BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24457_g2_i2 len=1432 path=[16745:0-523 17269:524-525 13920:526-549
24671:550-552 13947:553-633 24679:634-651 24697:652-657
22406:658-1297 23046:1298-1431]

Length=1432
                                                                      Score     E

ref|XP_009606258.1|  PREDICTED: polygalacturonase QRT2-like             523   8e-180   
ref|XP_009767751.1|  PREDICTED: polygalacturonase QRT2-like             516   2e-177   
ref|XP_006345284.1|  PREDICTED: polygalacturonase QRT2-like             506   7e-173   
ref|XP_004252072.1|  PREDICTED: polygalacturonase QRT2                  501   2e-171   
ref|XP_011078321.1|  PREDICTED: polygalacturonase QRT2-like isofo...    471   9e-160   
gb|EYU23048.1|  hypothetical protein MIMGU_mgv1a026845mg                469   2e-159   
ref|XP_011093565.1|  PREDICTED: probable polygalacturonase At1g80170    460   1e-155   
ref|XP_011078326.1|  PREDICTED: polygalacturonase QRT2-like isofo...    456   1e-154   
ref|XP_010047836.1|  PREDICTED: probable polygalacturonase At1g80170    436   5e-146   
ref|XP_008242767.1|  PREDICTED: probable polygalacturonase At1g80170    431   6e-144   
ref|XP_009368885.1|  PREDICTED: polygalacturonase-like                  413   7e-137   
ref|XP_007203411.1|  hypothetical protein PRUPE_ppa021427mg             409   9e-136   
ref|XP_010241947.1|  PREDICTED: polygalacturonase ADPG1-like            410   7e-135   
ref|XP_004287324.1|  PREDICTED: probable polygalacturonase At1g80...    405   5e-134   
gb|KHG17941.1|  hypothetical protein F383_07844                         404   2e-133   
ref|XP_007013436.1|  F18B13.22 protein isoform 1                        401   2e-132   
ref|XP_006427258.1|  hypothetical protein CICLE_v10026919mg             395   3e-130   
ref|XP_010533164.1|  PREDICTED: probable polygalacturonase At3g15...    394   3e-129   
ref|XP_007023162.1|  JHL06P13.4 protein, putative                       392   1e-128   
ref|XP_010688006.1|  PREDICTED: probable polygalacturonase At1g80170    390   3e-128   
ref|XP_011078329.1|  PREDICTED: polygalacturonase QRT2-like isofo...    384   6e-127   
ref|XP_007013437.1|  F18B13.22 protein isoform 2                        379   2e-124   
ref|XP_010254486.1|  PREDICTED: polygalacturonase ADPG1-like            382   3e-124   
ref|XP_010250371.1|  PREDICTED: probable polygalacturonase At1g80170    372   1e-120   
ref|XP_010250372.1|  PREDICTED: polygalacturonase ADPG1-like            361   1e-115   
ref|XP_010533165.1|  PREDICTED: probable polygalacturonase At3g15...    357   2e-115   
ref|XP_009385170.1|  PREDICTED: polygalacturonase QRT2-like             356   1e-114   
ref|XP_011078328.1|  PREDICTED: polygalacturonase-like isoform X3       353   1e-114   
ref|XP_007013439.1|  F18B13.22 protein isoform 4                        350   9e-114   
ref|XP_006465486.1|  PREDICTED: probable polygalacturonase At3g15...    353   6e-110   
ref|XP_010671219.1|  PREDICTED: probable polygalacturonase At3g15720    345   9e-110   
ref|XP_010254483.1|  PREDICTED: probable polygalacturonase At3g15720    338   1e-107   
gb|EEC81719.1|  hypothetical protein OsI_25337                          338   1e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_011007737.1|  PREDICTED: probable polygalacturonase At1g80170    336   6e-107   
dbj|BAC57279.1|  putative polygalacturonase PG1                         336   9e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009781155.1|  PREDICTED: probable polygalacturonase At1g80170    335   1e-106   
ref|XP_003601689.1|  hypothetical protein MTR_3g084360                  333   3e-106   
ref|XP_006427250.1|  hypothetical protein CICLE_v10027074mg             333   4e-106   
ref|XP_003540568.1|  PREDICTED: probable polygalacturonase At3g15...    333   5e-106   
gb|EMS53068.1|  Polygalacturonase                                       333   8e-106   
ref|XP_010654934.1|  PREDICTED: probable polygalacturonase At3g15720    332   9e-106   
ref|XP_010061913.1|  PREDICTED: probable polygalacturonase At3g15720    332   1e-105   
ref|XP_003545181.1|  PREDICTED: probable polygalacturonase At3g15...    332   1e-105   
gb|KDO45211.1|  hypothetical protein CISIN_1g041224mg                   332   1e-105   
ref|XP_007018009.1|  Pectin lyase-like superfamily protein, putative    332   2e-105   
ref|XP_003607885.1|  hypothetical protein MTR_4g084050                  332   2e-105   
ref|XP_006664897.1|  PREDICTED: polygalacturonase-like                  332   3e-105   
ref|XP_003546050.2|  PREDICTED: probable polygalacturonase At1g80...    332   3e-105   
gb|AES71940.2|  polygalacturonase/glycoside hydrolase family protein    330   4e-105   
gb|KHN44172.1|  Putative polygalacturonase                              331   4e-105   
ref|XP_006845770.1|  hypothetical protein AMTR_s00019p00250890          330   5e-105   
ref|XP_004292991.1|  PREDICTED: probable polygalacturonase At3g15...    332   5e-105   
ref|XP_006595163.1|  PREDICTED: probable polygalacturonase At3g15...    330   6e-105   
gb|KHN22454.1|  Putative polygalacturonase                              331   6e-105   
gb|KDP29312.1|  hypothetical protein JCGZ_19407                         329   1e-104   
ref|XP_009619865.1|  PREDICTED: probable polygalacturonase At3g15720    329   2e-104   
ref|XP_007227584.1|  hypothetical protein PRUPE_ppa015678mg             328   3e-104   
ref|XP_006427249.1|  hypothetical protein CICLE_v10027366mg             329   3e-104   
ref|XP_004489698.1|  PREDICTED: probable polygalacturonase At3g15...    328   4e-104   
ref|XP_004986167.1|  PREDICTED: polygalacturonase-like                  329   4e-104   
ref|XP_008665637.1|  PREDICTED: polygalacturonase ADPG1-like isof...    329   5e-104   
ref|XP_009595646.1|  PREDICTED: probable polygalacturonase At3g15...    328   6e-104   
gb|KHG01626.1|  hypothetical protein F383_22075                         328   6e-104   
ref|XP_006364236.1|  PREDICTED: probable polygalacturonase At3g15...    327   9e-104   
ref|XP_004498018.1|  PREDICTED: probable polygalacturonase At3g15...    327   9e-104   
gb|KEH25592.1|  polygalacturonase                                       327   9e-104   
ref|XP_004498026.1|  PREDICTED: probable polygalacturonase At3g15...    327   1e-103   
ref|XP_004986166.1|  PREDICTED: polygalacturonase-like                  330   1e-103   
ref|XP_010318778.1|  PREDICTED: probable polygalacturonase At3g15720    326   2e-103   
ref|XP_007212964.1|  hypothetical protein PRUPE_ppa021095mg             333   3e-103   
ref|XP_003566989.1|  PREDICTED: polygalacturonase-like                  327   3e-103   
gb|AFK43754.1|  unknown                                                 325   4e-103   
ref|XP_007163810.1|  hypothetical protein PHAVU_001G266200g             325   5e-103   
ref|XP_008665635.1|  PREDICTED: polygalacturonase-like                  326   7e-103   
gb|KCW68966.1|  hypothetical protein EUGRSUZ_F02531                     324   8e-103   
ref|XP_003559272.2|  PREDICTED: polygalacturonase ADPG1-like            325   9e-103   
ref|XP_007150743.1|  hypothetical protein PHAVU_005G177000g             325   1e-102   
ref|XP_002463688.1|  hypothetical protein SORBIDRAFT_01g004230          325   1e-102   Sorghum bicolor [broomcorn]
ref|XP_009355876.1|  PREDICTED: probable polygalacturonase At3g15720    324   1e-102   
ref|XP_004959073.1|  PREDICTED: polygalacturonase-like                  324   2e-102   
ref|XP_003566446.1|  PREDICTED: polygalacturonase-like                  324   3e-102   
ref|XP_004497875.1|  PREDICTED: probable polygalacturonase At3g15...    323   3e-102   
gb|KGN52885.1|  hypothetical protein Csa_4G004940                       323   5e-102   
ref|XP_009802084.1|  PREDICTED: probable polygalacturonase At1g80170    324   6e-102   
ref|XP_004308193.1|  PREDICTED: probable polygalacturonase At3g15...    325   7e-102   
ref|XP_009790843.1|  PREDICTED: probable polygalacturonase At3g15720    322   8e-102   
emb|CBI36303.3|  unnamed protein product                                322   9e-102   
ref|XP_006658431.1|  PREDICTED: polygalacturonase-like                  322   1e-101   
gb|EMS52449.1|  Polygalacturonase                                       322   2e-101   
ref|XP_004486675.1|  PREDICTED: probable polygalacturonase At3g15...    321   3e-101   
gb|KHG17940.1|  hypothetical protein F383_07843                         321   3e-101   
ref|XP_006657550.1|  PREDICTED: polygalacturonase-like                  321   3e-101   
ref|XP_006364199.1|  PREDICTED: probable polygalacturonase At1g80...    322   3e-101   
ref|XP_006465488.1|  PREDICTED: uncharacterized protein LOC102623476    332   5e-101   
ref|XP_010548804.1|  PREDICTED: polygalacturonase QRT2                  321   6e-101   
ref|XP_003597886.1|  Polygalacturonase                                  320   7e-101   
gb|AHG12641.1|  polygalacturonase                                       322   8e-101   
ref|XP_004152352.1|  PREDICTED: probable polygalacturonase At3g15...    320   1e-100   
gb|KDO45212.1|  hypothetical protein CISIN_1g047738mg                   319   1e-100   
ref|XP_008365049.1|  PREDICTED: probable polygalacturonase At1g80170    321   2e-100   
ref|XP_007203070.1|  hypothetical protein PRUPE_ppa023489mg             320   2e-100   
dbj|BAC57273.1|  putative polygalacturonase PG1                         320   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010266762.1|  PREDICTED: probable polygalacturonase At3g15720    320   2e-100   
ref|XP_002324855.2|  hypothetical protein POPTR_0018s01610g             318   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007226190.1|  hypothetical protein PRUPE_ppa015822mg             318   2e-100   
ref|XP_011081272.1|  PREDICTED: probable polygalacturonase At1g80170    320   3e-100   
ref|XP_004156878.1|  PREDICTED: probable polygalacturonase At3g15...    318   3e-100   
ref|XP_010417741.1|  PREDICTED: probable polygalacturonase At1g80170    319   5e-100   
ref|XP_006356262.1|  PREDICTED: probable polygalacturonase At1g80...    319   5e-100   
ref|XP_004241700.1|  PREDICTED: probable polygalacturonase At1g80170    319   5e-100   
gb|KGN52445.1|  hypothetical protein Csa_5G635400                       317   8e-100   
ref|XP_009365411.1|  PREDICTED: probable polygalacturonase At3g15720    323   9e-100   
gb|KCW81411.1|  hypothetical protein EUGRSUZ_C02788                     317   9e-100   
ref|XP_010545769.1|  PREDICTED: probable polygalacturonase At3g15...    319   9e-100   
ref|XP_010557796.1|  PREDICTED: polygalacturonase QRT2-like             319   1e-99    
ref|XP_009594191.1|  PREDICTED: probable polygalacturonase At1g80170    318   1e-99    
ref|XP_008665639.1|  PREDICTED: polygalacturonase ADPG2-like            319   2e-99    
ref|XP_002466242.1|  hypothetical protein SORBIDRAFT_01g004220          318   2e-99    Sorghum bicolor [broomcorn]
gb|EAZ39077.1|  hypothetical protein OsJ_23509                          319   2e-99    Oryza sativa Japonica Group [Japonica rice]
emb|CAN62658.1|  hypothetical protein VITISV_039094                     317   2e-99    Vitis vinifera
ref|XP_009396710.1|  PREDICTED: polygalacturonase ADPG1-like            316   3e-99    
gb|ABK26513.1|  unknown                                                 316   4e-99    Picea sitchensis
gb|KHG04134.1|  hypothetical protein F383_30138                         316   4e-99    
ref|XP_006465356.1|  PREDICTED: probable polygalacturonase At1g80...    317   6e-99    
ref|XP_010051184.1|  PREDICTED: probable polygalacturonase At3g15720    318   8e-99    
ref|XP_010429999.1|  PREDICTED: probable polygalacturonase At1g80170    316   1e-98    
gb|KHG25769.1|  hypothetical protein F383_09976                         315   1e-98    
ref|NP_565232.1|  putative polygalacturonase                            316   1e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KFK42419.1|  hypothetical protein AALP_AA2G253800                    315   1e-98    
ref|XP_006291145.1|  hypothetical protein CARUB_v10017263mg             315   1e-98    
ref|XP_002266543.3|  PREDICTED: probable polygalacturonase At3g15720    313   1e-98    Vitis vinifera
ref|XP_008243707.1|  PREDICTED: probable polygalacturonase At1g80170    316   2e-98    
gb|KHN39536.1|  Putative polygalacturonase                              312   2e-98    
ref|XP_006427234.1|  hypothetical protein CICLE_v10027523mg             315   2e-98    
ref|XP_002466241.1|  hypothetical protein SORBIDRAFT_01g004190          315   2e-98    Sorghum bicolor [broomcorn]
ref|XP_009362523.1|  PREDICTED: probable polygalacturonase At1g80170    316   2e-98    
ref|XP_006377005.1|  glycoside hydrolase family 28 family protein       313   2e-98    
ref|XP_006427256.1|  hypothetical protein CICLE_v10027137mg             313   2e-98    
ref|XP_008337125.1|  PREDICTED: probable polygalacturonase At3g15720    313   2e-98    
ref|XP_004486686.1|  PREDICTED: probable polygalacturonase At1g80...    315   3e-98    
ref|XP_002889308.1|  hypothetical protein ARALYDRAFT_316947             312   3e-98    
ref|XP_007013438.1|  F18B13.22 protein isoform 3                        308   3e-98    
gb|ABD28723.1|  Glycoside hydrolase, family 28                          312   4e-98    Medicago truncatula
ref|XP_004302967.1|  PREDICTED: probable polygalacturonase At1g80...    315   4e-98    
ref|XP_004305760.1|  PREDICTED: probable polygalacturonase At3g15...    312   4e-98    
ref|XP_010654779.1|  PREDICTED: probable polygalacturonase At3g15720    313   5e-98    
ref|XP_010030771.1|  PREDICTED: probable polygalacturonase At1g80170    313   5e-98    
gb|EMS53069.1|  Polygalacturonase                                       313   6e-98    
emb|CBI36307.3|  unnamed protein product                                312   6e-98    
ref|XP_009595648.1|  PREDICTED: probable polygalacturonase At3g15...    311   6e-98    
ref|XP_009338342.1|  PREDICTED: probable polygalacturonase At1g80170    314   8e-98    
ref|XP_003613981.1|  Polygalacturonase                                  311   1e-97    
ref|XP_007216032.1|  hypothetical protein PRUPE_ppa014982mg             313   1e-97    
ref|NP_001275837.1|  polygalacturonase precursor                        313   1e-97    
gb|KDO45233.1|  hypothetical protein CISIN_1g013309mg                   313   1e-97    
ref|XP_009595647.1|  PREDICTED: probable polygalacturonase At3g15...    310   1e-97    
ref|XP_010472976.1|  PREDICTED: probable polygalacturonase At1g80170    313   1e-97    
ref|XP_009362540.1|  PREDICTED: probable polygalacturonase At1g80170    313   2e-97    
gb|KDO61713.1|  hypothetical protein CISIN_1g037736mg                   310   2e-97    
ref|NP_001140231.1|  uncharacterized protein LOC100272271 precursor     313   2e-97    Zea mays [maize]
ref|XP_010088223.1|  Polygalacturonase QRT2                             311   2e-97    
ref|NP_001234256.1|  polygalacturonase                                  313   2e-97    
gb|KCW81410.1|  hypothetical protein EUGRSUZ_C02787                     310   2e-97    
gb|AAU43991.1|  unknown protein                                         311   2e-97    Oryza sativa Japonica Group [Japonica rice]
gb|EMT24271.1|  Polygalacturonase                                       311   2e-97    
ref|XP_009418868.1|  PREDICTED: polygalacturonase ADPG1-like            310   3e-97    
ref|XP_008337027.1|  PREDICTED: probable polygalacturonase At3g15720    310   3e-97    
ref|XP_011072232.1|  PREDICTED: probable polygalacturonase At1g80...    313   3e-97    
gb|KHN45091.1|  Polygalacturonase                                       309   5e-97    
ref|XP_006299494.1|  hypothetical protein CARUB_v10015662mg             311   6e-97    
emb|CBI36306.3|  unnamed protein product                                313   7e-97    
ref|XP_008231375.1|  PREDICTED: probable polygalacturonase At3g15720    311   7e-97    
ref|XP_007207616.1|  hypothetical protein PRUPE_ppa019727mg             309   7e-97    
ref|XP_008243390.1|  PREDICTED: probable polygalacturonase At3g15720    311   9e-97    
ref|XP_009135014.1|  PREDICTED: polygalacturonase QRT2-like isofo...    310   1e-96    
ref|XP_004305261.1|  PREDICTED: probable polygalacturonase At3g15...    309   1e-96    
ref|XP_009799918.1|  PREDICTED: probable polygalacturonase At1g80170    310   1e-96    
gb|EEC79626.1|  hypothetical protein OsI_20838                          310   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010472981.1|  PREDICTED: probable polygalacturonase At3g15...    309   1e-96    
ref|XP_011078892.1|  PREDICTED: polygalacturonase                       311   1e-96    
ref|XP_007023876.1|  Pectin lyase-like superfamily protein              310   2e-96    
ref|XP_006838303.1|  hypothetical protein AMTR_s00103p00121270          311   2e-96    
ref|XP_006655543.1|  PREDICTED: probable polygalacturonase At1g80...    309   2e-96    
ref|XP_006483708.1|  PREDICTED: probable polygalacturonase At3g15...    311   2e-96    
ref|XP_003545985.2|  PREDICTED: polygalacturonase-like                  310   2e-96    
ref|XP_004959739.1|  PREDICTED: polygalacturonase-like                  311   2e-96    
ref|XP_006597127.1|  PREDICTED: probable polygalacturonase At1g80...    309   2e-96    
emb|CDY07963.1|  BnaC03g35600D                                          309   2e-96    
ref|XP_004289976.1|  PREDICTED: polygalacturonase-like                  310   3e-96    
ref|XP_003559271.2|  PREDICTED: polygalacturonase ADPG1-like            308   3e-96    
gb|AAD55472.1|AC009322_12  Similar to polygalacturonases                307   3e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDY39404.1|  BnaAnng05350D                                          308   3e-96    
gb|EMT24270.1|  Polygalacturonase                                       308   3e-96    
ref|XP_008240888.1|  PREDICTED: polygalacturonase                       310   3e-96    
gb|ABR18059.1|  unknown                                                 311   3e-96    Picea sitchensis
emb|CDY69377.1|  BnaCnng63250D                                          308   3e-96    
ref|NP_001056198.1|  Os05g0542800                                       308   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003546932.1|  PREDICTED: probable polygalacturonase At1g80...    309   3e-96    
ref|XP_006450449.1|  hypothetical protein CICLE_v10010440mg             308   4e-96    
gb|KFK38249.1|  hypothetical protein AALP_AA3G088700                    308   5e-96    
ref|XP_004981339.1|  PREDICTED: polygalacturonase-like                  311   6e-96    
ref|XP_011014845.1|  PREDICTED: probable polygalacturonase At1g80...    308   6e-96    
emb|CDY37571.1|  BnaA02g19990D                                          306   6e-96    
ref|XP_006597125.1|  PREDICTED: probable polygalacturonase At1g80...    309   8e-96    
ref|XP_010445667.1|  PREDICTED: probable polygalacturonase At1g80170    307   1e-95    
ref|XP_002313308.2|  hypothetical protein POPTR_0009s06520g             308   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008226204.1|  PREDICTED: probable polygalacturonase At3g15720    315   1e-95    
ref|XP_011001322.1|  PREDICTED: probable polygalacturonase At3g15720    306   1e-95    
ref|XP_007011881.1|  Pectin lyase-like superfamily protein, putative    307   1e-95    
ref|XP_010419394.1|  PREDICTED: probable polygalacturonase At3g15720    306   2e-95    
gb|KHM99207.1|  Polygalacturonase                                       307   2e-95    
emb|CDO98133.1|  unnamed protein product                                308   2e-95    
ref|XP_003537159.2|  PREDICTED: polygalacturonase-like                  307   2e-95    
ref|XP_011099731.1|  PREDICTED: probable polygalacturonase At3g15720    306   2e-95    
ref|XP_008461801.1|  PREDICTED: polygalacturonase-like                  307   2e-95    
ref|XP_010450754.1|  PREDICTED: probable polygalacturonase At1g80170    306   2e-95    
ref|XP_002517618.1|  polygalacturonase, putative                        316   2e-95    Ricinus communis
ref|XP_011035674.1|  PREDICTED: probable polygalacturonase At1g80...    307   2e-95    
emb|CDX74019.1|  BnaA03g30280D                                          306   3e-95    
ref|XP_009420908.1|  PREDICTED: polygalacturonase-like                  305   3e-95    
emb|CDY38648.1|  BnaC02g23310D                                          304   3e-95    
gb|AAD55489.1|AC009322_29  Similar to polygalacturonases                307   3e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KCW81409.1|  hypothetical protein EUGRSUZ_C02785                     305   4e-95    
ref|XP_007148884.1|  hypothetical protein PHAVU_005G022500g             306   4e-95    
ref|XP_002282759.1|  PREDICTED: polygalacturonase                       306   4e-95    Vitis vinifera
ref|XP_010486374.1|  PREDICTED: polygalacturonase QRT2                  306   4e-95    
ref|XP_010254365.1|  PREDICTED: probable polygalacturonase At1g80170    306   4e-95    
ref|XP_004149736.1|  PREDICTED: polygalacturonase-like                  306   6e-95    
emb|CAN64004.1|  hypothetical protein VITISV_043286                     306   6e-95    Vitis vinifera
ref|XP_010435969.1|  PREDICTED: probable polygalacturonase At1g80170    305   7e-95    
gb|KHN22462.1|  Putative polygalacturonase                              310   7e-95    
ref|XP_002299601.2|  hypothetical protein POPTR_0001s17180g             306   7e-95    Populus trichocarpa [western balsam poplar]
gb|KGN58587.1|  hypothetical protein Csa_3G690840                       306   8e-95    
ref|XP_010250040.1|  PREDICTED: probable polygalacturonase At1g80170    306   8e-95    
ref|XP_004504535.1|  PREDICTED: probable polygalacturonase At3g15...    304   9e-95    
gb|KGN53196.1|  hypothetical protein Csa_4G025750                       303   1e-94    
ref|XP_006367078.1|  PREDICTED: probable polygalacturonase At1g80...    303   1e-94    
ref|XP_006407776.1|  hypothetical protein EUTSA_v10020758mg             305   1e-94    
ref|XP_010537985.1|  PREDICTED: probable polygalacturonase At1g80...    305   1e-94    
ref|XP_008385626.1|  PREDICTED: probable polygalacturonase At3g15720    304   1e-94    
ref|XP_004486687.1|  PREDICTED: probable polygalacturonase At1g80...    305   1e-94    
ref|XP_008337131.1|  PREDICTED: probable polygalacturonase At3g15720    304   1e-94    
emb|CDP18643.1|  unnamed protein product                                305   1e-94    
ref|XP_002277214.2|  PREDICTED: polygalacturonase isoform X1            305   2e-94    Vitis vinifera
gb|KDP37111.1|  hypothetical protein JCGZ_06167                         305   2e-94    
gb|ACN40008.1|  unknown                                                 305   2e-94    Picea sitchensis
dbj|BAJ53238.1|  JHL06P13.19                                            305   2e-94    
emb|CDP14857.1|  unnamed protein product                                303   2e-94    
ref|XP_010663872.1|  PREDICTED: probable polygalacturonase At3g15720    303   2e-94    
ref|XP_011024398.1|  PREDICTED: probable polygalacturonase At1g80170    303   2e-94    
dbj|BAC57275.1|  putative polygalacturonase precursor                   303   3e-94    Oryza sativa Japonica Group [Japonica rice]
gb|ABK23977.1|  unknown                                                 304   3e-94    Picea sitchensis
ref|XP_002517603.1|  Polygalacturonase precursor, putative              303   3e-94    Ricinus communis
ref|XP_010921896.1|  PREDICTED: probable polygalacturonase At1g80170    304   4e-94    
ref|XP_004499889.1|  PREDICTED: polygalacturonase QRT2-like             303   4e-94    
ref|XP_009135455.1|  PREDICTED: probable polygalacturonase At3g15720    304   4e-94    
ref|XP_002515526.1|  Polygalacturonase-2 precursor, putative            302   5e-94    Ricinus communis
ref|XP_010937534.1|  PREDICTED: polygalacturonase-like                  310   5e-94    
gb|EAZ03178.1|  hypothetical protein OsI_25331                          303   5e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_009379633.1|  PREDICTED: polygalacturonase                       304   5e-94    
ref|XP_009598055.1|  PREDICTED: probable polygalacturonase At3g15720    303   6e-94    
ref|XP_009355877.1|  PREDICTED: probable polygalacturonase At3g15720    302   7e-94    
ref|XP_007203487.1|  hypothetical protein PRUPE_ppa022427mg             303   7e-94    
ref|XP_009345603.1|  PREDICTED: probable polygalacturonase At3g15720    302   7e-94    
ref|XP_009135015.1|  PREDICTED: polygalacturonase QRT2-like isofo...    303   7e-94    
ref|XP_003601691.1|  Polygalacturonase                                  302   8e-94    
emb|CDY57689.1|  BnaA07g38300D                                          303   9e-94    
ref|XP_008368928.1|  PREDICTED: probable polygalacturonase At3g15720    302   1e-93    
ref|XP_006489947.1|  PREDICTED: polygalacturonase-like                  303   1e-93    
dbj|BAK07253.1|  predicted protein                                      302   1e-93    
ref|XP_004502362.1|  PREDICTED: probable polygalacturonase At3g15...    301   1e-93    
ref|XP_004135935.1|  PREDICTED: polygalacturonase QRT2-like             303   1e-93    
gb|ACF88280.1|  unknown                                                 301   1e-93    Zea mays [maize]
emb|CDY58462.1|  BnaA03g57500D                                          303   1e-93    
ref|XP_009104448.1|  PREDICTED: probable polygalacturonase At1g80170    303   1e-93    
ref|XP_010024123.1|  PREDICTED: polygalacturonase                       301   1e-93    
ref|XP_010464443.1|  PREDICTED: polygalacturonase QRT2-like             302   1e-93    
ref|XP_011025443.1|  PREDICTED: polygalacturonase QRT2-like             303   1e-93    
emb|CDY54312.1|  BnaC06g43100D                                          302   1e-93    
ref|XP_010494537.1|  PREDICTED: probable polygalacturonase At3g15720    300   2e-93    
ref|XP_011014846.1|  PREDICTED: probable polygalacturonase At1g80...    302   2e-93    
ref|XP_002887842.1|  hypothetical protein ARALYDRAFT_477239             302   2e-93    
ref|XP_004961348.1|  PREDICTED: probable polygalacturonase At1g80...    303   2e-93    
emb|CDX75843.1|  BnaC03g39260D                                          302   2e-93    
ref|XP_008454473.1|  PREDICTED: probable polygalacturonase At3g15720    300   2e-93    
ref|XP_006389764.1|  hypothetical protein EUTSA_v10018548mg             302   2e-93    
ref|XP_004231118.1|  PREDICTED: polygalacturonase-like                  301   2e-93    
ref|XP_010051182.1|  PREDICTED: probable polygalacturonase At3g15720    302   2e-93    
ref|XP_010659392.1|  PREDICTED: polygalacturonase-like                  302   2e-93    
gb|KHG21768.1|  hypothetical protein F383_04238                         301   3e-93    
gb|KCW90200.1|  hypothetical protein EUGRSUZ_A02373                     300   3e-93    
ref|XP_004164154.1|  PREDICTED: polygalacturonase-like                  306   4e-93    
gb|KFK35000.1|  hypothetical protein AALP_AA5G221100                    301   4e-93    
ref|XP_009629677.1|  PREDICTED: probable polygalacturonase At1g80170    301   4e-93    
ref|XP_009800089.1|  PREDICTED: polygalacturonase-like                  301   4e-93    
ref|XP_002282772.1|  PREDICTED: polygalacturonase                       301   4e-93    
emb|CBI24904.3|  unnamed protein product                                301   4e-93    
ref|XP_002440167.1|  hypothetical protein SORBIDRAFT_09g027150          300   5e-93    
emb|CDX73440.1|  BnaC08g25630D                                          300   5e-93    
ref|XP_004515677.1|  PREDICTED: probable polygalacturonase At3g15...    299   6e-93    
gb|AAY21049.1|  PGN                                                     299   6e-93    
ref|XP_010102536.1|  hypothetical protein L484_018006                   301   7e-93    
ref|XP_009413595.1|  PREDICTED: polygalacturonase-like                  300   7e-93    
emb|CDY14791.1|  BnaC04g47880D                                          300   7e-93    
gb|ACF80870.1|  unknown                                                 300   7e-93    
ref|XP_009334648.1|  PREDICTED: probable polygalacturonase At3g15720    299   8e-93    
ref|XP_010229442.1|  PREDICTED: polygalacturonase ADPG1-like            299   8e-93    
ref|XP_011035676.1|  PREDICTED: probable polygalacturonase At1g80...    300   8e-93    
ref|XP_007150725.1|  hypothetical protein PHAVU_005G175800g             300   8e-93    
emb|CAD21651.2|  endo polygalacturonase                                 300   8e-93    
ref|XP_006840713.1|  hypothetical protein AMTR_s00096p00099360          300   9e-93    
gb|ACJ06506.1|  polygalacturonase                                       300   1e-92    
gb|KHN43850.1|  Putative polygalacturonase                              299   1e-92    
gb|AFW78960.1|  polygalacturonase                                       301   1e-92    
ref|XP_004502247.1|  PREDICTED: probable polygalacturonase At3g15...    299   1e-92    
ref|XP_009614195.1|  PREDICTED: probable polygalacturonase At3g15720    298   1e-92    
gb|AES71942.2|  polygalacturonase/glycoside hydrolase family protein    298   2e-92    
ref|XP_002517823.1|  Polygalacturonase precursor, putative              300   2e-92    
ref|XP_009392185.1|  PREDICTED: probable polygalacturonase At1g80...    300   2e-92    
ref|XP_007032441.1|  Polygalacturonase-like protein, putative           300   2e-92    
gb|KEH41561.1|  endo polygalacturonase                                  300   2e-92    
ref|XP_009142016.1|  PREDICTED: polygalacturonase ADPG2-like            299   2e-92    
ref|NP_001289214.1|  polygalacturonase precursor                        300   2e-92    
ref|XP_009147011.1|  PREDICTED: polygalacturonase QRT2-like             299   2e-92    
ref|XP_003632658.2|  PREDICTED: polygalacturonase                       299   3e-92    
ref|NP_001151886.1|  polygalacturonase precursor                        298   5e-92    
ref|XP_009139940.1|  PREDICTED: polygalacturonase QRT2                  298   5e-92    
emb|CDY56952.1|  BnaC04g56090D                                          297   7e-92    
emb|CDX72025.1|  BnaC08g28490D                                          298   8e-92    
ref|XP_010667059.1|  PREDICTED: polygalacturonase-like isoform X1       297   8e-92    
ref|XP_002878158.1|  endo-polygalacturonase 1                           297   8e-92    
ref|XP_002308956.2|  hypothetical protein POPTR_0006s05120g             298   9e-92    
ref|XP_007034395.1|  Pectin lyase superfamily protein, putative i...    299   9e-92    
ref|XP_003633562.2|  PREDICTED: polygalacturonase-like isoform X1       298   9e-92    
ref|XP_011072231.1|  PREDICTED: probable polygalacturonase At1g80...    299   1e-91    
ref|XP_007034396.1|  Pectin lyase superfamily protein, putative i...    296   1e-91    
ref|XP_009802467.1|  PREDICTED: polygalacturonase-2-like                298   1e-91    
gb|EYU24653.1|  hypothetical protein MIMGU_mgv1a022836mg                296   1e-91    
ref|XP_007134323.1|  hypothetical protein PHAVU_010G037700g             296   1e-91    
emb|CAA65072.1|  polygalacturonase                                      297   1e-91    
ref|XP_006406925.1|  hypothetical protein EUTSA_v10020740mg             297   2e-91    
ref|XP_010494002.1|  PREDICTED: probable polygalacturonase At3g15720    295   2e-91    
gb|KGN45286.1|  hypothetical protein Csa_7G433170                       296   2e-91    
emb|CBI24903.3|  unnamed protein product                                296   2e-91    
ref|XP_010051183.1|  PREDICTED: probable polygalacturonase At3g15720    295   2e-91    
ref|XP_004172608.1|  PREDICTED: probable polygalacturonase At3g15...    294   2e-91    
ref|XP_010032438.1|  PREDICTED: polygalacturonase                       296   2e-91    
emb|CDY06902.1|  BnaA04g24130D                                          296   2e-91    
ref|XP_003561199.1|  PREDICTED: polygalacturonase ADPG1-like            297   3e-91    
ref|NP_566524.1|  probable polygalacturonase                            297   3e-91    
gb|ACJ06505.1|  polygalacturonase                                       296   3e-91    
ref|XP_011093353.1|  PREDICTED: polygalacturonase QRT2-like             296   3e-91    
ref|XP_009105713.1|  PREDICTED: probable polygalacturonase At1g80170    297   3e-91    
emb|CDX74418.1|  BnaA04g09710D                                          295   3e-91    
emb|CDY47139.1|  BnaA08g05440D                                          297   3e-91    
ref|XP_009765216.1|  PREDICTED: probable polygalacturonase At3g15720    299   3e-91    
ref|XP_010487407.1|  PREDICTED: probable polygalacturonase At3g15...    296   4e-91    
ref|XP_002529616.1|  Polygalacturonase precursor, putative              297   4e-91    
gb|EAZ03180.1|  hypothetical protein OsI_25333                          294   5e-91    
emb|CAN83753.1|  hypothetical protein VITISV_026267                     296   5e-91    
emb|CDY11585.1|  BnaC06g31540D                                          296   5e-91    
ref|XP_010653828.1|  PREDICTED: polygalacturonase isoform X2            295   6e-91    
ref|NP_187454.2|  polygalacturonase QRT2                                295   7e-91    
ref|XP_002277234.1|  PREDICTED: polygalacturonase                       295   8e-91    
gb|EMT22808.1|  Polygalacturonase ADPG1                                 294   8e-91    
gb|AFK47772.1|  unknown                                                 294   1e-90    
gb|EAZ39079.1|  hypothetical protein OsJ_23511                          293   1e-90    
emb|CBI15273.3|  unnamed protein product                                293   1e-90    
ref|XP_003597864.1|  hypothetical protein MTR_2g103410                  295   1e-90    
ref|XP_003618193.1|  Polygalacturonase                                  294   1e-90    
ref|XP_006439105.1|  hypothetical protein CICLE_v10033386mg             294   1e-90    
emb|CDY39399.1|  BnaAnng05300D                                          293   1e-90    
gb|KHN08870.1|  Polygalacturonase                                       293   1e-90    
ref|XP_008787364.1|  PREDICTED: probable polygalacturonase At3g15720    291   1e-90    
ref|XP_006400250.1|  hypothetical protein EUTSA_v10013641mg             294   1e-90    
ref|XP_009101636.1|  PREDICTED: probable polygalacturonase At3g15720    293   1e-90    
ref|XP_002968171.1|  hypothetical protein SELMODRAFT_89085              293   2e-90    
ref|XP_011020366.1|  PREDICTED: polygalacturonase-like                  295   2e-90    
ref|XP_009613568.1|  PREDICTED: polygalacturonase-like                  295   2e-90    
ref|XP_008359552.1|  PREDICTED: polygalacturonase-like                  295   2e-90    
ref|XP_010551910.1|  PREDICTED: polygalacturonase At1g48100 isofo...    295   2e-90    
ref|XP_006483679.1|  PREDICTED: polygalacturonase-like                  294   2e-90    
ref|XP_009801987.1|  PREDICTED: probable polygalacturonase At3g15720    292   2e-90    
ref|XP_011048121.1|  PREDICTED: polygalacturonase                       294   3e-90    
ref|XP_002882564.1|  predicted protein                                  293   4e-90    
ref|XP_003581528.1|  PREDICTED: polygalacturonase-2                     292   4e-90    
ref|XP_010551909.1|  PREDICTED: polygalacturonase At1g48100 isofo...    294   4e-90    
ref|XP_003537285.1|  PREDICTED: polygalacturonase-like                  293   4e-90    
ref|XP_011098761.1|  PREDICTED: polygalacturonase At1g48100             294   4e-90    
ref|NP_001234200.1|  polygalacturonase                                  291   4e-90    
gb|KDP37098.1|  hypothetical protein JCGZ_06154                         296   4e-90    
emb|CAC05657.1|  endopolygalacturonase                                  293   4e-90    
gb|ACJ06507.1|  polygalacturonase                                       293   4e-90    
ref|XP_002885106.1|  glycoside hydrolase family 28 protein              294   4e-90    
emb|CBI36284.3|  unnamed protein product                                293   5e-90    
ref|XP_004502364.1|  PREDICTED: probable polygalacturonase At3g15...    291   5e-90    
ref|NP_191310.1|  polygalacturonase ADPG1                               293   6e-90    
ref|XP_006296610.1|  hypothetical protein CARUB_v10013685mg             293   6e-90    
ref|XP_002970401.1|  hypothetical protein SELMODRAFT_93668              291   6e-90    
ref|XP_009336112.1|  PREDICTED: polygalacturonase-like                  293   7e-90    
dbj|BAD07736.1|  putative polygalacturonase                             294   7e-90    
ref|NP_001045783.1|  Os02g0130200                                       295   7e-90    
sp|P35336.1|PGLR_ACTDE  RecName: Full=Polygalacturonase; Short=PG...    293   7e-90    
ref|XP_008461095.1|  PREDICTED: probable polygalacturonase At1g80...    293   7e-90    
ref|XP_006402870.1|  hypothetical protein EUTSA_v10005982mg             293   8e-90    
ref|XP_007204868.1|  hypothetical protein PRUPE_ppa018519mg             291   8e-90    
gb|AAF21207.1|AC013483_31  putative polygalacturonase                   292   8e-90    
gb|EEC72414.1|  hypothetical protein OsI_05716                          294   9e-90    
ref|XP_010523935.1|  PREDICTED: polygalacturonase ADPG2-like            293   9e-90    
dbj|BAC22688.1|  polygalacturonase                                      293   1e-89    
ref|XP_009146202.1|  PREDICTED: probable polygalacturonase At3g15...    293   1e-89    
ref|XP_006292816.1|  hypothetical protein CARUB_v10019065mg             292   1e-89    
ref|NP_001284447.1|  polygalacturonase QRT2 precursor                   293   1e-89    
gb|EYU22774.1|  hypothetical protein MIMGU_mgv1a006357mg                292   1e-89    
ref|XP_008461096.1|  PREDICTED: probable polygalacturonase At1g80...    292   1e-89    
dbj|BAF32144.1|  pollen allergen                                        291   1e-89    
ref|XP_004500601.1|  PREDICTED: probable polygalacturonase At3g15...    291   1e-89    
ref|XP_009146201.1|  PREDICTED: probable polygalacturonase At3g15...    293   1e-89    
gb|KHM99814.1|  Polygalacturonase                                       291   1e-89    
ref|XP_010495247.1|  PREDICTED: probable polygalacturonase At3g15720    291   2e-89    
gb|AER27666.1|  polygalacturonase                                       292   2e-89    
ref|XP_010465560.1|  PREDICTED: probable polygalacturonase At3g15...    292   2e-89    
ref|XP_008375262.1|  PREDICTED: polygalacturonase-like                  291   2e-89    
ref|XP_008811864.1|  PREDICTED: probable polygalacturonase At1g80170    292   2e-89    
ref|XP_011096240.1|  PREDICTED: probable polygalacturonase At1g80170    292   2e-89    
ref|XP_004502365.1|  PREDICTED: probable polygalacturonase At3g15...    290   2e-89    
emb|CDX85471.1|  BnaA02g03420D                                          290   2e-89    
gb|AAL30418.1|AF434714_1  dehiscence-related endopolygalaturonase       291   2e-89    
ref|XP_002973043.1|  hypothetical protein SELMODRAFT_54363              290   2e-89    
gb|KEH18030.1|  polygalacturonase                                       290   2e-89    
ref|XP_011026643.1|  PREDICTED: probable polygalacturonase At3g15720    291   2e-89    
ref|XP_010453903.1|  PREDICTED: probable polygalacturonase At3g15...    291   3e-89    
ref|XP_010906126.1|  PREDICTED: polygalacturonase-like                  291   3e-89    
emb|CAA54448.1|  polygalacturonase                                      291   3e-89    
ref|XP_009116451.1|  PREDICTED: polygalacturonase ADPG1 isoform X1      291   3e-89    
ref|XP_007151017.1|  hypothetical protein PHAVU_004G011800g             290   3e-89    
emb|CDX69569.1|  BnaA10g19180D                                          291   4e-89    
dbj|BAJ53225.1|  JHL06P13.4                                             288   5e-89    
gb|KDP43482.1|  hypothetical protein JCGZ_16769                         290   7e-89    
ref|XP_007219828.1|  hypothetical protein PRUPE_ppa026655mg             288   7e-89    
gb|KFK44652.1|  hypothetical protein AALP_AA1G286400                    289   7e-89    
emb|CDY02729.1|  BnaC02g07060D                                          290   7e-89    
ref|XP_002281827.2|  PREDICTED: probable polygalacturonase At1g80170    290   8e-89    
ref|XP_009360500.1|  PREDICTED: probable polygalacturonase At3g15720    290   8e-89    
ref|XP_006364702.1|  PREDICTED: probable polygalacturonase At1g80...    291   8e-89    
gb|KEH33932.1|  polygalacturonase/glycoside hydrolase family protein    289   8e-89    
ref|XP_009354806.1|  PREDICTED: polygalacturonase                       289   8e-89    
emb|CDP07789.1|  unnamed protein product                                290   8e-89    
ref|XP_009104062.1|  PREDICTED: polygalacturonase ADPG1                 290   8e-89    
dbj|BAJ89118.1|  predicted protein                                      289   8e-89    
ref|XP_003518118.1|  PREDICTED: polygalacturonase-like                  291   9e-89    
ref|XP_010257197.1|  PREDICTED: polygalacturonase                       290   9e-89    
ref|XP_003605576.1|  hypothetical protein MTR_4g034020                  287   1e-88    
emb|CDY30107.1|  BnaC05g37550D                                          290   1e-88    
sp|P48978.1|PGLR_MALDO  RecName: Full=Polygalacturonase; Short=PG...    290   1e-88    
ref|XP_002309621.2|  hypothetical protein POPTR_0006s26920g             288   1e-88    
ref|XP_010067866.1|  PREDICTED: polygalacturonase-like                  289   1e-88    
ref|XP_004489256.1|  PREDICTED: polygalacturonase At1g48100-like        289   1e-88    
ref|XP_010527121.1|  PREDICTED: probable polygalacturonase At3g15720    288   1e-88    
ref|XP_006399978.1|  hypothetical protein EUTSA_v10013501mg             290   1e-88    
emb|CDY09873.1|  BnaC09g42880D                                          289   2e-88    
ref|XP_002984511.1|  hypothetical protein SELMODRAFT_44337              287   2e-88    
ref|XP_010070078.1|  PREDICTED: polygalacturonase At1g48100-like        290   2e-88    
gb|KHN23520.1|  Polygalacturonase                                       289   2e-88    
ref|XP_009121648.1|  PREDICTED: polygalacturonase At1g48100 isofo...    288   3e-88    
ref|XP_010415730.1|  PREDICTED: probable polygalacturonase At1g80170    290   3e-88    
ref|XP_009126168.1|  PREDICTED: probable polygalacturonase At3g15720    288   3e-88    
ref|NP_001238091.1|  polygalacturonase PG1 precursor                    289   3e-88    
emb|CDX97704.1|  BnaA05g23750D                                          289   3e-88    
ref|XP_002529090.1|  Polygalacturonase precursor, putative              287   3e-88    
ref|XP_010507688.1|  PREDICTED: polygalacturonase ADPG2                 287   3e-88    
ref|XP_010554840.1|  PREDICTED: polygalacturonase ADPG2-like            287   3e-88    
gb|EYU20740.1|  hypothetical protein MIMGU_mgv1a007521mg                287   3e-88    
ref|XP_006303966.1|  hypothetical protein CARUB_v10008847mg             291   3e-88    
gb|KCW66098.1|  hypothetical protein EUGRSUZ_G03373                     286   4e-88    
ref|XP_003595746.1|  Polygalacturonase                                  288   4e-88    
ref|NP_001280857.1|  polygalacturonase precursor                        289   4e-88    
gb|ACU24545.1|  unknown                                                 288   4e-88    
gb|EYU44763.1|  hypothetical protein MIMGU_mgv1a018728mg                288   4e-88    
ref|XP_010659391.1|  PREDICTED: polygalacturonase-like isoform X2       288   5e-88    
ref|NP_196969.1|  pectin lyase-like superfamily protein                 288   5e-88    
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               286   5e-88    
dbj|BAF32143.1|  pollen allergen                                        287   5e-88    
ref|XP_006289862.1|  hypothetical protein CARUB_v10003473mg             287   6e-88    
ref|XP_008349824.1|  PREDICTED: polygalacturonase                       287   6e-88    
ref|XP_009121649.1|  PREDICTED: polygalacturonase At1g48100 isofo...    288   7e-88    
gb|ACR38523.1|  unknown                                                 286   7e-88    
gb|AAA32914.1|  polygalacturonase                                       288   7e-88    
ref|XP_010251216.1|  PREDICTED: probable polygalacturonase At1g80170    288   7e-88    
emb|CDY30105.1|  BnaC05g37570D                                          288   7e-88    
ref|XP_010431134.1|  PREDICTED: probable polygalacturonase At3g15720    285   8e-88    
ref|XP_010471045.1|  PREDICTED: probable polygalacturonase At1g80170    288   9e-88    
ref|XP_006390881.1|  hypothetical protein EUTSA_v10019797mg             288   9e-88    
ref|XP_010424136.1|  PREDICTED: probable polygalacturonase At3g15720    287   9e-88    
ref|XP_010420111.1|  PREDICTED: polygalacturonase At1g48100-like        288   1e-87    
ref|XP_006645549.1|  PREDICTED: polygalacturonase QRT2-like             288   1e-87    
emb|CDY61868.1|  BnaCnng38530D                                          290   1e-87    
ref|XP_006411455.1|  hypothetical protein EUTSA_v10016680mg             287   1e-87    
ref|XP_006418338.1|  hypothetical protein EUTSA_v10007481mg             288   1e-87    
ref|XP_008240992.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    285   1e-87    



