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 169/273 (62%), Gaps = 6/273 (2%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F+ V+ L V G G IDG G  WW  SC+ +  L    K APTA+ F  C N  
Sbjct  143  DRRHWIVFRSVDRLTVHGRGSIDGNGHSWWPHSCKINKALP--CKEAPTALSFHYCTNLR  200

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG-  628
            + N+  ++S Q H  I  C    VS +S+ +PG SPNTDGIHI  S  + +T   I  G 
Sbjct  201  VENLKMVNSQQIHMSIEDCASVQVSRLSITAPGTSPNTDGIHITRSKDVRVTNCKIKTGS  260

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC+SI D T  + ++ V CGPGHGIS+GSLG   +  +V  I + +   +GTTNGARIK
Sbjct  261  DDCMSIEDGTHGLHVSGVVCGPGHGISVGSLGDDDSRAEVSGITIDSVQLHGTTNGARIK  320

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA---CKELASGVEISNVVYERIS  277
            T+Q G GY R++TF+N+ +  V NPI+IDQ+YCD   A   C+E  S V+IS+VV+  I 
Sbjct  321  TYQGGSGYARDITFQNMAMHGVRNPIVIDQSYCDRAEAEPPCRERRSAVQISDVVFRNIR  380

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            GT     AI ++CSR+VPC GI +++ID+  QG
Sbjct  381  GTTVTRDAIRMSCSRNVPCRGIVLQNIDLKMQG  413



>ref|XP_006439105.1| hypothetical protein CICLE_v10033386mg, partial [Citrus clementina]
 gb|ESR52345.1| hypothetical protein CICLE_v10033386mg, partial [Citrus clementina]
Length=418

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 165/264 (63%), Gaps = 2/264 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F+ VN  +VEGGG IDG GK WW +SC+ +  L  C   APTA+ F  C N 
Sbjct  126  RDPRHWLVFENVNNFRVEGGGTIDGNGKVWWRKSCKVNKSLP-CND-APTAVTFYGCKNV  183

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +S++ F +S + H     C      N+ V +PG+SPNTDGIH+  + ++ I    I  G
Sbjct  184  RVSSLRFRNSQKMHLTFQYCVNVRALNLLVIAPGNSPNTDGIHVTGTQNILIKNCVIRTG  243

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +   V ++ V     +GTTNG RIK
Sbjct  244  DDCISIVSGSKNVRATDIICGPGHGISIGSLGAGNSEAFVSNVLVNRARLSGTTNGVRIK  303

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G+ +++ F+N+++  V NPIIIDQ+YCD    C+E AS V++SNVVY+ I GT+
Sbjct  304  TWQGGSGFAKDILFQNVEMRNVTNPIIIDQHYCDQEKPCQEQASAVQVSNVVYQNIKGTS  363

Query  267  SRETAINLNCSRSVPCTGIRMESI  196
            + E AI L+CS   PC G+ ++ +
Sbjct  364  ASEVAIKLDCSNQFPCRGLVLQDV  387



>ref|XP_004152352.1| PREDICTED: probable polygalacturonase At3g15720-like [Cucumis 
sativus]
Length=415

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 167/266 (63%), Gaps = 11/266 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            DA  WL F  V+ L ++G G IDGQG  WWD+      D  G     PTA+    C+   
Sbjct  128  DAKNWLLFSNVSRLVIQGNGEIDGQGAAWWDR------DSDG----KPTALAIYDCDGLH  177

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +   +SPQ+H  I  CN  ++S +++ +P +SPNTDGI +  S H+ I   NI  GD
Sbjct  178  LSGLTHSNSPQSHMHIVRCNHASISKLNIVAPENSPNTDGIDVAHSSHVKIHNCNIGTGD  237

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I + TSNI I N+QCGPGHGISIGSLGK G    VED+ V NC   GT  GARIKT
Sbjct  238  DCIAISEGTSNIHIANIQCGPGHGISIGSLGKDGTSSSVEDVRVQNCHLKGTMYGARIKT  297

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACK-ELASGVEISNVVYERISGTA  268
            WQ G GY R ++F+ + L  V  PI+IDQ YC+ +  CK +  S VE+S+V+Y+ + GT+
Sbjct  298  WQGGAGYARKISFQGITLDQVHKPILIDQYYCNGKTDCKNQQTSAVEVSDVLYQGLHGTS  357

Query  267  SRETAINLNCSRSVPCTGIRMESIDI  190
            + E A+ L+CS +V C  I +E IDI
Sbjct  358  ATEVAVELSCSETVGCRNIVLEDIDI  383



>ref|XP_009420908.1| PREDICTED: polygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=397

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 167/271 (62%), Gaps = 2/271 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G  +  W+ F  ++ L V GGG I+G GK WW  SC+    +   +  APTA+ F SC N
Sbjct  102  GRISRHWILFSNIDNLTVRGGGTINGNGKIWWRGSCKMDASMPCIS--APTALSFNSCKN  159

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + N+  + SP+ H  +  C G + S++++ +P +SPNTDGIHI  S ++ I  S I  
Sbjct  160  LRVENLKVMDSPRMHISLEKCTGVDASHLTITAPHESPNTDGIHITHSKNVKIANSFIGT  219

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   + N+   N+ CGPGHGISIGSLG   +  QV ++ V    F GT NG RI
Sbjct  220  GDDCISIVSGSKNVMATNIVCGPGHGISIGSLGAHNSEAQVSNVTVDTARFIGTANGVRI  279

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G+GY + +TF+N+ +  V NPIIIDQNYCD +  C+   S V++ +V+Y+ I GT
Sbjct  280  KTWQGGKGYAKGLTFKNIVMHNVLNPIIIDQNYCDSQNPCQRQVSAVQVMDVLYQNIKGT  339

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQG  178
            ++ E AINL CS   PC  + ++ +++   G
Sbjct  340  SASEVAINLQCSNDRPCRHVLLQDVNLVGVG  370



>ref|XP_002322711.2| polygalacturonase family protein [Populus trichocarpa]
 gb|EEF04472.2| polygalacturonase family protein [Populus trichocarpa]
Length=452

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 166/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D+  WL F  V+ L VEGGG IDG GK WW+ SC+ +  L    K APTA+ F  C N  
Sbjct  162  DSRHWLLFDSVDNLLVEGGGTIDGNGKIWWENSCKVNKSLP--CKEAPTAVTFFECQNLI  219

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + ++   ++ Q H      N   VSN++V SP +SPNTDGIHI  + ++ IT S I  GD
Sbjct  220  VKDLKIQNAQQMHVTFKKSNHVLVSNLTVISPEESPNTDGIHITKTQNIQITDSVIGTGD  279

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N++   + CGPGHGISIGSLG   +   V  + V     +GT NG RIKT
Sbjct  280  DCISIVSGSHNVQATGITCGPGHGISIGSLGAHDSKDHVSGVTVKGAKLSGTANGVRIKT  339

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G V N+ F+N+++  V NPIIIDQNYCD    CK+  S +++ NV+Y+ I GT++
Sbjct  340  WQGGSGNVSNIKFQNIEMNKVTNPIIIDQNYCDQDKPCKQQKSALQVKNVMYKNIKGTSA  399

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             E A+  +CS++ PC GI ++ I++   G
Sbjct  400  SEVAMRFDCSKAYPCQGILLQDINLERAG  428



>emb|CDX75843.1| BnaC03g39260D [Brassica napus]
Length=453

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 166/267 (62%), Gaps = 12/267 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEG G+I+GQG  WW+         KG ++  PTA+KF SCNN  
Sbjct  102  DKDQWILFSDIEGLVVEGNGVINGQGSSWWEH--------KGSSR--PTALKFKSCNNLR  151

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +  + S + H  I  CNG ++SN+ + +P  SPNTDGI + AS ++ I    I+ GD
Sbjct  152  LSGLTHVDSAKAHIHINNCNGVSISNLRINAPESSPNTDGIDVAASSNVIIQDCVIATGD  211

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   TSNI ++ + CGPGHGISIGSLGK G    VEDI V NC F GTTNGARIKT
Sbjct  212  DCIAINSGTSNIRVSGIDCGPGHGISIGSLGKDGETASVEDICVQNCNFRGTTNGARIKT  271

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCD--VRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y +        + +S VE+S VVY    GT
Sbjct  272  WPGGSGYARRITFSGITLDNVENPIIIDQHYNNGGSEKNTDDKSSAVEVSKVVYSNFVGT  331

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  ++  CS +VPCT I M+ + I
Sbjct  332  SKSEYGVDFRCSAAVPCTEIFMKDVRI  358



>ref|XP_006483679.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=441

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 165/264 (63%), Gaps = 2/264 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   WL F+ VN  +VEGGG IDG GK WW +SC+ +  L  C   APTA+ F  C N 
Sbjct  149  RDPRHWLVFENVNNFRVEGGGTIDGNGKVWWRKSCKVNKSLP-CND-APTAVTFYGCKNV  206

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +S++ F +S + H     C      N+ V +PG+SPNTDGIH+  + ++ I    I  G
Sbjct  207  RVSSLRFRNSQKMHLTFQYCVNVRALNLLVIAPGNSPNTDGIHVTGTQNILIKNCVIRTG  266

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +   V ++ V     +GTTNG RIK
Sbjct  267  DDCISIVSGSKNVRATDIICGPGHGISIGSLGAGNSEAFVSNVLVNRARLSGTTNGVRIK  326

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G+ +++ F+N+++  V NPIIIDQ+YCD    C+E AS V++SNVVY+ I GT+
Sbjct  327  TWQGGSGFAKDILFQNVEMRNVSNPIIIDQHYCDQEKPCQEQASAVQVSNVVYQNIKGTS  386

Query  267  SRETAINLNCSRSVPCTGIRMESI  196
            + E AI L+CS   PC G+ ++ +
Sbjct  387  ASEVAIKLDCSNQFPCRGLVLQDV  410



>ref|XP_004164154.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=604

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 165/272 (61%), Gaps = 2/272 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+   VEG GII+G G+KWW  SC+ +  L    K APTA+ F  C N  +SN+
Sbjct  318  WLKFHEVDNFVVEGNGIINGNGRKWWQNSCKVNRGLP--CKRAPTAVTFYQCINLVVSNL  375

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F  + Q H     C      N+ V +PG+SPNTDGIHI  + +  I    I  GDDCIS
Sbjct  376  MFKDAQQMHLTFQKCTKVKALNLRVVAPGNSPNTDGIHITETQNAIIRNCVIGTGDDCIS  435

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   + N++  ++ CGPGHGISIGSLG   +  +V +I V     +GT+NG RIKTWQ G
Sbjct  436  IVSGSRNVQAMDITCGPGHGISIGSLGADNSEAEVSNIRVNRALISGTSNGVRIKTWQGG  495

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GY +N+ F+N+ +  V NPIIIDQNYCD + +C E  S V++SNVVY+ I GT++   A
Sbjct  496  SGYAKNIMFQNVVMRNVSNPIIIDQNYCDKKESCPEQKSAVKVSNVVYKNIRGTSASGDA  555

Query  252  INLNCSRSVPCTGIRMESIDITAQGRWPLIVA  157
            I  +CS+S PC GI +  I I  QG    + A
Sbjct  556  IKFDCSKSFPCQGISLLGIRIVGQGNQEAVTA  587



>ref|XP_010419394.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=410

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 167/263 (63%), Gaps = 11/263 (4%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+GL + G G+++GQGK WWD  CR HP            M F +C N +L ++
Sbjct  129  WLIFDQVDGLAIVGRGLLNGQGKAWWDIHCRDHPG---------PMMTFSNCGNVTLKSL  179

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F  S QTH L+ G     +S++ + SP  SPNTDGIHI +S  +SI +S+I+ GDDC+S
Sbjct  180  RFRDSAQTHVLVMGSQNVYISDIKITSPEASPNTDGIHITSSTAVSINHSDIAAGDDCVS  239

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +N+ ++ V CGPGHG+SIGSLG+ G  V VE+I V++  F GTTNGARIKTW  G
Sbjct  240  IGDQVNNVTVSFVNCGPGHGVSIGSLGRGGTEVAVENIRVWHVNFTGTTNGARIKTWPGG  299

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVR + F +++   V NPIIIDQ Y      C +    V I  V Y ++SGT++ + A
Sbjct  300  TGYVRGIEFFDIRFSSVQNPIIIDQFY-GCAPNCPQTRKAVHIEKVRYMKMSGTSATKVA  358

Query  252  INLNCS-RSVPCTGIRMESIDIT  187
            + L+CS  SVPC+ + M  ID++
Sbjct  359  MKLDCSGESVPCSNLFMRDIDLS  381



>gb|KDO45212.1| hypothetical protein CISIN_1g047738mg, partial [Citrus sinensis]
Length=391

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 171/264 (65%), Gaps = 16/264 (6%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+AF  + GL + G G+ DG G+KWWDQSC++HP  K C++ APTA+ F+ CNN  ++ 
Sbjct  112  RWIAFGNITGLNINGRGLFDGNGQKWWDQSCKHHPG-KDCSERAPTAVSFIQCNNVHINE  170

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I+   SPQ H ++      +  ++ ++SP  SPNTDGIHI  SH +S+  S I+      
Sbjct  171  IYVERSPQVHIVVDYSQDVHFKSLIIDSPETSPNTDGIHIARSHDVSVHTSIIAA-----  225

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
                      +  V CGPGHGISIGSLGK+G  V+VE+I V +  F  TTNGARIKTWQ 
Sbjct  226  ----------VTYVNCGPGHGISIGSLGKNGEEVKVENITVRHVNFCKTTNGARIKTWQA  275

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G+G V++V F  +    V NPIIIDQ YCD +  C + ++GV IS+V Y   +GT++ + 
Sbjct  276  GKGQVQHVEFSYMNFTEVQNPIIIDQYYCDQKDVCAKTSTGVHISDVRYLNATGTSATDV  335

Query  255  AINLNCSRSVPCTGIRMESIDITA  184
            AINL+CS +V CT I++E+I++ +
Sbjct  336  AINLDCSNNVACTDIKLENIELQS  359



>ref|XP_011078892.1| PREDICTED: polygalacturonase [Sesamum indicum]
Length=457

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 164/267 (61%), Gaps = 2/267 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   WL F  V  L VEGGG IDG G  WW  SC+ + + K C K APTA+ F  C +  
Sbjct  166  DKRHWLRFDSVENLVVEGGGTIDGNGNVWWQNSCKINKN-KPC-KDAPTALTFYKCTDLV  223

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+   ++ Q H     C     S + V SP +SPNTDGIHI A+  + ++   I+ GD
Sbjct  224  VKNLKIQNAQQIHVSFERCKSVEASKLVVNSPENSPNTDGIHITATQDIHVSTCTIATGD  283