>ref|XP_009606258.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
 ref|XP_009606259.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
Length=420

 Score =   523 bits (1346),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 250/415 (60%), Positives = 315/415 (76%), Gaps = 15/415 (4%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSRVS-------CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             Y+M+  V LFILGL ++SR+S         SFNV+DYGA  DG+TDDSQAFLNAW DACS
Sbjct  8     YTMKTLVLLFILGL-TNSRISYASIIGYAGSFNVLDYGAAADGITDDSQAFLNAWNDACS  66

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             S     SP+VIIP    FL+ PV F GPC S++I+F++SG +VAP SP  W G D SQWL
Sbjct  67    S--AGGSPEVIIPPNMIFLLSPVTFRGPCNSENIYFVISGRLVAPSSPGIWTGQDASQWL  124

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
             +F  V GLIV+G G IDGQG+ WWDQSCR HP+MEGCT LAPTA+KF+FC  +++SNI+F
Sbjct  125   AFRNVSGLIVDGSGTIDGQGQGWWDQSCRYHPDMEGCTRLAPTALKFIFCSQSSISNIYF  184

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
              +S Q H+ +  CNGF ++++ ++SPG+SPNTDG+HI +S++V IT+SKIS GDDCISIG
Sbjct  185   GNSAQTHILIERCNGFKVDSVMIESPGNSPNTDGIHIQSSQYVAITNSKISSGDDCISIG  244

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
             D+T++V+I N+QCGPGHGIS+GSLGK GNF QVENIH+SN+ FYGTTNGARIKTWQ GRG
Sbjct  245   DYTSNVQIYNIQCGPGHGISIGSLGKGGNFAQVENIHVSNAFFYGTTNGARIKTWQVGRG  304

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
             Y R++ FENL+  SV NPIIIDQNYC   G CKE  TGVQIS+V++Q I GT++T  AI+
Sbjct  305   YVRDVIFENLEFNSVKNPIIIDQNYCDVRGACKEMVTGVQISNVIYQNIFGTSSTNIAIN  364

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSV-----PVAACCSNAHGEETSVEPGPCLKQ  185
             LNCS +VPC  I +  I +T   P        V A C NA+G+E S+EPGPC+ +
Sbjct  365   LNCSMSVPCTDITMQLIQLTSATPGTATPGREVTAYCRNAYGQEYSIEPGPCISE  419



>ref|XP_009767751.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
 ref|XP_009767752.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
Length=418

 Score =   516 bits (1329),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 247/413 (60%), Positives = 313/413 (76%), Gaps = 13/413 (3%)
 Frame = -1

Query  1393  YSMEVFVFLFILGL----ISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  1232
             Y+M+  V LFILGL    IS + +     SFNV+DYGA  DG+TDDSQAFLNAW DACSS
Sbjct  8     YTMKTLVILFILGLRNSGISYASIIGYAGSFNVLDYGAAADGITDDSQAFLNAWNDACSS  67

Query  1231  TPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLS  1052
                  SP+VIIP    FL+ P+ F GPC S++I+F++SG +VAP SP  W G D SQWL+
Sbjct  68    --AGGSPEVIIPPNMIFLLSPLTFRGPCNSENIYFVISGRLVAPSSPAIWTGEDASQWLA  125

Query  1051  FNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFV  872
             F  V GLIV+G G IDGQG+ WWDQSCR HP+MEGCT LAPTA+KF+FC  +++SNI+F 
Sbjct  126   FRNVSGLIVDGSGTIDGQGQGWWDQSCRYHPDMEGCTRLAPTALKFIFCSQSSISNIYFG  185

Query  871   SSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGD  692
             +S Q H+ +  CNGF ++++ ++SPG+SPNTDG+HI +S++V IT+SKIS GDDCISIGD
Sbjct  186   NSAQTHILIERCNGFKVDSVLIESPGNSPNTDGIHIQSSQYVAITNSKISTGDDCISIGD  245

Query  691   FTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGY  512
             ++++V+I N+QCGPGHGIS+GSLGK GNF QVENIH+SN+ FYGTTNGARIKTWQ GRGY
Sbjct  246   YSSNVQIYNIQCGPGHGISIGSLGKGGNFAQVENIHVSNAFFYGTTNGARIKTWQVGRGY  305

Query  511   ARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISL  332
              R++ FENL+  SV NPIIIDQNYC   G CKE  TGVQIS+V++Q I GT++T+ AI+L
Sbjct  306   VRDVIFENLEFNSVKNPIIIDQNYCDVRGACKEMVTGVQISNVIYQNIFGTSSTDIAINL  365

Query  331   NCSKAVPCLGIKLDSIDITPQIPSV-----PVAACCSNAHGEETSVEPGPCLK  188
             NCS +VPC  I +  I +T   P        V A C NA+G+E S+EPGPC+ 
Sbjct  366   NCSMSVPCTDITMQLIQLTSATPGTTTQGREVTAYCRNAYGQEYSIEPGPCIS  418



>ref|XP_006345284.1| PREDICTED: polygalacturonase QRT2-like [Solanum tuberosum]
Length=439

 Score =   506 bits (1302),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 244/407 (60%), Positives = 312/407 (77%), Gaps = 9/407 (2%)
 Frame = -1

Query  1390  SMEVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  1232
             ++++ V LFIL  +++SR+   S       FNV+DYGA  DG+TDDSQA LN W DACSS
Sbjct  32    ALKILVLLFILIGLTNSRIYSASIFGYPGSFNVLDYGAAADGITDDSQALLNTWNDACSS  91

Query  1231  TPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLS  1052
             +    SPQVIIP    FL+ PV   GPC S++++F++SG++V+P SP  W G D+SQWL+
Sbjct  92    SA--GSPQVIIPPNMIFLLSPVTLTGPCNSENLYFVISGSLVSPSSPSVWTGQDSSQWLA  149

Query  1051  FNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFV  872
             FN V GL+V+G G IDGQGK WWDQSCR HP MEGCT LAPTA+KF+ C  +++SN++F 
Sbjct  150   FNNVSGLVVDGSGTIDGQGKGWWDQSCRYHPEMEGCTRLAPTALKFILCSQSSISNMYFA  209

Query  871   SSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGD  692
             +S Q H+ +  CNGFN+NN+ +QSPG+SPNTDG+HI +S++V IT+SKIS GDDCISIGD
Sbjct  210   NSAQTHILIERCNGFNVNNVMIQSPGNSPNTDGIHIQSSQNVAITNSKISSGDDCISIGD  269

Query  691   FTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGY  512
             ++++++I N+QCGPGHGIS+GSLGK G+  QVENIH++   FYGTTNGARIKTWQ GRGY
Sbjct  270   YSSNIQIYNIQCGPGHGISIGSLGKGGHSAQVENIHVNTVFFYGTTNGARIKTWQVGRGY  329

Query  511   ARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISL  332
              R++TFENLQ  SV NPIIIDQNYC   G CKE GTGVQIS+VV+Q I GT++T  AI+L
Sbjct  330   VRDVTFENLQFNSVKNPIIIDQNYCDVRGACKEMGTGVQISNVVYQNIYGTSSTAIAINL  389

Query  331   NCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             NCSK+VPC  I +  I +TP  P   V A C NA+G+E  +EPGPCL
Sbjct  390   NCSKSVPCTDITMQLIQLTPATPGRQVKAYCRNANGQEYRIEPGPCL  436



>ref|XP_004252072.1| PREDICTED: polygalacturonase QRT2 [Solanum lycopersicum]
Length=416

 Score =   501 bits (1289),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 247/408 (61%), Positives = 311/408 (76%), Gaps = 9/408 (2%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             Y+M+  VFLFIL  +S+SR+   S       FNV+DYGA  DG+TDDSQA LN W DACS
Sbjct  8     YTMKNLVFLFILIGLSNSRIYSASIYGYPGSFNVLDYGAAADGITDDSQALLNTWNDACS  67

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             S+  +  PQVIIP    FL+ P+   GPC SQ+I+F+VSG++V+P SP  W G D+SQWL
Sbjct  68    SSAGY--PQVIIPPNMIFLLSPMTLIGPCNSQNIYFVVSGSLVSPSSPSVWTGQDSSQWL  125

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
             +F  V GL+V G G IDGQGKKWWDQSCR HP ++GCT LAPTA+KF+FC  +++SN++F
Sbjct  126   AFRNVSGLVVGGSGTIDGQGKKWWDQSCRYHPELDGCTKLAPTALKFIFCSQSSISNMYF  185

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
              +S Q H+ +  CNGFN+NN+ +QSPG+SPNTDG+HI AS++V IT+SKIS GDDCISIG
Sbjct  186   ANSAQTHILIERCNGFNVNNVMIQSPGNSPNTDGIHIQASQNVAITNSKISSGDDCISIG  245

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
             D++++V+I N+QCGPGHGIS+GSLGK G+  QV NIH++N  FYGTTNGARIKTWQ GRG
Sbjct  246   DYSSNVQIYNIQCGPGHGISIGSLGKGGHSAQVSNIHVNNVFFYGTTNGARIKTWQVGRG  305

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
             + R++TFENLQ  SV NPIIIDQ+YC   G CKE GTGVQIS+VV+Q I GT+ T+ AI+
Sbjct  306   FVRDVTFENLQFNSVKNPIIIDQHYCDVRGACKETGTGVQISNVVYQNIYGTSITDVAIN  365

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             LNCS +VPC  I +  I +TP  P   V A C NA G+E  +EPGPCL
Sbjct  366   LNCSMSVPCTDITMQLIQLTPATPGKQVKAYCKNASGQEYGIEPGPCL  413



>ref|XP_011078321.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078322.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078324.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078325.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
Length=408

 Score =   471 bits (1212),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 301/401 (75%), Gaps = 4/401 (1%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  1208
             + +F+F     L+++  +   +FNV+DYGA  D +TDDSQAFL AW DACS++   +S +
Sbjct  8     LLIFLFTSATSLLNAHEIDEDNFNVMDYGATSDDLTDDSQAFLEAWDDACSASV--ESSR  65

Query  1207  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  1028
             V +PA  TF+V P+ F+GPC +  I+F +SG ++AP SP  W+G D SQWL F  V GL 
Sbjct  66    VYVPAEKTFVVDPITFHGPCYASTINFAISGRIMAPESPSSWDGGDASQWLGFKNVNGLK  125

Query  1027  VNGGG--VIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             V+G G  +IDGQGK WWDQSCR HP ++ CT LAPTA+KF+ C  +++SN+ F +S Q H
Sbjct  126   VDGFGFGLIDGQGKGWWDQSCRYHPRLKQCTTLAPTALKFVSCNESSVSNMKFTNSAQTH  185

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             + +  CN F+I+N+ ++SPG+SPNTDG+HI +S+HV+IT+S+I+ GDDC+SIGD T+++E
Sbjct  186   ILVRGCNSFSIDNVMIESPGNSPNTDGIHIQSSQHVLITNSRIATGDDCVSIGDHTSNIE  245

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             I NV+CGPGHGIS+GSLG+ GN+VQV+NI ++++ F GTTNGARIKTWQ GRGY R++TF
Sbjct  246   IENVECGPGHGISIGSLGRGGNYVQVQNILVTDAFFNGTTNGARIKTWQVGRGYVRDVTF  305

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
             +NL    V NPIIIDQNYC+    CKEQ TGVQIS+V ++ + GT+TT+ AI++NCS++V
Sbjct  306   QNLLFNHVQNPIIIDQNYCNVRNACKEQETGVQISNVNYKEVLGTSTTDIAININCSRSV  365

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             PC GI ++SI +        V A CSNA+GEE  V PGPCL
Sbjct  366   PCFGISMESIQLLSAEVGKQVTANCSNAYGEEVDVVPGPCL  406



>gb|EYU23048.1| hypothetical protein MIMGU_mgv1a026845mg, partial [Erythranthe 
guttata]
Length=383

 Score =   469 bits (1207),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 284/379 (75%), Gaps = 2/379 (1%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV+DYGA GDG+TDDSQAFL AW+ AC++  + + P++ +P  STFLV P+ F GPC S
Sbjct  6     FNVMDYGATGDGLTDDSQAFLEAWEAACNA--LVEFPKIYVPEESTFLVNPISFYGPCNS  63

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I+F +SGT++AP SP  WNG D SQWL F  V GL ++G GV DG+G+ WWDQSCR H
Sbjct  64    PTINFKISGTIIAPESPDVWNGRDASQWLGFEHVDGLKIDGYGVFDGRGQPWWDQSCRYH  123

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
             P ++ CT  APTA+KF++C  +++ N+  ++S Q H+ +  CN F I NL + SPG+SPN
Sbjct  124   PQLKQCTKTAPTALKFLWCKESSVRNMKLMNSAQTHILVKDCNNFKIENLMINSPGNSPN  183

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI AS  V IT+S+I+CGDDCISIGD+ ++V+I NV CGPGHGIS+GSLGK GN+V
Sbjct  184   TDGIHIQASHSVTITNSQIACGDDCISIGDYISNVQIANVVCGPGHGISIGSLGKGGNYV  243

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             QVENI ++++ F GTTNGARIKTWQ GRGY RN+ FENL+  +V NPIIIDQNYC     
Sbjct  244   QVENIRVTDAFFNGTTNGARIKTWQVGRGYVRNVVFENLKFNNVKNPIIIDQNYCFVRDA  303

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CKE+ TGVQ+S VV++ I+GT+TT+ AI+LNCS AVPC GI + SI+I        V A 
Sbjct  304   CKEEETGVQVSSVVYKEISGTSTTDIAINLNCSNAVPCFGISMQSINIDSAKSGKQVTAH  363

Query  241   CSNAHGEETSVEPGPCLKQ  185
             C+NAHG E  V PGPCL+ 
Sbjct  364   CNNAHGREVGVFPGPCLQH  382



>ref|XP_011093565.1| PREDICTED: probable polygalacturonase At1g80170 [Sesamum indicum]
Length=406

 Score =   460 bits (1184),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/406 (56%), Positives = 292/406 (72%), Gaps = 9/406 (2%)
 Frame = -1

Query  1387  MEVF-VFLFILGLISSSRVSCK------SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  1229
             M+ F V LF+ GL S              FNV+DYGA  DG TDDS+AF+ AW  ACS+ 
Sbjct  1     MDTFGVLLFLYGLASLHLTHSNLCTIEDHFNVMDYGATSDGYTDDSRAFVEAWNAACSAP  60

Query  1228  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSF  1049
               +  P+VI+P   TFLV PV F+GPC +  I+F +SG ++AP SP  W+G D SQWL F
Sbjct  61    TQY--PKVIVPPEKTFLVNPVIFHGPCDASTINFEISGRLMAPKSPSLWDGKDASQWLGF  118

Query  1048  NGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVS  869
               V GL V+G G IDGQGK WWDQSCR HP +  CT LAPTA+KF+ C  +++SN++FV+
Sbjct  119   KDVSGLNVDGFGSIDGQGKAWWDQSCRYHPQLINCTKLAPTALKFISCNGSSVSNLNFVN  178

Query  868   SPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDF  689
             S Q H+ +  CN FNINN+ + SP +SPNTDG+HIH+S+ +VIT+S+I  GDDCISIGD 
Sbjct  179   SSQTHILVTGCNSFNINNVLIDSPQNSPNTDGIHIHSSQQLVITNSRIRSGDDCISIGDH  238

Query  688   TNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYA  509
              ++++I NV+CGPGHGIS+GSLGKS N+V VE IH++N+ F  TTNGARIKTWQ GRGY 
Sbjct  239   NSNIQIANVECGPGHGISIGSLGKSRNYVNVEKIHVTNAFFNRTTNGARIKTWQVGRGYV  298

Query  508   RNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLN  329
             R++ FENL  +SV NPIIIDQNYC     C+EQ TGVQIS+V ++ I GT+TT+ AI+LN
Sbjct  299   RDVVFENLVFYSVKNPIIIDQNYCDVRDACREQVTGVQISNVSYKEIYGTSTTDIAINLN  358

Query  328   CSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             CS++VPC GI ++SI +T       V A C++A+G+E  V P PCL
Sbjct  359   CSRSVPCRGIWMESIQLTSANAGRKVTASCASAYGQEIDVVPYPCL  404



>ref|XP_011078326.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Sesamum indicum]
 ref|XP_011078327.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Sesamum indicum]
Length=376

 Score =   456 bits (1174),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/376 (57%), Positives = 287/376 (76%), Gaps = 4/376 (1%)
 Frame = -1

Query  1312  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  1133
             +DYGA  D +TDDSQAFL AW DACS++   +S +V +PA  TF+V P+ F+GPC +  I
Sbjct  1     MDYGATSDDLTDDSQAFLEAWDDACSASV--ESSRVYVPAEKTFVVDPITFHGPCYASTI  58

Query  1132  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGG--VIDGQGKKWWDQSCRDHP  959
             +F +SG ++AP SP  W+G D SQWL F  V GL V+G G  +IDGQGK WWDQSCR HP
Sbjct  59    NFAISGRIMAPESPSSWDGGDASQWLGFKNVNGLKVDGFGFGLIDGQGKGWWDQSCRYHP  118

Query  958   NMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNT  779
              ++ CT LAPTA+KF+ C  +++SN+ F +S Q H+ +  CN F+I+N+ ++SPG+SPNT
Sbjct  119   RLKQCTTLAPTALKFVSCNESSVSNMKFTNSAQTHILVRGCNSFSIDNVMIESPGNSPNT  178

Query  778   DGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQ  599
             DG+HI +S+HV+IT+S+I+ GDDC+SIGD T+++EI NV+CGPGHGIS+GSLG+ GN+VQ
Sbjct  179   DGIHIQSSQHVLITNSRIATGDDCVSIGDHTSNIEIENVECGPGHGISIGSLGRGGNYVQ  238

Query  598   VENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTC  419
             V+NI ++++ F GTTNGARIKTWQ GRGY R++TF+NL    V NPIIIDQNYC+    C
Sbjct  239   VQNILVTDAFFNGTTNGARIKTWQVGRGYVRDVTFQNLLFNHVQNPIIIDQNYCNVRNAC  298

Query  418   KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACC  239
             KEQ TGVQIS+V ++ + GT+TT+ AI++NCS++VPC GI ++SI +        V A C
Sbjct  299   KEQETGVQISNVNYKEVLGTSTTDIAININCSRSVPCFGISMESIQLLSAEVGKQVTANC  358

Query  238   SNAHGEETSVEPGPCL  191
             SNA+GEE  V PGPCL
Sbjct  359   SNAYGEEVDVVPGPCL  374



>ref|XP_010047836.1| PREDICTED: probable polygalacturonase At1g80170 [Eucalyptus grandis]
Length=406

 Score =   436 bits (1121),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/379 (56%), Positives = 275/379 (73%), Gaps = 3/379 (1%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V DYGA GDG+TDD+ AFL AW+  CS+    ++P +IIP   TFLV  + F+GPC +
Sbjct  29    FSVCDYGAIGDGVTDDTGAFLEAWQATCSTQ--FENPTMIIPDNYTFLVHQLTFSGPCNA  86

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
             Q I F+V G + AP SP  W  LD S W++F+G+  L V+G G IDGQG KWW+QSCR H
Sbjct  87    QKITFLVLGNINAPTSPRAWTDLDPSSWMTFHGIDQLRVSGFGTIDGQGSKWWNQSCRYH  146

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
             P++EGCT LAPTAMKF+ C  ++L+NI  V+SPQ HV +  C  F+I NL +++PG SPN
Sbjct  147   PHLEGCTSLAPTAMKFLSCSASSLNNIKLVNSPQTHVLIRGCRFFDIGNLLIEAPGTSPN  206

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI +S+HV I ++ I  GDDCISIGD+T+++ +++V CGPGHG+S+GSLG+ GNFV
Sbjct  207   TDGIHIQSSQHVSIANAVIGTGDDCISIGDYTSNIYVSSVTCGPGHGVSIGSLGRRGNFV  266

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             QVENIH+SN  F  TTNGARIKTWQ G+GY R ITFE L+  SV NPIIIDQNYCS  G 
Sbjct  267   QVENIHVSNVQFKHTTNGARIKTWQVGKGYVRRITFEYLKFDSVKNPIIIDQNYCSIRGA  326

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CKE  TGV IS+V +  ++GT++T+ AI+LNCS++V C  I L+SI++        V + 
Sbjct  327   CKEMPTGVHISNVAYVGLSGTSSTDVAINLNCSRSVACTRIVLESIELMSANMDRQVTSS  386

Query  241   CSNAHGEETS-VEPGPCLK  188
             C NAHG     V P PCL+
Sbjct  387   CLNAHGNAIGVVRPDPCLQ  405



>ref|XP_008242767.1| PREDICTED: probable polygalacturonase At1g80170 [Prunus mume]
Length=406

 Score =   431 bits (1107),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 287/404 (71%), Gaps = 12/404 (3%)
 Frame = -1

Query  1378  FVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
             F+ LF+  L+S S ++C +       F+V DYGA   G  DDS+AFL AW  AC+S    
Sbjct  7     FLLLFVGPLVSVS-IACSTEHANQTTFDVSDYGAVSGGHIDDSEAFLKAWNAACASET--  63

Query  1219  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  1040
             ++P +I+P    FL+ P+ F+GPC++++I+F++ G ++AP SP  W  LD SQWL+FNGV
Sbjct  64    ENPTLIVPP-KRFLLNPIVFSGPCRAKNINFLIFGRLLAPDSPGAWKELDPSQWLAFNGV  122

Query  1039  YGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
              GL + G G I+G+GK WWDQSCRDHP + GC+ LAPTA+K + C N+++S IHFV+S Q
Sbjct  123   SGLNIAGPGRINGRGKAWWDQSCRDHPRLVGCSTLAPTAVKLVSCKNSSISEIHFVNSSQ  182