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   +  +  +++ CGPGHGISIGSLG   +   V D+ V     +GTTNG RIKT
Sbjct  284  DCISIVSGSKKVRASDITCGPGHGISIGSLGSGNSEAHVSDVVVNRAKLSGTTNGVRIKT  343

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ F+N+++  V NPIIIDQNYCD    C++ +S V++ NVVYE I GT++
Sbjct  344  WQGGSGSANNIGFKNIEMENVKNPIIIDQNYCDQDEPCQDQSSAVQVKNVVYENIQGTSA  403

Query  264  RETAINLNCSRSVPCTGIRMESIDITA  184
               AI+L CS+S PC GI +E++++ A
Sbjct  404  STVAIDLECSKSYPCQGIVLENVNLEA  430



>ref|NP_001284447.1| polygalacturonase QRT2 precursor [Cucumis melo]
 gb|AAC26512.1| polygalacturonase precursor [Cucumis melo]
Length=461

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 169/271 (62%), Gaps = 2/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F+ + GL+VEG GII+G G+KWW  SC+ +  L    K APTA+ F  C N 
Sbjct  163  KDRRHWIIFQNLLGLRVEGKGIINGNGRKWWLNSCKVNKTLP--CKEAPTAVTFYQCTNL  220

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             +  + F ++ Q       CN     N+ + +PG+SPNTDGIH+  +  + I    I  G
Sbjct  221  RVEGLRFRNAQQMLLSFQRCNNVKALNLWIYAPGNSPNTDGIHVTGTQFIVIKNCLIMTG  280

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+    + CGPGHGISIGSLG   +  +V ++ V    F+GT+NG RIK
Sbjct  281  DDCISIVSGSKNVRAKGITCGPGHGISIGSLGAGKSEAEVSNVVVDTAKFSGTSNGVRIK  340

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G+GY +N+ F+N+ +  V NPIII+QNYCD +  C + A  V +SNV+Y+ I GT+
Sbjct  341  TWQGGKGYAQNIIFQNIVMDNVTNPIIINQNYCDQKEPCTQQADAVAVSNVMYQNIRGTS  400

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + E A+  +CS+SVPC GI ++ I++  +G+
Sbjct  401  ASEVAVKFDCSKSVPCQGILLQDINLVHKGK  431



>ref|XP_009613568.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=466

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 166/268 (62%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D+  WL F  V  L VEG G+I+G GK WW  SC+ +  L    K APTA+ F +CNN  
Sbjct  173  DSRHWLQFNNVRNLVVEGEGVINGNGKIWWQNSCKINKKLP--CKHAPTALTFYNCNNLK  230

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            +  +   ++ Q H     C+G  V+ + V +P +SPNTDGIHI  + +++I+  +I  GD
Sbjct  231  VRELKIENAQQMHVSFERCSGVEVTKLVVSAPENSPNTDGIHITNTKNITISSCSIGTGD  290

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N++  ++ CGPGHGISIGSLG   +   V +I VY     GTTNG RIKT
Sbjct  291  DCISIESGSRNVQAKDITCGPGHGISIGSLGDGNSEAHVSNIFVYGAKLTGTTNGLRIKT  350

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ F+N+ +  V  PIIIDQNYCD    CKE  S V++ NV+Y  I GT++
Sbjct  351  WQGGSGSANNIKFQNVVMNGVKTPIIIDQNYCDQDSPCKEQDSAVQVKNVIYLNIKGTSA  410

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
               AIN +CS++ PC GI ++++++  +
Sbjct  411  TNEAINFDCSKNFPCQGILLQNVNLVGE  438



>ref|XP_011024398.1| PREDICTED: probable polygalacturonase At1g80170 [Populus euphratica]
Length=419

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 168/266 (63%), Gaps = 6/266 (2%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQ--SCR--YHPDLKGCTKLAPTAMKFLSCNNS  808
            QW+ F  V+ L + G G +DGQG  WW++  SC+   H D + C +  PT +      N 
Sbjct  121  QWITFDEVDNLMIRGSGTMDGQGSTWWERHSSCKDHKHRDKRVCGR-KPTGLVISHSQNV  179

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             L  + F  SPQ H         + SN+++++PGDSPNTDGIH+  + ++ I YS I  G
Sbjct  180  HLEGLTFKDSPQMHVAFERSEWVHASNLTIQAPGDSPNTDGIHLQHAKNIFIDYSRIMTG  239

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISIGD +S I I ++ CGPGHGISIGSLG  G    VED+HV    F  TTNGARIK
Sbjct  240  DDCISIGDGSSQINITHIACGPGHGISIGSLGIDGKSETVEDVHVSYVVFTETTNGARIK  299

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G+G+ RN+ FEN++     NPIIIDQ YCD +  C + +S V+IS + +E I GT+
Sbjct  300  TWQGGKGFARNIVFENIRSEGARNPIIIDQYYCDHK-HCTDHSSAVKISRIRFENIYGTS  358

Query  267  SRETAINLNCSRSVPCTGIRMESIDI  190
             R+ A+++ CS SVPCT I + ++ +
Sbjct  359  HRKPAVHIACSESVPCTDIVLSNVHL  384



>ref|XP_002529616.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF32761.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=474

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 161/269 (60%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F+ V    VEGGG IDG GK WW  SC+ + DL    K APTA+ F  C N 
Sbjct  182  EDDRHWIVFERVQNFLVEGGGTIDGNGKIWWQNSCKLNKDLP--CKDAPTALTFYKCKNL  239

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+   ++ Q H    G     +SN+ V SP +SPNTDGIH+ ++ ++ IT   I  G
Sbjct  240  VVENLKIQNAQQMHVSFQGSKNVKISNLIVTSPEESPNTDGIHVTSTQNIQITDCVIGTG  299

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N++  N+ CGPGHGISIGSLG   +   V  + +     +GTTNG RIK
Sbjct  300  DDCISIVSGSQNVQAMNITCGPGHGISIGSLGSGNSKAHVSGVTINGAKLSGTTNGVRIK  359

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+++  V NPIIIDQNYCD    CKE  S V++ +VVY+ I GT+
Sbjct  360  TWQGGSGNASNIKFQNIKMDNVSNPIIIDQNYCDQDKPCKEQKSAVQVKDVVYKNIKGTS  419

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            +   AI  +CS S PC GI ++ + +  Q
Sbjct  420  ASHVAIKFDCSNSHPCEGILLQDVSLERQ  448



>emb|CDY58462.1| BnaA03g57500D [Brassica napus]
Length=453

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 165/267 (62%), Gaps = 12/267 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEG G+I+GQG  WW+         KG ++  PTA+KF SCNN  
Sbjct  102  DKDQWILFSDIEGLVVEGNGVINGQGSSWWEH--------KGSSR--PTALKFKSCNNLR  151

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +  + S + H  I  CNG ++SN+ + +P  SPNTDGI + AS ++ I    I+ GD
Sbjct  152  LSGLTHVDSAKAHIHINNCNGVSISNLRINAPESSPNTDGIDVAASSNVIIQDCVIATGD  211

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   TSNI +  + CGPGHGISIGSLGK G    VEDI V NC F GTTNGARIKT
Sbjct  212  DCIAINSGTSNIRVCGIDCGPGHGISIGSLGKDGETASVEDICVQNCNFRGTTNGARIKT  271

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCD--VRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y +        + +S VEIS VVY    GT
Sbjct  272  WPGGSGYARRITFSGITLDNVENPIIIDQHYNNGGSEKNTDDKSSAVEISKVVYSNFVGT  331

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  ++  CS +VPCT I M+ + I
Sbjct  332  SKSEYGVDFRCSAAVPCTEIFMKDVRI  358



>ref|XP_006402870.1| hypothetical protein EUTSA_v10005982mg [Eutrema salsugineum]
 gb|ESQ44323.1| hypothetical protein EUTSA_v10005982mg [Eutrema salsugineum]
Length=440

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 171/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
            +D + WL  + VN L ++GG  GII+G GK WW  SC+     K CTK APTA+   +  
Sbjct  147  NDKNHWLILEDVNNLSIDGGSTGIIEGNGKIWWQNSCKIDKS-KPCTK-APTALTLYNLK  204

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
              ++ N+   ++ Q    I  CN   V NV++ +P DSPNTDGIHI  + ++ I+ S I 
Sbjct  205  KLNVKNLRVKNAQQIQISIEKCNNVKVKNVAITAPDDSPNTDGIHITNTQNIQISNSEIG  264

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D + N++IN++ CGPGHGISIGSLG   +   V  I+V     + T NG R
Sbjct  265  TGDDCISIEDGSQNVQINDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKLSSTDNGVR  324

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+++  V NPIIIDQNYCD +  C++  S V++SNVVY  ISG
Sbjct  325  IKTYQGGSGTAKNIQFQNIRMENVKNPIIIDQNYCD-KEKCEQQESAVQVSNVVYRNISG  383

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  NCS   PC GI +E+++I
Sbjct  384  TSATDVAITFNCSEKYPCKGIVLENVNI  411



>ref|XP_004139416.1| PREDICTED: probable polygalacturonase At1g80170-like [Cucumis 
sativus]
 ref|XP_004159417.1| PREDICTED: probable polygalacturonase At1g80170-like [Cucumis 
sativus]
Length=290

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 166/272 (61%), Gaps = 49/272 (18%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGI--IDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
            G D S WLA +G++ L++ G GI  IDG+G  WW+QSCR HP+L+GCT +APTAMK +SC
Sbjct  35   GTDKSLWLALEGISRLRINGSGIGKIDGRGTGWWNQSCRDHPNLEGCTSIAPTAMKIISC  94

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
            N+ +LSN+HFI+S Q   L+ GC    + N+ + +P  SPNTDGIHIH+SH       NI
Sbjct  95   NDPNLSNLHFINSSQALVLLMGCIRTEIKNLVITAPERSPNTDGIHIHSSH-------NI  147

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
               +  I  GDYTS + I++++CGPGHGISIGSLG+ GNFVQVEDI V N  F GTTNGA
Sbjct  148  IIRNTTIGTGDYTSRMNISHIKCGPGHGISIGSLGRGGNFVQVEDISVSNIYFKGTTNGA  207

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKTWQ    ++ NV+ +NL                                        
Sbjct  208  RIKTWQQSGVHIANVSIKNL---------------------------------------F  228

Query  276  GTASRETAINLNCSRSVPCTG-IRMESIDITA  184
            GT+    AINLNCSRSV CTG I ++SI + +
Sbjct  229  GTSMSNVAINLNCSRSVACTGSILLKSIQLQS  260



>ref|XP_006301655.1| hypothetical protein CARUB_v10022105mg [Capsella rubella]
 gb|EOA34553.1| hypothetical protein CARUB_v10022105mg [Capsella rubella]
Length=336

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 168/264 (64%), Gaps = 13/264 (5%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V+GL + G G+++GQGK WWD  CR HP            M F +C N +L ++
Sbjct  55   WLIFDQVDGLAIVGRGLLNGQGKAWWDIHCRDHPG---------PMMTFSNCGNVTLKSL  105

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
             F +S QTH L+ G +   + ++ + +P  SPNTDGIHI +S  +SIT+S+I+ GDDC+S
Sbjct  106  RFRNSAQTHVLVMGSHNVYIDDIKITAPEASPNTDGIHITSSTAVSITHSDIATGDDCVS  165

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IGD  +N+ ++ + CGPGHG+SIGSLG+ G  V VE+I V++  F GTTNGARIKTW  G
Sbjct  166  IGDQVNNVNVSFLNCGPGHGVSIGSLGRGGTEVAVENIRVWHVNFTGTTNGARIKTWPGG  225

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNY-CDVRGACKELASGVEISNVVYERISGTASRET  256
             GY R + F +++   V NPIIIDQ Y C  +  C +    V I  V Y ++ GT++ + 
Sbjct  226  TGYARGIEFFDIRFSSVQNPIIIDQFYGCAPK--CPQTRKAVHIEKVRYMKMRGTSATKV  283

Query  255  AINLNCS-RSVPCTGIRMESIDIT  187
            A+ L CS  SVPC+ I M  ID++
Sbjct  284  AMKLECSGESVPCSDIFMRDIDLS  307



>ref|XP_007018009.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY15234.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=405

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 167/263 (63%), Gaps = 9/263 (3%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F  V GL V+G G IDG+G  WW+++ +         +  P  + F  C+N  +  I
Sbjct  107  WLCFSNVAGLTVDGPGQIDGKGAAWWNKTPK---------ECGPAVISFHKCDNLKVHGI  157

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
              ++SP  H  + G    N+S++ + +P DSPNTDGI I AS  L I+ S I  GDDCI+
Sbjct  158  TSLNSPGNHVSLNGSKDVNISHIQLIAPKDSPNTDGIDISASSSLQISDSFIGTGDDCIA  217

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   TSN+ I ++ CGPGHGIS+GSLGK+G F  VE++HV N TFNGT NGARIKTW  G
Sbjct  218  INGSTSNLNITSIACGPGHGISVGSLGKNGKFETVEEVHVRNSTFNGTQNGARIKTWTGG  277

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G+ RN++F+ +QL  V NPIIIDQ+YC  +   +E  S V+ISNV +    GT++ + A
Sbjct  278  SGFARNISFDGIQLVNVQNPIIIDQHYCPHKTCPREGKSAVKISNVTFSGFQGTSATDVA  337

Query  252  INLNCSRSVPCTGIRMESIDITA  184
            I L+CS  VPCT I + +  IT+
Sbjct  338  IKLDCSSIVPCTDITLNNNTITS  360



>ref|XP_010030771.1| PREDICTED: probable polygalacturonase At1g80170 [Eucalyptus grandis]
Length=420

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 169/272 (62%), Gaps = 5/272 (2%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+    V+GL V G G I+G G +WWD S  +H  + GC K  PT +    CN   
Sbjct  122  DCRHWIMISDVDGLSVLGSGAINGNGSEWWDHSLCHHHHV-GCGK-KPTGLVIDKCNEVR  179

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS + F  SPQ H  I G      +N+++ SPG SPNTDGIHI  S H+ +    I  GD
Sbjct  180  LSELTFKDSPQMHIAIEGSTRVTAANLTITSPGHSPNTDGIHIQRSQHVLVRDCYIGTGD  239

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISIG  +++++I+ + CGPGHG+SIGSLGK G+   VED+HV +  F GT+NG RIKT
Sbjct  240  DCISIGQGSAHLDISGISCGPGHGVSIGSLGKHGSRETVEDVHVRDVHFVGTSNGVRIKT  299

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G+GY R++ FE + +    +PIIIDQ YCD    CK   S V+ISNV Y +++GT+ 
Sbjct  300  WQGGKGYARDIVFERITVTNSSHPIIIDQFYCD-HEHCKNQTSAVQISNVTYSQVNGTSH  358

Query  264  RETAINLNCSRSVPCTGIRMESI--DITAQGR  175
             + A+ L CS + PC  I M+ I  ++T +G+
Sbjct  359  AKAAVELACSETHPCRDILMKDITLNLTVKGK  390



>ref|XP_004156878.1| PREDICTED: probable polygalacturonase At3g15720-like [Cucumis 
sativus]
Length=415

 Score =   240 bits (612),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 167/266 (63%), Gaps = 11/266 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            DA  WL F  V+ L ++G G IDGQG  WWD+      D  G     PTA+    C+   
Sbjct  128  DAKNWLLFSNVSRLVIQGNGEIDGQGAAWWDR------DSDG----KPTALAIYDCDGLH  177

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +   +SP++H  I  CN  ++S +++ +P +SPNTDGI +  S H+ I   NI  GD
Sbjct  178  LSGLTHSNSPKSHMHIVRCNHASISKLNIVAPENSPNTDGIDVAHSSHVKIHNCNIGTGD  237

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I + TSNI I N+QCGPGHGISIGSLGK G    VED+ V NC   GT  GARIKT
Sbjct  238  DCIAISEGTSNIHIANIQCGPGHGISIGSLGKDGTSSSVEDVRVQNCHLKGTMYGARIKT  297

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACK-ELASGVEISNVVYERISGTA  268
            WQ G GY R ++F+ + L  V  PI+IDQ YC+ +  CK +  S VE+S+V+Y+ + GT+
Sbjct  298  WQGGAGYARKISFQGITLDQVHKPILIDQYYCNGKTDCKNQQTSAVEVSDVLYQGLHGTS  357

Query  267  SRETAINLNCSRSVPCTGIRMESIDI  190
            + E A+ L+CS +V C  I +E IDI
Sbjct  358  ATEVAVELSCSETVGCRNIVLEDIDI  383



>ref|NP_001237524.1| polygalacturonase precursor [Glycine max]
 gb|ABC70314.1| polygalacturonase precursor [Glycine max]
Length=440

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 170/270 (63%), Gaps = 0/270 (0%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V+  +V GGG  +G+GKKWW  SC+ + +L       P A+ F  CNN 
Sbjct  146  EDRQHWIVFDSVSNFRVGGGGTFNGKGKKWWQSSCKVNTNLPCNDGPRPKAVTFYQCNNL  205

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++N+ F  +PQ H +  GC    VSN+ + +PGDSPNTDGIH+  + ++ I+ S+I  G
Sbjct  206  KVTNLRFKDAPQMHVVFEGCFNVIVSNLVIRAPGDSPNTDGIHVADTQNIVISNSDIGTG  265

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +  +V ++ V   T  GTTNG RIK
Sbjct  266  DDCISIISGSQNVRATDITCGPGHGISIGSLGADNSEAEVSNVVVNRATLTGTTNGVRIK  325

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ F N+ +  V NPIIIDQ YCD    C+E  S V++SNV+Y+ I GT+
Sbjct  326  TWQGGSGYARNIKFLNIAMQNVTNPIIIDQYYCDQSKPCQEQDSAVQLSNVLYQNIKGTS  385

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + E AI  +CSR+VPC  I ++ + +  QG
Sbjct  386  ASEVAIKFDCSRAVPCRQIYVQDVILEPQG  415



>ref|XP_009135455.1| PREDICTED: probable polygalacturonase At3g15720 [Brassica rapa]
Length=453

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 165/267 (62%), Gaps = 12/267 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEG G+I+GQG  WW+         KG ++  PTA+KF SCNN  
Sbjct  102  DKDQWILFSDIEGLVVEGNGVINGQGSSWWEH--------KGSSR--PTALKFKSCNNLR  151

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +  + S + H  I  CNG ++SN+ + +P  SPNTDGI + AS ++ I    I+ GD
Sbjct  152  LSGLTHVDSAKAHIHINNCNGVSISNLRINAPESSPNTDGIDVAASSNVIIQDCVIATGD  211

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   TSNI +  + CGPGHGISIGSLGK G    VEDI V NC F GTTNGARIKT
Sbjct  212  DCIAINSGTSNIRVCGIDCGPGHGISIGSLGKDGETASVEDICVQNCNFRGTTNGARIKT  271

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCD--VRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y +        + +S VE+S VVY    GT
Sbjct  272  WPGGSGYARRITFSGITLDNVENPIIIDQHYNNGGSEKNTDDKSSAVEVSKVVYSNFVGT  331

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  ++  CS +VPCT I M+ + I
Sbjct  332  SKSEYGVDFRCSTAVPCTEIFMKDVRI  358



>ref|XP_010435969.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 164/262 (63%), Gaps = 4/262 (2%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            QW+ F  +NGL ++G GI+DGQG KWW  +C+ +   K C K  P  +     +N  +SN
Sbjct  122  QWIEFAHINGLHIDGRGILDGQGTKWWSLNCKKYK--KACLK-RPRGVVISHSSNVHISN  178

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I    SP     +      +V  +++ + GDSPNTDGIHI  S ++ +  SNI  GDDCI
Sbjct  179  IMVKDSPNFQMSLEDSKWVSVKQLTITADGDSPNTDGIHIQRSQNVIVHNSNIRTGDDCI  238

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SIGD +  I I+ + CGPGHGISIGSLG+ G    VED+ V +CTF  TTNG RIKTWQ 
Sbjct  239  SIGDGSKYINISRISCGPGHGISIGSLGRYGTKETVEDVVVQDCTFRETTNGVRIKTWQG  298

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRG+VRNV FE ++L     PIIIDQ YC  R  CK   + VEI NV+Y  I GT+ ++ 
Sbjct  299  GRGHVRNVLFERIKLHGATRPIIIDQFYCPHR-QCKNHTNAVEIKNVMYNHIHGTSIKKP  357

Query  255  AINLNCSRSVPCTGIRMESIDI  190
             + L CS+SVPC GI M  I+I
Sbjct  358  FVQLLCSKSVPCRGIFMNDINI  379



>ref|XP_002266543.3| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=388

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 166/261 (64%), Gaps = 7/261 (3%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F  VNGL V+G G I+G+G +WW           G     PTAM F SCNN  L  +
Sbjct  103  WIGFWHVNGLTVKGNGQINGRGAEWW------QAYTSGKIYQRPTAMGFYSCNNLLLQGL  156

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
            +FI+S + H  + G NG  +S++++ +P  SPNTDGI I  S ++ ++ S I  GDDCI+
Sbjct  157  NFINSQRNHISVSGSNGVTISHLTITAPDSSPNTDGIDISHSKNVRVSDSTIGTGDDCIA  216

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
             GD TS + +  V CGPGHGISIGSLG  G   QVE+IHV +C+F GT NGARIKTWQ G
Sbjct  217  FGDQTSQVFVKGVACGPGHGISIGSLGVGGASAQVEEIHVDSCSFKGTQNGARIKTWQGG  276

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GY R +TF N++L   +NPIIIDQ YC     C+   S V+IS+V +    GT++ + A
Sbjct  277  SGYARKITFNNIKLEDAENPIIIDQYYCP-HSVCQTTTSAVQISDVSFTGFLGTSATDNA  335

Query  252  INLNCSRSVPCTGIRMESIDI  190
            I L+CS +V CT I ++ I+I
Sbjct  336  IKLSCSETVGCTNISLDYINI  356



>gb|EYU29034.1| hypothetical protein MIMGU_mgv1a022147mg, partial [Erythranthe 
guttata]
Length=398

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 161/266 (61%), Gaps = 9/266 (3%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V  + V GGG IDG G+ WW  SCR              A+ + +C N  + N+
Sbjct  132  WIKFEDVRNIDVYGGGTIDGNGEVWWKNSCRIKK---------TKALTYKNCTNLRMRNL  182

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
              +++ Q H     CNG   S + V +P DSPNTDGIH+  + +++I  S I  GDDCIS
Sbjct  183  KLLNAQQMHVNFQDCNGVEASELLVVAPEDSPNTDGIHVTRTSNINILDSQIRTGDDCIS  242

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I + + N+E+ N+ CGPGHGISIGSLG+      V DI V      GTTNG RIKTWQ G
Sbjct  243  IVNGSRNVEVRNIVCGPGHGISIGSLGEDKTENYVTDIFVKGAKLTGTTNGLRIKTWQGG  302

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             G  RN+ FE++Q+  V NPIII+Q+YCD    C+   S V++ NV+Y  I GT++ + A
Sbjct  303  SGIARNIVFEDIQMTNVSNPIIINQSYCDKNKKCQTEKSAVQVENVIYRNIRGTSASKMA  362

Query  252  INLNCSRSVPCTGIRMESIDITAQGR  175
            INL CS SVPC  I +E++ +TA  +
Sbjct  363  INLKCSDSVPCRNIAVENVLLTAHTK  388



>ref|XP_008375262.1| PREDICTED: polygalacturonase-like [Malus domestica]
Length=423

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 162/265 (61%), Gaps = 2/265 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F  +N   VEGGG I+G G+KWW  SC+ +  L  CT LAP A+ F  CN   
Sbjct  130  DRRHWILFTNLNNFTVEGGGTINGNGRKWWQNSCKVNESLP-CT-LAPNAVTFFGCNTLE  187

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+ F ++ Q H     C     SN+ V +PGDSPNTDGIH+ A+ ++ I+   I  GD
Sbjct  188  VDNVRFRNAQQMHLSFESCVNVKASNLIVTAPGDSPNTDGIHVTATQNIRISNCLIRTGD  247

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N+   ++ CGPGHGISIGSLG   +  +V D+ V      GTTNG RIKT
Sbjct  248  DCISIVSGSKNVRAEDITCGPGHGISIGSLGAGNSQAEVSDVVVSRAKITGTTNGLRIKT  307

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ ++N+ +  V NPIIIDQ+YCD    C+E  S V+ISNVVYE + GT++
Sbjct  308  WQGGSGNATNIRYKNVMMANVSNPIIIDQHYCDQDSPCQEQDSAVKISNVVYENVKGTSA  367

Query  264  RETAINLNCSRSVPCTGIRMESIDI  190
             + A+  +CS+   C  I ++ +++
Sbjct  368  SKVAVKFDCSKRFGCQEILLKDVNL  392



>ref|XP_007219828.1| hypothetical protein PRUPE_ppa026655mg, partial [Prunus persica]
 gb|EMJ21027.1| hypothetical protein PRUPE_ppa026655mg, partial [Prunus persica]
Length=375

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 162/271 (60%), Gaps = 2/271 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            +D   W+ F+ V   +VEGGG IDG G+ WW  SC+ +  L  CT +AP AM F  C N 
Sbjct  81   NDRRHWIVFENVTNFRVEGGGTIDGNGRIWWQNSCKVNESLP-CT-IAPNAMTFFGCINL  138

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + NI F +  + H     C     SN+ V +P DSPNTDGIH+  + ++ I    I  G
Sbjct  139  QVDNIRFQNPQKMHLSFHECVNVKASNLIVTAPEDSPNTDGIHVTGTQNIQIKNCLIRTG  198

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +  +V D+ V      GTTNG RIK
Sbjct  199  DDCISIVSGSRNVRATDIICGPGHGISIGSLGAGNSEAEVSDVMVSRAKMMGTTNGLRIK  258

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY  N+ F+N+ ++ V NPIII+Q YCD    C+E  S V+I+NVVY+ + GT+
Sbjct  259  TWQGGSGYASNIVFKNIMMYNVSNPIIINQYYCDQDEPCQEQKSAVKINNVVYDNVKGTS  318

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + + A+  +CS+   C GI + +++I   G 
Sbjct  319  ASKVAVKFDCSKRFGCQGILLRNVNIKPLGE  349



>emb|CDY06902.1| BnaA04g24130D [Brassica napus]
Length=433

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 171/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D S+W+ F GVN L V+GG  G ++G G+ WW+ SC+ + + K CTK APTA+ F +  
Sbjct  144  EDLSKWITFDGVNSLTVDGGATGTVNGNGETWWENSCKRN-EAKKCTK-APTALTFYNSK  201

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  ++N+    + Q    I  C+   VSNV V +P DSPNTDGIHI  + ++ ++ S I 
Sbjct  202  NLRVNNLRVKDAQQIQISIEKCSNVQVSNVEVTAPADSPNTDGIHITNTQNIQVSNSIIG  261

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI   + N++IN++ CG GHGISIGSLG   +   V  + V     +GT NG R
Sbjct  262  TGDDCISIESGSQNVKINDLTCGSGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDNGVR  321

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G   N+ F+N+Q+  V NPIIIDQ+YCD +  C E  S V+I NVVY  ISG
Sbjct  322  IKTYQGGSGTASNIIFQNIQMENVKNPIIIDQDYCD-KSKCTEQKSAVQIKNVVYRNISG  380

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  NCS++ PC GI ++ ++I
Sbjct  381  TSASDIAITFNCSKNYPCQGIVLDKVNI  408



>ref|XP_010032438.1| PREDICTED: polygalacturonase [Eucalyptus grandis]
 gb|KCW51831.1| hypothetical protein EUGRSUZ_J01279 [Eucalyptus grandis]
Length=442

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 166/268 (62%), Gaps = 2/268 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D  QWL F+ +  L VEGGG I+G G+ WW +SC+  P+L    K APTA+ F  CNN 
Sbjct  150  KDPRQWLKFENLENLAVEGGGYINGNGETWWKKSCKRDPNLP--CKDAPTALTFQECNNL  207

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++++   ++ Q H +   C      N+ + +P +SPNTDGIH+  + ++ I    I  G
Sbjct  208  RVADLSIKNAQQMHLVFQKCVNVRAVNLQITAPEESPNTDGIHVTETQNIIIDSCVIGTG  267

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   +  ++  ++ CGPGHGISIGSLG   +   V D+ +     +GT NG RIK
Sbjct  268  DDCISIVSGSRKVQATDITCGPGHGISIGSLGADKSADYVSDVLINKAKLSGTKNGVRIK  327

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ FEN+ +  V+NPIIIDQNYCD + +C + A+ V++ +V Y  I GT+
Sbjct  328  TWQGGSGYARNIKFENIAMTNVENPIIIDQNYCDQKESCPQQAAAVQVMDVSYMNIRGTS  387

Query  267  SRETAINLNCSRSVPCTGIRMESIDITA  184
            + E AI  +CS++ PC  I ++ +++ +
Sbjct  388  ASEDAIKFDCSKNHPCQDIFLQDVNLQS  415