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
              HV +  C+G NI N+ +++P  SPNTDG+HI AS +VVIT++ I  GDDC+SIGD T++
Sbjct  183   THVLIRDCDGINIENVLIEAPERSPNTDGIHISASHNVVITNAIIGTGDDCVSIGDHTSN  242

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             + I+ V+CGPGHGIS+GSLG+SGNFVQVENIH+S     GTTNGARIKTWQ GRGY R +
Sbjct  243   IAISYVKCGPGHGISIGSLGRSGNFVQVENIHVSKVYLQGTTNGARIKTWQVGRGYVRRV  302

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
             TFE++   SV NPIIIDQNYC+    CKE  TGV I+DV F ++ GT+++  A++LNCS+
Sbjct  303   TFEHIFFRSVKNPIIIDQNYCNKSDACKEMETGVHITDVSFNQLYGTSSSRVAVNLNCSR  362

Query  319   AVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSV-EPGPCL  191
             +V C  I L SI +   +    V + C+NAHG    V +P PCL
Sbjct  363   SVACTSIYLKSIYLRSALAGQNVTSNCTNAHGVAFGVIQPDPCL  406



>ref|XP_009368885.1| PREDICTED: polygalacturonase-like [Pyrus x bretschneideri]
Length=414

 Score =   413 bits (1061),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 275/389 (71%), Gaps = 5/389 (1%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGA-KGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVK  1172
             S+   +  +F+V D+GA    G  D+S+AFL AW   C+S    +   +I+P    FLV 
Sbjct  28    STEPANLTTFDVRDFGAISAGGNIDNSEAFLLAWNATCNSES--EISTLIVPR-RKFLVN  84

Query  1171  PVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGK  992
             PV F GPCK + I+F++ G ++AP SP  W  LD SQWL+F  V GL V G G I+G+GK
Sbjct  85    PVVFGGPCKPKIINFLILGRLLAPNSPEAWKELDQSQWLAFKRVSGLKVVGPGRINGRGK  144

Query  991   KWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNL  812
              WWDQSCRDHP ++GCT LAPTA+KF+ C N+++S +HFV+S Q HV +  C G +I N+
Sbjct  145   GWWDQSCRDHPGLKGCTVLAPTAVKFVSCNNSSISEVHFVNSSQVHVLIEGCEGIHIENV  204

Query  811   TVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISV  632
              +++P  SPNTDG+HI AS +V +T++ I+ GDDC+SIGD T+++ ++ V+CGPGHGIS+
Sbjct  205   LIEAPERSPNTDGIHISASHYVFVTNAIIATGDDCVSIGDHTSNIVVSYVKCGPGHGISI  264

Query  631   GSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIII  452
             GSLG+SGNFVQVENIH++     GTTNGARIKTWQ G+GY R +TFE++   SV NPIII
Sbjct  265   GSLGRSGNFVQVENIHVTQVYLQGTTNGARIKTWQAGKGYVRRVTFEHMFFRSVKNPIII  324

Query  451   DQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITP  272
             DQNYCS  G CKE  TGV ISDV F  + GT++++ AI+LNCS++V C G+ L SI + P
Sbjct  325   DQNYCSKRGACKELDTGVHISDVSFNNLYGTSSSQVAINLNCSRSVACTGVFLKSIYLRP  384

Query  271   QIPSVPVAACCSNAHGEETSV-EPGPCLK  188
              I    + + C+NAHG    V +P PCL+
Sbjct  385   AIQGQNLTSNCTNAHGIAFGVIQPEPCLQ  413



>ref|XP_007203411.1| hypothetical protein PRUPE_ppa021427mg, partial [Prunus persica]
 gb|EMJ04610.1| hypothetical protein PRUPE_ppa021427mg, partial [Prunus persica]
Length=383

 Score =   409 bits (1050),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 200/388 (52%), Positives = 273/388 (70%), Gaps = 13/388 (3%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  1169
             S+   +  +F+V DYGA   G  DDS+AFL AW  AC+S    ++P +I+P    FL+ P
Sbjct  7     STEHANQTTFDVRDYGAVSGGHIDDSEAFLKAWNAACTSET--ENPTLIVPP-KRFLLNP  63

Query  1168  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKK  989
             + F+GPC+++ I+F++ G ++AP SP  W  LD SQWL+FNGV GL + G G I+G+GK 
Sbjct  64    IVFSGPCRAKSINFLIFGRLLAPDSPGAWKELDPSQWLAFNGVSGLNIAGPGRINGRGKA  123

Query  988   WWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLT  809
             WWDQSCRDHP +         A+K + C N+++S IHF++S Q HV +  C+G NI N+ 
Sbjct  124   WWDQSCRDHPRL---------AVKLVSCKNSSISEIHFLNSSQTHVLIRDCDGINIENVL  174

Query  808   VQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVG  629
             +++P  SPNTDG+HI AS +VVIT++ I  GDDC+SIGD T+++ I+ V+CGPGHGIS+G
Sbjct  175   IEAPERSPNTDGIHISASHNVVITNAIIGTGDDCVSIGDHTSNIVISYVKCGPGHGISIG  234

Query  628   SLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIID  449
             SLG+SGNFVQVENIH+S     GTTNGARIKTWQ GRGY R +TFE++   SV NPIIID
Sbjct  235   SLGRSGNFVQVENIHVSKVYLQGTTNGARIKTWQVGRGYVRRVTFEHIFFGSVKNPIIID  294

Query  448   QNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             QNYC+  G CKE  TGV I+DV F ++ GT+++  A++LNCS++V C  I L SI +   
Sbjct  295   QNYCNKSGACKEMETGVHITDVSFNQLYGTSSSRVAMNLNCSRSVACTSIYLKSIYLRSA  354

Query  268   IPSVPVAACCSNAHGEETSV-EPGPCLK  188
             +    V + C+NAHG  + V +P PCL+
Sbjct  355   LAGQNVTSNCTNAHGVASGVIQPDPCLQ  382



>ref|XP_010241947.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=488

 Score =   410 bits (1054),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 259/372 (70%), Gaps = 18/372 (5%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SFNV+ YGA GDG TDDSQAFL AW   CS++     P +++P G TFLVKP+       
Sbjct  125   SFNVVRYGAVGDGKTDDSQAFLKAWNMMCSASS--GIPTMVVPKGLTFLVKPIM------  176

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
                      GT++AP +   W G+D S W++F  V GL V+G GVIDG+G  WWDQSCR 
Sbjct  177   ---------GTIIAPNTTDTWKGIDQSLWMAFTSVSGLRVSGSGVIDGRGSGWWDQSCRY  227

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
             HP   GCT LAPT MKF+ C    LSN+ F++SPQ HV +  C GF IN + + SPG SP
Sbjct  228   HPG-NGCTKLAPTTMKFLKCNQIHLSNVQFINSPQTHVLVMGCTGFYINGIAINSPGHSP  286

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+HI +++ ++I H+KIS GDDCISIGD+T+++ IN+V CGPGHGIS+GSLGK G+F
Sbjct  287   NTDGIHIQSAQDMLIQHTKISSGDDCISIGDYTSNIVINDVICGPGHGISIGSLGKDGSF  346

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
              +VENIH+ N++F  TTNG RIKTWQTG+GY + I+F+ +   +V+NPIIIDQNYCS  G
Sbjct  347   SKVENIHVRNASFTNTTNGVRIKTWQTGKGYCKKISFKGINFSNVENPIIIDQNYCSVRG  406

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CKE  TG+QISDV +  + GT++TE AI+ NCS + PC GI L SI ++   P   V++
Sbjct  407   ACKELPTGIQISDVQYADMVGTSSTEVAINFNCSSSFPCTGISLKSIKLSSATPGQKVSS  466

Query  244   CCSNAHGEETSV  209
              C++ HG  T +
Sbjct  467   ACNHVHGNVTGL  478



>ref|XP_004287324.1| PREDICTED: probable polygalacturonase At1g80170-like [Fragaria 
vesca subsp. vesca]
Length=408

 Score =   405 bits (1041),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/410 (49%), Positives = 268/410 (65%), Gaps = 13/410 (3%)
 Frame = -1

Query  1387  MEVFVFLFILGLI---------SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             M  ++FL  LG++           +  +  +FNV+DYGA     TD   AF  AW   CS
Sbjct  1     MGSYLFLVFLGIVYVITASSEHEHANTTRATFNVLDYGAVSGRHTDSGMAFWEAWNATCS  60

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             S    ++  +IIP    FL+ P+ F+GPCK Q I  ++ G ++AP SP  W   D  QWL
Sbjct  61    SEA--ENSTLIIPR-MRFLLSPITFDGPCKPQRIKILILGRLLAPESPEAWRDFDPGQWL  117

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
             +F GV GL + G G I+G+G  WW+QSCR HP +EGCT LAPTA+K + C N  L +IHF
Sbjct  118   AFRGVNGLEIAGPGTINGRGSGWWNQSCRYHPKLEGCTTLAPTALKVLSCKNIWLRDIHF  177

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
             ++S Q+H+ +  C+G  I NL +++PG+SPNTDG+HIHAS +V+I ++ I+ GDDCISIG
Sbjct  178   INSSQSHILIEGCDGIKIENLMIEAPGNSPNTDGIHIHASHNVIINNTIIASGDDCISIG  237

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
             D  +++ I+ ++CGPGHGIS+GSLGKSGN VQVEN+H+S  T  GTTNGARIKTWQ G+G
Sbjct  238   DHISNIAISYIKCGPGHGISIGSLGKSGNVVQVENVHVSKVTLQGTTNGARIKTWQVGQG  297

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
               R + FE+  + SV NPIIIDQNYC   G C+E  TGV ISDV F+   GT++T  AI+
Sbjct  298   NVRGVRFEDFFLDSVKNPIIIDQNYCKVRGACEELPTGVHISDVSFKNFYGTSSTNIAIN  357

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPGPCLK  188
             LNCS +VPC  I + SI +   I    V + C NA+G     V P PC +
Sbjct  358   LNCSLSVPCTEILMKSIYLRSAIAGQNVTSSCRNAYGIAFGVVHPSPCFQ  407



>gb|KHG17941.1| hypothetical protein F383_07844 [Gossypium arboreum]
Length=402

 Score =   404 bits (1037),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 271/403 (67%), Gaps = 6/403 (1%)
 Frame = -1

Query  1390  SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             S+ +   + ++ L++ S +S K FNV+ YGA G+G+TDDS AF+ AWKD CS      S 
Sbjct  3     SLSISYAICVVSLLTIS-ISAKEFNVLSYGASGNGITDDSLAFMKAWKDTCSEAA--SSA  59

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  1031
              ++IP G  FLV P+ F GPCKS  I+ ++SGT++AP  P  WN  D S WL+F GV GL
Sbjct  60    SLVIPKGKQFLVHPLIFTGPCKSGTINVMLSGTILAPNGPDQWNASDLSTWLAFEGVNGL  119

Query  1030  IVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHV  851
              ++G G IDG+GK WWD+SCR HP  +GC  LAPTA++F  C N  + N +F +SPQ HV
Sbjct  120   SISGFGTIDGRGKGWWDRSCRYHPG-QGCFTLAPTALRFQNCNNLKMLNTNFHNSPQTHV  178

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
              L  C    +  L +QSPG SPNTDG+HI   ++V I +S+I+ GDDCISIGD T D++I
Sbjct  179   LLLGCQNVELGFLNIQSPGTSPNTDGIHIQFGRNVSIHNSQIADGDDCISIGDKTYDIKI  238

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
             N+++CGPGHG+S+GSLG+ G  VQV NI +   +F+GTTNG RIKTWQTGRG  +N+TF 
Sbjct  239   NDIKCGPGHGVSIGSLGRDGEAVQVNNIKVKRVSFHGTTNGVRIKTWQTGRGLVQNVTFT  298

Query  490   NLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVP  311
             N+   +V+NPIIIDQ YC    +CK   TGV+I DV + ++ GT+ TE AI+LNCS  VP
Sbjct  299   NINFTAVENPIIIDQYYCDKLDSCKPTDTGVRIHDVRYSKLIGTSQTEVAINLNCSNNVP  358

Query  310   CLGIKLDSIDITPQIPSV-PVAACCSNAHGEETS-VEPGPCLK  188
             C GI LD++ +         + + C++A G     +EP  CLK
Sbjct  359   CTGITLDNVRLVSATHQFNQLVSSCNHAFGLNRGIIEPKSCLK  401



>ref|XP_007013436.1| F18B13.22 protein isoform 1 [Theobroma cacao]
 gb|EOY31055.1| F18B13.22 protein isoform 1 [Theobroma cacao]
Length=408

 Score =   401 bits (1031),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/409 (47%), Positives = 274/409 (67%), Gaps = 11/409 (3%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSF-------NVIDYGAKGDGMTDDSQAFLNAWKDACSST  1229
             M++F  + ++  +  S + C +        +V+D+GA G+G  D S+AFL AW   CS  
Sbjct  1     MDIFACIILVLWLFCSNIFCNAVGMKSELVDVLDFGAVGNGKADSSEAFLKAWNFVCSRE  60

Query  1228  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSF  1049
                +S ++I+P   TFL+ PV F+G CK++ I F++ GT+V+P SP  W GLD  +WL+F
Sbjct  61    T--ESVRLIVPGKHTFLLHPVTFSGQCKAREIKFLIHGTIVSPVSPKAWEGLDQGKWLTF  118

Query  1048  NGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNM-EGCTDLAPTAMKFMFCINTTLSNIHFV  872
              GV GL V G G I+G+G  WW+QSCR+HP + EGCT LAPTA+ F  C  ++LS +  +
Sbjct  119   YGVSGLKVKGTGEINGRGWGWWNQSCRNHPGLVEGCTSLAPTAITFQSCKTSSLSELRII  178

Query  871   SSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGD  692
             +S Q HV +   + F + ++ + +P  SPNTDG+HI ++ ++VI +S+I  GDDC+SIGD
Sbjct  179   NSSQTHVLIEGSDHFIVKDVIITAPETSPNTDGIHISSASNIVIRNSRIGTGDDCVSIGD  238

Query  691   FTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGY  512
              T +++I+ V+CGPGHGIS+GSLG++GNFVQV+NI +S   F GT NGARIKTWQ GRGY
Sbjct  239   HTTNIDISRVKCGPGHGISIGSLGRAGNFVQVQNIRVSRVAFKGTANGARIKTWQVGRGY  298

Query  511   ARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISL  332
              R +TFENL   SV NPIIIDQNYC+  G CKE  TGV I DV ++ + GT++T   I++
Sbjct  299   VRGVTFENLFFNSVKNPIIIDQNYCNVRGACKELPTGVHIRDVTYRNLWGTSSTHVGITM  358

Query  331   NCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPGPCLK  188
             NCS++V C G+ L SI +   +    V + C NAHG     V+P PC +
Sbjct  359   NCSQSVSCTGLLLQSIWLKSAMAGKRVISSCINAHGAAIGVVQPAPCFQ  407



>ref|XP_006427258.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
 gb|ESR40498.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
Length=406

 Score =   395 bits (1016),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/407 (49%), Positives = 262/407 (64%), Gaps = 8/407 (2%)
 Frame = -1

Query  1399  CFYS-----MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             CF S     + VF F       +S R++   FNV+D+GA GDG  DDS AF+ AW + CS
Sbjct  1     CFNSKLSGLISVFAFCMSSMCYASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCS  60

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             +T   KSP ++IP G TFLV P+ F GPCKS  I  ++SG+++AP  P  W   D S+W 
Sbjct  61    ATA--KSPTMVIPKGKTFLVHPITFTGPCKSSDITIMLSGSIIAPNGPNEWKEDDKSKWF  118

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
                 V  L ++G G IDG+GK WWD SC+ +   EGC  LAPT +KF  C N  ++N++F
Sbjct  119   DIQSVDSLQIDGSGTIDGRGKAWWDISCKINKK-EGCVKLAPTVLKFDRCNNLRMNNMNF  177

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
             ++SPQ HV +  C G     L++Q+PG SPNTDG+HI AS +V I ++ IS GDDCISIG
Sbjct  178   INSPQTHVTVMGCIGVEFGFLSIQAPGTSPNTDGIHIQASSNVYIHNAHISNGDDCISIG  237

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
             D T+++ I  V CGPGHG+S+GSLGK G  V VENI +SN  F GTTNGARIKTWQ G+G
Sbjct  238   DNTSNINITQVDCGPGHGVSIGSLGKDGGEVHVENITVSNINFKGTTNGARIKTWQVGKG  297

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
               ++I F NL    V+NPIIIDQ+YC    +CKE  TGV I D ++ +  GT+ TE AI+
Sbjct  298   TVKHIVFSNLNFTDVENPIIIDQHYCDVADSCKETDTGVHIDDALYAQSFGTSKTEVAIN  357

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPC  194
             LNCS + PC  I +D+I + P  P   V + C+NA+G+    +   C
Sbjct  358   LNCSSSSPCTNIIVDTIQLKPANPGQRVISSCNNANGQSKGNDQPKC  404



>ref|XP_010533164.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=424

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 272/408 (67%), Gaps = 18/408 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             ++ F+  F+L  I SS  S   F  +V+D+GA GDG T+D+QAFL+AW +AC S     +
Sbjct  15    LQEFLAFFVL-FIGSSHFSSAEFYLDVLDFGAVGDGHTNDTQAFLDAWDEACGSL---GN  70

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P ++IP   TFLV P+ F+GPC+S  I   V GTV+AP SP  W G D  +WL F  V G
Sbjct  71    PIMVIPKYMTFLVHPLVFSGPCRSTSITVAVIGTVIAPDSPAAWKGKDPGKWLEFIDVSG  130

Query  1033  LIVNG--GGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
             L V G   G ++G+G  WW+QSCRDHP ++GCT +APTA+ F  C +++L++I  ++S Q
Sbjct  131   LTVAGLGFGALNGRGLAWWNQSCRDHPRLQGCTSVAPTALTFSGCNSSSLNDIVSLNSSQ  190

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
              H  +       ++N+ +Q+P  SPNTDG+HIH+S  V IT+S  S GDDCISIGD+T++
Sbjct  191   THFLIINSKAITVSNVMMQAPELSPNTDGIHIHSSHDVFITNSVFSTGDDCISIGDYTSN  250

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             V I NV CGPGHGIS+GSLG+ GN VQVENIH+S S   GTTNG RIKTWQ GRGY RN+
Sbjct  251   VVITNVICGPGHGISIGSLGRGGNSVQVENIHVSRSYLKGTTNGLRIKTWQVGRGYVRNV  310

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
              F+++   SV NPIIIDQNYCS  G CKE  TGV I++V + ++ G+++T  AI+ +C +
Sbjct  311   LFQDITFDSVQNPIIIDQNYCSEKGLCKEMPTGVHITNVTYTKMVGSSSTAVAINFDCDR  370

Query  319   AVPCLGIKLDSIDITPQIP---------SVPVAACCSNAHGEETSVEP  203
             +VPC G+ L  I + P +P         +  V   C+NAHG    V+P
Sbjct  371   SVPCTGLNLRYIYLWP-VPTDLDGTSKITPAVTTSCANAHGYAVQVDP  417



>ref|XP_007023162.1| JHL06P13.4 protein, putative [Theobroma cacao]
 gb|EOY25784.1| JHL06P13.4 protein, putative [Theobroma cacao]
Length=413

 Score =   392 bits (1006),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/398 (49%), Positives = 255/398 (64%), Gaps = 3/398 (1%)
 Frame = -1

Query  1381  VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
             V   + I+ +  S+      FNV  YGA G+G+TDDS AF+ AWKD C +      P +I
Sbjct  14    VTCLVSIIAICISANAQQNVFNVQSYGAAGNGITDDSLAFMKAWKDTCGAGT--GIPTMI  71

Query  1201  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  1022
             IP G  FLV P+ F GPCK   I+  +SGT+VAP  P  W   D S WL+F  V GL ++
Sbjct  72    IPKGKIFLVNPITFTGPCKPSIINVKLSGTIVAPNGPDQWKAADLSTWLAFQDVNGLTID  131

Query  1021  GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLF  842
             G G +DG GK WWD+SC+ HP  +GC  LAPT +KF  C N  +SNI F +SPQ HV + 
Sbjct  132   GPGTMDGSGKGWWDRSCKLHPGHQGCIRLAPTVLKFARCNNIHMSNIKFQNSPQTHVLVL  191

Query  841   VCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNV  662
              C   +   LTVQ+PG SPNTDG+HI  S++V I +S+I  GDDCISIGD T+D+ I N+
Sbjct  192   GCQDVDFGFLTVQAPGTSPNTDGIHIQISRNVSIYNSQIGDGDDCISIGDLTSDINITNI  251

Query  661   QCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQ  482
              CGPGHG+S+GSLGK G   QV+NI++    F GTTNG RIKTWQTGRG   +++F N+ 
Sbjct  252   NCGPGHGVSIGSLGKDGGEAQVKNINVRGVNFRGTTNGVRIKTWQTGRGVVESVSFSNIN  311

Query  481   VFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLG  302
               +V+NPIIIDQ YC  P +C E  TGV I+ V++ ++ GT+ T+ AI+LNCS   PC G
Sbjct  312   FTAVENPIIIDQFYCDVPNSCTETNTGVHINGVLYSQLYGTSRTQVAINLNCSDNFPCTG  371

Query  301   IKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
             I L++I +        + + C+NA G     VEP  CL
Sbjct  372   ITLENIQLASATRGGHLVSSCNNAIGVSRGIVEPKSCL  409



>ref|XP_010688006.1| PREDICTED: probable polygalacturonase At1g80170 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   390 bits (1003),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 267/386 (69%), Gaps = 6/386 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S   FNV+D+GA  + + D SQAFL+ W+  C S     +  + +P   TFLV P+ F G
Sbjct  11    SSDHFNVLDHGAISNIINDSSQAFLDVWRLVCDSEV--DNTTLFVPRWRTFLVNPIVFTG  68

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PCK   I+F V G +VAP SP  W   D SQWL+F  V GL V+G GV++GQG  WW+QS
Sbjct  69    PCKPNIINFQVLGEIVAPPSPSAWEKHDPSQWLAFKEVRGLRVSGSGVVNGQGFGWWNQS  128

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+ HP+M GCT LAPTAMKF+ C  TTLS IHF++S Q H+ L  C+ F+I+NL ++SP 
Sbjct  129   CKYHPSMSGCTKLAPTAMKFVKCNETTLSGIHFINSSQTHITLSGCDIFHIDNLLIESPY  188

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG+H+   ++V+IT+  I  GDDCISIGD+T++++I+N+ CGPGHGIS+GSLG+ 
Sbjct  189   NSPNTDGIHLQRVRNVIITNIVIGTGDDCISIGDYTSNIDISNITCGPGHGISIGSLGRG  248

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             GN+VQV NI + N  F GT+NGARIKTWQ GRGY R + FE++   SV NP+IIDQ+Y S
Sbjct  249   GNYVQVNNIAVRNVYFKGTSNGARIKTWQEGRGYVRRVIFEDIFFNSVKNPVIIDQHYGS  308

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSV-  257
               G+  ++  GV ISDV ++   GT+T++ AI+LNCS++  C  + LDSI + P  P + 
Sbjct  309   TNGSQIKENMGVWISDVAYKHFYGTSTSQVAINLNCSESRGCNHVTLDSIILWPA-PQLH  367

Query  256   -PVAACCSNAHGEETS-VEPGPCLKQ  185
               V + CSNAHG     V+P  CL++
Sbjct  368   KQVTSYCSNAHGVTIGVVQPPSCLQE  393



>ref|XP_011078329.1| PREDICTED: polygalacturonase QRT2-like isoform X4 [Sesamum indicum]
Length=322

 Score =   384 bits (986),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 179/309 (58%), Positives = 239/309 (77%), Gaps = 2/309 (1%)
 Frame = -1

Query  1111  VVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGG--VIDGQGKKWWDQSCRDHPNMEGCTD  938
             ++AP SP  W+G D SQWL F  V GL V+G G  +IDGQGK WWDQSCR HP ++ CT 
Sbjct  12    IMAPESPSSWDGGDASQWLGFKNVNGLKVDGFGFGLIDGQGKGWWDQSCRYHPRLKQCTT  71

Query  937   LAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHA  758
             LAPTA+KF+ C  +++SN+ F +S Q H+ +  CN F+I+N+ ++SPG+SPNTDG+HI +
Sbjct  72    LAPTALKFVSCNESSVSNMKFTNSAQTHILVRGCNSFSIDNVMIESPGNSPNTDGIHIQS  131

Query  757   SKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHIS  578
             S+HV+IT+S+I+ GDDC+SIGD T+++EI NV+CGPGHGIS+GSLG+ GN+VQV+NI ++
Sbjct  132   SQHVLITNSRIATGDDCVSIGDHTSNIEIENVECGPGHGISIGSLGRGGNYVQVQNILVT  191

Query  577   NSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGV  398
             ++ F GTTNGARIKTWQ GRGY R++TF+NL    V NPIIIDQNYC+    CKEQ TGV
Sbjct  192   DAFFNGTTNGARIKTWQVGRGYVRDVTFQNLLFNHVQNPIIIDQNYCNVRNACKEQETGV  251

Query  397   QISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEE  218
             QIS+V ++ + GT+TT+ AI++NCS++VPC GI ++SI +        V A CSNA+GEE
Sbjct  252   QISNVNYKEVLGTSTTDIAININCSRSVPCFGISMESIQLLSAEVGKQVTANCSNAYGEE  311

Query  217   TSVEPGPCL  191
               V PGPCL
Sbjct  312   VDVVPGPCL  320



>ref|XP_007013437.1| F18B13.22 protein isoform 2 [Theobroma cacao]
 gb|EOY31056.1| F18B13.22 protein isoform 2 [Theobroma cacao]
Length=374

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 254/378 (67%), Gaps = 12/378 (3%)
 Frame = -1

Query  1318  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  1139
             +V+D+GA G+G  D S+AFL AW   CS     +S ++I+P   TFL+ PV F+G CK++
Sbjct  7     DVLDFGAVGNGKADSSEAFLKAWNFVCSRET--ESVRLIVPGKHTFLLHPVTFSGQCKAR  64

Query  1138  HIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHP  959
              I F++ GT+V+P SP  W GLD  +WL+F GV GL V G G I+G+G  WW+QSCR+HP
Sbjct  65    EIKFLIHGTIVSPVSPKAWEGLDQGKWLTFYGVSGLKVKGTGEINGRGWGWWNQSCRNHP  124

Query  958   NMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNT  779
              +         A+ F  C  ++LS +  ++S Q HV +   + F + ++ + +P  SPNT
Sbjct  125   GL---------AITFQSCKTSSLSELRIINSSQTHVLIEGSDHFIVKDVIITAPETSPNT  175

Query  778   DGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQ  599
             DG+HI ++ ++VI +S+I  GDDC+SIGD T +++I+ V+CGPGHGIS+GSLG++GNFVQ
Sbjct  176   DGIHISSASNIVIRNSRIGTGDDCVSIGDHTTNIDISRVKCGPGHGISIGSLGRAGNFVQ  235

Query  598   VENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTC  419
             V+NI +S   F GT NGARIKTWQ GRGY R +TFENL   SV NPIIIDQNYC+  G C
Sbjct  236   VQNIRVSRVAFKGTANGARIKTWQVGRGYVRGVTFENLFFNSVKNPIIIDQNYCNVRGAC  295

Query  418   KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACC  239
             KE  TGV I DV ++ + GT++T   I++NCS++V C G+ L SI +   +    V + C
Sbjct  296   KELPTGVHIRDVTYRNLWGTSSTHVGITMNCSQSVSCTGLLLQSIWLKSAMAGKRVISSC  355

Query  238   SNAHGEETS-VEPGPCLK  188
              NAHG     V+P PC +
Sbjct  356   INAHGAAIGVVQPAPCFQ  373



>ref|XP_010254486.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=466

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 257/371 (69%), Gaps = 8/371 (2%)
 Frame = -1

Query  1375  VFLFILGLIS-----SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             V LF+LGL S      +     SF+V+DYGA GDG TDDS+AFL AW   CSS      P
Sbjct  14    VLLFVLGLCSMPVCLDAAGDSTSFSVLDYGAAGDGQTDDSKAFLEAWNAMCSSRST-DIP  72

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  1031
              +++P G TFLVKPV F GPC +++++  + G+++AP +   W G+D ++W++FN V GL
Sbjct  73    IMVVPEGKTFLVKPVNFYGPCLAKNVNVQIMGSIIAPNTIKEWEGVD-ARWMAFNNVSGL  131

Query  1030  IVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHV  851
              V+G G IDG+G  WW+ SCRDHP  +GCT LAPT+M+F  C    LSN+ FV+SPQ H+
Sbjct  132   SVSGSGTIDGRGSDWWNNSCRDHPG-KGCTTLAPTSMEFQNCNECHLSNLRFVNSPQVHI  190

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
              ++ CNG  I+ + ++SP +SPNTDG+HI A  ++ I  + I  GDDCISIGDFT+++ +
Sbjct  191   LVYQCNGIYIDGIVIRSPENSPNTDGIHIQAVDNMFIQRADIGAGDDCISIGDFTSNINV  250

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
              ++ CGPGHGIS+GSLG  G   +VENI+++N T   T NG RIKTW+ G+GY R ITFE
Sbjct  251   KDIICGPGHGISIGSLGMGGTSSKVENINVNNVTLTNTMNGVRIKTWEEGQGYCRGITFE  310

Query  490   NLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVP  311
             ++++ +V NPIIIDQ+Y  +   CK+  TG  IS+V F  + GT++T  AI++NCS AVP
Sbjct  311   HIRLTNVQNPIIIDQHYFCWVAGCKDLPTGTHISNVTFSDVMGTSSTPVAINMNCSSAVP  370

Query  310   CLGIKLDSIDI  278
             C  I LDS+ +
Sbjct  371   CSEISLDSVQL  381



>ref|XP_010250371.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=452

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/400 (48%), Positives = 258/400 (65%), Gaps = 14/400 (4%)
 Frame = -1

Query  1378  FVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
              VF  +  ++  S  +  S FNV DYGA GDG TDDSQA L AW   C  TP    P ++
Sbjct  61    LVFTKVWSILVCSNANVISYFNVRDYGAAGDGSTDDSQAVLKAWSAMCK-TPT-GIPTMV  118

Query  1201  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  1022
             +P+G TFLV P+ F+GPC ++ I   + G ++AP     W G D S W+ F  V GL V+
Sbjct  119   VPSGKTFLVNPISFDGPCMAKKISVQIIGNIIAPSKTDAWKGKDQSTWIRFAKVSGLSVS  178

Query  1021  GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLF  842
             G G +DG+G  WWDQSCR H            A++F  C    L NIH ++S Q HV + 
Sbjct  179   GPGTVDGRGSAWWDQSCRYH---------HVQAIRFDSCKGCQLYNIHIINSAQTHVLII  229

Query  841   VCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNV  662
              C+ F+++ + + SP  SPNTDG+HI +S+HV I+ + I+ GDDCIS+GD T+DV I  +
Sbjct  230   GCDWFHLDTIIINSPDFSPNTDGIHIQSSQHVFISRANIASGDDCISVGDHTSDVSIKGI  289

Query  661   QCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQ  482
              CGPGHGIS+GSLG  G++VQVE+I++ ++ F+ TTNG RIKTWQ G+GYA+ ITFEN+ 
Sbjct  290   FCGPGHGISIGSLGNGGSYVQVEDIYVGHAYFFNTTNGVRIKTWQGGKGYAQRITFENIN  349

Query  481   VFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLG  302
               +V+NPIIIDQ YC+ P  CK+  TGV+IS V +  + GT+ +E AI+LNCS    C G
Sbjct  350   FTTVENPIIIDQYYCNIPYGCKDMPTGVKISQVTYNGMIGTSRSEVAINLNCSDRAACTG  409

Query  301   IKLDSIDITPQIPSVPVAACCSNAHGEETS-VEP-GPCLK  188
             I+L+SI +    P   + A C+NA+G+    VEP  PCLK
Sbjct  410   IRLESIKLEAASPGKQLNANCNNAYGKTIGVVEPKAPCLK  449



>ref|XP_010250372.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=494

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/407 (47%), Positives = 251/407 (62%), Gaps = 24/407 (6%)
 Frame = -1

Query  1381  VFVFLFILGLISS--SRV---SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             +F  + +LGL  S  +RV   +   F+V+ YGA GDG  DD+ AF  AW  AC       
Sbjct  55    IFTIIVVLGLACSVTARVMKDAMTVFDVMSYGAIGDGTADDTYAFSKAWTAACGEAS--G  112

Query  1216  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  1037
              P ++IP G TFL+ P+ F GPCKS+ +   + GT+VAP +P  WNG D   WL+F  V+
Sbjct  113   FPVMVIPEGKTFLLMPILFQGPCKSKTVGVKILGTIVAPENPVMWNGKDIDLWLAFKDVH  172

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTA--------------MKFMFCIN  899
             GL ++G G I+G+G  WWDQSCR+ P   GCT  APT                    C  
Sbjct  173   GLWMDGTGWINGRGYNWWDQSCRNKPK-PGCTTQAPTVGTKLHNLYVKHVQMFSIYSCSE  231

Query  898   TTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISC  719
               +SN+ F++SPQ H+++   N  +   L + SP  SPNTDG+HI A+ HV I  + I+ 
Sbjct  232   VFVSNLKFINSPQFHIKVGWSNKIHFTKLLINSPETSPNTDGIHIEATSHVNIHGAVIAA  291

Query  718   GDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARI  539
             GDDCISIG+ T+D+ I+N+ CGPGHGIS+GSLG+ G+ V V++I ++N  F  TTNGARI
Sbjct  292   GDDCISIGNGTSDINISNIICGPGHGISIGSLGRGGSTVTVDHISVTNVKFLRTTNGARI  351

Query  538   KTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGT  359
             KTWQ GRGYA NI FE L+   V NPIIIDQ YC     CK    GVQISD+ ++   GT
Sbjct  352   KTWQGGRGYASNIKFEQLEFTEVQNPIIIDQYYCDK--QCKNVTEGVQISDISYREAFGT  409

Query  358   ATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEE  218
             + T  AISLNC + V C GI +++I IT  IP  PV A CSNA G+ 
Sbjct  410   SKTPIAISLNCDETVGCKGIFMENIKITSAIPGKPVTASCSNAKGKR  456



>ref|XP_010533165.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/408 (48%), Positives = 252/408 (62%), Gaps = 53/408 (13%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             ++ F+  F+L  I SS  S   F  +V+D+GA GDG T+D+QAFL+AW +AC S     +
Sbjct  15    LQEFLAFFVL-FIGSSHFSSAEFYLDVLDFGAVGDGHTNDTQAFLDAWDEACGSL---GN  70