>gb|KFK35000.1| hypothetical protein AALP_AA5G221100 [Arabis alpina]
Length=428

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 171/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D + WL  + VN L V+GG  GIIDG GK WW  SC+     K CTK APTA    +  
Sbjct  142  KDKNHWLVIEDVNNLLVDGGSTGIIDGNGKIWWQNSCKIDRS-KPCTK-APTAFTLYNLK  199

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            + ++ N+   ++ Q    I  CN  NV NV + +P DSPNTDGIHI  + ++ I+ S+I 
Sbjct  200  SLNVKNLRVRNAQQIQISIEKCNNVNVKNVEITAPDDSPNTDGIHITNTQNIRISDSDIG  259

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D + N++IN++ CGPGHGISIGSLG   +   V  I V     + T NG R
Sbjct  260  TGDDCISIEDGSQNVQINDLNCGPGHGISIGSLGDDNSKAYVSGISVDGAKLSKTDNGVR  319

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+++  V NPIIIDQNYCD +  C++  S V++SNVVY+ I+G
Sbjct  320  IKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQNYCD-KDKCEQQGSAVQVSNVVYKNITG  378

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  +CS+  PC GI + +++I
Sbjct  379  TSATDVAIKFDCSKKYPCQGIVLSNVNI  406



>gb|KHN08870.1| Polygalacturonase [Glycine soja]
Length=385

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 164/270 (61%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  +  L V+GGG IDG G  WW  SC+ +  L    K APTA+ F  C + 
Sbjct  94   EDLTHWLVFDSIEKLSVKGGGTIDGNGNIWWQNSCKVNEKLP--CKNAPTALTFYKCKDL  151

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
            ++ ++   +  Q            VS+++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  152  TVEDLTIKNGQQMQVSFQNSENVQVSDLTVTAPGDSPNTDGIHVTNTQNIQISNSVIGTG  211

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + ++   ++ CGPGHGISIGSLG  G+   V  I V     +GTTNG RIK
Sbjct  212  DDCISIVSGSKDVLATDIICGPGHGISIGSLGAEGSKDFVSGITVKGAQLSGTTNGLRIK  271

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+Q+  V NPIIIDQNYCD    C+E  S V+I NV+Y+ ISGT+
Sbjct  272  TWQGGSGSASNIQFQNIQMDNVANPIIIDQNYCDQETPCEEQTSAVQIRNVLYQNISGTS  331

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + +  +  +CS+  PC GI +++ID+  +G
Sbjct  332  ASDVGVQFDCSKKFPCQGIVLQNIDLKLEG  361



>ref|XP_010445667.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=427

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 163/262 (62%), Gaps = 4/262 (2%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            QW+ F  +NGL ++G GI+DGQG KWW  +C+ +   K C K  P  +     +N  +SN
Sbjct  122  QWIEFAHINGLHIDGPGILDGQGPKWWSLNCKKYK--KACLK-RPRGVVISHSSNVHISN  178

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I    SP     +      +V  +++ + GDSPNTDGIHI  S ++ +  SNI  GDDCI
Sbjct  179  IMVKDSPNFQMSLEDSKWVSVKQLTITADGDSPNTDGIHIQRSQNVIVHNSNIRTGDDCI  238

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SIGD +  I I+ + CGPGHGISIGSLG+ G    VED+ V +CTF  TTNG +IKTWQ 
Sbjct  239  SIGDGSKYINISRISCGPGHGISIGSLGRYGTKETVEDVVVQDCTFRETTNGVKIKTWQG  298

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRG+VRNV FE ++L     PIIIDQ YC  R  CK     VEI NV+Y  I GT+ ++ 
Sbjct  299  GRGHVRNVLFERIKLHGATRPIIIDQFYCPHR-QCKNQTKAVEIKNVMYNHIHGTSIKKP  357

Query  255  AINLNCSRSVPCTGIRMESIDI  190
             + L CS+SVPC GI M  I+I
Sbjct  358  FVQLLCSKSVPCRGIFMNDINI  379



>ref|XP_010417741.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=444

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 166/268 (62%), Gaps = 4/268 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSC-RYHPDLKGCTKLAPTAMKFLSCN  814
            G +  +WL F+GV+   VEGGG ++G G++WW  SC R H +   C + APTA+ F  C 
Sbjct  127  GLNRRKWLYFQGVSRFTVEGGGTVNGMGQEWWRISCKRNHSN--PC-RGAPTALTFHKCK  183

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  L N++ I S Q H     C    VS + V +P  SPNTDGIHI  S  + I  + +S
Sbjct  184  NMKLENLNVIDSQQMHIAFTSCRRVTVSRLKVIAPATSPNTDGIHISVSRGIVIDNTTVS  243

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDC+SI   +S I I+N+ CGPGHGISIGSLGKS ++ +V+DI V   + + T NG R
Sbjct  244  TGDDCVSIVKNSSQISISNIVCGPGHGISIGSLGKSKSWEEVKDILVDTASISDTENGVR  303

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKTWQ G G V  + F N+++  V NPIIIDQ YCD R  C    S V I N+ + R+ G
Sbjct  304  IKTWQGGSGLVSKIIFRNIKMNNVSNPIIIDQYYCDSRKPCANQTSAVTIENISFVRVRG  363

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI ++CS S PC  I ++ ID+
Sbjct  364  TSASKQAIKISCSDSSPCRNILLQDIDL  391



>emb|CAA11846.1| polygalacturonase [Rubus idaeus]
Length=335

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 169/272 (62%), Gaps = 3/272 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   W+ F  V  L V+G G I+G G+ WW  SC+ +   K C  LAPTA+ F  CNN  
Sbjct  48   DLYHWIIFDNVRNLLVQGPGTINGNGQIWWQNSCK-NKHTKPCGTLAPTAVTFYQCNNLV  106

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+ F  S Q H     C     S ++V +P  SPNTDGIH+  + +++I+ S I  GD
Sbjct  107  VKNLKFKDSQQMHVSFEDCTNVQASYLTVTAPETSPNTDGIHVANTQNITISNSIIGTGD  166

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N++ +++ CGPGHGISIGSLG+ G+  +V  + V     +GT NG RIKT
Sbjct  167  DCISIVSGSQNVQASSITCGPGHGISIGSLGEGGSEDRVSKVTVNGAKISGTMNGVRIKT  226

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDV--RGACKELASGVEISNVVYERISGT  271
            WQ G G   N+ F+N+++  V NPIIIDQNYCD   +  CK+ +  V++ NV+Y+ I GT
Sbjct  227  WQGGSGMASNIVFQNIEMNDVTNPIIIDQNYCDTSDKRKCKQQSKAVKVQNVLYKNIRGT  286

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            ++ + AI  +CS+S+PC GI ++++ +  + +
Sbjct  287  SASKYAIAFDCSKSIPCQGIVLQNVQLHKRAK  318



>ref|XP_011033319.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=454

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 166/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D+  W+ F  V  L VEGGG IDG GK WW+ SC+ +  L  CT+ APTA+ F  C N  
Sbjct  164  DSRHWILFDSVENLLVEGGGTIDGNGKIWWENSCKVNKSLP-CTE-APTAVTFFECQNLI  221

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + ++   ++ Q H      N   VSN+++ SP +SPNTDGIH+  + ++ I  S I  GD
Sbjct  222  VKDLKIQNAQQMHVTFKKSNHVLVSNLTITSPEESPNTDGIHVTKTKNIQIKDSVIGTGD  281

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N++   + CGPGHGISIGSLG   +   V  + V     +GT NG RIKT
Sbjct  282  DCISIVSGSHNVQATGITCGPGHGISIGSLGAHDSKDHVSGVTVNGAKLSGTANGVRIKT  341

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G V N+ F+N+++  V NPIIIDQNYCD    CK+  S +++ NV+Y+ I GT++
Sbjct  342  WQGGSGNVSNIKFQNIEMNKVTNPIIIDQNYCDQDKPCKQQRSALQVKNVMYKNIKGTSA  401

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
             E A+  +CS++ PC GI ++ I++   G
Sbjct  402  SEVAVRFDCSKAYPCQGILLQDINLERAG  430



>gb|ACJ06505.1| polygalacturonase [Diospyros kaki]
Length=441

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 162/270 (60%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  V  LKV+GGG IDG G  WW+ SC+ +  L    K APTA+ F +C N 
Sbjct  149  EDGTHWLLFDSVQNLKVQGGGTIDGNGNTWWENSCKINKALP--CKDAPTALTFYNCKNI  206

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+    + Q H           S+++V SP  SPNTDGIHI  + ++ I+   I  G
Sbjct  207  IVKNLKIQHAQQIHLSFEKSTNVQASSLTVTSPQTSPNTDGIHITNTQNIQISSCVIGTG  266

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   +  ++  ++ CGPGHGISIGSLG   +   V D+ V      GT NG RIK
Sbjct  267  DDCISIVSGSQKVKATDITCGPGHGISIGSLGSGNSKAFVSDVLVNGAKLYGTQNGVRIK  326

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F N+Q+  VDNPIIIDQNYCD    CKE  S V++ +V+Y+ I GT+
Sbjct  327  TWQGGSGIASNIKFLNVQMNNVDNPIIIDQNYCDQDKPCKEQGSSVQLKDVLYQNIQGTS  386

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + + AIN +CS+  PC GI ++S++I  +G
Sbjct  387  ASDVAINFSCSKDFPCEGIVLQSVNIRREG  416



>ref|XP_009418868.1| PREDICTED: polygalacturonase ADPG1-like [Musa acuminata subsp. 
malaccensis]
Length=392

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 173/273 (63%), Gaps = 8/273 (3%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F  VNGL +   G+IDGQG  +W  +CR +     C   AP+A+  L+ N S LS +
Sbjct  106  WIVFNNVNGLSIASTGVIDGQGSAYW--TCRNNYQ---CND-APSALTVLNANGSRLSGL  159

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
              I+SP  H ++    G  +  ++V +PGDSPNTDG+ I  S H+S++ S I  GDDC++
Sbjct  160  KLINSPSKHLIVGRSVGVTIDRINVTAPGDSPNTDGVFIQQSQHVSLSNSIIGTGDDCVA  219

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            IG+ T ++ +  + CGPGHGISIGSLG   +  QVE IHV N      TNG RIKTWQ G
Sbjct  220  IGNGTLDVTVTGITCGPGHGISIGSLGSENSEAQVEQIHVSNSRIFNATNGLRIKTWQGG  279

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACK-ELASGVEISNVVYERISGTASRET  256
             GY +N++FE + L  VDNPI+IDQ YC  RG C    +S +++SNV Y  ISGT + + 
Sbjct  280  SGYAKNISFEAINLAAVDNPILIDQYYCP-RGDCALNQSSSLQVSNVHYSDISGTTTGKI  338

Query  255  AINLNCSRSVPCTGIRMESIDITAQGRWPLIVA  157
            AINLNCS+SV CT I +++I+I +      +VA
Sbjct  339  AINLNCSQSVICTDISLQNINIQSADAGGTVVA  371



>gb|ACJ06506.1| polygalacturonase [Diospyros kaki]
Length=441

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 162/270 (60%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  V  LKV+GGG IDG G  WW+ SC+ +  L    K APTA+ F +C N 
Sbjct  149  EDGTHWLLFDSVQNLKVQGGGTIDGNGNTWWENSCKINKALP--CKDAPTALTFYNCKNI  206

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+    + Q H           S+++V SP  SPNTDGIHI  + ++ I+   I  G
Sbjct  207  IVKNLKIQHAQQIHLSFEKSTNVQASSLTVTSPQTSPNTDGIHITNTQNIQISSCVIGTG  266

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   +  ++  ++ CGPGHGISIGSLG   +   V D+ V      GT NG RIK
Sbjct  267  DDCISIVSGSQKVKATDITCGPGHGISIGSLGSGNSKAFVSDVLVNGAKLYGTQNGVRIK  326

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F N+Q+  VDNPIIIDQNYCD    CKE  S V++ +V+Y+ I GT+
Sbjct  327  TWQGGSGIASNIKFLNVQMNNVDNPIIIDQNYCDQDKPCKEQGSSVQLKDVLYQNIQGTS  386

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + + AIN +CS+  PC GI ++S++I  +G
Sbjct  387  ASDVAINFSCSKDFPCEGIVLQSVNIRREG  416



>ref|XP_010554840.1| PREDICTED: polygalacturonase ADPG2-like [Tarenaya hassleriana]
Length=405

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 163/268 (61%), Gaps = 4/268 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D   WL F  VN L V+GG  G IDG GK WW  SC+ +P  K CTK APTA+ F +  
Sbjct  115  KDKRHWLTFDAVNNLSVDGGTTGNIDGNGKIWWQNSCKINPS-KPCTK-APTALTFYNSK  172

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N  ++N+   ++ Q       C     SNV+V +P DSPNTDGIHI  + ++ +  S I 
Sbjct  173  NVKVTNLRVRNAQQIQVSFEKCANVIASNVAVTAPEDSPNTDGIHITNTQNIQVINSIIG  232

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI   + N++I ++ CGPGHGISIGSLG       V  + V     +GT NG R
Sbjct  233  TGDDCISIESGSQNVQIKDITCGPGHGISIGSLGDDNTRAYVSGVTVDGAKLSGTDNGVR  292

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G   N+ F+N+Q+  V NPIIIDQNYCD    CK+  S V++ NVVY  I G
Sbjct  293  IKTYQGGSGTASNIKFQNIQMNNVKNPIIIDQNYCDKSKPCKKQKSAVQVRNVVYRNIKG  352

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++   AI  +CS+S PC GI ++++++
Sbjct  353  TSASGMAIKFDCSKSYPCKGIVLQNVNL  380



>gb|EMT22808.1| Polygalacturonase ADPG1 [Aegilops tauschii]
Length=411

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 167/271 (62%), Gaps = 7/271 (3%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F+ V+GL V G G IDG G+ WW  SCR    LK C+  AP A+    CNN ++ NI
Sbjct  113  WIMFRNVDGLTVTGDGTIDGNGETWWKSSCRVDKKLK-CSN-APMALLLSRCNNLTVENI  170

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
              ++S Q H  +  C    +  +++ +PGDSP  DGIHI  +  + +   +I  GDDC+S
Sbjct  171  RLLNSQQIHMSVEDCRDVLLKGITITAPGDSPMNDGIHIARTKDIQVLDCDIKTGDDCMS  230

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I   T N+  + + CGPGHGISIGSLG   +  +V +I +Y    +GTTNGAR+K+WQ G
Sbjct  231  IETGTENLYASRITCGPGHGISIGSLGNDNSEARVSNITIYKAHLSGTTNGARMKSWQGG  290

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVR-----GACKELASGVEISNVVYERISGTA  268
            +GY ++VTFE++ +  V NPIIIDQNYC          CK+  S VE SN+ ++ I GT+
Sbjct  291  KGYAKDVTFEDITMEEVHNPIIIDQNYCTSADPANPKPCKKQTSAVEFSNIRFKNIRGTS  350