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P ++IP   TFLV P+ F+GPC+S  I   V GTV+AP SP  W G D  +WL F  V G
Sbjct  71    PIMVIPKYMTFLVHPLVFSGPCRSTSITVAVIGTVIAPDSPAAWKGKDPGKWLEFIDVSG  130

Query  1033  LIVN--GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
             L V   G G ++G+G  WW+QSCRDHP ++GCT +APT                      
Sbjct  131   LTVAGLGFGALNGRGLAWWNQSCRDHPRLQGCTSVAPT----------------------  168

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
                      G NI      +P  SPNTDG+HIH+S  V IT+S  S GDDCISIGD+T++
Sbjct  169   ---------GVNI----FGAPELSPNTDGIHIHSSHDVFITNSVFSTGDDCISIGDYTSN  215

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             V I NV CGPGHGIS+GSLG+ GN VQVENIH+S S   GTTNG RIKTWQ GRGY RN+
Sbjct  216   VVITNVICGPGHGISIGSLGRGGNSVQVENIHVSRSYLKGTTNGLRIKTWQVGRGYVRNV  275

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
              F+++   SV NPIIIDQNYCS  G CKE  TGV I++V + ++ G+++T  AI+ +C +
Sbjct  276   LFQDITFDSVQNPIIIDQNYCSEKGLCKEMPTGVHITNVTYTKMVGSSSTAVAINFDCDR  335

Query  319   AVPCLGIKLDSIDITPQIP---------SVPVAACCSNAHGEETSVEP  203
             +VPC G+ L  I + P +P         +  V   C+NAHG    V+P
Sbjct  336   SVPCTGLNLRYIYLWP-VPTDLDGTSKITPAVTTSCANAHGYAVQVDP  382



>ref|XP_009385170.1| PREDICTED: polygalacturonase QRT2-like [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/368 (49%), Positives = 241/368 (65%), Gaps = 5/368 (1%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +F+V DYGA GDG+TDD+QAF +AW+  C        P + IP  + FLV P+ F GPCK
Sbjct  25    AFDVKDYGAAGDGITDDTQAFADAWEATCRK--ATGLPIMFIPGKNKFLVSPIIFKGPCK  82

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIV--NGGGVIDGQGKKWWDQSC  971
             + ++   V GT+VAP SP  WN  D S W+ F  V GL +  +G G+ DG+G  WW QSC
Sbjct  83    ASNVLVQVEGTLVAPDSPSTWNFTDASLWIQFKSVDGLRLTSSGFGLFDGRGSNWWRQSC  142

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             +  P  +GCT LAPTA+KF+ C +  +S++ F++SPQ H+ +   N   + NL + +PG 
Sbjct  143   KLDPR-KGCTSLAPTAVKFVQCNDLAVSSLRFINSPQTHILIIDSNRVYVTNLNITAPGT  201

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+HIHAS+HV I  + I  GDDCISIGD T+D+ +  + CGPGHGISVGSLG+ G
Sbjct  202   SPNTDGIHIHASRHVYIQDTIIGTGDDCISIGDRTSDIVVTRITCGPGHGISVGSLGRGG  261

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
             + V VE I +S   F+ TTNGARIKTWQ   GYA++++FE ++  +V NPIIIDQNY + 
Sbjct  262   SNVSVERIQVSYVNFFNTTNGARIKTWQGATGYAKSMSFEKIKFNNVQNPIIIDQNYGAK  321

Query  430   PGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPV  251
                   Q   VQIS+V +    GTA T+ AI+LNCS+ VPC  I+ D+++I         
Sbjct  322   ANNYTIQQNAVQISNVRYAYCAGTAKTDIAINLNCSQTVPCTDIQFDNVNIPVTSRGGTT  381

Query  250   AACCSNAH  227
              A C+NAH
Sbjct  382   RAYCNNAH  389



>ref|XP_011078328.1| PREDICTED: polygalacturonase-like isoform X3 [Sesamum indicum]
Length=349

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/399 (45%), Positives = 253/399 (63%), Gaps = 59/399 (15%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  1208
             + +F+F     L+++  +   +FNV+DYGA  D +TDDSQAFL AW DACS++   +S +
Sbjct  8     LLIFLFTSATSLLNAHEIDEDNFNVMDYGATSDDLTDDSQAFLEAWDDACSASV--ESSR  65

Query  1207  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  1028
             V +PA  TF+V P+ F+GPC +  I+F    T +AP +            L F       
Sbjct  66    VYVPAEKTFVVDPITFHGPCYASTINFAKQCTTLAPTA------------LKF-------  106

Query  1027  VNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQ  848
                                        C + + + MKF              +S Q H+ 
Sbjct  107   -------------------------VSCNESSVSNMKF-------------TNSAQTHIL  128

Query  847   LFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEIN  668
             +  CN F+I+N+ ++SPG+SPNTDG+HI +S+HV+IT+S+I+ GDDC+SIGD T+++EI 
Sbjct  129   VRGCNSFSIDNVMIESPGNSPNTDGIHIQSSQHVLITNSRIATGDDCVSIGDHTSNIEIE  188

Query  667   NVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFEN  488
             NV+CGPGHGIS+GSLG+ GN+VQV+NI ++++ F GTTNGARIKTWQ GRGY R++TF+N
Sbjct  189   NVECGPGHGISIGSLGRGGNYVQVQNILVTDAFFNGTTNGARIKTWQVGRGYVRDVTFQN  248

Query  487   LQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPC  308
             L    V NPIIIDQNYC+    CKEQ TGVQIS+V ++ + GT+TT+ AI++NCS++VPC
Sbjct  249   LLFNHVQNPIIIDQNYCNVRNACKEQETGVQISNVNYKEVLGTSTTDIAININCSRSVPC  308

Query  307   LGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
              GI ++SI +        V A CSNA+GEE  V PGPCL
Sbjct  309   FGISMESIQLLSAEVGKQVTANCSNAYGEEVDVVPGPCL  347



>ref|XP_007013439.1| F18B13.22 protein isoform 4, partial [Theobroma cacao]
 gb|EOY31058.1| F18B13.22 protein isoform 4, partial [Theobroma cacao]
Length=329

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 229/332 (69%), Gaps = 5/332 (2%)
 Frame = -1

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             L+ PV F+G CK++ I F++ GT+V+P SP  W GLD  +WL+F GV GL V G G I+G
Sbjct  1     LLHPVTFSGQCKAREIKFLIHGTIVSPVSPKAWEGLDQGKWLTFYGVSGLKVKGTGEING  60

Query  1000  QGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNI  821
             +G  WW+QSCR+HP +     LAPTA+ F  C  ++LS +  ++S Q HV +   + F +
Sbjct  61    RGWGWWNQSCRNHPGLA----LAPTAITFQSCKTSSLSELRIINSSQTHVLIEGSDHFIV  116

Query  820   NNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHG  641
              ++ + +P  SPNTDG+HI ++ ++VI +S+I  GDDC+SIGD T +++I+ V+CGPGHG
Sbjct  117   KDVIITAPETSPNTDGIHISSASNIVIRNSRIGTGDDCVSIGDHTTNIDISRVKCGPGHG  176

Query  640   ISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNP  461
             IS+GSLG++GNFVQV+NI +S   F GT NGARIKTWQ GRGY R +TFENL   SV NP
Sbjct  177   ISIGSLGRAGNFVQVQNIRVSRVAFKGTANGARIKTWQVGRGYVRGVTFENLFFNSVKNP  236

Query  460   IIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSID  281
             IIIDQNYC+  G CKE  TGV I DV ++ + GT++T   I++NCS++V C G+ L SI 
Sbjct  237   IIIDQNYCNVRGACKELPTGVHIRDVTYRNLWGTSSTHVGITMNCSQSVSCTGLLLQSIW  296

Query  280   ITPQIPSVPVAACCSNAHGEETS-VEPGPCLK  188
             +   +    V + C NAHG     V+P PC +
Sbjct  297   LKSAMAGKRVISSCINAHGAAIGVVQPAPCFQ  328



>ref|XP_006465486.1| PREDICTED: probable polygalacturonase At3g15720-like [Citrus 
sinensis]
Length=715

 Score =   353 bits (906),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 224/327 (69%), Gaps = 5/327 (2%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSS--RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
              ++   L+ L LIS++  R++   FNV+D+GA GDG  DDS AF+ AW + CS+T   KS
Sbjct  3     QDLSAILYFLCLISTASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCSATA--KS  60

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P ++IP G TFLV+P+ F GPCKS  I  ++SG+++AP  P  W   D S+W    GV  
Sbjct  61    PTMVIPKGKTFLVRPITFAGPCKSSDITIMLSGSIIAPNGPNEWKEDDKSKWFEIQGVDS  120

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             L ++G G IDG+GK WWD SC+ +   EGC  LAPT +KF  C N  ++N++F++SPQ H
Sbjct  121   LQIDGSGTIDGRGKAWWDISCKINKK-EGCIKLAPTVLKFDRCNNLRMNNMNFINSPQTH  179

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             V L  CNG     L++Q+PG SPNTDG+HI AS +V I ++ IS GDDCISIGD T+++ 
Sbjct  180   VTLMGCNGVEFGFLSIQAPGTSPNTDGIHIQASSNVYIHNAHISDGDDCISIGDNTSNIN  239

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             I  V CGPGHG+S+GSLGK G  V VENI +SN  F GTTNGARIKTWQ G+G  ++I F
Sbjct  240   ITQVDCGPGHGVSIGSLGKDGGEVHVENITVSNINFKGTTNGARIKTWQVGKGTVKHIVF  299

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKE  413
              NL    V+NPIIIDQ+YC    +CKE
Sbjct  300   SNLNFTDVENPIIIDQHYCDVADSCKE  326


 Score =   314 bits (805),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 236/404 (58%), Gaps = 19/404 (5%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             F+ + + + +  LG  S S      +NV+++GA G+G+TDDSQAF+ AW   C  T    
Sbjct  330   FFIISLLMRMATLGW-SRSYPGAMPYNVMNFGAVGNGVTDDSQAFIKAWNAVCGDTS--N  386

Query  1216  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  1037
             +P + +P G TFL++P  F GPCKS ++   + G ++AP  P  W G D   WL F  V 
Sbjct  387   NPTLQVPQGKTFLLQPTSFQGPCKSSNLQVQIEGNLIAPEGPSSWKGKDRRSWLYFVNVN  446

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQA  857
             G  VNG G IDGQG +WW + C D             A+ F  C +  +S +  ++S + 
Sbjct  447   GFTVNGNGEIDGQGSQWW-KLCSD-------------ALVFEKCTSFQVSGLKHINSQKN  492

Query  856   HVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDV  677
             H+ L  C    ++NL + +P  SPNTDG+ I AS+++ I +S I+ GDDC++I   ++ +
Sbjct  493   HISLDNCQDATLSNLHISAPESSPNTDGIDISASQNIHILNSNIATGDDCVAINTGSSQI  552

Query  676   EINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNIT  497
              +  + CGPGHGIS+GSLGK G    VE +H+ N T   T NG RIKTWQ G GYAR IT
Sbjct  553   NVTGLTCGPGHGISIGSLGKQGEAAAVEEVHVKNCTLNATQNGLRIKTWQGGSGYARKIT  612

Query  496   FENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKA  317
             F ++ +  VDNPIIIDQ YC +   C  +   V+ISDV +  I+GT+ T+ AI+LNCS+ 
Sbjct  613   FNDITLTDVDNPIIIDQFYCPHE-QCSNETNAVKISDVSYTGIHGTSITQDAIALNCSRT  671

Query  316   VPCLGIKLDSIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCLK  188
             V C  I L+ I IT         + C NAHG+ + SV    CLK
Sbjct  672   VGCDNIVLEHIHITSSNSKEGTYSTCINAHGKCDDSVPSVGCLK  715



>ref|XP_010671219.1| PREDICTED: probable polygalacturonase At3g15720 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   345 bits (886),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 187/418 (45%), Positives = 266/418 (64%), Gaps = 17/418 (4%)
 Frame = -1

Query  1417  IFALYCCFYSMEVFVFLFIL-GLISSS---RVSCK-----SFNVIDYGAKGDGMTDDSQA  1265
             + A +C  Y +  F+  ++  GL++SS   RV  +     +FNV++YGA GDG  DD+ A
Sbjct  62    VEAYWCQDYLLVFFIVAYVANGLLASSHGARVRVQGNDSPTFNVLNYGAIGDGKQDDTLA  121

Query  1264  FLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPG  1085
             F  AW D C+S+  + +P +++P G TFLVK + F GPCKS  IH  V G +VAP S   
Sbjct  122   FSKAWSDVCNSS--NDTPTLVVPLGKTFLVKSILFKGPCKSTRIHVEVQGNIVAPDSIDE  179

Query  1084  WNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQ-SCRDHPNM--EGCTDLAPTAMKF  914
             W    ++ WL F  V  LIV+G GVIDG+G  WW++ S  +H  M  +G +   P A++F
Sbjct  180   WGECQSNTWLQFEYVDNLIVDGQGVIDGRGSIWWNKASIINHDAMINDGTSCDRPVALRF  239

Query  913   MFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITH  734
               C    L  +    SP +H+ L   N   I+N+ + +P DSPNTDG+ I +S ++ I H
Sbjct  240   QSCNGFQLRGLTHKDSPGSHITLSGANNSTISNVNIIAPEDSPNTDGIDISSSTNLQILH  299

Query  733   SKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTT  554
             S I+ GDDCI++G  T+ + I+N+ CGPGHGISVGSLGK G   +VE IH+ N TF  ++
Sbjct  300   STIATGDDCIAMGSHTSQIYISNITCGPGHGISVGSLGKDGAEAKVEEIHVRNCTFINSS  359

Query  553   NGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQ  374
             NGARIKTWQ G GYARNIT++++ +  V+NPIIIDQ YC   G CK Q   V +S+V F 
Sbjct  360   NGARIKTWQGGSGYARNITYDDIILTDVNNPIIIDQYYCF--GQCKIQPLAVAVSNVKFS  417

Query  373   RINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAH-GEETSVEP  203
               +GT++++AAI+LNCS+ VPC  I++  IDI P I ++ + + C +A   E++SV P
Sbjct  418   GFHGTSSSKAAITLNCSQTVPCTNIQMADIDIAPFISTINITSFCESAQVQEDSSVVP  475



>ref|XP_010254483.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=425

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/400 (44%), Positives = 243/400 (61%), Gaps = 6/400 (2%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRVS--CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             F++  +     IL ++SS   +    SF+V++YGA GDG TDDS+AFLNAW+ AC     
Sbjct  25    FFTTLLITLCAILPVLSSRLAAGASNSFDVVNYGAVGDGRTDDSKAFLNAWEAACGDAS-  83

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
               SP +IIPA  TFL+ PV+F GPCKS +++  V G +++P     W+     +WLSF  
Sbjct  84    -GSPTLIIPAMKTFLLHPVEFIGPCKSNNVYVQVLGNIISPSDKSAWSDSTMGKWLSFAH  142

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V GL +NG G IDGQG  WW QSC ++  +       PTA+ F  C    +  +H V+S 
Sbjct  143   VNGLTINGPGYIDGQGSTWWKQSCENN-ELYATKCQRPTALLFNQCNGLRVDGLHHVNSA  201

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             + H+ +  CN   +N L V +P DSPNTDGV I  S +V + +S    GDDCI+I   ++
Sbjct  202   KNHISIHSCNDVTLNQLKVTAPKDSPNTDGVDISNSTYVRVMNSDFETGDDCIAINSGSS  261

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              + I  V CGPGHGISVGSLG SG++  VE +H+ +  F+GT  GARIKTWQ G GYA+ 
Sbjct  262   FINITYVNCGPGHGISVGSLGVSGSYATVEEVHVEHCNFFGTQAGARIKTWQGGSGYAKR  321

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             I+F  + V  VD+PIIIDQ YC +   C+   + V++SDV +  I G++T+E  ISL CS
Sbjct  322   ISFNAITVKEVDHPIIIDQYYCPHD-KCENTTSAVEVSDVTYSGIIGSSTSEDVISLRCS  380

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             ++V C  I ++ ++IT   P     + C NAHG   +  P
Sbjct  381   ESVACTNIVMNYVNITTTAPGKEARSYCLNAHGSSKNTNP  420



>gb|EEC81719.1| hypothetical protein OsI_25337 [Oryza sativa Indica Group]
Length=429

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 239/377 (63%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V  +GA GDG  DD++A   AW  ACSS    +   V++P G  +L K +  +GPCKS
Sbjct  53    FDVRKHGAYGDGQHDDTKALSKAWAVACSSL---QPSIVLVPKGKRYLTKHITLSGPCKS  109

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I F++ GT+VAP +   W+      W+ FNGV GL V+GGG +DG GK WW  SC+ +
Sbjct  110   S-ITFMIEGTLVAPPTRSDWSKETIRHWIMFNGVIGLTVDGGGTVDGNGKIWWQNSCKTN  168

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT+ +PTA+ F  C N  + N+  ++S Q H+ +  C    I+ LT+ +PG SPN
Sbjct  169   AKL-ACTE-SPTALTFYSCSNLKVENLKLLNSQQIHMSVEDCTNVRISGLTITAPGTSPN  226

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK+V +T   I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  
Sbjct  227   TDGIHITRSKNVQVTGCTIKTGDDCMSIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEA  286

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ I     YGTTNGARIKTWQ GRGYA+ I F+N+ + +V NP+IIDQNYC     
Sbjct  287   HVNNVTIGTVRLYGTTNGARIKTWQGGRGYAKYIVFQNMIMENVWNPVIIDQNYCDSATP  346

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK+Q + VQIS+VVF+ I GT+ ++ AI L+CS+ VPC GI L+ + +T +       + 
Sbjct  347   CKKQTSAVQISNVVFKNIRGTSASKEAIKLDCSRNVPCQGITLNDVKLTVKGGGGDAKST  406

Query  241   CSNAHGEET-SVEPGPC  194
             C NA  +++ +V P PC
Sbjct  407   CRNAKWKKSGTVVPQPC  423



>ref|XP_011007737.1| PREDICTED: probable polygalacturonase At1g80170 [Populus euphratica]
Length=406

 Score =   336 bits (861),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 238/380 (63%), Gaps = 10/380 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
              FNVI+YGA G+G+T+DS AFL  W + C++     +  +IIP G TF + P+ FNGPCK
Sbjct  34    EFNVINYGASGNGITNDSLAFLRTWNNTCNAP---GTSTMIIPKGKTFFLNPLTFNGPCK  90

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             +  I  +  G V+AP  P  W   D S WL F  +  L V+G  ++DG+G+ WWD SCR 
Sbjct  91    ANKISVMFYGRVIAPDGPNNWKERDLSTWLRFKDIAWLTVSGSRLLDGRGEGWWDASCRY  150

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
              P  +GC  L PTA++F  C +  + +I+ V+SPQ H+ L+      +  L +QSP  SP
Sbjct  151   RPG-KGCFILMPTAVRFEGCEHLQVDHINIVNSPQFHITLWGSRNAELRFLDIQSPESSP  209

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+HI +S  V +  S I  GDDCISIGD+T+++ I +V CGPGHGIS+GS G+  N 
Sbjct  210   NTDGIHISSSNDVTVHDSIIGSGDDCISIGDYTSNITILDVSCGPGHGISIGSFGRGRNE  269

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
             V+VE I +S + F GTTNGARIKTWQ  RG  R++ F +L    V+NPIIIDQ+Y    G
Sbjct  270   VEVEGIFVSRANFSGTTNGARIKTWQGARGNVRDVHFSDLIFTEVENPIIIDQHY----G  325

Query  424   TCKEQG-TGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               +E+  TGV ISDV + R  GT  T  AI+ NCS +V C  I LD+I +   I    ++
Sbjct  326   DPQEKNQTGVHISDVSYSRAQGTTKTAVAINFNCSSSVACTNIALDNIQLKSSIRGQQLS  385

Query  247   ACCSNAHG-EETSVEPGPCL  191
             + C+NA+G  +  V P  CL
Sbjct  386   SFCNNAYGITKGIVYPKSCL  405



>dbj|BAC57279.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 dbj|BAD30173.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 gb|EEE66781.1| hypothetical protein OsJ_23515 [Oryza sativa Japonica Group]
Length=429

 Score =   336 bits (862),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 237/377 (63%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V  +G+ GDG  DD++A   AW  ACSS    +   V++P G  +L K +  +GPCKS
Sbjct  53    FDVRKHGSYGDGQHDDTKALSKAWAAACSSL---QPSIVLVPKGKRYLTKHITLSGPCKS  109

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I F++ GT+VAP     W+      W+ FNGV GL V GGG +DG GK WW  SC+ +
Sbjct  110   S-ITFMIEGTLVAPPKRSDWSKETIRHWIMFNGVIGLTVAGGGTVDGNGKIWWQNSCKTN  168

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT+ +PTA+ F  C N  + N+  ++S Q H+ +  C    I+ LT+ +PG SPN
Sbjct  169   AKL-ACTE-SPTALTFYSCSNLKVENLKLLNSQQIHMSVEDCTNVRISGLTITAPGTSPN  226

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK+V +T   I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  
Sbjct  227   TDGIHITRSKNVQVTGCTIKTGDDCMSIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEA  286

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ I     YGTTNGARIKTWQ GRGYA+ I F+N+ + +V NP+IIDQNYC     
Sbjct  287   HVNNVTIGTVRLYGTTNGARIKTWQGGRGYAKYIVFQNMIMENVWNPVIIDQNYCDSATP  346

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK+Q + VQIS+VVF+ I GT+ ++ AI L+CS+ VPC GI L+ + +T +       + 
Sbjct  347   CKKQTSAVQISNVVFKNIRGTSASKEAIKLDCSRNVPCQGITLNDVKLTVKGGGGDAKST  406

Query  241   CSNAHGEET-SVEPGPC  194
             C NA  +++ +V P PC
Sbjct  407   CRNAKWKKSGTVVPQPC  423



>ref|XP_009781155.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=391

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 228/368 (62%), Gaps = 61/368 (17%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SFNV+DYGA  D +TD+S+AFLN+W  ACSS                             
Sbjct  85    SFNVLDYGATADRITDNSKAFLNSWNHACSS-----------------------------  115

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
                          + GSP           +S   + GL V+G G IDGQGK+WWDQSCR 
Sbjct  116   -------------SAGSPE----------ISGRLLNGLYVDGLGSIDGQGKEWWDQSCRH  152

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
             HPNM         AMKF+ C  +++SNI+F++S Q H  +  CN F + ++ +QSP  SP
Sbjct  153   HPNM---------AMKFLSCNKSSISNINFINSSQTHTLVRGCNDFMVEHVFIQSPRYSP  203

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             N DG+HI +S+ V IT+S IS G+DCISIGD ++ + I+++ CGPGHGIS+GSLGK GN 
Sbjct  204   NNDGIHIQSSQFVTITNSNISTGNDCISIGDHSSYINISDIHCGPGHGISIGSLGKGGNL  263

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
              QVENI++SNS F GTTNGARIKTWQ G GY R++ FENL+  SVDNPIIIDQNYC   G
Sbjct  264   TQVENINVSNSFFSGTTNGARIKTWQVGTGYVRDVRFENLEFNSVDNPIIIDQNYCDVRG  323

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CKE   GV IS+VV++ + GT++T+ AI+LNCS +VPC  I L  I +T       V A
Sbjct  324   ACKEMPIGVHISNVVYENMKGTSSTDIAINLNCSNSVPCTDITLQQIRLTSATLGGKVTA  383

Query  244   CCSNAHGE  221
              C NAHG+
Sbjct  384   YCKNAHGQ  391



>ref|XP_003601689.1| hypothetical protein MTR_3g084360 [Medicago truncatula]
Length=400

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 177/412 (43%), Positives = 250/412 (61%), Gaps = 17/412 (4%)
 Frame = -1

Query  1414  FALYCCFYSMEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  1238
               L    Y M +FV  +    L++   ++ KSFNV++YGAKGD  TDDS AFL AW++ C
Sbjct  1     MKLLFVLYLMSLFVSPISCFRLVNRKPLAQKSFNVVNYGAKGDSNTDDSNAFLKAWQEVC  60

Query  1237  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTS  1064
              ST    +P +IIP G  F+++P  F GPCKS  +  ++ GT++AP S   W  +  D  
Sbjct  61    GST--QGTPTLIIPGGKKFMLQPSSFQGPCKSSTVKVMMMGTIIAPQSSGKWKWDSRDDD  118

Query  1063  QWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSN  884
              W+SF+ + GLI++G G  DGQG  WW ++  DH          PTA++F+ C N  L  
Sbjct  119   AWISFSHIKGLIISGEGTFDGQGASWW-KNYNDHGR--------PTALQFLGCDNLKLGP  169

Query  883   IHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCI  704
             +  + SP+ H+ +  CNG  I++L + +P +SPNTDG+ I  S +++I HS IS GDDCI
Sbjct  170   LRHIDSPKNHISIVDCNGALISHLHIIAPENSPNTDGIDISRSTNIIIEHSTISTGDDCI  229

Query  703   SIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQT  524
             +I   +  + I  + CGPGHGISVGSLGK G +  VE +H+S+S F GT NGARIKTW  
Sbjct  230   AINSGSKFINITAINCGPGHGISVGSLGKDGKYATVEEVHVSHSIFTGTENGARIKTWTA  289

Query  523   GRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEA  344
             G GYAR IT+E++ +  V+NPIIIDQ+Y +          GV++SDV F+   GTA  + 
Sbjct  290   GTGYARKITYEDITLIKVNNPIIIDQHYDALESVSDSVRKGVKVSDVTFRGFRGTANEKD  349

Query  343   AISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             AI LNC++ + C  I L++I+I       P +A C+N  G  +S  P  PC 
Sbjct  350   AIELNCAR-IGCTNIVLENINIAGLGGEKP-SASCNNVQGSCSSCNPNVPCF  399



>ref|XP_006427250.1| hypothetical protein CICLE_v10027074mg [Citrus clementina]
 gb|ESR40490.1| hypothetical protein CICLE_v10027074mg [Citrus clementina]
Length=400

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 175/368 (48%), Positives = 231/368 (63%), Gaps = 13/368 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             S +VI +GA GDG TDDSQAFL AWK  C S     +P +++PAG TFL+ PV F GPCK
Sbjct  32    SVSVIQFGAVGDGETDDSQAFLKAWKSICGSKS--NAPPLLVPAGKTFLLNPVSFQGPCK  89

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S  I+  + G +VAP S   W+G D  +WL F+ V GL VNG G IDG+G  WW  S + 
Sbjct  90    SSSINVQIQGNIVAPHSS-AWDGHDKKKWLLFSNVNGLTVNGNGKIDGKGASWW--SNKQ  146

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
             H          PTA+ F  C N     +  V SP  H+ ++ CN  +I+NL + +P  SP
Sbjct  147   HQR--------PTALSFGSCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSP  198

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S +V I    I+ GDDC++IG  T+++ +  V CGPGHGIS+GSLG +G  
Sbjct  199   NTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGT  258

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
               VE++H+ + TF GT NGARIKTWQ G G+AR I+FE +++ S DNPIIIDQ YC    
Sbjct  259   SIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPND  318

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK Q + V++SDV +    GT++TE A+ L+CS++V C  IK++ IDIT         A
Sbjct  319   ECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRA  378

Query  244   CCSNAHGE  221
              C NAHGE
Sbjct  379   SCINAHGE  386



>ref|XP_003540568.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=402

 Score =   333 bits (854),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 175/400 (44%), Positives = 247/400 (62%), Gaps = 14/400 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSR-----VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             + +F  L+++   S SR     ++  +FNV+DYGA GDG+TDDSQAFL AW   C+    
Sbjct  5     IAIFFLLYLVSHCSCSRLREAAINLNTFNVMDYGAIGDGLTDDSQAFLKAWSMVCAMK--  62

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
             + +  + +P G TF++KP+QF+GPC    +HF + G VVAP S   W G D+S+W+ F+ 
Sbjct  63    NGAATLKVPPGKTFMLKPLQFSGPCSFSSVHFQLEGDVVAPKSTEAWKGQDSSKWIDFSN  122

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V GLI++GGG IDG G  WW+ SC+    ++ C+   PTA+    C N  L+    ++S 
Sbjct  123   VDGLIIDGGGQIDGSGSVWWN-SCK----VKSCS--RPTALSIHNCNNLQLTGTRHLNSA  175

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             + H+ +   N  +I N+T+ +P DSPNTDG+ +  S +++I  S I+ GDDCI++   T+
Sbjct  176   RNHISINNSNHTHIFNVTITAPQDSPNTDGIDVSQSSYILIQRSTIATGDDCIAMNSGTS  235

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              V I  + CGPGHGISVGSLGK G    VE++H+SN  F G  NG RIKTW  G GYARN
Sbjct  236   YVNITGITCGPGHGISVGSLGKKGTCQTVEHVHVSNCNFKGADNGMRIKTWPGGCGYARN  295

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             I FE++ + +  NPIIIDQ+Y +     K+Q + VQIS V ++ +NGT  +E AI LNC 
Sbjct  296   IKFEHIVLTNTKNPIIIDQDYENVQNEDKKQTSEVQISGVTYRYVNGTCNSETAIILNCG  355

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
                 C  I +D ++IT       V A C+NAHG   S  P
Sbjct  356   AGAGCTDIFMDLVNITSTSSGSNVLASCNNAHGVAASTSP  395



>gb|EMS53068.1| Polygalacturonase [Triticum urartu]
Length=409

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 174/381 (46%), Positives = 238/381 (62%), Gaps = 7/381 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F V +YGA GDG  DD+Q    AW  ACSS+   +   ++IP G T+L+  V  +GPCKS
Sbjct  35    FIVDNYGAHGDGKHDDTQPLAKAWNAACSSS---RPAMLLIPEGKTYLLNSVTLSGPCKS  91

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               + F+V GT+VAP S   W   DTS+W+   GV GL V+GGG I+G G  WW  SC+ +
Sbjct  92    SVV-FMVKGTLVAPRSRSAWRDNDTSRWIMIQGVTGLTVSGGGTINGNGDVWWTNSCKTN  150

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT  APTA+ F  C N  + N+  V+S Q H+ +  CN   +  L++ +PG SPN
Sbjct  151   KALP-CTK-APTALTFHLCTNLQVENLKLVNSQQIHLSVEDCNAVQLARLSITAPGTSPN  208

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +    I  GDDCISI + T ++ ++ V CGPGHGISVGSLG   +  
Sbjct  209   TDGIHITRSKDVQVKDCVIKTGDDCISIENGTRNLFVSKVVCGPGHGISVGSLGDDNSRA  268

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I +   YGTTNGARIKTWQ G GYA+ ITF+N+ + +V NPIIIDQNYC     
Sbjct  269   EVSGITIDSVQLYGTTNGARIKTWQGGSGYAKGITFQNMIMDNVQNPIIIDQNYCDSAKP  328

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK +G+ V++S+VVF+ I GT  ++ AI L+CS ++ C  I L++ID+  +       + 
Sbjct  329   CKSRGSAVEVSNVVFKNIRGTTVSKDAIKLSCSNSISCSDIVLENIDLKMEGGKGDTEST  388

Query  241   CSNAHGEET-SVEPGPCLKQD  182
             C NA  +E+ +V P PC  Q+
Sbjct  389   CQNAKWQESGTVIPQPCQFQN  409



>ref|XP_010654934.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=399

 Score =   332 bits (852),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 176/394 (45%), Positives = 247/394 (63%), Gaps = 9/394 (2%)
 Frame = -1

Query  1360  LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  1181
             +GL     +S  + NV D+GA GDG TDDSQAFL AWK AC     + +   II +G  F
Sbjct  9     IGLSDDDELS--TINVRDFGAIGDGTTDDSQAFLKAWKKACGIQAGYVN--FIIESGKAF  64

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             L+KP++F GPC++ +I+  V GT+ AP S   W G     WL F  + GLIVNG G I+G
Sbjct  65    LLKPIRFEGPCRASYINIQVLGTITAPKSIYEWGGQSVDNWLIFFRINGLIVNGKGTING  124

Query  1000  QGKKWWDQSCRD---HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNG  830
             QG  WW Q  ++   HP ++G ++  P A+ F+ C N  L +++ ++SP+ HV +F  NG
Sbjct  125   QGSIWWQQLPKNNLFHP-LDGVSNKGPDALSFVGCNNLKLDHLNLINSPRRHVVIFNING  183

Query  829   FNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGP  650
               I+NL + +P +SPNTDG+ I  S ++ + +  I  GDDCI+IG  +  + I+N+ CGP
Sbjct  184   ATISNLNIIAPKESPNTDGIDIGQSTNIQLHYCNIKTGDDCIAIGPSSFYINISNIACGP  243

Query  649   GHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSV  470
             GHGIS+GSLG +G   +VE + + + TF GT NG RIKTW+ G GYAR I FE + + + 
Sbjct  244   GHGISIGSLGLNGRTDKVEEVQVRDCTFTGTRNGVRIKTWEGGSGYARKILFEGITLNAA  303

Query  469   DNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLD  290
             DNPIIIDQ YC      K+  +GV++SD+ F R+ GT TT+ AI+L+CSK+V C  I L+
Sbjct  304   DNPIIIDQYYCPNNMCSKQSTSGVKLSDISFTRVIGTTTTKNAINLSCSKSVACTNILLN  363

Query  289   SIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCL  191
              ++I        V++ C NAHG    SV P  CL
Sbjct  364   HVNIKSAYSEDVVSSYCINAHGRFSDSVPPVDCL  397



>ref|XP_010061913.1| PREDICTED: probable polygalacturonase At3g15720 [Eucalyptus grandis]
Length=407

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 245/408 (60%), Gaps = 11/408 (3%)
 Frame = -1

Query  1387  MEVFV----FLFILGLIS-SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             ME F+    F  +L +++  +  +  SF+V+ YGA GDG TDDS AFL AW  AC S+  
Sbjct  4     MEHFIVCLLFFGVLNMVNCGASTASTSFDVLSYGAVGDGKTDDSPAFLEAWNAACISSS-  62

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
              K   + +PA  TFL+KPV F+GPC+ ++++ +VSG + AP S   ++G  T+ WL+F+ 
Sbjct  63    -KLSILTVPAKKTFLLKPVTFSGPCQPEYMYVLVSGNIAAPNSMTDYSGYQTNSWLAFSN  121

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSC-RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSS  866
             V GL++ G G+IDG+G  WW Q C  +  N   CT   P A+ F  C    L+ +  V+S
Sbjct  122   VSGLMITGTGIIDGKGSGWWSQPCIGNASNAATCT--GPAALTFYRCTRLVLNGLRHVNS  179