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + + AI L+CS +VPC  I ++ + +T + R
Sbjct  351  ATKEAIKLDCSDTVPCRDILLQDVKLTFRDR  381



>ref|XP_006356262.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=437

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 168/272 (62%), Gaps = 2/272 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            DA +WL F  V  L V+GGG I+G G+KWW  SC+   +     + APTAM F  CNN  
Sbjct  128  DAHKWLYFVKVRHLTVQGGGTINGMGQKWWATSCKI--NTTNPCRHAPTAMSFHKCNNLK  185

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + +I  ++S Q H  I  C    VS + VE+P  SPNTDGIHI +S H++I    I  GD
Sbjct  186  VRDIRMLNSQQMHISISNCINVEVSRMIVEAPAKSPNTDGIHITSSTHVAIKDCTIRTGD  245

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI + +S+I + N+ CGPGHGISIGSLGKS ++ QV ++ V    F+ T NG RIKT
Sbjct  246  DCISIVNNSSSILVKNIACGPGHGISIGSLGKSNSWSQVHNVCVDGAYFSNTENGVRIKT  305

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ GRG+VR ++F N+ +  V NPIIIDQ YCD    C    SG+ I +V +  I GT++
Sbjct  306  WQGGRGFVRRISFMNVWMENVSNPIIIDQYYCDSSFPCPNQTSGISIHSVSFVGIRGTSA  365

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
             + AI   CS S PC  + ++ + + +   +P
Sbjct  366  TKNAIKFACSDSSPCKKLFLKDVQLLSYLGFP  397



>sp|P35336.1|PGLR_ACTDE RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Actinidia deliciosa]
 gb|AAC14453.1| polygalacturonase [Actinidia deliciosa var. deliciosa]
Length=467

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 162/269 (60%), Gaps = 2/269 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   WL F  V  L+VEGGG I+G GK WW  SC+ +  L    K APTA+ F    +  
Sbjct  166  DGRHWLVFDSVQNLRVEGGGTINGNGKIWWQNSCKTNKALP--CKDAPTALTFYKSKHVI  223

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N+   ++ Q H     C     SN+ V +P +SPNTDGIH+  + ++ I+   I  GD
Sbjct  224  VKNLKIENAQQIHVSFDNCVNVQASNLMVTAPENSPNTDGIHVTGTQNIHISSCVIGTGD  283

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI + +  + +N++ CGPGHGISIGSLG   +   V D+ V      GTTNG RIKT
Sbjct  284  DCISIVNGSRKVRVNDITCGPGHGISIGSLGYGNSEAHVSDVVVNGAKLCGTTNGVRIKT  343

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ F+N+++  V+NPIIIDQNYCD    C+E +S V++ NVVY+ I GT +
Sbjct  344  WQGGSGSASNIKFQNVEMHNVENPIIIDQNYCDQDKPCQEQSSAVQVKNVVYQNIKGTCA  403

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQG  178
               AI  +CS+  PC GI +E +D+  +G
Sbjct  404  SNVAITFDCSKRFPCQGIVLEDVDLEIEG  432



>gb|KFK42419.1| hypothetical protein AALP_AA2G253800 [Arabis alpina]
Length=444

 Score =   238 bits (608),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 165/267 (62%), Gaps = 2/267 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G +  +W+ F GV+ L VEGGG ++G G++WW +SC+ H     C + APTA+ F  C N
Sbjct  130  GLNLRKWIYFHGVSRLTVEGGGTVNGMGQEWWRRSCK-HNHSNPC-RGAPTALTFHKCKN  187

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + NI+ I S Q H     C   ++S + V +P  SPNTDGIHI  S  + I  + +S 
Sbjct  188  MRVENINVIDSQQMHIAFTSCRRVSISGLKVIAPASSPNTDGIHISVSRGIVIDNTTVST  247

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDC+SI   +S I I+N+ CGPGHGISIGSLGKS ++ +V D+ V   + + T NG RI
Sbjct  248  GDDCVSIVKNSSQISISNIVCGPGHGISIGSLGKSKSWEEVSDVTVDTASISDTENGVRI  307

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G V N+ F N+ +  V NPIIIDQ YCD +  C    S + I N+ + RI GT
Sbjct  308  KTWQGGSGLVSNIIFRNINMNNVSNPIIIDQYYCDSKKPCANQTSALTIENIAFVRIRGT  367

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            ++ + AI + CS + PC  I +E ID+
Sbjct  368  SASKQAIKITCSDTSPCRNILLEDIDL  394



>emb|CBI36307.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 166/261 (64%), Gaps = 3/261 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            W+ F  VNGL V+G G I+G+G +WW      +  L   T     AM F SCNN  L  +
Sbjct  115  WIGFWHVNGLTVKGNGQINGRGAEWWQAYTSTYCKLNASTP--SIAMGFYSCNNLLLQGL  172

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
            +FI+S + H  + G NG  +S++++ +P  SPNTDGI I  S ++ ++ S I  GDDCI+
Sbjct  173  NFINSQRNHISVSGSNGVTISHLTITAPDSSPNTDGIDISHSKNVRVSDSTIGTGDDCIA  232

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
             GD TS + +  V CGPGHGISIGSLG  G   QVE+IHV +C+F GT NGARIKTWQ G
Sbjct  233  FGDQTSQVFVKGVACGPGHGISIGSLGVGGASAQVEEIHVDSCSFKGTQNGARIKTWQGG  292

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GY R +TF N++L   +NPIIIDQ YC     C+   S V+IS+V +    GT++ + A
Sbjct  293  SGYARKITFNNIKLEDAENPIIIDQYYCP-HSVCQTTTSAVQISDVSFTGFLGTSATDNA  351

Query  252  INLNCSRSVPCTGIRMESIDI  190
            I L+CS +V CT I ++ I+I
Sbjct  352  IKLSCSETVGCTNISLDYINI  372



>gb|AAL30418.1|AF434714_1 dehiscence-related endopolygalaturonase [Glycine max]
Length=428

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 164/270 (61%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  +  L V+GGG IDG G  WW  SC+ +  L    K APTA+ F  C + 
Sbjct  137  EDLTHWLVFDSIEKLSVKGGGTIDGNGNIWWQNSCKVNEKLP--CKNAPTALTFYKCKDL  194

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
            ++ ++   +  Q            VS+++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  195  TVEDLTIKNGQQMQVSFQNSENVQVSDLTVTAPGDSPNTDGIHVTNTQNIQISNSVIGTG  254

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + ++   ++ CGPGHGISIGSLG  G+   V  I V     +GTTNG RIK
Sbjct  255  DDCISIVSGSKDVLATDIICGPGHGISIGSLGAEGSKDFVSGITVKGAQLSGTTNGLRIK  314

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+Q+  V NPIIIDQNYCD    C+E  S V+I NV+Y+ ISGT+
Sbjct  315  TWQGGSGSASNIQFQNIQMDNVANPIIIDQNYCDQETPCEEQTSAVQIRNVLYQNISGTS  374

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + +  +  +CS+  PC GI +++ID+  +G
Sbjct  375  ASDVGVQFDCSKKFPCQGIVLQNIDLKLEG  404



>ref|XP_003537285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=428

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 164/270 (61%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  +  L V+GGG IDG G  WW  SC+ +  L    K APTA+ F  C + 
Sbjct  137  EDLTHWLVFDSIEKLSVKGGGTIDGNGNIWWQNSCKVNEKLP--CKNAPTALTFYKCKDL  194

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
            ++ ++   +  Q            VS+++V +PGDSPNTDGIH+  + ++ I+ S I  G
Sbjct  195  TVEDLTIKNGQQMQVSFQNSENVQVSDLTVTAPGDSPNTDGIHVTNTQNIQISNSVIGTG  254

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + ++   ++ CGPGHGISIGSLG  G+   V  I V     +GTTNG RIK
Sbjct  255  DDCISIVSGSKDVLATDIICGPGHGISIGSLGAEGSKDFVSGITVKGAQLSGTTNGLRIK  314

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F+N+Q+  V NPIIIDQNYCD    C+E  S V+I NV+Y+ ISGT+
Sbjct  315  TWQGGSGSASNIQFQNIQMDNVANPIIIDQNYCDQETPCEEQTSAVQIRNVLYQNISGTS  374

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + +  +  +CS+  PC GI +++ID+  +G
Sbjct  375  ASDVGVQFDCSKKFPCQGIVLQNIDLKLEG  404



>ref|XP_010450754.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 162/262 (62%), Gaps = 4/262 (2%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            QW+ F  +NGL ++G G +DGQG KWW  +C+ +   K C K  P  +     +N  +SN
Sbjct  122  QWIEFAHINGLHIDGRGTLDGQGTKWWSLNCKKYK--KACLK-RPRGVVISHSSNVHISN  178

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            I    SP     +      +V  +++ + GDSPNTDGIHI  S ++ +  SNI  GDDCI
Sbjct  179  IMVKDSPNFQMSLEDSKWVSVKQLTITADGDSPNTDGIHIQRSQNVIVHNSNIRTGDDCI  238

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SIGD +  + I+ + CGPGHGISIGSLG+ G    VED+ V +CTF  TTNG RIKTWQ 
Sbjct  239  SIGDGSKYVNISRISCGPGHGISIGSLGRYGTKETVEDVVVQDCTFRETTNGVRIKTWQG  298

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            GRG+VRNV FE ++L     PIIIDQ YC  R  CK     VEI NV+Y  I GT+ ++ 
Sbjct  299  GRGHVRNVLFERIKLHGATRPIIIDQFYCPHR-QCKNHTEAVEIKNVMYNHIHGTSIKKP  357

Query  255  AINLNCSRSVPCTGIRMESIDI  190
             + L CS+SVPC GI M  I+I
Sbjct  358  FVQLLCSKSVPCRGIFMNDINI  379



>ref|XP_009802467.1| PREDICTED: polygalacturonase-2-like [Nicotiana sylvestris]
Length=467

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 164/268 (61%), Gaps = 2/268 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D+  WL F  V  L VEG G+I+G GK WW  SC+ +  L    K APTA+ F +CNN  
Sbjct  174  DSRHWLQFDSVQNLVVEGEGVINGNGKIWWQNSCKINKKLP--CKHAPTALTFYNCNNLK  231

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            L ++    + Q H     C+   V+ + V +P +SPNTDGIHI  + +++I+   I  GD
Sbjct  232  LRDLKIEDAQQMHVSFERCSRVEVTKLFVSAPENSPNTDGIHITNTQYITISGCTIGTGD  291

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   + N++  ++ CGPGHGISIGSLG   +   V +I V      GT+NG RIKT
Sbjct  292  DCISIESGSRNVQAKDITCGPGHGISIGSLGDGNSEAHVSNILVNGTKLTGTSNGLRIKT  351

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ G G   N+ FEN+ +  V NPIIIDQNYCD    CKE  S V++ NV+Y+ I GT++
Sbjct  352  WQGGSGSASNIKFENVVMNGVKNPIIIDQNYCDQDSPCKEQDSAVQVKNVIYQNIKGTSA  411

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQ  181
               AIN +CS++ PC  I +++I++  +
Sbjct  412  TNEAINFDCSKNFPCQRIMLQNINLVGE  439



>gb|EAZ03180.1| hypothetical protein OsI_25333 [Oryza sativa Indica Group]
Length=393

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 161/248 (65%), Gaps = 2/248 (1%)
 Frame = -2

Query  921  IDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNIHFISSPQTHALIFGCNG  742
            IDG GK WW  SC+ +  L  CT+ APTA+ F SC N  +  +  ++S Q    +  C  
Sbjct  131  IDGNGKIWWQNSCKTNSKLP-CTE-APTALTFYSCKNLKVEYLKVVNSQQIQISVEDCTD  188

Query  741  FNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCISIGDYTSNIEINNVQCGP  562
              VS +S+ +P  +PNTDGIHI  S  + +T   I  GDDC+SI D T N+ + N+ CGP
Sbjct  189  VMVSRLSITAPETAPNTDGIHITRSRDVEVTDCMIKTGDDCMSIEDGTENLHVKNMVCGP  248

Query  561  GHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTGRGYVRNVTFENLQLFLV  382
            GHGISIGSLG   +   V ++ V N    GTTNGARIKTWQ G+G  +N+ F+N+ +  V
Sbjct  249  GHGISIGSLGDHNSEAHVNNVTVDNVRLYGTTNGARIKTWQGGKGSAKNIVFQNMVMDNV  308

Query  381  DNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETAINLNCSRSVPCTGIRME  202
             NPIIIDQNYCD    CK+  S VE+SNV+++ I GT++ E AI L+CS SVPC GI +E
Sbjct  309  WNPIIIDQNYCDSSTPCKQQKSAVEVSNVLFKNIRGTSASEEAIMLHCSSSVPCHGITLE  368

Query  201  SIDITAQG  178
            ++++T +G
Sbjct  369  NVNLTVKG  376



>ref|XP_004497875.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=403

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 178/272 (65%), Gaps = 10/272 (4%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G     W+ F  +NGL + GGG +DGQG  WW+   ++H D    T+  PTA++F +C+N
Sbjct  117  GDVGKSWIQFWHINGLVINGGGTVDGQGAPWWN---KFH-DQTDLTR--PTALRFSNCDN  170

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
             +++ +  I+SP+ H  I  C+G  +S++ + +P +SPNTDG  I +S ++ I  S IS 
Sbjct  171  LNVATLTHINSPKNHISITSCHGVRISHLHINAPEESPNTDGFDISSSSNILIYRSTIST  230

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   ++ I I +V CGPGHGIS+GSLGK G+F  VE+I V NCTF GTTNGARI
Sbjct  231  GDDCIAINSGSNFINITDVYCGPGHGISVGSLGKGGDFAMVEEILVKNCTFRGTTNGARI  290

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTW  GRGY R +TFE+++L+ V +P+IIDQ Y  +  +  +    V+IS+V Y +I GT
Sbjct  291  KTWVGGRGYARKITFEDIKLYKVSHPVIIDQQYDALLSSTND---AVKISDVTYRKIRGT  347

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            ++   AI LNC+ S+ CT I  E+I I    R
Sbjct  348  SNDNDAIELNCA-SIGCTNIVFENIYIIGVDR  378



>emb|CDX72025.1| BnaC08g28490D [Brassica napus]
Length=432

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 171/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCN  814
             D + WL  + VN L V+GG  G +DG GK WW  SC+     K CTK APTA+ F +  
Sbjct  145  KDKNHWLILEDVNNLSVDGGSEGTVDGNGKIWWKNSCKIDRS-KPCTK-APTALTFYNLK  202

Query  813  NSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNIS  634
            N ++ N+   ++ Q    +  CN  N+ NV + +P DSPNTDGIHI  + ++ ++ S+I 
Sbjct  203  NLNVKNLRVRNAQQIQISVEKCNNVNIKNVEITAPDDSPNTDGIHITNTQNIRVSNSHIG  262

Query  633  CGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGAR  454
             GDDCISI D + N++IN++ CGPGHGISIGSLG   +   V  ++V       T NG R
Sbjct  263  TGDDCISIEDGSQNVQINDLTCGPGHGISIGSLGDDNSKAYVSGVNVDGAKLAETDNGVR  322

Query  453  IKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISG  274
            IKT+Q G G  +N+ F+N+++  V NPIIIDQNYCD +  C++  S V+++NVVY  ISG
Sbjct  323  IKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQNYCD-KDKCEQQDSAVQVNNVVYRNISG  381

Query  273  TASRETAINLNCSRSVPCTGIRMESIDI  190
            T++ + AI  +CS   PC GI +++++I
Sbjct  382  TSATDVAITFDCSEKYPCKGIVLDNVNI  409



>ref|XP_009146202.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Brassica 
rapa]
Length=455

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 161/267 (60%), Gaps = 12/267 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEG G I+GQG  WW+         KG ++  PTA+KF SCNN  
Sbjct  101  DKDQWILFSDIEGLVVEGNGEINGQGSSWWEH--------KGSSR--PTALKFKSCNNLR  150

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +  + S   H  I GCN   +SN+ + +P  SPNTDGI +  S ++ I    I+ GD
Sbjct  151  LSGLTHVDSAMAHIHINGCNDVTISNLRINAPESSPNTDGIDVAVSSNVIIQDCVIATGD  210

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   T+NI I+ + CGPGHGISIGSLGK G    VED+ V NC F GT NGARIKT
Sbjct  211  DCIAINSGTANIRISGIDCGPGHGISIGSLGKDGEIASVEDVCVQNCNFRGTMNGARIKT  270

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNY--CDVRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y   D   +  + +S VE+S VVY    GT
Sbjct  271  WPGGSGYARRITFNGITLDNVENPIIIDQHYNNGDSDKSTDDKSSAVEVSKVVYSNFVGT  330

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  +N  CS  VPCT I ++ + I
Sbjct  331  SRSEYGVNFRCSTRVPCTEIFLKDVKI  357



>ref|XP_010654779.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=414

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 174/276 (63%), Gaps = 9/276 (3%)
 Frame = -2

Query  981  ASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTK-------LAPTAMKFL  823
            +S WL F+ ++G  + G G +DGQG  WW  S  Y  +L   T          P A+ F 
Sbjct  114  SSYWLIFQYIDGFIINGKGTLDGQGSSWWP-SLYYKQELLNDTNSYDMDDVARPIALGFS  172

Query  822  SCNNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYS  643
             CNN  +  ++ I+SP  H  +F CNG  +SN+++++P +SPNTDGI I     + +  +
Sbjct  173  FCNNLQIYGLNVINSPSKHVKLFRCNGAILSNLNIKAPKESPNTDGIVIGECSQIQVHDN  232

Query  642  NISCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTN  463
            NI  GDDC++I   +SNI I+ V CGPGHGISIGSLG +G +  VE+IHV +C+F GT N
Sbjct  233  NIGTGDDCVAILKGSSNINISRVACGPGHGISIGSLGMNGAYDTVEEIHVQDCSFTGTQN  292

Query  462  GARIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYER  283
            G RIKTWQ G GY R ++F+ + L   +NPIIIDQ YC  +  C    S V++S++ Y  
Sbjct  293  GIRIKTWQGGSGYARKISFQGITLNAAENPIIIDQYYCP-QLHCPNKTSAVKVSDISYAG  351

Query  282  ISGTASRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + GT+  +TAINL CS+S+ CT I ++ I+IT+ G+
Sbjct  352  VQGTSMTKTAINLRCSQSMACTNIELKRINITSVGQ  387



>ref|XP_009146201.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Brassica 
rapa]
Length=458

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 161/267 (60%), Gaps = 12/267 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEG G I+GQG  WW+         KG ++  PTA+KF SCNN  
Sbjct  104  DKDQWILFSDIEGLVVEGNGEINGQGSSWWEH--------KGSSR--PTALKFKSCNNLR  153

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +  + S   H  I GCN   +SN+ + +P  SPNTDGI +  S ++ I    I+ GD
Sbjct  154  LSGLTHVDSAMAHIHINGCNDVTISNLRINAPESSPNTDGIDVAVSSNVIIQDCVIATGD  213

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   T+NI I+ + CGPGHGISIGSLGK G    VED+ V NC F GT NGARIKT
Sbjct  214  DCIAINSGTANIRISGIDCGPGHGISIGSLGKDGEIASVEDVCVQNCNFRGTMNGARIKT  273

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNY--CDVRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y   D   +  + +S VE+S VVY    GT
Sbjct  274  WPGGSGYARRITFNGITLDNVENPIIIDQHYNNGDSDKSTDDKSSAVEVSKVVYSNFVGT  333

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  +N  CS  VPCT I ++ + I
Sbjct  334  SRSEYGVNFRCSTRVPCTEIFLKDVKI  360



>emb|CAC05657.1| endopolygalacturonase [Brassica napus]
 emb|CAC05658.1| endopolygalacturonase [Brassica napus]
Length=434

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 172/269 (64%), Gaps = 6/269 (2%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGG--GIIDGQGKK-WWDQSCRYHPDLKGCTKLAPTAMKFLSC  817
             D S+W+ F GVN L V+GG  G ++G G + WW+ SC+ + + K CTK APTA+ F + 
Sbjct  144  EDLSKWITFDGVNSLTVDGGATGTVNGNGAETWWENSCKRN-EAKKCTK-APTALTFYNS  201

Query  816  NNSSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNI  637
             N  ++N+    + Q    I  C+   VSNV V +P DSPNTDGIHI  + ++ ++ S I
Sbjct  202  KNLRVNNLRVKDAQQIQISIEKCSNVQVSNVEVTAPADSPNTDGIHITNTQNIQVSNSII  261

Query  636  SCGDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGA  457
              GDDCISI   + N++IN++ CGPGHGISIGSLG   +   V  + V     +GT NG 
Sbjct  262  GTGDDCISIESGSQNVQINDLTCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDNGV  321

Query  456  RIKTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERIS  277
            RIKT Q G G   N+ F+N+Q+  V+NPIIIDQ+YCD +  C E  S V+I NVVY  IS
Sbjct  322  RIKTNQGGSGTASNIIFQNIQMENVENPIIIDQDYCD-KSKCTEQKSAVQIKNVVYRNIS  380

Query  276  GTASRETAINLNCSRSVPCTGIRMESIDI  190
            GT++ + AI  NCS++ PC GI ++ ++I
Sbjct  381  GTSASDIAITFNCSKNYPCQGIVLDKVNI  409



>ref|XP_006406925.1| hypothetical protein EUTSA_v10020740mg [Eutrema salsugineum]
 gb|ESQ48378.1| hypothetical protein EUTSA_v10020740mg [Eutrema salsugineum]
Length=441

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 162/267 (61%), Gaps = 13/267 (5%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEGGG I+GQG  WW+         KG     PTA+KF SCNN  
Sbjct  91   DKDQWILFTDIEGLVVEGGGEINGQGSSWWEH--------KGSR---PTALKFKSCNNLR  139

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS I  + SP  H  I  CN  ++SN+ + +P  SPNTDGI + AS ++ I    I+ GD
Sbjct  140  LSGITHVDSPMAHIHINQCNDVSISNLRINAPESSPNTDGIDVAASSNVIIQDCIIATGD  199

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   TSNI I+ + CGPGHGISIGSLGK G    VE++ V NC F GT NGARIKT
Sbjct  200  DCIAINSGTSNIRISGIDCGPGHGISIGSLGKDGETASVENVCVQNCNFRGTMNGARIKT  259

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCD--VRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y +        + +S VE+S V+Y    GT
Sbjct  260  WPGGSGYARMITFHGITLDNVENPIIIDQHYNNGGSEKTKDDKSSAVEVSKVMYSNFVGT  319

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  ++  CS+SVPCT I M  + I
Sbjct  320  SKSEYGVDFRCSQSVPCTDIFMRDVRI  346



>emb|CBI15273.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 165/266 (62%), Gaps = 14/266 (5%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+ FK V+GL + G GIIDG GK WW                   A++  S N   L+ 
Sbjct  112  KWIHFKRVDGLFINGSGIIDGNGKNWWSSG-------------YINALEVTSSNKVQLTG  158

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            + F ++P  H +   C+  ++SNVS+++PGDSPNTDGIH+  S H++I + +I  GDDCI
Sbjct  159  LSFRNNPHMHVVFDSCDMVHISNVSIDAPGDSPNTDGIHLKESTHVNIEFCSIRTGDDCI  218

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            SI D  SNI I N++CGPGHGISIGS+G+ G +  VE+I+V +  F G+ +G RIKTWQ 
Sbjct  219  SIVDKCSNITIQNIECGPGHGISIGSMGQYGAYETVENIYVSDVQFKGSLSGVRIKTWQG  278

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G+G+ R + F+ +       PI IDQ YC     C E A  VEIS++ Y  I GT+ R+T
Sbjct  279  GKGHARKMVFKGITSLNTQYPIQIDQFYCP-HAKCDEQADAVEISDISYIDIKGTSMRKT  337

Query  255  AINLNCSRSVPCTGIRMESIDITAQG  178
            A+ L CS SVPC  I M+ I+++ QG
Sbjct  338  AVKLACSESVPCKNIFMQDINLSYQG  363



>gb|KHG17940.1| hypothetical protein F383_07843 [Gossypium arboreum]
Length=402

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 161/269 (60%), Gaps = 2/269 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G   ++WLAF  VNGL + G G I+G+G  WW Q C  H   KG T   PTA+ F SCN 
Sbjct  106  GFHINRWLAFTHVNGLTIIGSGTINGRGAAWWSQPC-LHKVPKGVTCKGPTALTFYSCNG  164

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              L  I  I+S + H  I  C     SN+ + +P  SPNTDGI I  S ++ I  S I  
Sbjct  165  LVLKGIRHINSQRNHITISNCKDVTFSNLHISAPKTSPNTDGIDISGSSNVQILNSFIGT  224

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   +S+I I  + CGPGHGISIG+LG  G    VE++HV NCT  GT  G RI
Sbjct  225  GDDCIAISSGSSHINITGIACGPGHGISIGALGAHGEDT-VEEVHVRNCTLKGTMTGVRI  283

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G  R ++FE ++    D+PIIIDQ YC  R  CK   SG+ IS+V Y  I GT
Sbjct  284  KTWQGGVGTARRISFEKIRFIRADSPIIIDQYYCPSRVNCKNETSGIRISDVSYRSIIGT  343

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            ++ +  INL+C ++V CT I+   + IT+
Sbjct  344  STTDKVINLSCDQNVGCTNIQFNYVYITS  372



>gb|AHG12641.1| polygalacturonase [Nicotiana tabacum]
Length=455

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 166/269 (62%), Gaps = 2/269 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G +  +WL F+ V  L +EGGG I+G G++WW +SC+   +L    + APTA+ F  CNN
Sbjct  143  GLNPRKWLYFRSVKYLTIEGGGAINGMGQEWWSRSCKV--NLTNPCQHAPTALTFHKCNN  200

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + NI  ++S Q H     C     S +SV +P DSPNTDG HI +S  ++I    I  
Sbjct  201  LKVRNIKILNSQQMHLAFTDCKHVAASRLSVLAPADSPNTDGTHIGSSKQVNIKDCTIGT  260

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   +S I++ N+ CGPGHGISIGSLGKS +  QV ++HV   + + T NG RI
Sbjct  261  GDDCISIVGNSSRIKVRNIVCGPGHGISIGSLGKSNSMSQVYNVHVNGASISNTENGVRI  320

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+VR +TFE++ +  V NPIIIDQ YCD    C    S + I ++ +  I GT
Sbjct  321  KTWQGGTGFVRKITFESVWMENVSNPIIIDQYYCDSLLPCSNKTSNIRIDSISFVGIKGT  380

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            ++ E AI + CS S PC  + +E + +T+
Sbjct  381  SATEKAITVACSDSCPCRKLYLEDVQLTS  409



>ref|XP_010034237.1| PREDICTED: polygalacturonase-like [Eucalyptus grandis]
 gb|KCW50908.1| hypothetical protein EUGRSUZ_J00557 [Eucalyptus grandis]
Length=410

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 165/269 (61%), Gaps = 2/269 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F+ +  L V GGG I+G G+ WW +SC+  P  K   K APTA+ F  C   
Sbjct  118  KDPTLWLKFENLTKLSVAGGGYINGNGETWWQKSCKRKP--KPPCKHAPTALTFQECKYL  175

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             ++++   ++ Q H +   C   +  N+ + +P +SPNTDGIH+  + +++I +  I  G
Sbjct  176  RVADLTITNAQQMHLVFKKCVNVSAVNLQITAPKESPNTDGIHVTDTQNITIDHCAIGTG  235

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   +SN++  ++ CGPGHGISIGSLG   +   V ++ + N   +GTTNG RIK
Sbjct  236  DDCISIVSGSSNVQATDIACGPGHGISIGSLGAHMSADYVSNVVINNSRLSGTTNGVRIK  295

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY  N+ FENL +  V NPIIIDQNYCD    C   A+ V++ NV Y  I GT+
Sbjct  296  TWQGGSGYASNIRFENLAMDNVTNPIIIDQNYCDQEKPCPPQAAAVQVRNVTYTNIRGTS  355

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQ  181
            + E AI  +CSR+ PC  I ++ I++ ++
Sbjct  356  ASEEAIKFDCSRNHPCEDIFLQDINLRSE  384



>ref|XP_009594191.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana tomentosiformis]
Length=454

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 169/269 (63%), Gaps = 2/269 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G +  +WL F+ +  L +EGGG I+G G++WW +SC+ +     C + APTA+ F  CNN
Sbjct  142  GLNPRKWLYFRSMKHLTIEGGGTINGMGQEWWARSCKVN-KTNPC-QHAPTALTFHRCNN  199

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + NI  ++S Q H     C    VS+++V +P DSPNTDGIHI +S  ++I    I  
Sbjct  200  LKVRNIEILNSQQMHLAFTDCKHVAVSHLAVLAPADSPNTDGIHISSSTQVNIKDCTIGT  259

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   +S I++ N+ CGPGHGISIGSLGKS +  QV ++HV   + + T NG RI
Sbjct  260  GDDCISIVGNSSRIKVRNIVCGPGHGISIGSLGKSNSMSQVYNVHVNGASISNTENGVRI  319