Query  865   PQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFT  686
             P++H+ L  C    I+N+ + +P  SPNTDG+ I  S HV +  S I  GDDCI+I   +
Sbjct  180   PRSHIALTSCQFVTISNIHISAPATSPNTDGIDISGSTHVYVRDSFIGTGDDCIAISAGS  239

Query  685   NDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYAR  506
             + + +  + CGPGHGIS+GSLG  G    VEN+ + N T  GT  G RIKTWQ G GYAR
Sbjct  240   SHINVTRITCGPGHGISIGSLGAHGENDTVENVTVQNCTLKGTMTGVRIKTWQGGIGYAR  299

Query  505   NITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNC  326
              ITF  ++   VDNPIIIDQ YC     CK + +G+++SD+ +  I GT+ T+  I+L+C
Sbjct  300   KITFNKIRFIRVDNPIIIDQYYCPTQVGCKNETSGIRVSDISYSVIYGTSVTDKVINLSC  359

Query  325   SKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCLKQ  185
              +   C  I LD + IT  +P+    + C NAHG+ +   P   CL +
Sbjct  360   DQNFGCSNIVLDHVYITSTVPNKKAYSYCFNAHGKYSHTRPAVTCLLK  407



>ref|XP_003545181.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=402

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/407 (43%), Positives = 251/407 (62%), Gaps = 15/407 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRV-----SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             + +F  L+++   S SR+     +  +FNV+DYGA GDG+TDDSQAFL AW   C+    
Sbjct  5     IAIFFVLYLVSHCSCSRIREAAINLYTFNVMDYGAIGDGLTDDSQAFLKAWSMVCAMK--  62

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
             + +  + +P G TF++KP+QF+GPC    +HF + G VVAP S   W G D+S+W+ F+ 
Sbjct  63    NGAATLKVPPGKTFMLKPLQFSGPCSFSSVHFQLEGDVVAPKSTEAWKGQDSSKWIDFSN  122

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V GLI++GGG IDG G  WW+ SC+    ++ C+   PTA+    C N  L+    ++S 
Sbjct  123   VDGLIIDGGGQIDGSGSVWWN-SCK----VKSCS--RPTALSIQNCNNLQLTGTRHLNSA  175

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             + H+ +   N  +I N+T+ +P DSPNTDG+ +  S +++I  S I+ GDDCI++   T+
Sbjct  176   RNHISINNSNHTHIFNVTITAPQDSPNTDGIDVSQSSYILIQRSTIATGDDCIAMKSGTS  235

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              V I  + CGPGHGISVGSLGK G    VE++H++N  F G  NG RIKTW  G GYARN
Sbjct  236   YVNITGITCGPGHGISVGSLGKKGTCQTVEHVHVNNCNFKGADNGMRIKTWPGGCGYARN  295

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             I FE++ + +  NPIIIDQ+Y +     K+Q + VQIS V ++ +NGT+ +E AI LNC 
Sbjct  296   IKFEHILLTNTKNPIIIDQDYENVQNEDKKQTSEVQISGVTYRCVNGTSNSETAIILNCG  355

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCLKQ  185
                 C  I +D ++IT       V A C+NAHG   S  P   CL Q
Sbjct  356   AGAGCTDIFMDVVNITSTSSGSNVHASCNNAHGVAASTSPPVSCLSQ  402



>gb|KDO45211.1| hypothetical protein CISIN_1g041224mg [Citrus sinensis]
Length=400

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 230/368 (63%), Gaps = 13/368 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             S +VI +GA GDG TDDSQAFL AWK  C S     +  +++PAG TFL+ PV F GPCK
Sbjct  32    SVSVIQFGAVGDGETDDSQAFLKAWKSICGSKS--NAAPLLVPAGKTFLLNPVSFQGPCK  89

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S  I+  + G +VAP S   W+G D  +WL F+ V GL VNG G IDG+G  WW      
Sbjct  90    SSSINVQIQGNIVAPHSS-AWDGHDKKKWLLFSNVNGLTVNGNGKIDGKGASWWSNK---  145

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
                     +  PTA+ F  C N     +  V SP  H+ ++ CN  +I+NL + +P  SP
Sbjct  146   -------QNQRPTALSFGSCNNLVFRGLTHVDSPGNHISVYGCNDVSISNLKIIAPESSP  198

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S +V I    I+ GDDC++IG  T+++ +  V CGPGHGIS+GSLG +G  
Sbjct  199   NTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGT  258

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
               VE++H+ + TF GT NGARIKTWQ G G+AR I+FE +++ S DNPIIIDQ YC   G
Sbjct  259   SIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIRLESSDNPIIIDQYYCGPNG  318

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK Q + V++SDV +    GT++TE A+ L+CS++V C  IK+++IDIT         A
Sbjct  319   DCKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINNIDITHSDSGKDTRA  378

Query  244   CCSNAHGE  221
              C NAHGE
Sbjct  379   SCINAHGE  386



>ref|XP_007018009.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY15234.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=405

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 249/409 (61%), Gaps = 22/409 (5%)
 Frame = -1

Query  1414  FALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
              A++  F      +F F LG+      +C+S NV D+GA GDG TDDS AFL AWK  C+
Sbjct  1     MAMFTAF-----MIFSFALGI-----ANCQSLNVTDFGAVGDGKTDDSLAFLKAWKALCA  50

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             +T    +P + IP+  TFL+K VQF+GPCKS+ IH  V G +VAP +   W   D   WL
Sbjct  51    ATNT-PNPTLEIPSNKTFLLKQVQFSGPCKSKSIHIHVLGNIVAPNNNT-WTKCDNGCWL  108

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
              F+ V GL V+G G IDG+G  WW+++ ++           P  + F  C N  +  I  
Sbjct  109   CFSNVAGLTVDGPGQIDGKGAAWWNKTPKE---------CGPAVISFHKCDNLKVHGITS  159

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
             ++SP  HV L      NI+++ + +P DSPNTDG+ I AS  + I+ S I  GDDCI+I 
Sbjct  160   LNSPGNHVSLNGSKDVNISHIQLIAPKDSPNTDGIDISASSSLQISDSFIGTGDDCIAIN  219

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
               T+++ I ++ CGPGHGISVGSLGK+G F  VE +H+ NSTF GT NGARIKTW  G G
Sbjct  220   GSTSNLNITSIACGPGHGISVGSLGKNGKFETVEEVHVRNSTFNGTQNGARIKTWTGGSG  279

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
             +ARNI+F+ +Q+ +V NPIIIDQ+YC +    +E  + V+IS+V F    GT+ T+ AI 
Sbjct  280   FARNISFDGIQLVNVQNPIIIDQHYCPHKTCPREGKSAVKISNVTFSGFQGTSATDVAIK  339

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP-GPCL  191
             L+CS  VPC  I L++  IT   P   V + C+N  G  T  +P  PCL
Sbjct  340   LDCSSIVPCTDITLNNNTITSSTPGKNVTSECNNVRGSSTLTKPIVPCL  388



>ref|XP_003607885.1| hypothetical protein MTR_4g084050 [Medicago truncatula]
 gb|ABC75354.1| Glycoside hydrolase, family 28 [Medicago truncatula]
 gb|AES90082.1| polygalacturonase [Medicago truncatula]
Length=394

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/403 (44%), Positives = 246/403 (61%), Gaps = 22/403 (5%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  1208
             M+    L ++ +I+S  +    FNV+ YGAKGDG TDDS AF NAW+D C ST    +P 
Sbjct  1     MKGLFVLCLIFVIASPCLCQNYFNVVKYGAKGDGHTDDSNAFTNAWQDVCGST--RDTPT  58

Query  1207  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYG  1034
             +IIP G  F+++P+ F GPCKS  I   + GT+ AP S   W  +  D   W+ F+ + G
Sbjct  59    LIIPEGQNFMLQPLSFQGPCKSTTISVKIMGTITAPQSNANWKWDDNDGDYWIKFSNING  118

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             LI+NGGG +DGQG  WW+ +            + PTA+K + C N  L  +  ++SP+ H
Sbjct  119   LIINGGGTVDGQGDSWWNNNGH----------IRPTALKILECDNLKLGPLKHINSPRNH  168

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             + +  CN   I+NL + +P DSPNTDG+ I  S ++ + HS IS GDDCI+I + T  + 
Sbjct  169   ISIVGCNDALISNLHIIAPKDSPNTDGIDISTSTNISVQHSIISTGDDCIAINNGTEFIY  228

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             I ++QCGPGHGISVGSLGK G++  VE IH+SN TF  TTNGARIKTW  G GYAR IT+
Sbjct  229   ITDIQCGPGHGISVGSLGKDGDYSTVEEIHVSNITFRETTNGARIKTWTGGSGYARKITY  288

Query  493   ENLQVFSVDNPIIIDQNYCSY-PGTCKEQ-----GTGVQISDVVFQRINGTATTEAAISL  332
             E++ VF V+NP+IIDQ Y +  P   K          V++SDV+F+ I GT   + AI L
Sbjct  289   EDIIVFKVENPVIIDQQYDALEPLKTKYNVLEGVSKAVKVSDVIFRNIRGTTNGKDAIDL  348

Query  331   NCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             NC++ + C  I L+ IDI   +     +A C++  G  +S  P
Sbjct  349   NCAR-IGCTNIILEDIDIV-DLDGKKASASCNSVQGSCSSCNP  389



>ref|XP_006664897.1| PREDICTED: polygalacturonase-like [Oryza brachyantha]
Length=426

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 233/377 (62%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V  +GA GDG+ DDS+A   AW  ACSS+   +   V++P G  +L K +  +GPCKS
Sbjct  52    FDVRKHGAYGDGLHDDSKALAKAWSAACSSS---QPSIVLVPKGMKYLTKHITLSGPCKS  108

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I  ++ GT+VAP     W+      W+ FNGV GL V G G I+G GK WW  SC+ +
Sbjct  109   S-ITLMIEGTLVAPPRKSDWSKKTIQHWIMFNGVRGLTVAGHGAINGNGKIWWQNSCKTN  167

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT  APTA+ F  C N  + N+  V+S Q H+ +  C    I  LT+ +PG SPN
Sbjct  168   SKLT-CTK-APTALTFSSCSNLKVENLKLVNSQQIHMSVEDCTDVRILGLTITAPGTSPN  225

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T   I  GDDC+SI D T ++ +  + CGPGHGIS+GSLG   +  
Sbjct  226   TDGIHITRSKKVHVTGCTIKTGDDCMSIEDGTENLHVKKIVCGPGHGISIGSLGDHNSKA  285

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V N+ + N   YGTTNGARIKTWQ GRGYA+NI F+N+ + +V NPIIIDQNYC     
Sbjct  286   RVNNVTVDNVRLYGTTNGARIKTWQGGRGYAKNIVFQNMIMENVWNPIIIDQNYCDSATP  345

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK+Q + VQ+S+V F+ I GT+ ++ AI L+CS+ VPC  I L  + +T +       + 
Sbjct  346   CKKQTSAVQVSNVSFKNIRGTSASKEAIKLDCSRNVPCQDINLKDVKLTVKGDGGDAKST  405

Query  241   CSNAHGEET-SVEPGPC  194
             C NA  +++ +V P PC
Sbjct  406   CRNAKWKKSGTVIPQPC  422



>ref|XP_003546050.2| PREDICTED: probable polygalacturonase At1g80170-like [Glycine 
max]
Length=412

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 245/400 (61%), Gaps = 5/400 (1%)
 Frame = -1

Query  1396  FYSMEVF-VFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             F  ME F + L IL +++    S   +FNV+ YGA G+G T+DS AFL AWK AC S   
Sbjct  9     FDIMEFFFIVLMILSVLTPGLSSTIITFNVLQYGAVGNGQTNDSPAFLKAWKAACQSK--  66

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
                 ++IIPA  TFL+KP  F+GPCKS + +  +SG +VAP +   ++G  T+ WL F+ 
Sbjct  67    SHIARLIIPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIVAPKTKSEYSGFHTNTWLGFSF  126

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V GL ++G G IDG+G  WW Q C  +P   G T   PTA+ F  C    L     ++  
Sbjct  127   VNGLAISGKGTIDGRGSAWWQQPCVGNPQ-PGATCRPPTAVTFNRCNRLQLKGYTSINPA  185

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             ++HV L  CN   I+N+ + +PG SPNTDG+ I  S  + + +S I+ GDDCI+I   ++
Sbjct  186   RSHVTLTSCNKGIISNIRLIAPGTSPNTDGIDISGSTGIQVLNSFIATGDDCIAISAGSS  245

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              ++I  + CGPGHGIS+GSLG  G+   VE++H+ N T   T  G RIKTWQ G GYAR 
Sbjct  246   KIKITGITCGPGHGISIGSLGTRGDTDIVEDVHVENCTLTETLTGVRIKTWQGGAGYARR  305

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             ITFEN++    ++PIIIDQ YC +   C+ Q   ++ISDV ++ I GT+ T+ AI+L+C 
Sbjct  306   ITFENIRFVRANSPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGTSLTDKAINLSCD  365

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             + V C  I LD + ITP +P   V + C NAHG  T  +P
Sbjct  366   QNVGCSNIVLDHVYITPAVPGQKVFSYCHNAHGIATHTKP  405



>gb|AES71940.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=391

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/403 (43%), Positives = 248/403 (62%), Gaps = 17/403 (4%)
 Frame = -1

Query  1387  MEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             M +FV  +    L++   ++ KSFNV++YGAKGD  TDDS AFL AW++ C ST    +P
Sbjct  1     MSLFVSPISCFRLVNRKPLAQKSFNVVNYGAKGDSNTDDSNAFLKAWQEVCGST--QGTP  58

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVY  1037
              +IIP G  F+++P  F GPCKS  +  ++ GT++AP S   W  +  D   W+SF+ + 
Sbjct  59    TLIIPGGKKFMLQPSSFQGPCKSSTVKVMMMGTIIAPQSSGKWKWDSRDDDAWISFSHIK  118

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQA  857
             GLI++G G  DGQG  WW ++  DH          PTA++F+ C N  L  +  + SP+ 
Sbjct  119   GLIISGEGTFDGQGASWW-KNYNDHGR--------PTALQFLGCDNLKLGPLRHIDSPKN  169

Query  856   HVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDV  677
             H+ +  CNG  I++L + +P +SPNTDG+ I  S +++I HS IS GDDCI+I   +  +
Sbjct  170   HISIVDCNGALISHLHIIAPENSPNTDGIDISRSTNIIIEHSTISTGDDCIAINSGSKFI  229

Query  676   EINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNIT  497
              I  + CGPGHGISVGSLGK G +  VE +H+S+S F GT NGARIKTW  G GYAR IT
Sbjct  230   NITAINCGPGHGISVGSLGKDGKYATVEEVHVSHSIFTGTENGARIKTWTAGTGYARKIT  289

Query  496   FENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKA  317
             +E++ +  V+NPIIIDQ+Y +          GV++SDV F+   GTA  + AI LNC++ 
Sbjct  290   YEDITLIKVNNPIIIDQHYDALESVSDSVRKGVKVSDVTFRGFRGTANEKDAIELNCAR-  348

Query  316   VPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             + C  I L++I+I       P +A C+N  G  +S  P  PC 
Sbjct  349   IGCTNIVLENINIAGLGGEKP-SASCNNVQGSCSSCNPNVPCF  390



>gb|KHN44172.1| Putative polygalacturonase [Glycine soja]
Length=412

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 244/400 (61%), Gaps = 5/400 (1%)
 Frame = -1

Query  1396  FYSMEVF-VFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             F  ME F   L IL +I+    S   SFNV+ YGA G+G T+DS AFL AWK AC S   
Sbjct  9     FDIMEFFFTVLIILSVITPGLSSTTTSFNVLQYGAVGNGQTNDSPAFLKAWKAACQSNS-  67

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
             H S ++IIPA  TFL+KP  F+GPCKS + +  +SG ++AP +   ++G  T+ WL F+ 
Sbjct  68    HIS-RLIIPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIIAPKTKSEYSGFHTNTWLGFSF  126

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V GL ++G G IDG+G  WW Q C  +P + G T   PTA+ F  C    L     ++  
Sbjct  127   VNGLAISGKGTIDGRGSAWWQQPCVGNP-LPGATCRPPTAVTFNRCNRLQLKGYTSINPA  185

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             ++H+ L  C    I+N+ + +PG SPNTDG+ I  S  + + +S I+ GDDCI+I   ++
Sbjct  186   RSHMTLTSCKKGIISNIRLIAPGTSPNTDGIDISGSTDIQVLNSFIATGDDCIAISAGSS  245

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              ++I  + CGPGHGIS+GSLG  G    VE++H+ N T   T  G RIKTWQ G GYAR 
Sbjct  246   KIKITGITCGPGHGISIGSLGTRGETDIVEDVHVENCTLTETLTGVRIKTWQGGAGYARR  305

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             ITFE ++    +NPIIIDQ YC +   C+ Q   ++ISDV ++ I GT+ T+ AI+L+C 
Sbjct  306   ITFEKIRFVRANNPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGTSLTDKAINLSCD  365

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             + V C  I LD + ITP +P   V + C NAHG  T  +P
Sbjct  366   QNVGCSNIVLDHVYITPSVPGQKVFSYCHNAHGIATHTKP  405



>ref|XP_006845770.1| hypothetical protein AMTR_s00019p00250890 [Amborella trichopoda]
 gb|ERN07445.1| hypothetical protein AMTR_s00019p00250890 [Amborella trichopoda]
Length=396

 Score =   330 bits (847),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/387 (44%), Positives = 236/387 (61%), Gaps = 7/387 (2%)
 Frame = -1

Query  1351  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVK  1172
             +S S  + KSF+V+DYGAKGDGM DD+ AF  AW  ACS+     SP++IIP+G+ F V 
Sbjct  16    LSDSTSTSKSFDVMDYGAKGDGMKDDTDAFAKAWNAACSA---KGSPEMIIPSGNLFRVG  72

Query  1171  PVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGK  992
             P+QF GPC+S H+H  V G +V P  P  W G     WL F+ V GLIV+G G IDG G 
Sbjct  73    PIQFTGPCESNHVHVTVEGDIVGP-PPSSWKGASKETWLVFSHVNGLIVDGSGKIDGHGP  131

Query  991   KWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNL  812
              WW Q+CR +   +G     PTA+   +  +  +S ++ V+S Q H+ +       +++L
Sbjct  132   AWWAQACRQN---KGDICANPTALTVEYSSDVRVSGLNIVNSQQMHMGIEQSTSVTLSHL  188

Query  811   TVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISV  632
             T+++PGDSPNTDG+HI  S  V I +  I  GDDCISIG  ++++ I+++ CGPGHGIS+
Sbjct  189   TIRAPGDSPNTDGIHIQGSSSVTIENCNIGTGDDCISIGPGSSNLNISHIVCGPGHGISI  248

Query  631   GSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIII  452
             GSLGK      V+ +H+++    GTTNG RIKTWQ G G   +ITFE + + +VD PIII
Sbjct  249   GSLGKGTEKANVQGVHVTDVNMTGTTNGVRIKTWQGGAGTVSDITFERITMDNVDRPIII  308

Query  451   DQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITP  272
             DQ YC     C+ + + VQ+  V F  + GT+    A++L CSK+V C  I LD ID+  
Sbjct  309   DQYYCDSNYRCQNKTSAVQVKGVKFIGVRGTSVRPEAVTLACSKSVACTNILLDGIDLKT  368

Query  271   QIPSVPVAACCSNAHGEETSVEPGPCL  191
                   V+ C +     +  V P PCL
Sbjct  369   VDGEKTVSYCLNAFGSAKGQVIPKPCL  395



>ref|XP_004292991.1| PREDICTED: probable polygalacturonase At3g15720-like [Fragaria 
vesca subsp. vesca]
Length=443

 Score =   332 bits (851),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 240/407 (59%), Gaps = 13/407 (3%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             Y +  F+  +      S  V  ++F+V+DY A GDG TDDSQAF+ AW+  C +   +  
Sbjct  3     YILVSFLIFYTYSSHLSEIVCGQTFSVLDYDAVGDGDTDDSQAFVRAWEAVCGA-ETYDV  61

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P + IP   TFL++P +F GPCKS  +H  V G +VAP +P  W   +T  WL+F  V+ 
Sbjct  62    PTLQIPEEKTFLLQPTKFKGPCKSNRVHVQVLGKLVAPETPEAWKECETDVWLTFTDVHN  121

Query  1033  LIVNGGGVIDGQGKKWW----------DQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSN  884
             L VNG G IDG+G  WW          D+  ++   +  C    P A+ F  C N  L+ 
Sbjct  122   LTVNGSGQIDGRGSSWWSKAEHQRLYIDEKHKNDDEVVKCH--RPKALHFQGCHNLLLTG  179

Query  883   IHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCI  704
             +  V+SP+AH+ +  C    + NLT+ +P DSPNTDG+ I  S +V I  S I  GDDCI
Sbjct  180   LTHVNSPKAHISISNCRYVYVANLTITAPEDSPNTDGIDISNSNYVNIHSSYIGTGDDCI  239

Query  703   SIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQT  524
             +I    +++ I  ++CGPGHGISVGSLG+ G +  VEN+++ N +F GT NG RIKTWQ 
Sbjct  240   AINSGCSNLNITTIKCGPGHGISVGSLGQDGAYATVENVYVKNCSFSGTQNGVRIKTWQG  299

Query  523   GRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEA  344
             G GYA+NITFE +++ +  N IIIDQ YC+    CK + + V+ISDV +  I GT+  E 
Sbjct  300   GSGYAKNITFEKIRLHAAKNSIIIDQYYCNGGHGCKNKSSAVEISDVRYMDIKGTSAKED  359

Query  343   AISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             AI  NC++   C  I +D+I+IT  +P   + A C N +G   S  P
Sbjct  360   AIIFNCNQFSGCRNIVMDNINITSDVPGEELYASCYNINGTSNSTLP  406



>ref|XP_006595163.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=401

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 174/393 (44%), Positives = 241/393 (61%), Gaps = 4/393 (1%)
 Frame = -1

Query  1378  FVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
             F  L IL +I+    S   SFNV+ YGA G+G T+DS AFL AWK AC S   H S ++I
Sbjct  5     FTVLIILSVITPGLSSTTTSFNVLQYGAVGNGQTNDSPAFLKAWKAACQSNS-HIS-RLI  62

Query  1201  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  1022
             IPA  TFL+KP  F+GPCKS + +  +SG ++AP +   ++G  T+ WL F+ V GL ++
Sbjct  63    IPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIIAPKTKSEYSGFHTNTWLGFSFVNGLAIS  122

Query  1021  GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLF  842
             G G IDG+G  WW Q C  +P + G T   PTA+ F  C    L     ++  ++H+ L 
Sbjct  123   GKGTIDGRGSAWWQQPCVGNP-LPGATCRPPTAVTFNRCNRLQLKGYTSINPARSHMTLT  181

Query  841   VCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNV  662
              C    I+N+ + +PG SPNTDG+ I  S  + + +S I+ GDDCI+I   ++ ++I  +
Sbjct  182   SCKKGIISNIRLIAPGTSPNTDGIDISGSTDIQVLNSFIATGDDCIAISAGSSKIKITGI  241

Query  661   QCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQ  482
              CGPGHGIS+GSLG  G    VE++H+ N T   T  G RIKTWQ G GYAR ITFE ++
Sbjct  242   TCGPGHGISIGSLGTRGETDIVEDVHVENCTLTETLTGVRIKTWQGGAGYARRITFEKIR  301

Query  481   VFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLG  302
                 +NPIIIDQ YC +   C+ Q   ++ISDV ++ I GT+ T+ AI+L+C + V C  
Sbjct  302   FVRANNPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGTSLTDKAINLSCDQNVGCSN  361

Query  301   IKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             I LD + ITP +P   V + C NAHG  T  +P
Sbjct  362   IVLDHVYITPSVPGQKVFSYCHNAHGIATHTKP  394



>gb|KHN22454.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score =   331 bits (849),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 175/400 (44%), Positives = 246/400 (62%), Gaps = 5/400 (1%)
 Frame = -1

Query  1396  FYSMEVF-VFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             F  ME F + L IL +++    S   +FNV+ YGA G+G T+DS AFL AWK AC S   
Sbjct  22    FDIMEFFFIVLMILSVLTPGLSSTIITFNVLQYGAVGNGQTNDSPAFLKAWKAACQSK--  79

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
                 ++IIPA  TFL+KP  F+GPCKS + +  +SG +VAP +   ++G  T+ WL F+ 
Sbjct  80    SHIARLIIPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIVAPKTKSEYSGFHTNTWLGFSF  139

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V GL ++G G IDG+G  WW Q C  +P + G T   PTA+ F  C    L     ++  
Sbjct  140   VNGLAISGKGTIDGRGSAWWQQPCVGNP-LPGATCRPPTAVTFNRCNRLQLKGYTSINPA  198

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             ++HV L  CN   I+N+ + +PG SPNTDG+ I  S  + + +S I+ GDDCI+I   ++
Sbjct  199   RSHVTLTSCNKGIISNIRLIAPGTSPNTDGIDISGSTGIQVLNSFIATGDDCIAISAGSS  258

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              ++I  + CGPGHGIS+GSLG  G+   VE++H+ N +   T  G RIKTWQ G GYAR 
Sbjct  259   KIKITGITCGPGHGISIGSLGTRGDTDIVEDVHVENCSLTETLTGVRIKTWQGGAGYARR  318

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             ITFEN++    ++PIIIDQ YC +   C+ Q   ++ISDV ++ I GT+ T+ AI+L+C 
Sbjct  319   ITFENIRFVRANSPIIIDQFYCPHRSDCQNQTRAIKISDVTYKGIVGTSLTDKAINLSCD  378

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             + V C  I LD + ITP +P   V + C NAHG  T  +P
Sbjct  379   QNVGCSNIVLDHVYITPAVPGQKVFSYCHNAHGIATHTKP  418



>gb|KDP29312.1| hypothetical protein JCGZ_19407 [Jatropha curcas]
Length=398

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 253/388 (65%), Gaps = 13/388 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SFNV+DYGA GDG TD+SQA L AW+D C +T    +P +I+PAG TFL+KPV+F GPCK
Sbjct  21    SFNVLDYGAIGDGKTDNSQAVLRAWEDLCGAT--RGTPTLIVPAGGTFLLKPVRFQGPCK  78

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S+++H  + GT+VA  +   W G D   WL F+ V GLI++GGG IDGQG  WW + C++
Sbjct  79    SKNLHIQIQGTIVASNNINAW-GKDKGSWLQFSDVNGLIIDGGGQIDGQGGLWW-KFCKE  136

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
                 +GC+   PTA+ F  C    LS +  ++S + H+ +  C+  N+ +L + +P DSP
Sbjct  137   D---KGCS--RPTALSFHNCNGLQLSGLKHLNSQRNHISINGCSDVNLFHLYITAPQDSP  191

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I AS H+ I +S I  GDDCI+I  F++ + I+ + CGPGHGISVGSLGK+G +
Sbjct  192   NTDGIDISASTHINIRNSVIRTGDDCIAINGFSSYINISGISCGPGHGISVGSLGKNGAY  251

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY-CSYP  428
               VE +H+ N TF GT NG RIKTWQ G GYAR ITF+N+ + +  NPIIIDQNY C +P
Sbjct  252   ETVEEVHVQNCTFKGTQNGVRIKTWQGGAGYARKITFDNIILIASQNPIIIDQNYFCRFP  311

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
              +   + + V ISDV ++ I G+++ E AI LNC +   C  I +D I+I P  P + + 
Sbjct  312   YS--AESSNVYISDVTYRNIRGSSSVERAIDLNCGRKRGCTNIVMDDIEIVPSSPGMHLH  369

Query  247   ACCSNAHGEETSVEPG-PCLKQD*FNLF  167
             A C+NA+G  T   P  PCL     + F
Sbjct  370   AFCNNAYGISTLASPTVPCLSNKFLDFF  397



>ref|XP_009619865.1| PREDICTED: probable polygalacturonase At3g15720 [Nicotiana tomentosiformis]
Length=411

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/396 (45%), Positives = 239/396 (60%), Gaps = 11/396 (3%)
 Frame = -1

Query  1375  VFLFILGLISS--SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
             +FL +L + S   S    K+FNV+++GA GDG TDD  AFL AW+  C S    +S +VI
Sbjct  15    IFLVLLCMFSPVWSADDIKTFNVVNFGAVGDGRTDDLPAFLKAWETVCQS----ESSRVI  70

Query  1201  --IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  1028
               IP    FL+ P  F GPCK   IH  VSG ++AP S  GW+G  T+ WL F  +  L 
Sbjct  71    LVIPEKKKFLLTPSTFEGPCKPSFIHIQVSGNIIAPNSKSGWDGRATNAWLIFENIDHLT  130

Query  1027  VNGGGVIDGQGKKWWDQSCRDHPNMEGCTDL-APTAMKFMFCINTTLSNIHFVSSPQAHV  851
             VNG GV DGQG  WW   C D  N    T    PTA+ F  C    +  +  + S ++H+
Sbjct  131   VNGNGVFDGQGHVWWSNPCLDDNNPSQETQCKGPTALIFRRCDRLRVWGVTLIRSARSHI  190

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
              L  CN  +I N+ + SPGDSPNTDG+ + AS +V I +S I+ GDDCI+IG  +++V I
Sbjct  191   ILTACNEVSIANIRIMSPGDSPNTDGIDVSASTNVRIHNSLIATGDDCIAIGGGSSNVNI  250

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
             + + CGPGHGIS+GSLG+ G F  VE++ + N T   T  G RIKTWQ G+GYAR ITFE
Sbjct  251   SGITCGPGHGISIGSLGEGG-FEIVEDVRVRNCTIKDTLTGVRIKTWQGGKGYARRITFE  309

Query  490   NLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVP  311
              +++ +V+NPIIIDQ YC     CK     V +SD+ F+ I+GT+  +  I+L+CS+ V 
Sbjct  310   GIKLVAVNNPIIIDQFYCPSRVNCKNDTAAVALSDIAFRGISGTSLMDEVINLSCSETVG  369

Query  310   CLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             C  I +D + I+  +   PV A C NAHG  T   P
Sbjct  370   CKNILVDHVYIS-SVKGNPVHAKCVNAHGRHTHTRP  404



>ref|XP_007227584.1| hypothetical protein PRUPE_ppa015678mg [Prunus persica]
 gb|EMJ28783.1| hypothetical protein PRUPE_ppa015678mg [Prunus persica]
Length=390

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/400 (42%), Positives = 239/400 (60%), Gaps = 22/400 (6%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRV----SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
              ++ +  FI  + SS  +    S  +F+V+ +GA GDG TDDS+A +NAWK  C +    
Sbjct  2     QDILISFFIFCIASSQLLGIVYSKTTFDVVKFGAVGDGQTDDSEAIVNAWKALCGAAAAG  61

Query  1219  KS-PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
                P + +P G TFL++P +F GPCKS+ +H  VSG ++AP +P  W    +  WLSF  
Sbjct  62    DDVPTLTVPGGKTFLLQPSEFEGPCKSKSVHIQVSGNLMAPKTPDAWKVCPSYSWLSFRN  121

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V  LI++G G IDGQG  WW +                 A++F  C +  LS +  ++SP
Sbjct  122   VDNLILDGSGKIDGQGSAWWSK-----------------ALQFHRCDHLRLSGLTHINSP  164

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             ++H+ +   N  +I++LT+ +P +SPNTDG+++  S +V I  SKI  GDDCI+I    +
Sbjct  165   RSHIGIGTSNDVDISHLTIIAPDESPNTDGINVANSTYVYIHDSKIGTGDDCIAISSGAS  224

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
             +V I  + CGPGHGISVGSLG +G +  VEN+++ + +F GT NGARIKTW  G GYARN
Sbjct  225   NVRIAKIACGPGHGISVGSLGANGAYAAVENVYVRDCSFNGTQNGARIKTWPGGSGYARN  284

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             ITFEN+ + +  NPIIIDQ YC+    C +Q   V +S+V F    GT   E AI L+C+
Sbjct  285   ITFENITLTATKNPIIIDQQYCNGAHDCAKQSKAVLVSNVRFTDFRGTCGNEEAIKLDCN  344

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
                 C  I+L  I+IT  +PS  V A C+NA G   S  P
Sbjct  345   HISGCQNIELVKINITSTVPSKKVYASCNNAKGNSGSTVP  384



>ref|XP_006427249.1| hypothetical protein CICLE_v10027366mg [Citrus clementina]
 gb|ESR40489.1| hypothetical protein CICLE_v10027366mg [Citrus clementina]
Length=415

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 233/382 (61%), Gaps = 13/382 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV++YGA G+G +DDS A+  AW DAC +    ++P +IIP G TFLV P+ F+GPCK
Sbjct  45    TFNVLNYGAVGNGNSDDSLAYAKAWNDACKANA--QTPTMIIPKGKTFLVHPITFSGPCK  102

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S +I   +SGT+ AP  P  W   +  +W+ F  + GL +NG G  DG G+KWWDQSC+ 
Sbjct  103   SSNISIQLSGTIKAPDGPSAWTS-EIERWIVFGNITGLNINGRGHFDGNGQKWWDQSCKH  161

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
             HP           A+ F+ C N  ++ I+   SPQ H+ +      +  +L + SP  SP
Sbjct  162   HPGK---------AVSFIQCNNVHINEIYVERSPQVHIVVDYSQDVHFKSLIIDSPETSP  212

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+HI  S  V +  S I+ GDDCISI D T+++ +  V CGPGHGIS+GSLGK+G  
Sbjct  213   NTDGIHIARSHDVSVHTSIIAAGDDCISISDQTSNISVTYVNCGPGHGISIGSLGKNGEE  272

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
             V+VENI + +  F  TTNGARIKTWQ G+G  +++ F  +    V NPIIIDQ YC    
Sbjct  273   VKVENITVRHVNFCKTTNGARIKTWQAGKGQVQHVEFSYMNFTEVQNPIIIDQYYCDQKD  332

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              C +  TGV ISDV +    GT+ T+ AI+L+CS  V C  IKL++I++        V +
Sbjct  333   VCAKTSTGVHISDVRYLNATGTSATDVAINLDCSNNVACTDIKLENIELQSATEGKGVLS  392

Query  244   CCSNAHG-EETSVEPGPCLKQD  182
              C NA G  + + +P  CLK +
Sbjct  393   SCKNAFGVAKGNCKPKSCLKSN  414



>ref|XP_004489698.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=398

 Score =   328 bits (841),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 242/385 (63%), Gaps = 19/385 (5%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SFNV+DYGA G+G  D++QAF++AWKD CS+  +H SP ++IP G TF+++P+ F GPC 
Sbjct  29    SFNVLDYGAVGNGKNDETQAFVDAWKDTCSA--IHDSPTLLIPKGKTFILQPLWFQGPCN  86