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+VR +TFE++ +  V NPIIIDQ YCD    C    S + I ++ +  I GT
Sbjct  320  KTWQGGTGFVRKITFESVWMENVSNPIIIDQYYCDSLLPCSNKTSNIRIDSISFVGIKGT  379

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
            ++ E AI + CS S PC  + +E + +T+
Sbjct  380  SATEKAITVACSDSCPCRKLYLEDVQLTS  408



>ref|XP_004308193.1| PREDICTED: probable polygalacturonase At3g15720-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 167/272 (61%), Gaps = 11/272 (4%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D  +W+ F  V GL + GGG IDGQG  WW ++C        C +  PTA+    C+  
Sbjct  181  RDKDKWVQFDNVQGLIINGGGQIDGQGLVWW-RACS----TTNCKR--PTALHINDCHGL  233

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             LS+I  I S + H  I GCN   VS + + +P DSPNTDGI I  S +++I  S+I  G
Sbjct  234  RLSDITHIDSARNHISISGCNDVEVSGILIRAPADSPNTDGIDISTSTNINIRDSSIGTG  293

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCI+I   TS++ +  V CGPGHGISIGSLG+ G++  VED+ V  CTFNGTTNGARIK
Sbjct  294  DDCIAINSGTSHVNVTGVLCGPGHGISIGSLGEHGSYSMVEDVQVRKCTFNGTTNGARIK  353

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVR----GACKELASGVEISNVVYERI  280
            TW+ G GY R++ FEN+ +  + NPIIIDQ Y DV     G   +  S V++S+V +   
Sbjct  354  TWKGGSGYARDIIFENITIQAIKNPIIIDQEYSDVLYTGFGTLHDQGSAVQVSDVTFRDF  413

Query  279  SGTASRETAINLNCSRSVPCTGIRMESIDITA  184
             G+ S + AI L+C   V C  I M+ ID+T+
Sbjct  414  QGSVSGDVAITLDCDNRVGCKNIVMDHIDLTS  445



>ref|XP_010254484.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=289

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 162/264 (61%), Gaps = 12/264 (5%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +W+AF  VNGL + G G IDG+G  WW   C+            PTA++F +CN   L+ 
Sbjct  3    KWIAFSHVNGLTINGPGQIDGRGSSWWSHECQ-----------RPTALQFNACNGLRLNG  51

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +H ++SP+ H  I  C+   +  + + SP DSPNTDGI I  S H+ I  S IS GDDCI
Sbjct  52   LHHVNSPRNHISIESCSYATLYQLQINSPKDSPNTDGIDISNSTHVRIINSTISTGDDCI  111

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            +I   +S I I+ V CGPGHGISIGSLG+ G++  VE+IHV  C F GT  GARIKTWQ 
Sbjct  112  AINSGSSYINISYVNCGPGHGISIGSLGELGSYATVEEIHVQYCNFFGTETGARIKTWQG  171

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY R + F  + +  VD PIIIDQ YC   G C    S VE+S+V Y  I G++++E 
Sbjct  172  GSGYARRIFFFEITVTEVDIPIIIDQYYCP-SGNCPNKTSAVEVSDVTYNGIRGSSTKED  230

Query  255  AINLNCSRSVPCTGIRMESIDITA  184
             I+L CS +V C  I M  +++T+
Sbjct  231  VISLCCSETVACRNIVMNFVNLTS  254



>ref|XP_009799918.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=451

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 166/274 (61%), Gaps = 2/274 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G +  +WL F  V  L VEGGG ++G G+KWW  SC+   +     + APTAM F  CNN
Sbjct  138  GLNPHKWLYFFKVKYLTVEGGGTVNGMGQKWWSSSCKI--NTTNPCRHAPTAMTFHKCNN  195

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              + +I  ++S Q H  I  C    VS++ V++P  SPNTDGIHI +S H+ I  S+I  
Sbjct  196  LKVRDIRMLNSQQMHISISKCIHVEVSHLIVQAPAKSPNTDGIHISSSIHVGIRDSSIGT  255

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCISI   +S I + N+ CGPGHGISIGSLGKS ++ QV D+ V     + T NG RI
Sbjct  256  GDDCISIVGNSSRILVKNIACGPGHGISIGSLGKSNSWSQVHDVSVDGAYLSNTENGVRI  315

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G G+VR + F NL +  V NPIIIDQ YCD R AC      + I++V +  I G+
Sbjct  316  KTWQGGSGFVRKIAFANLWMENVSNPIIIDQYYCDSRQACPNQTLAISINSVSFVGIRGS  375

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
            ++ + AI   CS S PC  + +E I + +   +P
Sbjct  376  SATKNAITFACSDSSPCRNLYLEDIQLVSFLEFP  409



>gb|KHG01626.1| hypothetical protein F383_22075 [Gossypium arboreum]
Length=401

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 160/267 (60%), Gaps = 2/267 (1%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G+    WLAF  VNGL + G G I+G+G  WW +   Y     G  K  PTA+ F  CN 
Sbjct  105  GYHLDMWLAFTNVNGLTIIGSGTINGRGAIWWSECSSYRVPEGGTCK-GPTALTFYRCNG  163

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              L     I+S + H  IF C     SN+ + +P  SPNTDGI I +S ++ I  S I  
Sbjct  164  LVLKGTKHINSQRNHIAIFNCKDVTFSNLHISAPKTSPNTDGIDIASSSNVRILNSFIGT  223

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   +S+I I  + CGPGHGIS+GSLG  G    VE++HV NCTFN T  G RI
Sbjct  224  GDDCIAISSGSSHINITGIACGPGHGISVGSLGAHGGNDTVEEVHVRNCTFNETMTGVRI  283

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY R + FE ++    DNPIIIDQ YC   G CK   SG++IS+V Y  I+GT
Sbjct  284  KTWQGGVGYARKILFEKIKFIRADNPIIIDQYYCP-GGHCKNETSGIKISDVSYRYITGT  342

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            ++ +  INL+C ++V CT I++  + I
Sbjct  343  STTDKVINLSCDQNVGCTNIQLYYVHI  369



>ref|XP_006838303.1| hypothetical protein AMTR_s00103p00121270 [Amborella trichopoda]
 gb|ERN00872.1| hypothetical protein AMTR_s00103p00121270 [Amborella trichopoda]
Length=463

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 161/271 (59%), Gaps = 2/271 (1%)
 Frame = -2

Query  981  ASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSL  802
            +  WL F  VN L VEGGG I+G G+ WW+ SC+     K C    PTA+ F SC N  +
Sbjct  173  SRHWLLFSHVNNLSVEGGGTINGNGEIWWENSCKIDKS-KPCIS-GPTALTFESCENLIV  230

Query  801  SNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDD  622
              +    S Q H     C     SN+ V++P  SPNTDGIH+  S ++ I  S I  GDD
Sbjct  231  QELRIKDSQQMHLTFQKCVNVMASNLMVQAPEHSPNTDGIHVTGSKNVVIQNSTIGTGDD  290

Query  621  CISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTW  442
            CISI   + NI+  ++ CGPGHGISIGSLG   +   V  I V     +GTTNG RIKTW
Sbjct  291  CISIVSGSQNIKAVDINCGPGHGISIGSLGAGNSEAHVSAITVDRANLHGTTNGLRIKTW  350

Query  441  QTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASR  262
            Q G G  +N+ F+N+ +  V NPIIIDQNYCD +  C E AS V+ISNV+Y  + GT++ 
Sbjct  351  QGGSGNAKNIIFQNVAMHNVSNPIIIDQNYCDSKKPCPEQASAVQISNVIYRNVKGTSAT  410

Query  261  ETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
            + A+  NCSRS PC  I ++ I++  +   P
Sbjct  411  KLAMKFNCSRSYPCERILVQDINLLMESSEP  441



>ref|XP_010254483.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=425

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 163/263 (62%), Gaps = 2/263 (1%)
 Frame = -2

Query  975  QWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSN  796
            +WL+F  VNGL + G G IDGQG  WW QSC  + +L       PTA+ F  CN   +  
Sbjct  136  KWLSFAHVNGLTINGPGYIDGQGSTWWKQSCENN-ELYATKCQRPTALLFNQCNGLRVDG  194

Query  795  IHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCI  616
            +H ++S + H  I  CN   ++ + V +P DSPNTDG+ I  S ++ +  S+   GDDCI
Sbjct  195  LHHVNSAKNHISIHSCNDVTLNQLKVTAPKDSPNTDGVDISNSTYVRVMNSDFETGDDCI  254

Query  615  SIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQT  436
            +I   +S I I  V CGPGHGIS+GSLG SG++  VE++HV +C F GT  GARIKTWQ 
Sbjct  255  AINSGSSFINITYVNCGPGHGISVGSLGVSGSYATVEEVHVEHCNFFGTQAGARIKTWQG  314

Query  435  GRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRET  256
            G GY + ++F  + +  VD+PIIIDQ YC     C+   S VE+S+V Y  I G+++ E 
Sbjct  315  GSGYAKRISFNAITVKEVDHPIIIDQYYCP-HDKCENTTSAVEVSDVTYSGIIGSSTSED  373

Query  255  AINLNCSRSVPCTGIRMESIDIT  187
             I+L CS SV CT I M  ++IT
Sbjct  374  VISLRCSESVACTNIVMNYVNIT  396



>gb|AAX09642.1| polygalacturonase [Malus domestica]
Length=292

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 160/260 (62%), Gaps = 2/260 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D   WL F  V  L V G G I+G G  WW  SC+  P    C   APTA+ F  CNN  
Sbjct  33   DIDHWLIFDNVQNLLVVGPGTINGNGNIWWKNSCKIKPQ-PPCGTYAPTAVTFNRCNNLV  91

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + N++   + Q H +   C     S ++V +P DSPNTDGIH+  + +++I+ S I  GD
Sbjct  92   VKNLNIQDAQQIHVIFQNCINVQASRLTVTAPEDSPNTDGIHVTNTQNITISSSVIGTGD  151

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI   +  ++  ++ CGPGHGISIGSLG+ G+   V  + V     +GT+NG RIKT
Sbjct  152  DCISIVSGSQRVQATDITCGPGHGISIGSLGEDGSEDHVSGVFVNGAKLSGTSNGLRIKT  211

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGA-CKELASGVEISNVVYERISGTA  268
            W+ G G V N+ F+N+Q+  V NPIIIDQNYCD +   CK+  S V++ NV+Y+ I GT+
Sbjct  212  WKGGSGSVTNIVFQNVQMNDVTNPIIIDQNYCDHKTKDCKQQKSAVQVKNVLYQNIRGTS  271

Query  267  SRETAINLNCSRSVPCTGIR  208
            +   AI LNCS+SVPC GI+
Sbjct  272  ASGDAITLNCSQSVPCQGIK  291



>ref|NP_001045783.1| Os02g0130200 [Oryza sativa Japonica Group]
 dbj|BAF07697.1| Os02g0130200 [Oryza sativa Japonica Group]
 dbj|BAG97839.1| unnamed protein product [Oryza sativa Japonica Group]
Length=508

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 160/264 (61%), Gaps = 2/264 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F G+ G +++GGG+IDG G KWW  SC+   D     K APTA+   SC   S+ N+
Sbjct  190  WLLFSGLAGARIQGGGLIDGSGSKWWANSCKI--DRSKPCKGAPTALTIDSCRGVSVRNL  247

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +       +++V V+SP DSPNTDGIH+  S  ++I    I+ GDDCIS
Sbjct  248  RLQNAQQMHLTVSRSRDVRLASVRVDSPEDSPNTDGIHVADSTAVTIQSCRIATGDDCIS  307

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I + +  + + ++ CGPGHGISIGSLG+ G F  V+ + +         NG RIKTWQ G
Sbjct  308  ISNGSFAVRMRDIDCGPGHGISIGSLGQGGAFAAVDGVSLDGARVARAQNGVRIKTWQGG  367

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVRNV F  +++  VD+PI+IDQ YCD    C+   S V +S VV+  I+GTA R  A
Sbjct  368  AGYVRNVRFAGVRVDGVDHPIVIDQFYCDATRPCRNRTSNVRVSGVVFRNITGTARRAEA  427

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I L CS +VPC GI +  ID+  +
Sbjct  428  IRLACSDAVPCVGIVLSDIDLRRE  451



>gb|EAZ39079.1| hypothetical protein OsJ_23511 [Oryza sativa Japonica Group]
Length=393

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 160/248 (65%), Gaps = 2/248 (1%)
 Frame = -2

Query  921  IDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNIHFISSPQTHALIFGCNG  742
            IDG GK WW  SC+ +  L  CT+ APTA+ F SC N  +  +  ++S Q    +  C  
Sbjct  131  IDGNGKIWWQNSCKTNSKLP-CTE-APTALTFYSCKNLKVEYLKVVNSQQIQISVEDCTD  188

Query  741  FNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCISIGDYTSNIEINNVQCGP  562
              VS +S+ +P  +PNTDGIHI  S  + +T   I  GDDC+SI D T N+ + N+ CGP
Sbjct  189  VMVSRLSITAPETAPNTDGIHITRSRDVEVTDCMIKTGDDCMSIEDGTENLHVKNMVCGP  248

Query  561  GHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTGRGYVRNVTFENLQLFLV  382
            GHGISIGSLG   +   V ++ V N    GT NGARIKTWQ G+G  +N+ F+N+ +  V
Sbjct  249  GHGISIGSLGDHNSEAHVNNVTVDNVRLYGTANGARIKTWQGGKGSAKNIVFQNMVMDNV  308

Query  381  DNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETAINLNCSRSVPCTGIRME  202
             NPIIIDQNYCD    CK+  S VE+SNV+++ I GT++ E AI L+CS SVPC GI +E
Sbjct  309  WNPIIIDQNYCDSSTPCKQQKSAVEVSNVLFKNIRGTSASEEAIMLHCSSSVPCHGITLE  368

Query  201  SIDITAQG  178
            ++++T +G
Sbjct  369  NVNLTVKG  376



>ref|XP_003546050.2| PREDICTED: probable polygalacturonase At1g80170-like [Glycine 
max]
Length=412

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 162/268 (60%), Gaps = 1/268 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G   + WL F  VNGL + G G IDG+G  WW Q C  +P   G T   PTA+ F  CN 
Sbjct  115  GFHTNTWLGFSFVNGLAISGKGTIDGRGSAWWQQPCVGNPQ-PGATCRPPTAVTFNRCNR  173

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              L     I+  ++H  +  CN   +SN+ + +PG SPNTDGI I  S  + +  S I+ 
Sbjct  174  LQLKGYTSINPARSHVTLTSCNKGIISNIRLIAPGTSPNTDGIDISGSTGIQVLNSFIAT  233

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   +S I+I  + CGPGHGISIGSLG  G+   VED+HV NCT   T  G RI
Sbjct  234  GDDCIAISAGSSKIKITGITCGPGHGISIGSLGTRGDTDIVEDVHVENCTLTETLTGVRI  293

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY R +TFEN++    ++PIIIDQ YC  R  C+     ++IS+V Y+ I GT
Sbjct  294  KTWQGGAGYARRITFENIRFVRANSPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGT  353

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +  + AINL+C ++V C+ I ++ + IT
Sbjct  354  SLTDKAINLSCDQNVGCSNIVLDHVYIT  381



>gb|ACJ06507.1| polygalacturonase [Diospyros kaki]
Length=441

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 161/270 (60%), Gaps = 2/270 (1%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D + WL F  V  LKV+GGG IDG G  WW+ SC+ +  L    K APTA+ F +C N 
Sbjct  149  EDGTHWLLFDSVQNLKVQGGGTIDGNGNTWWENSCKINKALP--CKDAPTALTFYNCKNI  206

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+    + Q H           S+++V SP  SPNTDGIHI  + ++ I+   I  G
Sbjct  207  IVKNLKIQHAQQIHLSFEKSTNVQASSLTVTSPQTSPNTDGIHITNTQNIQISSCVIGTG  266

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   +  ++  ++ CGPGHGISIGSLG   +   V D+ V      GT NG RIK
Sbjct  267  DDCISIVSGSQKVKATDITCGPGHGISIGSLGSGNSKAFVSDVLVNGAKLYGTQNGVRIK  326

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G G   N+ F N+Q+  VDNPIIIDQNYCD    CKE  S V++ +++Y+ I GT+
Sbjct  327  TWQGGSGIASNIKFLNVQMNNVDNPIIIDQNYCDQDKPCKEQGSSVQVKDMLYQNIQGTS  386

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQG  178
            + + AIN +C +  PC GI ++S++I  +G
Sbjct  387  ASDVAINFSCCKDFPCEGIVLQSVNIRREG  416



>dbj|BAD07736.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=481

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 160/264 (61%), Gaps = 2/264 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F G+ G +++GGG+IDG G KWW  SC+   D     K APTA+   SC   S+ N+
Sbjct  163  WLLFSGLAGARIQGGGLIDGSGSKWWANSCKI--DRSKPCKGAPTALTIDSCRGVSVRNL  220

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +       +++V V+SP DSPNTDGIH+  S  ++I    I+ GDDCIS
Sbjct  221  RLQNAQQMHLTVSRSRDVRLASVRVDSPEDSPNTDGIHVADSTAVTIQSCRIATGDDCIS  280

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I + +  + + ++ CGPGHGISIGSLG+ G F  V+ + +         NG RIKTWQ G
Sbjct  281  ISNGSFAVRMRDIDCGPGHGISIGSLGQGGAFAAVDGVSLDGARVARAQNGVRIKTWQGG  340

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVRNV F  +++  VD+PI+IDQ YCD    C+   S V +S VV+  I+GTA R  A
Sbjct  341  AGYVRNVRFAGVRVDGVDHPIVIDQFYCDATRPCRNRTSNVRVSGVVFRNITGTARRAEA  400

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I L CS +VPC GI +  ID+  +
Sbjct  401  IRLACSDAVPCVGIVLSDIDLRRE  424



>gb|KHN22454.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 163/268 (61%), Gaps = 1/268 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G   + WL F  VNGL + G G IDG+G  WW Q C  +P L G T   PTA+ F  CN 
Sbjct  128  GFHTNTWLGFSFVNGLAISGKGTIDGRGSAWWQQPCVGNP-LPGATCRPPTAVTFNRCNR  186

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              L     I+  ++H  +  CN   +SN+ + +PG SPNTDGI I  S  + +  S I+ 
Sbjct  187  LQLKGYTSINPARSHVTLTSCNKGIISNIRLIAPGTSPNTDGIDISGSTGIQVLNSFIAT  246

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   +S I+I  + CGPGHGISIGSLG  G+   VED+HV NC+   T  G RI
Sbjct  247  GDDCIAISAGSSKIKITGITCGPGHGISIGSLGTRGDTDIVEDVHVENCSLTETLTGVRI  306

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY R +TFEN++    ++PIIIDQ YC  R  C+     ++IS+V Y+ I GT
Sbjct  307  KTWQGGAGYARRITFENIRFVRANSPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGT  366

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +  + AINL+C ++V C+ I ++ + IT
Sbjct  367  SLTDKAINLSCDQNVGCSNIVLDHVYIT  394



>ref|XP_009334648.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=389

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 167/269 (62%), Gaps = 9/269 (3%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
            HD   WL F  VNGLK+E  G+IDG+G  WW Q+  + P  +      PTA+ F +CN  
Sbjct  97   HDVKNWLIFSKVNGLKIERDGVIDGRGGIWWSQA--HKPGER------PTALAFYNCNEL  148

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             LS +  ++SP+ H  I GCNG  +S + + +PG SPNTDGI I  S ++ I   +I  G
Sbjct  149  VLSGLTHVNSPRNHITISGCNGVTISRLQITAPGSSPNTDGIDIGQSRNVQIHDCSIGTG  208

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDC++IG  +S + I+ + CGPGHGISIGSLG+ G    VE ++V +    GTTNG RIK
Sbjct  209  DDCVAIGGGSSYVNISRLLCGPGHGISIGSLGRGGLTDNVEKVYVRDSVLRGTTNGLRIK  268

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACK-ELASGVEISNVVYERISGT  271
            TWQ G GY R ++FE + L  V  PIIIDQ YCD +   + +  S V++S+V + R+ GT
Sbjct  269  TWQGGSGYARKISFEGITLDTVAKPIIIDQFYCDQQPPGQNQSTSAVKVSDVYFSRVHGT  328

Query  270  ASRETAINLNCSRSVPCTGIRMESIDITA  184
             S + A+ L CS+ V CT I +  I+I +
Sbjct  329  TSTDKAVELKCSQIVACTNIVLTDINIVS  357



>gb|EEC72414.1| hypothetical protein OsI_05716 [Oryza sativa Indica Group]
Length=481

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 160/264 (61%), Gaps = 2/264 (1%)
 Frame = -2

Query  972  WLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSSLSNI  793
            WL F G+ G +++GGG+IDG G KWW  SC+   D     K APTA+   SC   S+ N+
Sbjct  163  WLLFSGLAGARIQGGGLIDGSGSKWWANSCKI--DRSKPCKGAPTALTIDSCRGVSVRNL  220

Query  792  HFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGDDCIS  613
               ++ Q H  +       +++V V+SP DSPNTDGIH+  S  ++I    I+ GDDCIS
Sbjct  221  RLQNAQQMHLTVSRSRDVRLASVRVDSPEDSPNTDGIHVADSTAVTIQSCRIATGDDCIS  280

Query  612  IGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKTWQTG  433
            I + +  + + ++ CGPGHGISIGSLG+ G F  V+ + +         NG RIKTWQ G
Sbjct  281  ISNGSFAVRMRDIDCGPGHGISIGSLGQGGAFAAVDGVSLDGARVARAQNGVRIKTWQGG  340

Query  432  RGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTASRETA  253
             GYVRNV F  +++  VD+PI+IDQ YCD    C+   S V +S VV+  I+GTA R  A
Sbjct  341  AGYVRNVRFAGVRVDGVDHPIVIDQFYCDATRPCRNRTSNVRVSGVVFRNITGTARRAEA  400

Query  252  INLNCSRSVPCTGIRMESIDITAQ  181
            I L CS +VPC GI +  ID+  +
Sbjct  401  IRLACSDAVPCVGIVLSDIDLRRE  424



>ref|XP_004241700.1| PREDICTED: probable polygalacturonase At1g80170 [Solanum lycopersicum]
Length=437

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 166/272 (61%), Gaps = 2/272 (1%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            DA +WL F  V  L V+GGG I+G G+KWW  SC+   +     + APTAM F  CNN  
Sbjct  128  DAHKWLYFVKVRHLTVQGGGTINGMGQKWWATSCKI--NTTNPCRHAPTAMSFHKCNNLK  185

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            + +I  ++S Q H  I  C    VS + VE+P  SPNTDGIHI +S  ++I    I  GD
Sbjct  186  VRDIRMLNSQQMHISISNCINVEVSRMIVEAPAKSPNTDGIHITSSIRVAIKDCTIRTGD  245

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCISI + +S+I + N+ CGPGHGISIGSLGKS ++ QV ++ V    F+ T NG RIKT
Sbjct  246  DCISIVNNSSSILVKNIACGPGHGISIGSLGKSNSWSQVHNVCVDGAYFSNTENGVRIKT  305

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTAS  265
            WQ GRGYVR ++F N+ +  V NPIIIDQ YCD    C    SG+ I +V +  I GT++
Sbjct  306  WQGGRGYVRRISFMNVWMENVSNPIIIDQYYCDSPFPCPNQTSGIHIHSVSFIGIRGTSA  365

Query  264  RETAINLNCSRSVPCTGIRMESIDITAQGRWP  169
             + AI   CS S PC  + ++ + + +    P
Sbjct  366  TKNAIKFACSDSSPCKKLFLKDVQLVSYSGLP  397



>ref|XP_007131458.1| hypothetical protein PHAVU_011G015100g [Phaseolus vulgaris]
 gb|ESW03452.1| hypothetical protein PHAVU_011G015100g [Phaseolus vulgaris]
Length=440

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 166/271 (61%), Gaps = 0/271 (0%)
 Frame = -2

Query  987  HDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNS  808
             D   W+ F  V+  +V GGG  +G+GKKWW  SC+   +L       P A+ F  C N 
Sbjct  146  EDRQHWIIFDSVSNFRVGGGGTFNGKGKKWWQNSCKVTTNLPCNDGPRPKAVTFFQCKNL  205

Query  807  SLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCG  628
             + N+ F  + Q H    GC     SN+ + +PGDSPNTDGIH+  + ++ I+ S+I  G
Sbjct  206  EVRNLMFKDAQQMHVTFEGCFNVIASNLVIRAPGDSPNTDGIHVADTQNIVISNSDIGTG  265

Query  627  DDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIK  448
            DDCISI   + N+   ++ CGPGHGISIGSLG   +  +V ++ V   T  GTTNG RIK
Sbjct  266  DDCISIISGSQNVRATDITCGPGHGISIGSLGADNSEAEVSNVVVNRATLKGTTNGVRIK  325

Query  447  TWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGTA  268
            TWQ G GY RN+ F N+ +  V NPIIIDQ YCD   AC+E  S V++SNV+Y+ I GT+
Sbjct  326  TWQGGSGYARNIKFLNIMMQNVTNPIIIDQYYCDQAKACQEQNSAVQLSNVLYQNIRGTS  385

Query  267  SRETAINLNCSRSVPCTGIRMESIDITAQGR  175
            + E AI  +CSR+VPC  I ++ + +  QGR
Sbjct  386  ASEVAIKFDCSRAVPCRQIYLQDVILEPQGR  416



>emb|CDX97704.1| BnaA05g23750D [Brassica napus]
Length=456

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 160/267 (60%), Gaps = 12/267 (4%)
 Frame = -2

Query  984  DASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNNSS  805
            D  QW+ F  + GL VEG G I+GQG  WW+         KG ++  PTA+KF SCNN  
Sbjct  102  DKDQWILFSDIEGLVVEGNGEINGQGSSWWEH--------KGSSR--PTALKFKSCNNLR  151

Query  804  LSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISCGD  625
            LS +  + S   H  I GCN   +SN+ + +P  SPNTDGI +  S ++ I    I+ GD
Sbjct  152  LSGLTHVDSAMAHIHINGCNDVTISNLRINAPESSPNTDGIDVAVSSNVIIQDCVIATGD  211

Query  624  DCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARIKT  445
            DCI+I   T+NI I+ + CGPGHGISIGSLGK G    VED+ V NC F GT NGARIKT
Sbjct  212  DCIAINSGTANIRISGIDCGPGHGISIGSLGKDGEIASVEDVCVQNCNFRGTMNGARIKT  271

Query  444  WQTGRGYVRNVTFENLQLFLVDNPIIIDQNY--CDVRGACKELASGVEISNVVYERISGT  271
            W  G GY R +TF  + L  V+NPIIIDQ+Y   D   +  + +S VE+S VVY    GT
Sbjct  272  WPGGSGYARRITFNGITLDNVENPIIIDQHYNNGDSDKSTDDKSSAVEVSKVVYSNFVGT  331

Query  270  ASRETAINLNCSRSVPCTGIRMESIDI  190
            +  E  +N  CS   PCT I ++ + I
Sbjct  332  SRSEYGVNFRCSTRAPCTEIFLKDVKI  358



>ref|XP_006595163.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=401

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 160/268 (60%), Gaps = 1/268 (0%)
 Frame = -2

Query  990  GHDASQWLAFKGVNGLKVEGGGIIDGQGKKWWDQSCRYHPDLKGCTKLAPTAMKFLSCNN  811
            G   + WL F  VNGL + G G IDG+G  WW Q C  +P L G T   PTA+ F  CN 
Sbjct  104  GFHTNTWLGFSFVNGLAISGKGTIDGRGSAWWQQPCVGNP-LPGATCRPPTAVTFNRCNR  162

Query  810  SSLSNIHFISSPQTHALIFGCNGFNVSNVSVESPGDSPNTDGIHIHASHHLSITYSNISC  631
              L     I+  ++H  +  C    +SN+ + +PG SPNTDGI I  S  + +  S I+ 
Sbjct  163  LQLKGYTSINPARSHMTLTSCKKGIISNIRLIAPGTSPNTDGIDISGSTDIQVLNSFIAT  222

Query  630  GDDCISIGDYTSNIEINNVQCGPGHGISIGSLGKSGNFVQVEDIHVYNCTFNGTTNGARI  451
            GDDCI+I   +S I+I  + CGPGHGISIGSLG  G    VED+HV NCT   T  G RI
Sbjct  223  GDDCIAISAGSSKIKITGITCGPGHGISIGSLGTRGETDIVEDVHVENCTLTETLTGVRI  282

Query  450  KTWQTGRGYVRNVTFENLQLFLVDNPIIIDQNYCDVRGACKELASGVEISNVVYERISGT  271
            KTWQ G GY R +TFE ++    +NPIIIDQ YC  R  C+     ++IS+V Y+ I GT
Sbjct  283  KTWQGGAGYARRITFEKIRFVRANNPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGT  342

Query  270  ASRETAINLNCSRSVPCTGIRMESIDIT  187
            +  + AINL+C ++V C+ I ++ + IT
Sbjct  343  SLTDKAINLSCDQNVGCSNIVLDHVYIT  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2245478025683