Query  1144  SQHIHFIVSGTVVAPGSPPGW---NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             S  ++  + GT+ AP     W   N  +   W+ F+ + GLI+ G G IDGQG  WWD  
Sbjct  87    STTVYVKLEGTIKAPNKIEAWKWPNNNEKETWIRFSEINGLIIYGSGQIDGQGAPWWD--  144

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C  + N +      PTA+ F  C N  L  +  ++SP+ H+ L  C+G +I+ L + +P 
Sbjct  145   CYSNTNCD-----RPTALHFHACENLILRGLTHINSPRNHISLNACHGSHISKLHIIAPN  199

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG+ I  S +V+I +SK+  GDDCI+I   ++ + I  + CGPGHGISVGSLG++
Sbjct  200   ESPNTDGIDIAESSNVIIENSKMETGDDCIAINHGSSSINIIGIFCGPGHGISVGSLGRN  259

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G    VENI++ N TF GTTNGARIKTW  G GYAR +TFE++ V    NP+IIDQ Y  
Sbjct  260   GADESVENIYVRNCTFNGTTNGARIKTWMGGHGYARKVTFEDIIVIEAYNPVIIDQEYNP  319

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
             Y     +    V++SDV F+ I GT+ ++ AI LNC +A+ C  I L+ I+IT  I    
Sbjct  320   Y-----DSVHAVKVSDVTFRNIRGTSISKHAIQLNCDEAISCTNIILEGINITSSIGE-E  373

Query  253   VAACCSNAHGEETSVEPG-PCLKQD  182
             V A C NA G  TS  P  PCL Q+
Sbjct  374   VHASCKNAKGMCTSCIPYVPCLSQE  398



>ref|XP_004986167.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=429

 Score =   329 bits (844),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/381 (44%), Positives = 237/381 (62%), Gaps = 7/381 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD++A   AW+ AC+S    +   V++P G  +L+K V+ +GPCKS
Sbjct  55    FSLDRYGARGDGRHDDAEALAKAWEAACASP---RPAVVLVPGGKRYLLKVVRLSGPCKS  111

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               +   V GT+VA  +   W+  D   W+ F GV  L VNGGG +DG G+ WW  SC+ +
Sbjct  112   G-VTLAVKGTLVASPNRADWSDKDRRHWIVFRGVDELTVNGGGAVDGNGETWWKHSCKIN  170

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               M  C + APTA+ F FC N  +  +  ++S Q H+ +  C    +  L++ + G SPN
Sbjct  171   KAMP-CKE-APTALSFHFCTNLKVEGLKVMNSQQIHMSIEDCTNVQLRGLSITASGTSPN  228

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T+ KI  GDDC+SI + T+++ ++ V CGPGHGIS+GSLG   +  
Sbjct  229   TDGIHITRSKDVQVTNCKIRTGDDCMSIENGTHNLHVSKVVCGPGHGISIGSLGDDNSRA  288

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I     YGTTNGARIKT+Q G GYA++ITF+N+ + +V NPIIIDQNYC     
Sbjct  289   EVSGITIDAVQLYGTTNGARIKTYQGGSGYAKDITFQNMIMDNVKNPIIIDQNYCDKAKP  348

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK Q + V++S+VVF+ I GT  T+ AI LNCS+ VPC GI L +ID+  +       + 
Sbjct  349   CKAQESAVEVSNVVFKNIRGTTITKDAIKLNCSRNVPCHGITLQNIDLKMEAGDGAAEST  408

Query  241   CSNAHGEET-SVEPGPCLKQD  182
             C NA   +  +V P PC  ++
Sbjct  409   CQNAKWRKVGTVLPQPCTSKN  429



>ref|XP_008665637.1| PREDICTED: polygalacturonase ADPG1-like isoform X1 [Zea mays]
 tpg|DAA52077.1| TPA: hypothetical protein ZEAMMB73_569322 [Zea mays]
Length=441

 Score =   329 bits (844),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/381 (44%), Positives = 236/381 (62%), Gaps = 7/381 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD++A   AWK AC+S    +   V++PAG  +L+K +   GPCKS
Sbjct  65    FSLDRYGARGDGRNDDTRALEMAWKAACASP---RPAVVLVPAGRRYLLKLLTLRGPCKS  121

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               +   V GT+VA  +   W+  D   W+ F  +  L VNGGG IDG G+KWW  SC+ +
Sbjct  122   S-VTLTVKGTLVASPNRADWSDSDRRHWIVFRSIDELTVNGGGAIDGNGEKWWPHSCKIN  180

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  C + APTA+ F +C+   + ++  ++S Q H+ +       +  L++ +PG SPN
Sbjct  181   KALP-CKE-APTALSFHYCVGLKVEDLKIMNSQQIHMSVEDSANVLLARLSITAPGTSPN  238

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T  KI  GDDC+SI + T+++ ++ V CGPGHGIS+GSLG   +  
Sbjct  239   TDGIHITRSKDVRVTDCKIKTGDDCMSIENGTHNLHVSKVTCGPGHGISIGSLGDDNSRA  298

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I +   +GTTNGARIKT+Q G GYA++ITF+N+ ++ V NPIIIDQNYC     
Sbjct  299   EVSGITIDSVQLHGTTNGARIKTYQGGSGYAKDITFQNMVMYDVKNPIIIDQNYCDRAKP  358

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C EQ + VQ+S VVF+ I GT +T+ AI +NCS+ VPC GI L +ID+  Q       + 
Sbjct  359   CGEQESAVQVSGVVFKNIRGTTSTKDAIKMNCSENVPCQGITLQNIDLEMQDGKGSTRST  418

Query  241   CSNAHGEE-TSVEPGPCLKQD  182
             C NA   E  +V P PC   D
Sbjct  419   CRNAKWREFGTVHPQPCTATD  439



>ref|XP_009595646.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Nicotiana 
tomentosiformis]
Length=406

 Score =   328 bits (841),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/408 (41%), Positives = 247/408 (61%), Gaps = 13/408 (3%)
 Frame = -1

Query  1384  EVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQ-------AFLNAWKDACSSTP  1226
               F+F+  +      +     F+V  YGA GDGM DD++       AF  AW   CSS  
Sbjct  3     RAFIFVICITPFILDKSLAAIFDVTSYGAVGDGMHDDTKVTQIISIAFKQAWTATCSSKS  62

Query  1225  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFN  1046
               ++P ++IP+  +FL++P+ F GPCKS +IH  +SG++VAP  P  W G +   W+ F 
Sbjct  63    --RNPSMLIPSEKSFLIRPITFQGPCKSSNIHLQLSGSIVAPEDPKEWRGCENVSWIYFT  120

Query  1045  GVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSS  866
             GV+GL +NG G I+G G++WW        N   CT   PTA+ F +C    LS I  V+S
Sbjct  121   GVFGLFINGSGTINGNGQRWWKIPSGIRVNGT-CT--KPTAVHFNYCNGLQLSGIKLVNS  177

Query  865   PQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFT  686
              + H+ L    G  I+N+ + +P  S NTDG+ I  S  + I  S I  GDDCI+I    
Sbjct  178   SRNHISLTYSKGVTISNIHISAPKYSRNTDGIDISNSSQLHIQDSTIQTGDDCIAINTGC  237

Query  685   NDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYAR  506
              D+ I+ + CGPGHGISVGSLG    +  V+N++++N    GT NG RIKTWQ G GYAR
Sbjct  238   VDIHISGISCGPGHGISVGSLGPDNTYAYVDNVYVTNCNLVGTQNGVRIKTWQGGSGYAR  297

Query  505   NITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNC  326
             +I FE++ + +V+NPIIIDQNYC+   +C+ Q + V++S + ++ I+G+ +++AAI+LNC
Sbjct  298   SIHFEDIHLKNVENPIIIDQNYCNGDHSCQPQESAVKVSYITYKNIHGSTSSKAAINLNC  357

Query  325   SKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCLKQ  185
             S +  C  I +++I+ITP +    V A C+NA G+ +S  P  PCL +
Sbjct  358   SNSTACTNIDMENINITPVVSGQKVFAICNNAKGKASSTSPPVPCLDK  405



>gb|KHG01626.1| hypothetical protein F383_22075 [Gossypium arboreum]
Length=401

 Score =   328 bits (840),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 175/398 (44%), Positives = 235/398 (59%), Gaps = 7/398 (2%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             ME+   +FI  L   +R +  +   FNV+DYGA GDG TDDS AF  AWK  C+S    +
Sbjct  1     MELIFSVFITILYVLTRGASGATNLFNVMDYGAVGDGKTDDSPAFSKAWKSTCNSPS--R  58

Query  1216  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  1037
             +P ++IPA   FL+KPV F+GPCKS  IH ++SG +VAP S   W G     WL+F  V 
Sbjct  59    NPILVIPASKIFLLKPVTFSGPCKSTSIHVLMSGNIVAPDSRSAWKGYHLDMWLAFTNVN  118

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQA  857
             GL + G G I+G+G  WW + C  +   EG T   PTA+ F  C    L     ++S + 
Sbjct  119   GLTIIGSGTINGRGAIWWSE-CSSYRVPEGGTCKGPTALTFYRCNGLVLKGTKHINSQRN  177

Query  856   HVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDV  677
             H+ +F C     +NL + +P  SPNTDG+ I +S +V I +S I  GDDCI+I   ++ +
Sbjct  178   HIAIFNCKDVTFSNLHISAPKTSPNTDGIDIASSSNVRILNSFIGTGDDCIAISSGSSHI  237

Query  676   EINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNIT  497
              I  + CGPGHGISVGSLG  G    VE +H+ N TF  T  G RIKTWQ G GYAR I 
Sbjct  238   NITGIACGPGHGISVGSLGAHGGNDTVEEVHVRNCTFNETMTGVRIKTWQGGVGYARKIL  297

Query  496   FENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKA  317
             FE ++    DNPIIIDQ YC   G CK + +G++ISDV ++ I GT+TT+  I+L+C + 
Sbjct  298   FEKIKFIRADNPIIIDQYYCP-GGHCKNETSGIKISDVSYRYITGTSTTDKVINLSCDQN  356

Query  316   VPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             V C  I+L  + I   +P     +   NAHG  T  +P
Sbjct  357   VGCTNIQLYYVHIISTVPGKKAYSFSFNAHGNCTHTKP  394



>ref|XP_006364236.1| PREDICTED: probable polygalacturonase At3g15720-like [Solanum 
tuberosum]
Length=407

 Score =   327 bits (839),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 241/405 (60%), Gaps = 11/405 (3%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             FY +   V L ++  + S+ +  K+FNVID+GA GDG TDD  AFL AW+  C S    +
Sbjct  8     FYLVTFLVLLCMVSSVWSADI--KTFNVIDFGAVGDGRTDDLPAFLKAWEAVCQS----E  61

Query  1216  SPQVI--IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
             S +VI  IP    FL+KP +F+GPCK   IH  VSG ++AP S   W+G  T+ WL+F  
Sbjct  62    SSRVILVIPKRKKFLLKPSEFDGPCKPSSIHIQVSGNIIAPNSKSAWDGAATNAWLTFAN  121

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             +  L VNG GV DGQG  WW  +C +    +      PTA+ F  C    +  +  + S 
Sbjct  122   INHLTVNGNGVFDGQGHIWWSNACTNDNTSQETQCKGPTALIFRRCDQLRVRGVTIIRSA  181

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             ++H+ L  CN  +I N+ + SPGDS NTDG+ +  S +V I +S I+ GDDCI+IG  ++
Sbjct  182   RSHIILTACNEVSIANIRIMSPGDSLNTDGIDVSGSTNVRIHNSLIATGDDCIAIGGGSS  241

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
             +V I+ + CGPGHGIS+GSLG+ G F  VE++++ N T   T  G RIKTWQ G GYAR 
Sbjct  242   NVSISGITCGPGHGISIGSLGEGG-FEVVEDVNVRNCTMKDTLAGVRIKTWQGGEGYARR  300

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             I FE +   +V+NPIIIDQ YC     CK     V +SD+ F+ I GT+  +  I+L+CS
Sbjct  301   IAFEGIVFVAVNNPIIIDQFYCPSRVNCKNDTAAVALSDITFRGILGTSLMDEVINLSCS  360

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             + V C  I LD + I+  +   PV A C NAHG  T   P   CL
Sbjct  361   ETVGCKNILLDRVYIS-SVNGNPVHAKCINAHGRYTHTRPAVKCL  404



>ref|XP_004498018.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score =   327 bits (839),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 170/382 (45%), Positives = 242/382 (63%), Gaps = 19/382 (5%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV++YGAKGDG TDDS AFL AW+D CS+     +P ++IP G  F+++PV F GPC S
Sbjct  35    FNVLNYGAKGDGQTDDSNAFLKAWQDVCSTR--QSNPTLLIPNGKRFMLQPVSFKGPCIS  92

Query  1141  QHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
               ++ ++ GT+ AP S   W+   G     W+ F  + GL++NGGG +DGQG  WW++  
Sbjct  93    SRVNVVLQGTISAPKSIEEWDWTKGDVGKSWIQFWHINGLVINGGGTVDGQGAPWWNK--  150

Query  970   RDHPNMEGCTDLA-PTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
                      TDL  PTA++F  C N  ++ +  ++SP+ H+ +  CNG  I+NL + +P 
Sbjct  151   -----FHDQTDLTRPTALRFSNCDNLNVATLTHINSPKNHISITSCNGVRISNLHINAPE  205

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG  I +S +++I HS IS GDDCI+I   +N + I +V CGPGHGISVGSLGK 
Sbjct  206   ESPNTDGFDISSSSNILIYHSTISIGDDCIAINSGSNFINITDVYCGPGHGISVGSLGKD  265

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G+F  VE I + N T  GTTNGARIKTW  GRGYAR ITFE+++++ VD+P+IIDQ Y +
Sbjct  266   GDFAMVEEILVKNCTISGTTNGARIKTWVGGRGYARKITFEDIKLYKVDHPVIIDQQYDA  325

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                +  +    V+ISDV +++I GT+    AI LNC+ ++ C  I  ++I I   +    
Sbjct  326   LLSSTND---AVKISDVTYRKIRGTSNDNDAIELNCA-SIGCTNIVFENIYII-GVDGET  380

Query  253   VAACCSNAHGEETSVEPG-PCL  191
              ++ C N  G  ++  P  PCL
Sbjct  381   TSSSCRNVEGTSSNCNPKIPCL  402



>gb|KEH25592.1| polygalacturonase [Medicago truncatula]
Length=400

 Score =   327 bits (839),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 244/385 (63%), Gaps = 17/385 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SFNV+DYGA G+G  D+++AF++AWKD C    +H+S  ++IP G TF+++PV F GPC 
Sbjct  29    SFNVLDYGAVGNGKNDETRAFVDAWKDTC--IAMHESSTLLIPKGKTFMLQPVWFQGPCN  86

Query  1144  SQHIHFIVSGTVVAPGSPPGW---NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             S +I+  + GT++AP +   W   N      W+ F  + GLIV GGG+IDG+G +WWD  
Sbjct  87    SSNIYVKLEGTIIAPKNIEAWKWPNDNYKGSWIRFIEISGLIVYGGGIIDGKGAQWWD--  144

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C  H N++ C    PTA+ F  C N  L  +  ++SP+ H+ L  C+G +I+ L + +P 
Sbjct  145   C--HSNIK-CEKENPTALHFHACENLILRELTHINSPRNHISLNACHGSHISKLHIIAPN  201

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG+ I  S +++I +SKI  GDDCI+I   +N + IN + CGPGHGISVGSLG++
Sbjct  202   ESPNTDGIDIAESSNIIIENSKIETGDDCIAINHGSNSIYINGIFCGPGHGISVGSLGRN  261

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G    VENI++ N TF  TTNGARIKTW  G GYAR +TFE++ +   DNP+IIDQ Y  
Sbjct  262   GVHESVENIYVRNCTFNRTTNGARIKTWIGGNGYARKVTFEDIILIEADNPVIIDQEYNP  321

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
             Y     +    V++SDV F+ I GT+  + AI L+C + + C  I L+ I+IT  I    
Sbjct  322   Y-----DSAYAVKVSDVTFRNIRGTSIAKHAIQLHCDEDITCTNIILEGINITSSIGE-E  375

Query  253   VAACCSNAHGEETSVEPG-PCLKQD  182
             V A C N +G  TS  P  PCL  +
Sbjct  376   VHASCKNVNGVCTSCIPYVPCLSLE  400



>ref|XP_004498026.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 242/382 (63%), Gaps = 19/382 (5%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV++YGAKGDG TDDS AFL AW+D CS+     +P ++IP G  F+++PV F GPC S
Sbjct  35    FNVLNYGAKGDGQTDDSNAFLKAWQDVCSTR--QSNPTLLIPNGKRFMLQPVSFQGPCIS  92

Query  1141  QHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
               ++ ++ GT+ AP S   W+   G     W+ F  + GL++NGGG +DGQG  WW++  
Sbjct  93    SRVNVVLQGTISAPKSIEEWDWTKGDVGKSWIQFWHINGLVINGGGTVDGQGAPWWNK--  150

Query  970   RDHPNMEGCTDLA-PTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
                      TDL  PTA++F  C N  ++ +  ++SP+ H+ +  C+G  I+NL + +P 
Sbjct  151   -----FHDQTDLTRPTALRFSNCDNLNVATLTHINSPKNHISITSCDGVRISNLHINAPE  205

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG  I +S +++I HS IS GDDCI+I   +N + I +V CGPGHGISVGSLGK 
Sbjct  206   ESPNTDGFDISSSSNILIYHSTISTGDDCIAINSGSNFINITDVYCGPGHGISVGSLGKD  265

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G+F  VE + + N TF GTTNGARIKTW  GRGYAR ITFE+++++ VD+P+IIDQ Y +
Sbjct  266   GDFAMVEEVLVKNCTFSGTTNGARIKTWVGGRGYARKITFEDIKLYKVDHPVIIDQQYDA  325

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                +  +    V+ISDV +++I GT+    AI LNC+ ++ C  I  ++I I   +    
Sbjct  326   LLSSTND---AVKISDVTYRKIRGTSNDNDAIELNCA-SIGCTNIVFENIYII-GVDGET  380

Query  253   VAACCSNAHGEETSVEPG-PCL  191
              ++ C N  G  +   P  PCL
Sbjct  381   TSSSCRNVEGTSSYCNPKIPCL  402



>ref|XP_004986166.1| PREDICTED: polygalacturonase-like, partial [Setaria italica]
Length=479

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/381 (44%), Positives = 238/381 (62%), Gaps = 7/381 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD++A   AWK AC+S    +   V++P G  +L+K V+  GPCKS
Sbjct  105   FSLDRYGARGDGRHDDTRALAKAWKAACASP---RPAVVLVPGGKRYLLKLVRLAGPCKS  161

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               +   V GT+VA  +   W+  D   W+ F+ V  L VNGGG +DG G+ WW  SC+ +
Sbjct  162   SVV-LTVKGTLVASPNRADWSDRDRRHWIVFSAVDKLTVNGGGAVDGNGETWWKHSCKIN  220

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               M  C + APTA+ F +C    + ++  V+S Q H+ +  C    +  L++ + G SPN
Sbjct  221   KAMP-CKE-APTALSFHYCTGLRVQDLKIVNSQQIHMSIEDCTNVQLAGLSITASGTSPN  278

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T+ KI  GDDC+SI + T+++ ++ V CGPGHGIS+GSLG   +  
Sbjct  279   TDGIHITRSKDVQVTNCKIKTGDDCMSIENGTHNLYVSKVVCGPGHGISIGSLGDDNSRA  338

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I     YGTTNGARIKT+Q G GYA++ITF+N+ + +V NPIIIDQNYC     
Sbjct  339   EVSGITIDTVQLYGTTNGARIKTYQGGSGYAKDITFQNMIMDNVKNPIIIDQNYCDKAKP  398

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK QG+ V++S+VVF+ I GT  T+ AI LNCSK VPC GI L +ID+  +       + 
Sbjct  399   CKAQGSAVEVSNVVFKNIRGTTVTKDAIKLNCSKNVPCHGITLQNIDLKMEGGDGAAEST  458

Query  241   CSNAHGEET-SVEPGPCLKQD  182
             C NA   ++ +V P PC  ++
Sbjct  459   CQNAKWRKSGTVRPQPCTSKN  479



>ref|XP_010318778.1| PREDICTED: probable polygalacturonase At3g15720 [Solanum lycopersicum]
Length=407

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/406 (44%), Positives = 242/406 (60%), Gaps = 13/406 (3%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSR-VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
             FY   +  FL +L ++SS R    K+FNVID+GA GDG TDD  AFL AW+  C S    
Sbjct  8     FY---LVTFLVLLCIVSSVRSADIKTFNVIDFGAVGDGRTDDLPAFLKAWEAVCQS----  60

Query  1219  KSPQVI--IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFN  1046
             +S +VI  IP    FL+KP +F+GPCK   IH  VSG ++AP S   W+G  T+ WL+F 
Sbjct  61    ESSRVILVIPKRKKFLLKPSEFDGPCKPSSIHIQVSGNIIAPNSKSAWDGAATNAWLTFA  120

Query  1045  GVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSS  866
              +  L VNG GV DG G  WW  +C +           PTA+ F  C    +  +  + S
Sbjct  121   NIDHLTVNGNGVFDGLGHIWWSNACTNDNTSPETQCKGPTALIFRRCDQLRVRGVTMIRS  180

Query  865   PQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFT  686
             P++H+ L  CN  +I N+ + SPGDS NTDG+ +  S +V I +S I+ GDDCI+IG  +
Sbjct  181   PRSHIILTACNEVSIANIRIMSPGDSLNTDGIGVSGSTNVQIQNSLIATGDDCIAIGGGS  240

Query  685   NDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYAR  506
             +++ I+ + CGPGHGIS+GSLG+ G F  VE++++ N T   T  G RIKTWQ G GYAR
Sbjct  241   SNISISGITCGPGHGISIGSLGEGG-FEVVEDVNVRNCTMKDTLAGVRIKTWQGGEGYAR  299

Query  505   NITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNC  326
              I FE +   +V+NPIIIDQ YC     CK+    V +SD+ F+ I GT+  +  I+L+C
Sbjct  300   RIAFEGIVFVAVNNPIIIDQFYCPSRVNCKKDTAAVALSDITFRGILGTSLMDEVINLSC  359

Query  325   SKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             S+ V C  I +D + I+  +   PV A C NAHG  T   P   CL
Sbjct  360   SETVGCKNILVDRVYIS-SVNGNPVHAKCINAHGRYTHTSPAVKCL  404



>ref|XP_007212964.1| hypothetical protein PRUPE_ppa021095mg [Prunus persica]
 gb|EMJ14163.1| hypothetical protein PRUPE_ppa021095mg [Prunus persica]
Length=621

 Score =   333 bits (854),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 179/409 (44%), Positives = 246/409 (60%), Gaps = 17/409 (4%)
 Frame = -1

Query  1381  VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTPVHKSPQV  1205
             V + +F +G     R    +FNV+DYGA GDG TDDS+AFL AW + C ++   +  P +
Sbjct  6     VLILIFWIGFGHGQR----TFNVLDYGATGDGKTDDSKAFLKAWGELCGAADEPNGMPTL  61

Query  1204  IIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT-SQWLSFNGVYGLI  1028
             +IP    FL++P++F GPC S  +H  + G +VAP    GW   ++ S WL F  V  L+
Sbjct  62    VIPEMKAFLLQPIKFRGPCNSDGVHVQIMGKLVAPKMLDGWTECESDSDWLQFKDVGNLV  121

Query  1027  VNGGGVIDGQGKKWW------DQSCRD-HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVS  869
             V+G G IDGQG  WW      D+  R    N + C   AP A+ F  C N  LS +  ++
Sbjct  122   VDGSGEIDGQGSSWWTTPNQYDRLSRKLMMNKQNCK--APDALHFHGCDNLKLSGLTHLN  179

Query  868   SPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDF  689
             S +AH+ +  CN   +++LT+ +P DSPNTDG+ I  S++V I HS I  GDDCI+I   
Sbjct  180   SARAHIAISGCNNVYVSHLTITAPEDSPNTDGIDISNSRNVFIQHSAIGTGDDCIAINGG  239

Query  688   TNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYA  509
              +D+ I N+ CGPGHGISVGSLG +G    V+N+++ +S+F GTTNGARIKTWQ G GYA
Sbjct  240   CSDLNIANIACGPGHGISVGSLGANGALETVQNVYVRDSSFSGTTNGARIKTWQGGSGYA  299

Query  508   RNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLN  329
             +NITFE + + +  NPIIIDQ YC+    CK Q + + + DV +    GT+  E AI L+
Sbjct  300   KNITFEKITLDAAKNPIIIDQFYCNNDHNCKSQASALLVEDVKYIDFEGTSANEEAIKLD  359

Query  328   CSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEE--TSVEPGPCLK  188
             C +   C  I +D I IT  +P   + A C+NA G    T V   PCLK
Sbjct  360   CDQNSGCRNIIMDRIKITSAVPDKKIYASCNNAIGTSIGTIVPNVPCLK  408



>ref|XP_003566989.1| PREDICTED: polygalacturonase-like [Brachypodium distachyon]
Length=424

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/410 (43%), Positives = 240/410 (59%), Gaps = 12/410 (3%)
 Frame = -1

Query  1408  LYCCFYS---MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  1238
             L CC  +   MEV      +        S   FNV+ YGA GDG  DD++A    W  AC
Sbjct  17    LVCCVLAKGHMEVIPLTNGVDHRGRFLASNNVFNVLRYGAHGDGRHDDTKALEKTWAAAC  76

Query  1237  SSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ  1061
             SS+     P ++ IP G+ +L K V F+GPCKS +I  ++ GT+VAP     W       
Sbjct  77    SSS----HPGILLIPKGNKYLTKHVTFSGPCKS-NIKLMIEGTLVAPQKRSYWIEQTIRH  131

Query  1060  WLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNI  881
             W+ F  V GL V GGG IDG GK WW  SC+   N E     +P A+ F  C N  ++N+
Sbjct  132   WILFKAVRGLTVTGGGTIDGNGKIWWQNSCK--VNAELPCRQSPAALTFYSCTNLKVNNL  189

Query  880   HFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCIS  701
               ++S Q H+ +  C+   I+ L++ +P  SPNTDG+HI  SK V +    I  GDDC+S
Sbjct  190   ELLNSQQIHMSVECCSDVRISRLSITAPSTSPNTDGIHIAHSKDVKVRDCAIKTGDDCMS  249

Query  700   IGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTG  521
             I D T ++ + N+ CGPGHGIS+GSLG   +  +V NI I     +GTTNGARIKTWQ G
Sbjct  250   IEDGTKNLHVKNIVCGPGHGISIGSLGDRNSEAEVANITIDGVRLHGTTNGARIKTWQGG  309

Query  520   RGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAA  341
             RGYA+NI F+N+ + +V NPIII+QNYC     CK+Q + V++S+V+F+ I GT+ +  A
Sbjct  310   RGYAKNIVFQNIIMDNVWNPIIINQNYCDSATPCKKQQSAVEVSNVLFKNIRGTSASREA  369

Query  340   ISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPC  194
             I LNCS  VPC GI L ++ +T +  S    + C NA   +  +V P PC
Sbjct  370   IKLNCSPTVPCHGIALHNVRLTLKRGSGDAKSTCHNAQWRKLGTVMPQPC  419



>gb|AFK43754.1| unknown [Medicago truncatula]
Length=400

 Score =   325 bits (834),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 243/385 (63%), Gaps = 17/385 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SFNV+DYGA G+G  D+++AF++AWKD C    +H+S  ++IP G TF+++PV F GPC 
Sbjct  29    SFNVLDYGAVGNGKNDETRAFVDAWKDTC--IAMHESSTLLIPKGKTFMLQPVWFQGPCN  86

Query  1144  SQHIHFIVSGTVVAPGSPPGW---NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             S +I+  + GT++AP +   W   N      W+ F  + GLIV GGG+IDG+G +WWD  
Sbjct  87    SSNIYVKLEGTIIAPKNIEAWKWPNDNYKGSWIRFIEISGLIVYGGGIIDGKGAQWWD--  144

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C  H N++ C    PTA+ F  C N  L  +  ++SP+ H+ L  C+G +I+ L + +P 
Sbjct  145   C--HSNIK-CEKENPTALHFHACENLILRELTHINSPRNHISLNACHGSHISKLHIIAPN  201

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG+ I  S +++I +SKI  GDDCI+I   +N + IN + CGPGHGISVGSLG++
Sbjct  202   ESPNTDGIDIAESSNIIIENSKIETGDDCIAINHGSNSIYINGIFCGPGHGISVGSLGRN  261

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G    VEN ++ N TF  TTNGARIKTW  G GYAR +TFE++ +   DNP+IIDQ Y  
Sbjct  262   GVHESVENTYVRNCTFNRTTNGARIKTWIGGNGYARKVTFEDIILIEADNPVIIDQEYNP  321

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
             Y     +    V++SDV F+ I GT+  + AI L+C + + C  I L+ I+IT  I    
Sbjct  322   Y-----DSAYAVKVSDVTFRNIRGTSIAKHAIQLHCDEDITCTNIILEGINITSSIGE-E  375

Query  253   VAACCSNAHGEETSVEPG-PCLKQD  182
             V A C N +G  TS  P  PCL  +
Sbjct  376   VHASCKNVNGVCTSCIPYVPCLSLE  400



>ref|XP_007163810.1| hypothetical protein PHAVU_001G266200g [Phaseolus vulgaris]
 gb|ESW35804.1| hypothetical protein PHAVU_001G266200g [Phaseolus vulgaris]
Length=392

 Score =   325 bits (833),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/400 (43%), Positives = 249/400 (62%), Gaps = 18/400 (5%)
 Frame = -1

Query  1378  FVFLFILGLISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQV  1205
             FV L  + +I+SS    S  +FNV+ YGA G+G TDD+QAFL AWKD C +T      ++
Sbjct  6     FVLLIFVRVIASSTFCPSSLTFNVLSYGATGNGHTDDTQAFLKAWKDVCGAT--RNYVKL  63

Query  1204  IIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ-WLSFNGVYGLI  1028
             +IP    FL++P+ F GPC    I  ++ GTV AP     W  LD  + W+ F+ + GL+
Sbjct  64    LIPDNKMFLLQPLSFKGPCNPATIEVLLEGTVTAPERVGVWKFLDNRRKWIQFSDISGLV  123

Query  1027  VNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQ  848
             + GGG IDGQG  WW+ +  D  N        PTA+ F  C +  LS+IH  +SP+ H+ 
Sbjct  124   MKGGGQIDGQGAAWWNSN--DVSNR-------PTALHFHNCKDVRLSSIHHKNSPRNHIS  174

Query  847   LFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEIN  668
             +  CN   I+++ + +P +SPNTDG+ I  S ++ I  S I  GDDCI+I   T+ V I+
Sbjct  175   IDTCNSLEISHIHITAPEESPNTDGIDISGSSNIFIHSSHIQTGDDCIAINSGTSSVNIS  234

Query  667   NVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFEN  488
             ++ CGPGHGIS+GSLG++G   +VE I++ N TF GT+NG R+KTW+ GRGYAR I FE+
Sbjct  235   DIFCGPGHGISIGSLGRNGEDARVEEIYVRNCTFVGTSNGVRVKTWRGGRGYARKIRFED  294

Query  487   LQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPC  308
             ++V  V  P+IIDQ Y S     + + + V+IS+V ++ + GT+++++A+ L+C   V C
Sbjct  295   IKVVGVKQPVIIDQEYSSVE--MESERSAVKISEVSYRNVKGTSSSDSAVELSCDPNVGC  352

Query  307   LGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP-GPCL  191
               I ++ I IT +  SV  A+ C+NAHG  +   P  PCL
Sbjct  353   SEILMEDISITKEDGSVATAS-CTNAHGTSSHCNPIVPCL  391



>ref|XP_008665635.1| PREDICTED: polygalacturonase-like [Zea mays]
 ref|XP_008665636.1| PREDICTED: polygalacturonase-like [Zea mays]
 tpg|DAA52075.1| TPA: hypothetical protein ZEAMMB73_445912 [Zea mays]
Length=436

 Score =   326 bits (836),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 235/377 (62%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             ++V  YGA+GDG  DD++A   AWK AC+S    +   V++P G  +L+K +   GPCKS
Sbjct  62    YSVDRYGARGDGRNDDTRALEMAWKAACASP---RPAVVLVPDGRRYLLKLLTLRGPCKS  118

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               +   V GT+VA  +   W+  D   W+ F  +  L VNGGG IDG G+KWW  SC+ +
Sbjct  119   S-VTLTVKGTLVASPNRADWSDNDRRHWIVFRSIDKLTVNGGGAIDGNGEKWWPHSCKIN  177

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  C + APTA+ F +C++  + ++  V+S Q H+ +       +  L++ +PG SPN
Sbjct  178   KALP-CKE-APTALSFHYCVDLKVEDLKIVNSQQIHMSVEDSANALLARLSITAPGTSPN  235

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T  KI  GDDC+SI + T+++ ++ V CGPGHGIS+GSLG   +  
Sbjct  236   TDGIHITRSKDVRVTDCKIKTGDDCMSIENGTHNLHVSKVNCGPGHGISIGSLGDDNSRA  295

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I +   +GTTNGARIKT+Q G GYA++ITF+N+ ++ V NPIIIDQNYC     
Sbjct  296   EVSGITIDSVQLHGTTNGARIKTYQGGSGYAKDITFQNMVMYDVKNPIIIDQNYCDKAKP  355

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C EQ + VQ+S VVF+ I GT +T+ AI +NCS+ VPC GI L +ID+  Q       + 
Sbjct  356   CGEQESAVQVSGVVFKNIRGTTSTKDAIKMNCSENVPCQGITLQNIDLKMQDGKGNTRST  415

Query  241   CSNAHGEE-TSVEPGPC  194
             C NA   E  +V P PC
Sbjct  416   CQNAKWTEFGTVRPQPC  432



>gb|KCW68966.1| hypothetical protein EUGRSUZ_F02531 [Eucalyptus grandis]
Length=381

 Score =   324 bits (831),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/381 (43%), Positives = 230/381 (60%), Gaps = 12/381 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             SF+V+ YGA GDG TDDS AFL AW  AC S+   K   + +PA  TFL+KPV F+GPC+
Sbjct  12    SFDVLSYGAVGDGKTDDSPAFLEAWNAACISSS--KLSILTVPAKKTFLLKPVTFSGPCQ  69

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
              ++++ +VSG + AP S   ++G  T+ WL+F+ V GL++ G G+IDG+G  WW Q C  
Sbjct  70    PEYMYVLVSGNIAAPNSMTDYSGYQTNSWLAFSNVSGLMITGTGIIDGKGSGWWSQPCIG  129

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
             +         A  A+ F  C    L+ +  V+SP++H+ L  C    I+N+ + +P  SP
Sbjct  130   N---------ASNALTFYRCTRLVLNGLRHVNSPRSHIALTSCQFVTISNIHISAPATSP  180

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S HV +  S I  GDDCI+I   ++ + +  + CGPGHGIS+GSLG  G  
Sbjct  181   NTDGIDISGSTHVYVRDSFIGTGDDCIAISAGSSHINVTRITCGPGHGISIGSLGAHGEN  240

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
               VEN+ + N T  GT  G RIKTWQ G GYAR ITF  ++   VDNPIIIDQ YC    
Sbjct  241   DTVENVTVQNCTLKGTMTGVRIKTWQGGIGYARKITFNKIRFIRVDNPIIIDQYYCPTQV  300

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK + +G+++SD+ +  I GT+ T+  I+L+C +   C  I LD + IT  +P+    +
Sbjct  301   GCKNETSGIRVSDISYSVIYGTSVTDKVINLSCDQNFGCSNIVLDHVYITSTVPNKKAYS  360

Query  244   CCSNAHGEETSVEPG-PCLKQ  185
              C NAHG+ +   P   CL +
Sbjct  361   YCFNAHGKYSHTRPAVTCLLK  381



>ref|XP_003559272.2| PREDICTED: polygalacturonase ADPG1-like [Brachypodium distachyon]
Length=411

 Score =   325 bits (833),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 167/381 (44%), Positives = 239/381 (63%), Gaps = 7/381 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V +YGA+GDG  DD+QA   AW  ACSS+   +   +++P G ++L+K +  +GPCKS
Sbjct  37    FSVDNYGARGDGKHDDTQALAKAWNAACSSS---RPAVLLVPKGKSYLLKSLTLSGPCKS  93

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
              ++ F+V GT+VAP S   W+  +   W+  +GV GL V GGG IDG G  WW  SC+  
Sbjct  94    -NVAFMVKGTLVAPQSRSDWSEDNRRHWIVLHGVSGLTVTGGGTIDGNGDIWWKNSCKID  152

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT+ APTA+ F  C N T+ NI  V S Q ++ +  C+   +  L++ +PG SPN
Sbjct  153   KALP-CTE-APTALTFHMCDNLTVENIRIVDSQQINLSVEDCSDVRLARLSITAPGTSPN  210

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +    I  GDDC+SI D T+++ ++ V CGPGHGIS+GSLG   +  
Sbjct  211   TDGIHITRSKDVQVRDCLIKTGDDCMSIEDGTHNLRVSKVVCGPGHGISIGSLGDDNSRA  270

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I+I     YGTTNGAR+KT+Q G GYA++I F+N+ + +V NPIIIDQNYC     
Sbjct  271   EVSGIYIDTVQLYGTTNGARVKTYQGGSGYAKDIVFQNIIMDNVQNPIIIDQNYCDSAKP  330

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK Q   V+IS+VVF+ I GT  ++ AI LNCS +V C  I L++I++  +       + 
Sbjct  331   CKNQELAVEISNVVFKNIRGTTVSKDAIQLNCSNSVSCSDIVLENINLKMEGGEGETEST  390

Query  241   CSNAHGEET-SVEPGPCLKQD  182
             C NA   ++ +V P PC  ++
Sbjct  391   CQNARWRKSGNVSPLPCKNKN  411



>ref|XP_007150743.1| hypothetical protein PHAVU_005G177000g [Phaseolus vulgaris]
 gb|ESW22737.1| hypothetical protein PHAVU_005G177000g [Phaseolus vulgaris]
Length=401

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/393 (43%), Positives = 241/393 (61%), Gaps = 4/393 (1%)
 Frame = -1

Query  1378  FVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
             F  L IL +I+    S  + FNV+ YGA GDG T+DS AFL AWKD C S   H S Q+I
Sbjct  5     FTVLIILSVIAPGLSSTTTTFNVLQYGAVGDGQTNDSPAFLKAWKDVCQSKS-HIS-QLI  62

Query  1201  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  1022
             IPA  TF++KP  F+GPCKS + +  +SG +VAP +   ++G  T+ WL F+ + GLI++
Sbjct  63    IPAKRTFMLKPTTFSGPCKSNYTYIQLSGNIVAPKTKSEYSGFHTNTWLGFSFIDGLIIS  122

Query  1021  GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLF  842
             G G IDG+G  WW Q C  + +  G T   PTA+ F  C    L     ++  ++H+ L 
Sbjct  123   GKGSIDGRGSIWWQQPCLGN-SQPGTTCRPPTAVTFNRCNRLQLKGYTSINPARSHMTLT  181

Query  841   VCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNV  662
              C    ++NL + +PG SPNTDG+ I  S+ + + +S I+ GDDCI+I   ++ + I+ +
Sbjct  182   SCQKGTLSNLRLVAPGTSPNTDGIDISGSRDIQVLNSSIATGDDCIAISAGSSKITISGI  241

Query  661   QCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQ  482
              CGPGHGIS+GSLG  G    VE++H+ N T   T  G RIKTWQ G G+AR I+FE ++
Sbjct  242   TCGPGHGISIGSLGTRGETDIVEDVHVENCTLTETLTGVRIKTWQGGAGFARRISFEKIK  301

Query  481   VFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLG  302
                 +NPIIIDQ YC +   C+ +   +++SD+ ++ I GT+ T+ AI+L+C + V C  
Sbjct  302   FVRANNPIIIDQFYCPHRSDCQNKTQSIKVSDITYKGIVGTSLTDKAINLSCDENVGCSN  361

Query  301   IKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             I LD + IT  +P   V + C NAHG  T  +P
Sbjct  362   IVLDHVYITSAVPGQKVFSFCHNAHGTATHTKP  394



>ref|XP_002463688.1| hypothetical protein SORBIDRAFT_01g004230 [Sorghum bicolor]
 gb|EER90686.1| hypothetical protein SORBIDRAFT_01g004230 [Sorghum bicolor]
Length=436

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/378 (44%), Positives = 233/378 (62%), Gaps = 7/378 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD+ A   AW+ AC+S    +   V++P G  +L+K V   GPCKS
Sbjct  62    FSLDSYGARGDGRHDDTPALEKAWEAACASP---RPAVVLVPNGGRYLLKLVTLRGPCKS  118

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               +   V GT+VA      W+  D   W+ F  V  L VNGGG IDG G+KWW  SC+ +
Sbjct  119   S-VTLTVKGTLVASPDRADWSDKDRRHWIVFRRVNKLTVNGGGTIDGNGQKWWPHSCKIN  177

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +     +APTA+ F  C N  + N+  ++  Q H+ +  C    +  L++ +P  SPN
Sbjct  178   KTLP--CKVAPTALSFHHCTNLRVDNLKIMNGQQMHMSVEDCTDVVLARLSITAPARSPN  235

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK+V +T+ KI  GDDC+SI + T+++ ++ V CGPGHGIS+GSLG   +  
Sbjct  236   TDGIHITRSKNVRVTNCKIKTGDDCMSIENGTHNLHVSKVVCGPGHGISIGSLGDDNSRA  295

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I +   YGTTNGARIKT+Q G GYA++ITF+N+ ++ V NPIIIDQNYC     
Sbjct  296   EVSGITIDSVQLYGTTNGARIKTYQGGSGYAKDITFQNMIMYGVKNPIIIDQNYCDKATP  355

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C EQ + V++S+VVF+ I GT  T+ AI +NCSK VPC GI L +ID+  +     + + 
Sbjct  356   CAEQRSAVRVSNVVFKNIRGTTITKHAIKMNCSKNVPCQGITLKNIDMKLKGGKGNIDST  415

Query  241   CSNAHGEETS-VEPGPCL  191
             C NA   ++  V P PC+
Sbjct  416   CQNAKWRKSGFVHPQPCI  433



>ref|XP_009355876.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=399

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/402 (42%), Positives = 237/402 (59%), Gaps = 13/402 (3%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  1208
             + + +F  +L  +     S K+F+V++Y A GDG  DDS+AF+NAWK  C +  V   P 
Sbjct  6     VSLLIFSIVLSGLIDIGYSEKTFDVLNYRAVGDGEADDSEAFVNAWKALCGADEVGDVPT  65

Query  1207  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  1028
             ++IP G TFL++P++F GPC+   +H  V G VVAP +   W    ++ WL F  V  L 
Sbjct  66    LVIPKGKTFLLQPIEFEGPCRPTRVHIQVLGNVVAPKTVDAWECPSSNAWLQFTNVANLT  125

Query  1027  VNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQ  848
             ++G G IDGQG  WW  S  +             A+ F  C N  LS +  V+SP+AH+ 
Sbjct  126   LDGSGTIDGQGSSWWSNSIANQLQ----------ALHFNNCNNLRLSGLTHVNSPKAHIG  175

Query  847   LFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEIN  668
             +  C   ++++LT+ +P +SPNTDG+ I  S  V I  S I  GDDCI+I   ++++ + 
Sbjct  176   ITHCINVDVSHLTIIAPAESPNTDGIDISNSISVNIHDSFIGTGDDCIAINSGSSNINVT  235

Query  667   NVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFEN  488
             N+ CGPGHGISVGSLGK+G    VEN+ + + +F GT NGARIKTWQ G GYA+NI FE 
Sbjct  236   NIACGPGHGISVGSLGKNGAHETVENVSVRDCSFNGTQNGARIKTWQGGSGYAKNIVFEK  295

Query  487   LQVFSVDNPIIIDQNYCSYPGT--CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
             + + +  NPIIIDQ YC       CK Q + V +SDV +    GT+ +E AI LNC++  
Sbjct  296   ITLVAAANPIIIDQFYCDAEAKLRCKNQTSAVTVSDVRYIDFQGTSGSEEAIKLNCNQIQ  355

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCL  191
              C  I +  I IT  +PS  + A CS+A G    S  P PCL
Sbjct  356   GCQNIVMQEIRITSAVPSKKIYASCSHAKGTCNDSTVPVPCL  397



>ref|XP_004959073.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=417

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/413 (43%), Positives = 245/413 (59%), Gaps = 9/413 (2%)
 Frame = -1

Query  1429  LSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAW  1250
             LSA++   +   +S+     +  + L   S  S K FNV  YGA GDG  DD+++    W
Sbjct  9     LSATLLVFF--LWSVGADKDINGITLRGRSLESKKVFNVRRYGAHGDGRHDDTRSIAKTW  66

Query  1249  KDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLD  1070
               ACSS+   +S  V+IP G   L+  V  +GPCKS  I  ++ GT++AP     W+   
Sbjct  67    AAACSSS---QSAVVLIPRGKRHLINHVTLSGPCKSS-IMLMIEGTLMAPPKGSHWSKKT  122

Query  1069  TSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTL  890
                W+ FN V GL + GGG IDG GK WW  SC+   N       APTA+ F  C N  L
Sbjct  123   NRHWIMFNDVDGLTIAGGGTIDGNGKIWWQNSCK--TNSRPPCKQAPTALTFYSCKNLKL  180

Query  889   SNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDD  710
              N+  V+S Q H+ +  C+   I  L++ +PG SPNTDG+HI  SKHV +    I  GDD
Sbjct  181   ENLKLVNSQQIHMSVEDCSHVKIARLSITAPGTSPNTDGIHITRSKHVQVRDCTIKTGDD  240

Query  709   CISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTW  530
             C+SI D T ++  +N+ CGPGHGIS+GSLG  G+   V N+ +  +  YGT NGARIKTW
Sbjct  241   CMSIEDGTENLHASNIVCGPGHGISIGSLGDRGSRAHVVNVTVDTAWLYGTANGARIKTW  300

Query  529   QTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATT  350
             Q GRGYA+NI FEN+ +  V NPI+IDQNYC     C++Q + V++S+V+F+ I GT+ +
Sbjct  301   QGGRGYAKNIVFENMVMGDVRNPIVIDQNYCDSATPCRKQKSAVEVSNVLFKNIRGTSAS  360

Query  349   EAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPC  194
             + AI L CS +VPC GI L+++ +T +       + C NA   ++ +V P PC
Sbjct  361   KEAIKLRCSTSVPCHGITLENVKLTLKGGDGVAKSTCENAKWRKSGTVTPQPC  413



>ref|XP_003566446.1| PREDICTED: polygalacturonase-like [Brachypodium distachyon]
Length=424

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 178/418 (43%), Positives = 247/418 (59%), Gaps = 12/418 (3%)
 Frame = -1

Query  1432  ILSASIFAL--YCCFYS---MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQ  1268
             I  ASI  +  +CC  +   M+V            S  S   F+V+ YGA GDG  DD++
Sbjct  7     IFPASILVVLFFCCVLAKGDMKVVSLTNGADHRGRSLKSNSVFDVLRYGALGDGHHDDTK  66

Query  1267  AFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPP  1088
                 AW  ACSS+  H S  V++P G  +L K V F+GPCKS +I+F++ GT+VAP    
Sbjct  67    GLAKAWAAACSSS--HPSI-VLLPKGKKYLTKHVTFSGPCKS-NINFMIEGTLVAPPKRS  122

Query  1087  GWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMF  908
              W       W+ F  V GL V G G IDG GK WW  SC+ +  +  C   +PTA+ F  
Sbjct  123   YWIEATIRHWILFKAVRGLTVTGVGTIDGNGKLWWQNSCKVNSKLP-CRQ-SPTALTFYS  180

Query  907   CINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSK  728
             C N  ++N+  ++S Q H+ +  C    I  L++ +P  SPNTDG+HI  SK V + +  
Sbjct  181   CTNLKVNNLKLLNSQQIHMSVERCTDVRIFRLSITAPSSSPNTDGIHIAHSKGVKVRNCM  240

Query  727   ISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNG  548
             I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  QV NI I     +GTTNG
Sbjct  241   IRTGDDCLSIEDGTKNLHVKNIVCGPGHGISIGSLGDQNSEAQVANITIDGVRLHGTTNG  300

Query  547   ARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRI  368
             ARIKTWQ GRGYA+NI F+N+ + +V NPIIIDQNYC     CK+Q + V++S+V+F+ I
Sbjct  301   ARIKTWQGGRGYAKNIVFQNMIMDNVWNPIIIDQNYCDSATPCKKQKSAVEVSNVLFKNI  360

Query  367   NGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGP  197
              GT+ +  AI L+CS+A PC GI L ++ +T +       + C NA  ++  +V P P
Sbjct  361   RGTSASREAIKLSCSRAAPCHGIALHNVKLTLKRGGGNAKSTCQNAKWKKLGTVMPQP  418



>ref|XP_004497875.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=403

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 241/382 (63%), Gaps = 19/382 (5%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV++YGAKGDG TDDS AFL AW+D CS+     +P ++IP G  FL++PV F GPCKS
Sbjct  35    FNVLNYGAKGDGQTDDSNAFLRAWQDVCSTR--QSNPILLIPNGKRFLLQPVSFRGPCKS  92

Query  1141  QHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
               ++ ++ GT+ AP S   W+   G     W+ F  + GL++NGGG +DGQG  WW++  
Sbjct  93    SRVNVVLQGTISAPKSIEEWDWTKGDVGKSWIQFWHINGLVINGGGTVDGQGAPWWNK--  150

Query  970   RDHPNMEGCTDLA-PTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
                      TDL  PTA++F  C N  ++ +  ++SP+ H+ +  C+G  I++L + +P 
Sbjct  151   -----FHDQTDLTRPTALRFSNCDNLNVATLTHINSPKNHISITSCHGVRISHLHINAPE  205

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG  I +S +++I  S IS GDDCI+I   +N + I +V CGPGHGISVGSLGK 
Sbjct  206   ESPNTDGFDISSSSNILIYRSTISTGDDCIAINSGSNFINITDVYCGPGHGISVGSLGKG  265

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G+F  VE I + N TF GTTNGARIKTW  GRGYAR ITFE+++++ V +P+IIDQ Y +
Sbjct  266   GDFAMVEEILVKNCTFRGTTNGARIKTWVGGRGYARKITFEDIKLYKVSHPVIIDQQYDA  325

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                +  +    V+ISDV +++I GT+    AI LNC+ ++ C  I  ++I I   +    
Sbjct  326   LLSSTND---AVKISDVTYRKIRGTSNDNDAIELNCA-SIGCTNIVFENIYII-GVDRET  380

Query  253   VAACCSNAHGEETSVEPG-PCL  191
              ++ C N  G  +   P  PCL
Sbjct  381   TSSSCRNVEGTSSYCNPKIPCL  402



>gb|KGN52885.1| hypothetical protein Csa_4G004940 [Cucumis sativus]
Length=414

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/382 (44%), Positives = 230/382 (60%), Gaps = 16/382 (4%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTPVHKSPQVIIPAGSTFLVKPVQFNGP  1151
             K+ +VI YGA GDG TDDS+AFL AWK  C ++TP      +++P+  TFL+ PVQF GP
Sbjct  46    KAIDVIQYGAAGDGKTDDSRAFLKAWKAVCEANTP----SAMLVPSTKTFLLNPVQFQGP  101

Query  1150  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
             C S  +   + G +VAP     W   D   WL F+ V  L++ G G IDGQG  WWD   
Sbjct  102   CMSSSVGVQILGKIVAPSDLDAWKVFDAKNWLLFSNVSRLVIQGNGEIDGQGAAWWD---  158

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             RD       +D  PTA+    C    LS +   +SPQ+H+ +  CN  +I+ L + +P +
Sbjct  159   RD-------SDGKPTALAIYDCDGLHLSGLTHSNSPQSHMHIVRCNHASISKLNIVAPEN  211

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+ +  S HV I +  I  GDDCI+I + T+++ I N+QCGPGHGIS+GSLGK G
Sbjct  212   SPNTDGIDVAHSSHVKIHNCNIGTGDDCIAISEGTSNIHIANIQCGPGHGISIGSLGKDG  271

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
                 VE++ + N    GT  GARIKTWQ G GYAR I+F+ + +  V  PI+IDQ YC+ 
Sbjct  272   TSSSVEDVRVQNCHLKGTMYGARIKTWQGGAGYARKISFQGITLDQVHKPILIDQYYCNG  331

Query  430   PGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPV  251
                CK Q + V++SDV++Q ++GT+ TE A+ L+CS+ V C  I L+ IDI         
Sbjct  332   KTDCKNQTSAVEVSDVLYQGLHGTSATEVAVELSCSETVGCRNIVLEDIDIRYADSDKIA  391

Query  250   AACCSNAHGEETSVEPG-PCLK  188
              + C +AHG  T+  P   CLK
Sbjct  392   QSSCDDAHGTSTNTFPAVDCLK  413



>ref|XP_009802084.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=455

 Score =   324 bits (831),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 170/418 (41%), Positives = 251/418 (60%), Gaps = 14/418 (3%)
 Frame = -1

Query  1423  ASIFALYCCFYSMEVFVFLFILGLISS------SRVSCKSFNVIDYGAKGDGMTDDSQAF  1262
             AS++ +Y    S  V  F  ++ L +S      +R S   F+V D+GA GDG+TDD+ +F
Sbjct  26    ASLYGIYFVLISANVNGFDSVIQLPTSASLRNTTRKSETLFDVSDFGAVGDGITDDTNSF  85

Query  1261  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  1082
              +AW  ACSS    K   ++IP G +FLV+P+ F GPC+S+ +   ++GT++AP  P  W
Sbjct  86    KDAWDKACSSASRSK---IVIPGGYSFLVQPLNFAGPCRSK-VSLGIAGTILAPKDPKVW  141

Query  1081  NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCI  902
             +GL+  +WL F  V  L + GGG I+G G++WW +SC+   N+      APTA+ F  C 
Sbjct  142   DGLNPRKWLYFRSVKYLTIEGGGAINGMGQEWWSRSCK--VNLTNPCQHAPTALTFHKCN  199

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             N  + NI  ++S Q H+    C     + L+V +P DSPNTDG+HI +SK V I    I 
Sbjct  200   NLKVRNIKILNSQQMHLAFTDCKHVAASRLSVLAPADSPNTDGIHISSSKQVNIKDCTIG  259

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDCISI   ++ +++ N+ CGPGHGIS+GSLGK  +  QV N+H++ ++   T NG R
Sbjct  260   TGDDCISIVGNSSRIKVRNIVCGPGHGISIGSLGKFNSMSQVYNVHVNGASISNTENGVR  319

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G+ R ITFEN+ + +V NPIIIDQ YC     C  + + ++I ++ F  I G
Sbjct  320   IKTWQGGTGFVRKITFENVWMENVSNPIIIDQYYCDSLLPCSNKTSNIRIDNISFVGIKG  379

Query  361   TATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVE-PGPCL  191
             T+ TE AI++ CS + PC  + L+ + +T      P+ + C  A+G  + +  P PC 
Sbjct  380   TSATEKAITVACSDSFPCRKLYLEDVQLT-SFSGEPITSFCWEAYGSSSGLNYPPPCF  436



>ref|XP_004308193.1| PREDICTED: probable polygalacturonase At3g15720-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   325 bits (832),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 166/378 (44%), Positives = 233/378 (62%), Gaps = 15/378 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV++YGA G+G  DD+QAFL AW D C ST     P +IIP G  FL+  V+F GPC+
Sbjct  102   TFNVMNYGAVGNGEVDDTQAFLKAWGDVCGST--QGIPTLIIPKGKDFLLNSVKFQGPCR  159

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             +  ++F ++G++VA      W   D  +W+ F+ V GLI+NGGG IDGQG  WW ++C  
Sbjct  160   AASVNFQLNGSIVAKKDMTAWR--DKDKWVQFDNVQGLIINGGGQIDGQGLVWW-RAC--  214

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
               +   C    PTA+    C    LS+I  + S + H+ +  CN   ++ + +++P DSP
Sbjct  215   --STTNCK--RPTALHINDCHGLRLSDITHIDSARNHISISGCNDVEVSGILIRAPADSP  270

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S ++ I  S I  GDDCI+I   T+ V +  V CGPGHGIS+GSLG+ G++
Sbjct  271   NTDGIDISTSTNINIRDSSIGTGDDCIAINSGTSHVNVTGVLCGPGHGISIGSLGEHGSY  330

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP-  428
               VE++ +   TF GTTNGARIKTW+ G GYAR+I FEN+ + ++ NPIIIDQ Y     
Sbjct  331   SMVEDVQVRKCTFNGTTNGARIKTWKGGSGYARDIIFENITIQAIKNPIIIDQEYSDVLY  390

Query  427   ---GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSV  257
                GT  +QG+ VQ+SDV F+   G+ + + AI+L+C   V C  I +D ID+T  +   
Sbjct  391   TGFGTLHDQGSAVQVSDVTFRDFQGSVSGDVAITLDCDNRVGCKNIVMDHIDLTSSVHGK  450

Query  256   PVAACCSNAHGEETSVEP  203
              VAA C N  G  TS+ P
Sbjct  451   KVAAYCKNVRGLRTSLSP  468



>ref|XP_009790843.1| PREDICTED: probable polygalacturonase At3g15720, partial [Nicotiana 
sylvestris]
Length=399

 Score =   322 bits (826),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 229/375 (61%), Gaps = 7/375 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V DYGA GDG+TDDSQAF  AW D C      ++P + +P+   FL+ P+ F GPC S
Sbjct  23    FDVTDYGAIGDGVTDDSQAFQQAWLDVCYDC---ENPTMNLPSEKLFLLSPILFQGPCNS  79

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I+  V G + AP +   W G +   WL F G+ GLI+NG G I+GQG  WW+ S R H
Sbjct  80    TTINIQVLGNITAPQNITEWVGCENDSWLYFTGISGLIINGTGQINGQGATWWNISGRAH  139

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
                  C    PTAM F FC +  LS ++ V+S + H+ +    G NI+N+T+ +P DSPN
Sbjct  140   KVNGTCH--KPTAMHFNFCNDLQLSGLNLVNSSRNHISINFSTGVNISNITITAPEDSPN  197

Query  781   TDGVHIHASK-HVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             TDG+ +  S   V I +S I  GDDCISI    +D+ I  + CGPGHGISVGSLG +  F
Sbjct  198   TDGIDLSMSTTQVQIMNSTIQTGDDCISINTGCSDINITGISCGPGHGISVGSLGVNETF  257

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
             V VENI+++N T  GT NG RIKTWQ G GYAR I FEN+ + +V +PIIIDQ YC+   
Sbjct  258   VTVENINVTNCTLQGTQNGVRIKTWQDGMGYARFINFENINLTNVRHPIIIDQFYCNGAH  317

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCS-KAVPCLGIKLDSIDITPQIPSVPVA  248
              C  +   VQ+S+V ++ I GT  ++ AI++NCS     C  +  + I+IT  +P     
Sbjct  318   NCGVEPNAVQVSNVTYKDIFGTTPSKIAINMNCSDNCTACTSLVFEQINITTVLPEKQTL  377

Query  247   ACCSNAHGEETSVEP  203
             A C+NAHG+  S  P
Sbjct  378   AACNNAHGQANSTLP  392



>emb|CBI36303.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   322 bits (824),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 174/394 (44%), Positives = 241/394 (61%), Gaps = 17/394 (4%)
 Frame = -1

Query  1360  LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  1181
             +GL     +S  + NV D+GA GDG TDDSQAFL AWK AC     + +   II +G  F
Sbjct  9     IGLSDDDELS--TINVRDFGAIGDGTTDDSQAFLKAWKKACGIQAGYVN--FIIESGKAF  64

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             L+KP++F GPC++ +I+  V GT+ AP S   W G     WL F  + GLIVNG G I+G
Sbjct  65    LLKPIRFEGPCRASYINIQVLGTITAPKSIYEWGGQSVDNWLIFFRINGLIVNGKGTING  124

Query  1000  QGKKWWDQSCRD---HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNG  830
             QG  WW Q  ++   HP           A+ F+ C N  L +++ ++SP+ HV +F  NG
Sbjct  125   QGSIWWQQLPKNNLFHP---------LDALSFVGCNNLKLDHLNLINSPRRHVVIFNING  175

Query  829   FNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGP  650
               I+NL + +P +SPNTDG+ I  S ++ + +  I  GDDCI+IG  +  + I+N+ CGP
Sbjct  176   ATISNLNIIAPKESPNTDGIDIGQSTNIQLHYCNIKTGDDCIAIGPSSFYINISNIACGP  235

Query  649   GHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSV  470
             GHGIS+GSLG +G   +VE + + + TF GT NG RIKTW+ G GYAR I FE + + + 
Sbjct  236   GHGISIGSLGLNGRTDKVEEVQVRDCTFTGTRNGVRIKTWEGGSGYARKILFEGITLNAA  295

Query  469   DNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLD  290
             DNPIIIDQ YC      K+  +GV++SD+ F R+ GT TT+ AI+L+CSK+V C  I L+
Sbjct  296   DNPIIIDQYYCPNNMCSKQSTSGVKLSDISFTRVIGTTTTKNAINLSCSKSVACTNILLN  355

Query  289   SIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCL  191
              ++I        V++ C NAHG    SV P  CL
Sbjct  356   HVNIKSAYSEDVVSSYCINAHGRFSDSVPPVDCL  389



>ref|XP_006658431.1| PREDICTED: polygalacturonase-like [Oryza brachyantha]
Length=407

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 233/377 (62%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD++A ++AW  ACSS    K   V+IP G  +L K    +GPCKS
Sbjct  33    FSMQSYGARGDGRHDDTKALVDAWAAACSSA---KPAVVLIPKGKKYLTKHTTLSGPCKS  89

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I  +V G++VA      W+      W+ F+GV  L V GGG IDG GK WW  SC+ +
Sbjct  90    S-ILLMVKGSLVASPERSDWSKETVKHWILFSGVTSLTVTGGGTIDGNGKIWWQNSCKTN  148

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT  APTA+ F  C N  + N+  V+S Q  + +  C    ++ L++ +P  SPN
Sbjct  149   SKLP-CTQ-APTALTFYSCKNLKVENLKVVNSQQIQISVEDCTHVKMSRLSIFAPETSPN  206

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  S+ V +    I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  
Sbjct  207   TDGIHITRSRDVQVADCTIKTGDDCMSIEDGTENLHVKNLVCGPGHGISIGSLGDHSSED  266

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ + N   YGTTNGARIKTWQ G+G A+NI F+N+ + +V NPIIIDQNYC     
Sbjct  267   HVNNVTVDNVRMYGTTNGARIKTWQGGKGSAKNIVFQNMIMDNVWNPIIIDQNYCDSSTP  326

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK+Q + V++S+V+F+ I GT+ +E AI L+CS +VPC  I L+++ +T +  S    + 
Sbjct  327   CKQQKSAVEVSNVLFKNIRGTSASEEAIMLHCSSSVPCHAITLENVKLTVKGGSSDAKST  386

Query  241   CSNAHGEET-SVEPGPC  194
             C NA  +++ SV P PC
Sbjct  387   CQNAEWKKSGSVSPQPC  403



>gb|EMS52449.1| Polygalacturonase [Triticum urartu]
Length=420

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/381 (44%), Positives = 228/381 (60%), Gaps = 7/381 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V+ YGA GDG  DD++A   AW  ACSS        V+IP G   L K V F GPCKS
Sbjct  46    FSVLRYGAYGDGRHDDTKALSKAWAAACSSL---NPSTVLIPKGKKCLTKHVTFFGPCKS  102

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I  ++ GT+VAP     W       W+ F  V GL V GGG IDG GK WW  SC+ +
Sbjct  103   S-IKLMIEGTLVAPPKRSYWIEDTIRHWILFRSVRGLTVTGGGTIDGNGKFWWQNSCKVN  161

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  C   APTA+ F  C N  ++N+  ++S Q H+ +  C+   ++ L++++P  SPN
Sbjct  162   TKLP-CRQ-APTALTFYSCTNLKVNNLEVLNSQQIHISMERCSDVRMSRLSIRAPSTSPN  219

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +    I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  
Sbjct  220   TDGIHIVHSKDVKVMDCAIKTGDDCMSIEDGTENLHVKNIVCGPGHGISIGSLGDRNSQA  279

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             QV NI I     + T NGARIKTWQ GRGYA+NI F+N+ + +V NPIIIDQNYC+    
Sbjct  280   QVANITIDGVRLHDTANGARIKTWQGGRGYAKNIVFKNMIMDNVRNPIIIDQNYCNSATP  339

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C +Q   V++S+++F+ I GT+ +  AI L+CSKAVPC GI L ++ +T +       + 
Sbjct  340   CNKQKVAVEVSNLLFKNIRGTSASREAIKLSCSKAVPCHGIALHNVRLTLKRGGGDAKST  399

Query  241   CSNAHGEET-SVEPGPCLKQD  182
             C NA   +  +V P PC   D
Sbjct  400   CQNAKWRKLGTVMPQPCSLND  420



>ref|XP_004486675.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=404

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/399 (41%), Positives = 242/399 (61%), Gaps = 4/399 (1%)
 Frame = -1

Query  1396  FYSMEVF-VFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
             F +ME+F   L I+ +I     S  +FNV+ YGA GDG  +DS AF+ AWKD C S    
Sbjct  2     FDTMELFFTVLMIMSMIKPGLSSTTTFNVLQYGAIGDGKNNDSPAFVKAWKDVCQSK--S  59

Query  1219  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  1040
              +  +IIPA  TFL++P+ FNGPC S++I+  +SG +VAP +   ++G   + W+ F+ V
Sbjct  60    DTSHLIIPATKTFLLRPITFNGPCNSKYIYIQISGNIVAPKTKSEYSGSHINTWIGFSFV  119

Query  1039  YGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
              GLI++G G IDG+G  WW Q C  +P   G     PTA+    C    +     ++  +
Sbjct  120   NGLIISGKGTIDGRGSVWWKQPCIGNPP-PGTNCRPPTAITLNRCYRFQIKGYTSMNPAR  178

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
             +H+ L  C    I+N+ + +PGDSPNTDG+ I +S+ + + +S I+ GDDCI+I   ++ 
Sbjct  179   SHITLTSCKKGIISNIRLIAPGDSPNTDGIDISSSRDIQVLNSFIATGDDCIAISAGSSL  238

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             V+I  + CGPGHGIS+GSLG  G    VE++H+ N T   T  G RIKT Q G G+AR I
Sbjct  239   VKITGITCGPGHGISIGSLGARGETDIVEDVHVKNCTLTQTLTGVRIKTKQGGGGFARRI  298

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
             TFEN++    +NPI+IDQ YC     C+ +   +++SDV ++ I+GT+ T+ AI+LNC +
Sbjct  299   TFENIKFVRANNPIMIDQFYCVNGMVCQNKTQAIKVSDVTYRGISGTSLTDKAINLNCDQ  358

Query  319   AVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
              V C  I  D + +   +P + V + C NAHG  T  +P
Sbjct  359   NVGCSNIVFDRVYVKSGVPGMKVFSFCHNAHGRATHTKP  397



>gb|KHG17940.1| hypothetical protein F383_07843 [Gossypium arboreum]
Length=402

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 223/373 (60%), Gaps = 4/373 (1%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV+DYGA GDG TDDS AF  AWK  C++    ++P +IIPA   FL+KPV F+GPCK 
Sbjct  27    FNVVDYGAVGDGKTDDSAAFSKAWKAICNAPS--RNPILIIPATKIFLLKPVTFSGPCKP  84

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               IH ++SG +VAP S   W G   ++WL+F  V GL + G G I+G+G  WW Q C  H
Sbjct  85    TSIHVLMSGNIVAPNSKMAWKGFHINRWLAFTHVNGLTIIGSGTINGRGAAWWSQPCL-H  143

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
                +G T   PTA+ F  C    L  I  ++S + H+ +  C     +NL + +P  SPN
Sbjct  144   KVPKGVTCKGPTALTFYSCNGLVLKGIRHINSQRNHITISNCKDVTFSNLHISAPKTSPN  203

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+ I  S +V I +S I  GDDCI+I   ++ + I  + CGPGHGIS+G+LG  G   
Sbjct  204   TDGIDISGSSNVQILNSFIGTGDDCIAISSGSSHINITGIACGPGHGISIGALGAHGEDT  263

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              VE +H+ N T  GT  G RIKTWQ G G AR I+FE ++    D+PIIIDQ YC     
Sbjct  264   -VEEVHVRNCTLKGTMTGVRIKTWQGGVGTARRISFEKIRFIRADSPIIIDQYYCPSRVN  322

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK + +G++ISDV ++ I GT+TT+  I+L+C + V C  I+ + + IT  +P     A 
Sbjct  323   CKNETSGIRISDVSYRSIIGTSTTDKVINLSCDQNVGCTNIQFNYVYITSTVPGKKAYAF  382

Query  241   CSNAHGEETSVEP  203
               NAHG  T   P
Sbjct  383   SFNAHGNYTHTRP  395



>ref|XP_006657550.1| PREDICTED: polygalacturonase-like [Oryza brachyantha]
Length=406

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 169/394 (43%), Positives = 235/394 (60%), Gaps = 8/394 (2%)
 Frame = -1

Query  1372  FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPA  1193
             FLF L  + +   S   F+V  YGA GDG  DD++A  + W  ACSS    K   V+IP 
Sbjct  16    FLFFLPGVDAD-TSSNVFSVQSYGAHGDGQHDDTKALGDTWSAACSSA---KPAVVLIPK  71

Query  1192  GSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGG  1013
             G  +L K     GPCKS  I F+V GT+VA      W+      W+  +GV  L V GGG
Sbjct  72    GKKYLTKHTTLFGPCKSS-IMFMVKGTLVASPERSDWSKETIRHWILISGVTALTVTGGG  130

Query  1012  VIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCN  833
              IDG G  WW  SC+ +  +  CT+ APTA+ F+ C N  + N+  V S Q  + +  C 
Sbjct  131   TIDGNGMIWWQNSCKTNSKLP-CTE-APTALTFLSCKNLKVENLKVVDSQQIQISVEDCT  188

Query  832   GFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCG  653
                ++ +++ +P  SPNTDG+HI  S+ V +    I  GDDC+SI D T+++ + N+ CG
Sbjct  189   DVKVSRVSITAPETSPNTDGIHITRSRDVQVMDCTIKTGDDCMSIEDGTDNLYVKNIVCG  248

Query  652   PGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFS  473
             PGHGIS+GSLG   +   V N+ I     YGTTNGARIKTWQ G+G A+NI F+N+ + +
Sbjct  249   PGHGISIGSLGDHNSEAHVNNVTIDTVRLYGTTNGARIKTWQGGKGSAKNIVFQNMIMNN  308

Query  472   VDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKL  293
             V NPIIIDQNYC     CK+Q + V++S+V+F+ I GT+ +E  I L+CS +VPC G+ L
Sbjct  309   VRNPIIIDQNYCDSSTPCKQQKSAVEVSNVLFKNIQGTSASEETIMLHCSSSVPCHGVTL  368

Query  292   DSIDITPQIPSVPVAACCSNAHGEE-TSVEPGPC  194
             ++I +T +  S    + C NA  ++  SV P PC
Sbjct  369   ENIKLTLKAGSSDAKSTCQNAEWKKFGSVSPQPC  402



>ref|XP_006364199.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=452

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/418 (41%), Positives = 253/418 (61%), Gaps = 12/418 (3%)
 Frame = -1

Query  1429  LSASIFALYCCFYSMEVFVFLFILGLI-SSSRVSCKS---FNVIDYGAKGDGMTDDSQAF  1262
             L AS+++LY    S  V  F  +L L+ +S+ +  KS   F V D+GA GDG+TDD+++F
Sbjct  23    LFASLYSLYFLLISANVSGFESLLQLLPASASLRSKSESLFQVNDFGAAGDGITDDTKSF  82

Query  1261  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  1082
              + W  ACSS P H   +++IPAG +FLV+ + F GPC+S+ +   ++GT++AP  P  W
Sbjct  83    KDVWDMACSS-PSHA--KIVIPAGYSFLVRHINFAGPCRSK-VSIRIAGTILAPKDPEVW  138

Query  1081  NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCI  902
             + L+  +WL F  V  L V GGG+I+G G++WW +SC+   N       APTA+ F  C 
Sbjct  139   DDLNPRKWLYFFRVKHLTVEGGGIINGMGQEWWARSCK--VNRTNPCHHAPTALTFHKCN  196

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             N  + NI   +S Q H+    C    ++ L V++PGDSPNTD +HI +S  V +    I 
Sbjct  197   NLKIKNIKIFNSQQMHLAFTGCKHVTVSQLVVKAPGDSPNTDAIHISSSTQVNVKDCTIG  256

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDCISI   ++ +++ N+ CGPGHGIS+GSLGKS +F QV N+H++ ++   T NG R
Sbjct  257   TGDDCISIVGNSSRIKVKNIVCGPGHGISIGSLGKSNSFSQVYNVHVNGASISNTENGVR  316

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G+ + ++FEN+ + +V NPIIIDQ YC     C  + + ++I  + F  I G
Sbjct  317   IKTWQGGSGFVKKVSFENVWMENVSNPIIIDQYYCDSTKPCSNKTSNIRIDSISFMGIKG  376

Query  361   TATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVE-PGPCL  191
             T+ TE A++L CS + PC  + L+ I +T      P    C  A+G  + +  P PC 
Sbjct  377   TSATERAVTLACSDSFPCRKLYLEDIQLTSS-SGDPATFFCWQAYGTTSGLNYPPPCF  433



>ref|XP_006465488.1| PREDICTED: uncharacterized protein LOC102623476 [Citrus sinensis]
Length=815

 Score =   332 bits (852),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 230/368 (63%), Gaps = 13/368 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             S +VI +GA GDG TDDSQAFL AWK  C S     +  +++PAG TFL+ PV F GPCK
Sbjct  447   SVSVIQFGAVGDGETDDSQAFLKAWKSICGSKS--NAAPLLVPAGKTFLLNPVSFQGPCK  504

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S  I+  + G +VAP S   W+G D  +WL F+ V GL VNG G IDG+G  WW      
Sbjct  505   SSSINVQIQGNIVAPHSS-AWDGHDKKKWLLFSNVNGLTVNGNGKIDGKGASWWSNK---  560

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
                     +  PTA+ F  C N     +  V SP  H+ ++ CN  +I+NL + +P  SP
Sbjct  561   -------QNQRPTALSFGSCNNLVFRGLTHVDSPGNHISVYGCNDVSISNLKIIAPESSP  613

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S +V I    I+ GDDC++IG  T+++ +  V CGPGHGIS+GSLG +G  
Sbjct  614   NTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGT  673

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
               VE++H+ + TF GT NGARIKTWQ G G+AR I+FE +++ S DNPIIIDQ YC   G
Sbjct  674   SIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIRLESSDNPIIIDQYYCGPNG  733

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK Q + V++SDV +    GT++TE A+ L+CS++V C  IK+++IDIT         A
Sbjct  734   DCKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINNIDITHSDSGKDTRA  793

Query  244   CCSNAHGE  221
              C NAHGE
Sbjct  794   SCINAHGE  801


 Score =   332 bits (851),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 237/390 (61%), Gaps = 13/390 (3%)
 Frame = -1

Query  1390  SMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             SM + + L  L   I+ +     +FNV++YGA G+G +DDS AF  AW DAC +    ++
Sbjct  13    SMCILILLSTLATRINVNADDQNTFNVLNYGAVGNGNSDDSLAFSKAWNDACKANA--QT  70

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P +IIP G TFLV+P+ F GPCKS +I   +SGT+ AP  P  W   +  +W++F  + G
Sbjct  71    PTMIIPKGKTFLVRPITFYGPCKSSNISIQLSGTIKAPDGPSAWTS-EIGRWIAFGNITG  129

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             L +NG G+ DG G+KWWDQSC+ HP           A+ F+ C N  ++ I+   SPQ H
Sbjct  130   LNINGRGLFDGNGQKWWDQSCKHHPGK---------AVSFIQCSNAHINEIYVERSPQVH  180

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             V +      +  +L + SP  SPNTDG+HI  S  V +  S I+ GDDCISI D T+++ 
Sbjct  181   VVVDYSQDVHFKSLIINSPETSPNTDGIHIAHSHDVSVHTSVIAAGDDCISISDQTSNIS  240

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             +  V CGPGHGIS+GSLGK+G  V+VENI + +  FY TTNGARIKTWQ G+G  +++ F
Sbjct  241   VTYVNCGPGHGISIGSLGKNGEEVKVENITVRHVNFYKTTNGARIKTWQAGKGQVQHVEF  300

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
               +    V NPIIIDQ YC     C +  TGV I+DV +    GT+ T+ AI+L+CS  V
Sbjct  301   SYMNFTEVQNPIIIDQYYCDQKDVCAKTSTGVHINDVRYLNATGTSATDVAINLDCSNNV  360

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHG  224
              C  IKL++I++        V + C NA G
Sbjct  361   ACTDIKLENIELQSATEGKGVLSSCKNAFG  390



>ref|XP_010548804.1| PREDICTED: polygalacturonase QRT2, partial [Tarenaya hassleriana]
Length=430

 Score =   321 bits (822),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 160/391 (41%), Positives = 247/391 (63%), Gaps = 12/391 (3%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRV------SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             F+    + +   +G ++  RV      S + FNV D+GA+GDG +DDS+AF  AW +ACS
Sbjct  30    FHVPRSYKYGKTIGPVTHHRVGNAPMSSPQVFNVDDFGARGDG-SDDSKAFEKAWDEACS  88

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             S+   K+   ++P+   + ++P+ F+GPC+ Q I F + G + A  +P  +  +D   W+
Sbjct  89    SS--SKTAFFVVPSNKAYRLRPITFSGPCRPQFIVFKIYGKLEASKNPSDYE-MDRRYWI  145

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
              F  V  L V GGG+IDG G+ WW +SC+ +P++  C + APTA+ F  C N  +S I  
Sbjct  146   VFESVNNLRVEGGGIIDGNGQIWWKKSCKINPSLP-CKE-APTAVTFEECKNLIVSKIRL  203

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
              ++ Q H+    C       + V SPG+SPNTDG+H+ A+K+++I+ S +  GDDCISI 
Sbjct  204   QNAQQMHLTFKDCENVKAFGIMVTSPGNSPNTDGIHVTATKNILISDSVVRTGDDCISIV  263

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
               + +V    + CGPGHGIS+GSLG+  +   V N+ ++ +T  GTTNG RIKTWQ GRG
Sbjct  264   SGSVNVRATGITCGPGHGISIGSLGEGNSEAYVSNVVVNKATIIGTTNGVRIKTWQGGRG  323

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
             YA+NI F+++ + +V NPIIIDQNYC   G+C EQ + V++S+VV++ I GT++T  A+ 
Sbjct  324   YAKNIVFQDIIMKNVTNPIIIDQNYCDRDGSCPEQASAVRVSNVVYRNIQGTSSTPTAVK  383

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
              +CSK++PC GI + ++ +  Q   +  A+C
Sbjct  384   FDCSKSIPCRGISMQNVKLKDQSEEISKASC  414



>ref|XP_003597886.1| Polygalacturonase [Medicago truncatula]
 gb|AES68137.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=404

 Score =   320 bits (820),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/399 (40%), Positives = 241/399 (60%), Gaps = 4/399 (1%)
 Frame = -1

Query  1396  FYSME-VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
             F++ME  F  L IL +         +FNV+ YGA GDG T+DS AFL AWKD C+S    
Sbjct  2     FHTMEYFFTLLMILSMFKLGLSITTTFNVLQYGAVGDGKTNDSPAFLKAWKDVCNSK--S  59

Query  1219  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  1040
              + ++IIPA  TFL++P+ F GPCKS +I+  +SG ++AP +   ++G   + W+ F+ V
Sbjct  60    GTSRLIIPAAKTFLLRPIAFRGPCKSNYIYIELSGNIIAPKTKSEYSGSPINTWIGFSFV  119

Query  1039  YGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
              GLI++G G +DG+G  WW Q C  +P   G +   PTA+    C    +     ++  +
Sbjct  120   NGLIISGKGTVDGRGSMWWKQPCIGNPP-PGTSCRPPTAITLNRCYRFQIKGYTSINPAR  178

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
             +H+ L  C    I+N+ + +PG+SPNTDG+ I AS+ + + +S I+ GDDCI+I   ++ 
Sbjct  179   SHITLTSCKKGIISNIRLIAPGESPNTDGIDISASRDIQVLNSFIATGDDCIAISAGSSV  238

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             ++I  + CGPGHGIS+GSLG  G+   VE++H+ N T   T  G RIKT Q G G+AR I
Sbjct  239   IKITAITCGPGHGISIGSLGARGDTDIVEDVHVKNCTLTETLTGVRIKTKQGGGGFARRI  298

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
             TFEN++     NPI IDQ YC     C+     +++SDV ++ I+GT+ T+ AI+LNC +
Sbjct  299   TFENIKFVRAHNPIWIDQFYCVNQMVCRNMTKAIKVSDVTYRGISGTSLTDKAINLNCDQ  358

Query  319   AVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
              V C  +  D + +   +P + V + C NAHG  +  +P
Sbjct  359   NVGCSNLVFDRVYVRSAVPKMKVFSFCHNAHGRASHTKP  397



>gb|AHG12641.1| polygalacturonase [Nicotiana tabacum]
Length=455

 Score =   322 bits (824),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 170/418 (41%), Positives = 250/418 (60%), Gaps = 14/418 (3%)
 Frame = -1

Query  1423  ASIFALYCCFYSMEVFVFLFILGLISS------SRVSCKSFNVIDYGAKGDGMTDDSQAF  1262
             AS++ +Y    S  V  F  ++ L +S      +R S   F+V D+GA GDG+TDD+ +F
Sbjct  26    ASLYGIYFVLISANVNGFDSVIQLPTSASLRNTTRKSETLFDVSDFGAVGDGITDDTNSF  85

Query  1261  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  1082
              +AW  ACSS    K   ++IP G +FLV+P+ F GPC+S+ +   ++GT++AP  P  W
Sbjct  86    KDAWDKACSSASRLK---IVIPGGYSFLVQPLNFAGPCRSK-VSLGIAGTILAPKDPKVW  141

Query  1081  NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCI  902
             +GL+  +WL F  V  L + GGG I+G G++WW +SC+   N+      APTA+ F  C 
Sbjct  142   DGLNPRKWLYFRSVKYLTIEGGGAINGMGQEWWSRSCK--VNLTNPCQHAPTALTFHKCN  199

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             N  + NI  ++S Q H+    C     + L+V +P DSPNTDG HI +SK V I    I 
Sbjct  200   NLKVRNIKILNSQQMHLAFTDCKHVAASRLSVLAPADSPNTDGTHIGSSKQVNIKDCTIG  259

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDCISI   ++ +++ N+ CGPGHGIS+GSLGKS +  QV N+H++ ++   T NG R
Sbjct  260   TGDDCISIVGNSSRIKVRNIVCGPGHGISIGSLGKSNSMSQVYNVHVNGASISNTENGVR  319

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G+ R ITFE++ + +V NPIIIDQ YC     C  + + ++I  + F  I G
Sbjct  320   IKTWQGGTGFVRKITFESVWMENVSNPIIIDQYYCDSLLPCSNKTSNIRIDSISFVGIKG  379

Query  361   TATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVE-PGPCL  191
             T+ TE AI++ CS + PC  + L+ + +T      P+ + C  A+G  + +  P PC 
Sbjct  380   TSATEKAITVACSDSCPCRKLYLEDVQLT-SFSGDPITSFCWEAYGSSSGLNYPPPCF  436



>ref|XP_004152352.1| PREDICTED: probable polygalacturonase At3g15720-like [Cucumis 
sativus]
Length=415

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 230/383 (60%), Gaps = 17/383 (4%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTPVHKSPQVIIPAGSTFLVKPVQFNGP  1151
             K+ +VI YGA GDG TDDS+AFL AWK  C ++TP      +++P+  TFL+ PVQF GP
Sbjct  46    KAIDVIQYGAAGDGKTDDSRAFLKAWKAVCEANTP----SAMLVPSTKTFLLNPVQFQGP  101

Query  1150  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
             C S  +   + G +VAP     W   D   WL F+ V  L++ G G IDGQG  WWD   
Sbjct  102   CMSSSVGVQILGKIVAPSDLDAWKVFDAKNWLLFSNVSRLVIQGNGEIDGQGAAWWD---  158

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             RD       +D  PTA+    C    LS +   +SPQ+H+ +  CN  +I+ L + +P +
Sbjct  159   RD-------SDGKPTALAIYDCDGLHLSGLTHSNSPQSHMHIVRCNHASISKLNIVAPEN  211

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+ +  S HV I +  I  GDDCI+I + T+++ I N+QCGPGHGIS+GSLGK G
Sbjct  212   SPNTDGIDVAHSSHVKIHNCNIGTGDDCIAISEGTSNIHIANIQCGPGHGISIGSLGKDG  271

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
                 VE++ + N    GT  GARIKTWQ G GYAR I+F+ + +  V  PI+IDQ YC+ 
Sbjct  272   TSSSVEDVRVQNCHLKGTMYGARIKTWQGGAGYARKISFQGITLDQVHKPILIDQYYCNG  331

Query  430   PGTCKEQGT-GVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                CK Q T  V++SDV++Q ++GT+ TE A+ L+CS+ V C  I L+ IDI        
Sbjct  332   KTDCKNQQTSAVEVSDVLYQGLHGTSATEVAVELSCSETVGCRNIVLEDIDIRYADSDKI  391

Query  253   VAACCSNAHGEETSVEPG-PCLK  188
               + C +AHG  T+  P   CLK
Sbjct  392   AQSSCDDAHGTSTNTFPAVDCLK  414



>gb|KDO45212.1| hypothetical protein CISIN_1g047738mg, partial [Citrus sinensis]
Length=391

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/405 (42%), Positives = 239/405 (59%), Gaps = 21/405 (5%)
 Frame = -1

Query  1390  SMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             SM + + L  L   I+ +     +FNV++YGA G+G +DDS A+  AW DAC +    ++
Sbjct  5     SMCILILLSTLATHINVNADDQNTFNVLNYGAVGNGNSDDSLAYAKAWNDACKANA--QT  62

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P +IIP G TFLV P+ F+GPCKS +I   +SGT+ AP  P  W   +  +W++F  + G
Sbjct  63    PTMIIPKGKTFLVHPITFSGPCKSSNISIQLSGTIKAPDGPSAWTS-EIGRWIAFGNITG  121

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             L +NG G+ DG G+KWWDQSC+ HP  + C++ APTA+ F+ C N  ++ I+   SPQ H
Sbjct  122   LNINGRGLFDGNGQKWWDQSCKHHPGKD-CSERAPTAVSFIQCNNVHINEIYVERSPQVH  180

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             + +      +  +L + SP  SPNTDG+HI A  H V  H+ I                 
Sbjct  181   IVVDYSQDVHFKSLIIDSPETSPNTDGIHI-ARSHDVSVHTSIIAA--------------  225

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             +  V CGPGHGIS+GSLGK+G  V+VENI + +  F  TTNGARIKTWQ G+G  +++ F
Sbjct  226   VTYVNCGPGHGISIGSLGKNGEEVKVENITVRHVNFCKTTNGARIKTWQAGKGQVQHVEF  285

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
               +    V NPIIIDQ YC     C +  TGV ISDV +    GT+ T+ AI+L+CS  V
Sbjct  286   SYMNFTEVQNPIIIDQYYCDQKDVCAKTSTGVHISDVRYLNATGTSATDVAINLDCSNNV  345

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHG-EETSVEPGPCLKQD  182
              C  IKL++I++        V + C NA G  + + +P  CLK +
Sbjct  346   ACTDIKLENIELQSATEGKGVLSSCKNAFGVAKGNCKPKSCLKSN  390



>ref|XP_008365049.1| PREDICTED: probable polygalacturonase At1g80170 [Malus domestica]
Length=462

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 230/381 (60%), Gaps = 6/381 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V ++GAKGDG+TDDSQAF NAW+ ACS   +    +++IPAGST+LV PV   G
Sbjct  55    SKRVLSVGEFGAKGDGVTDDSQAFKNAWEIACS---IPARTRILIPAGSTYLVHPVDIAG  111

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L + GGG I+G G++WW +S
Sbjct  112   PCRSR-VTLMISGTVIAPEDPDAWIGLNRRKWLYFHGVNHLTIEGGGTINGMGQEWWARS  170

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+   N       APTA+ F  C N  + N+  V+S Q H+    C     +NL V +P 
Sbjct  171   CKT--NSSNPCRHAPTAVTFHKCKNLKVKNLLIVNSQQMHMAFTSCMRVVASNLKVIAPA  228

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+HI ASK V +  + I  GDDCISI   ++ + I N+ CGPGHGIS+GSLGKS
Sbjct  229   VSPNTDGIHISASKGVKVKDTIIRTGDDCISIVSNSSRIRIINIACGPGHGISIGSLGKS  288

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              ++ QV N+ +  +    T NG RIKTWQ G G+A NI F N+ + +V NPIIIDQ YC 
Sbjct  289   NSWSQVRNVVVDTAFLSNTDNGVRIKTWQGGSGFASNIAFRNVMMENVSNPIIIDQYYCD  348

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C  Q + V++ ++ F  I GT+ TE AI   CS   PC G+ ++ I + P +  + 
Sbjct  349   SRLPCLNQTSAVKVENISFVHIKGTSATEEAIKFVCSDDSPCEGLYMEDIQLLPCVGEIT  408

Query  253   VAACCSNAHGEETSVEPGPCL  191
              + C          V+P  C 
Sbjct  409   TSLCWEAQGSSLGLVDPPACF  429



>ref|XP_007203070.1| hypothetical protein PRUPE_ppa023489mg [Prunus persica]
 gb|EMJ04269.1| hypothetical protein PRUPE_ppa023489mg [Prunus persica]
Length=436

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/393 (43%), Positives = 236/393 (60%), Gaps = 12/393 (3%)
 Frame = -1

Query  1366  FILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGS  1187
             F    + +      +FNV+DYGA G+G+ DD++AFL AW   C+S+    +  +++P G 
Sbjct  53    FSKAFLEAWEAKTNTFNVVDYGAVGNGLVDDTKAFLKAWGAMCASS-TQGTLTLVVPKGK  111

Query  1186  TFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVI  1007
              FL+  V F GPC++  ++F + G++VAP +   W   +   W+ F+ V GL VNGGG I
Sbjct  112   RFLLNAVAFEGPCRASKVNFQIQGSIVAPNNIGAWT--NKEMWIQFSKVQGLSVNGGGRI  169

Query  1006  DGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGF  827
             DG G  WW ++C      EGC    PTA+ F  C    LS +   +SP+ H+ +  CNG 
Sbjct  170   DGNGAVWW-KAC----GGEGCQ--RPTALHFNKCHGFQLSRLAIFNSPKNHISICSCNGP  222

Query  826   NINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPG  647
              +  L + +P DSPNTDG+ I  S  V I  S I+ GDDCI+I   ++ ++I +++CGPG
Sbjct  223   RVFGLFIWAPKDSPNTDGIDISQSTRVTIQSSHIATGDDCIAINSGSSYIKIRDIKCGPG  282

Query  646   HGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVD  467
             HGIS+GSLG+ G + QVE + +SN TF GTTNG RIKTW+ G GYAR ITFE +      
Sbjct  283   HGISIGSLGQHGEYSQVEEVQVSNCTFKGTTNGVRIKTWEGGSGYARKITFEGITFEDTK  342

Query  466   NPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDS  287
             NPIIIDQ+Y + P +  +    VQ+SDV ++ INGT   E AISL C+    C  I +D+
Sbjct  343   NPIIIDQHYFAKPTSAMDISKSVQVSDVTYRNINGTCADEKAISLACAGG-GCTNIVMDN  401

Query  286   IDITPQIPSVPVAACCSNAHGEET-SVEPGPCL  191
             + I   +P+    A C NAHG  + SV   PCL
Sbjct  402   VTIKSDLPNKRSYAYCDNAHGTSSFSVPSVPCL  434



>dbj|BAC57273.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 dbj|BAD30433.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
Length=422

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 233/371 (63%), Gaps = 6/371 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V  +GA GDG  DD++A   AW  ACSS+   +   V+IP G  +L K +  +GPCKS
Sbjct  53    FDVRKHGAYGDGQHDDTKALAKAWAAACSSS---QPSIVLIPKGKRYLTKHITLSGPCKS  109

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I F++ GT+VAP     W+      W+ FNGV GL V GGG +D  GK WW  SC+ +
Sbjct  110   S-ITFMIEGTLVAPPKRSDWSKETIRHWIMFNGVSGLTVAGGGTVDENGKIWWQNSCKTN  168

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT+ APTA+ F  C N  + N+  ++S Q H+ +  C    I++LT+ +PG SPN
Sbjct  169   AKLP-CTE-APTALTFYSCSNLKVENLKLLNSQQIHMSVEDCTDVRISSLTITAPGTSPN  226

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK+V +T   I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  
Sbjct  227   TDGIHITRSKNVQVTGCIIKTGDDCMSIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEA  286

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ +     YGTTNGARIKTWQ G GYA+NI F+N+ + +V NPIIIDQNYC     
Sbjct  287   HVNNVTVDTVRLYGTTNGARIKTWQGGWGYAKNIVFQNMIMENVWNPIIIDQNYCDSATP  346

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CKEQ + VQ+S+VVF+ I GT+ ++ AI L+CS+ VPC GI L  + +T +       + 
Sbjct  347   CKEQTSAVQVSNVVFKNIRGTSASKEAIKLDCSRNVPCQGITLKDVKLTIKGGGSDAKST  406

Query  241   CSNAHGEETSV  209
             C NA  +++ +
Sbjct  407   CGNAKWKKSGI  417



>ref|XP_010266762.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=451

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/406 (44%), Positives = 242/406 (60%), Gaps = 19/406 (5%)
 Frame = -1

Query  1396  FYSMEVFVFLF-ILGLISSSRVSCKS-----FNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             F+ + + +  F + GL    RV         FNVID GA GDG TDDSQAFL AW   C+
Sbjct  51    FFIIPLVLLCFSLFGLARLQRVMLNEPSPYLFNVIDSGAVGDGKTDDSQAFLKAWSMVCA  110

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN-GLDTSQW  1058
             +      P V+     TFL+ PV F GPC S ++   +SG +VAP     WN   D   W
Sbjct  111   A----PGPSVLDIPPKTFLLNPVTFKGPCNSTNVQVQISGNIVAPVDASAWNKDADKGHW  166

Query  1057  LSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIH  878
             + F+ + GL+++G G I+GQG  WW+  CR     + C+     A++   C N+ L  ++
Sbjct  167   ILFDSINGLVISGSGEINGQGSYWWN--CRS----DKCSSTPDAALEVRSCNNSQLKGLN  220

Query  877   FVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISI  698
             FV SP+ HV    C    I+ +T  +P DSPNTDG+HI   ++V + +S I  GDDCISI
Sbjct  221   FVDSPRMHVVFNHCVNVQISQITATAPKDSPNTDGIHIAGCQYVEVMNSIIQTGDDCISI  280

Query  697   GDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGR  518
                ++++ IN V+CGPGHGISVGSLG SG    VE + +SN  F G+ NG RIKTWQ G 
Sbjct  281   ETGSSNIYINGVKCGPGHGISVGSLGDSGEEDSVEQVVVSNCNFNGSMNGVRIKTWQGGS  340

Query  517   GYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAI  338
             GYAR I F+N+ V +VD+PI+IDQ YC     CK + + V++S+V F  I+GT+T E AI
Sbjct  341   GYARGIKFQNINVNNVDHPIVIDQYYCG-GNHCKNETSAVKVSNVSFINIHGTSTREDAI  399

Query  337   SLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHG-EETSVEP  203
             SL CS+ V C  I L++I +T  +P     + C NAHG  + SVEP
Sbjct  400   SLACSQTVACTDILLENIQLTTLVPGKNATSYCLNAHGTAKASVEP  445



>ref|XP_002324855.2| hypothetical protein POPTR_0018s01610g [Populus trichocarpa]
 gb|EEF03420.2| hypothetical protein POPTR_0018s01610g [Populus trichocarpa]
Length=399

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 230/404 (57%), Gaps = 15/404 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
             M+   F F++  I++S        K FNV+D+GA GDG  DD+ AFL+AW+  C      
Sbjct  1     MQDVYFSFLILCIAASSFGIGHGQKVFNVVDFGAIGDGQIDDTNAFLSAWQALCGDDAAQ  60

Query  1219  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  1040
              +P + IP G TFL++PV+F GPCKS  +H  V G ++AP +   WN      W+ F GV
Sbjct  61    GTPSLQIPEGKTFLLQPVKFQGPCKSVFVHVQVQGKIIAPNTIEEWNNCQADYWIGFVGV  120

Query  1039  YGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
               L + G G+IDGQG  WW         M      +  A+ F  C +  LS +  V SP+
Sbjct  121   ANLNMYGSGLIDGQGSVWW---------MRAMQANSLNALNFEKCDDLQLSGLTHVDSPK  171

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
              H+ +  CNG  I+NL + +P +SPNTDG+ +  S +V I  S I+ GDDC++I    + 
Sbjct  172   GHIGITDCNGVLISNLNIAAPENSPNTDGIDMARSTNVHIQDSMIATGDDCVAINGGCSY  231

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             + I N+ CGPGHGISVGSLGK G +  VE +H+ N +F GT N ARIKTWQ G GYAR I
Sbjct  232   INITNIACGPGHGISVGSLGKDGQYDTVEEVHVRNCSFTGTQNAARIKTWQGGSGYARKI  291

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
             ++E + + +  NPIIIDQ YC     C+   T +Q+SDV +    GT+  E AI L+CS 
Sbjct  292   SYEQITLVASKNPIIIDQYYCDGVNNCRNSSTALQVSDVTYSGFQGTSVDEEAIRLDCSD  351

Query  319   AVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
                C+ I +D+I+IT   P     A C +  G      P  PCL
Sbjct  352   R-GCINIVMDNINITSLDPGKTTYAYCEHTSGTSWFTAPYVPCL  394



>ref|XP_007226190.1| hypothetical protein PRUPE_ppa015822mg, partial [Prunus persica]
 gb|EMJ27389.1| hypothetical protein PRUPE_ppa015822mg, partial [Prunus persica]
Length=379

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 229/381 (60%), Gaps = 13/381 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS-PQVIIPAGSTFLVKPVQFNGPC  1148
             +F+V+ +GA GDG TDD++AF+ AW   C +       P + IP G TFL++P +F GPC
Sbjct  3     TFDVVKFGAVGDGQTDDTEAFVKAWTALCGAAAGGDDVPTLTIPGGKTFLLQPSEFEGPC  62

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
             KS+ +H  VSG +VAP +P  W       WL F  V  LI++G G IDGQG  WW +   
Sbjct  63    KSKSVHVQVSGNLVAPKTPDAWKVCPPHSWLVFRKVDNLIIDGSGKIDGQGSAWWGEDSS  122

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
                           A+ F+ C +  LS +  ++SP++H+ +   N   I++LT+ +P +S
Sbjct  123   -----------LINALHFLRCDHLRLSGLTHINSPRSHIGISTSNDVEISHLTIIAPDES  171

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+++  S +V I  SKI  GDDCI+I   +++V I  + CGPGHGISVGSLG  G 
Sbjct  172   PNTDGINVTNSTYVNIHDSKIGTGDDCITIMSGSSNVRIAKIACGPGHGISVGSLGADGA  231

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
             +  VENI++ + +F GT NGARIKTW  G GYARNITFEN+ + +  NPIIIDQ YC+  
Sbjct  232   YAAVENIYVRDCSFIGTQNGARIKTWPGGSGYARNITFENIILTAAKNPIIIDQQYCNGA  291

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C ++   V +S+V F    GT+  E AI L+C+    C  I+L  I+IT  +PS  V 
Sbjct  292   HNCPKKSKAVLVSNVRFTGFRGTSDNEEAIKLDCNHISGCQNIELVKINITSTVPSKKVY  351

Query  247   ACCSNAHGEETSVEPG-PCLK  188
             A C+NA G   S  P   CLK
Sbjct  352   ASCNNAKGNSGSTVPTVSCLK  372



>ref|XP_011081272.1| PREDICTED: probable polygalacturonase At1g80170 [Sesamum indicum]
Length=461

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/357 (45%), Positives = 230/357 (64%), Gaps = 6/357 (2%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  1169
             +SSR     FN+ D+GAKGDG+ DD++   + WK ACSS+   K   +IIPAG+++LVKP
Sbjct  56    TSSRSKTVLFNIDDFGAKGDGIADDTKIVQDVWKVACSSSSPAK---IIIPAGNSYLVKP  112

Query  1168  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKK  989
             + F GPC+S ++   VSG +VAP  P  W+GL+  +WL F+GV  L + GGG+IDG+G+K
Sbjct  113   IDFPGPCQS-NVTLRVSGILVAPQDPEVWDGLNVHKWLYFHGVKQLTIEGGGLIDGRGQK  171

Query  988   WWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLT  809
             WW QSC+ + +   CT  APTA+ F  C N  + N+  V+S Q H+    C     + +T
Sbjct  172   WWAQSCKTNES-NPCTH-APTAVTFHKCKNLKVRNVTLVNSQQMHMAFTNCMHVAASGVT  229

Query  808   VQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVG  629
             V +P DSPNTDG+HI  + HV + +  +  GDDCISI   ++ + I N+ CGPGHGIS+G
Sbjct  230   VIAPADSPNTDGIHISTTTHVELKNIAVGTGDDCISIVGNSSQIRIKNIVCGPGHGISIG  289

Query  628   SLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIID  449
             SLGK      V+++ +  +  + T NG RIKTWQ G G+AR ITF+N+ + +V NPIIID
Sbjct  290   SLGKYNMSAAVQDVIVDGAVLFNTENGVRIKTWQGGSGFARKITFQNILMRNVSNPIIID  349

Query  448   QNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             Q YC  P  C  Q + V I  + F+ I GT+ TE AI L CS + PC  + L+++++
Sbjct  350   QYYCDSPVPCLNQTSTVHIDSISFRNIKGTSETEGAIMLLCSDSYPCKRLYLENVEL  406



>ref|XP_004156878.1| PREDICTED: probable polygalacturonase At3g15720-like [Cucumis 
sativus]
Length=415

 Score =   318 bits (816),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/383 (44%), Positives = 230/383 (60%), Gaps = 17/383 (4%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTPVHKSPQVIIPAGSTFLVKPVQFNGP  1151
             K+ +V+ YGA GDG TDDS+AFL AWK  C ++TP      +++P+  TFL+ PVQF GP
Sbjct  46    KAIDVVQYGAAGDGKTDDSRAFLKAWKAVCEANTP----SAMLVPSTKTFLLNPVQFQGP  101

Query  1150  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
             C S  +   + G +VAP     W   D   WL F+ V  L++ G G IDGQG  WWD   
Sbjct  102   CMSSSVGVQILGKIVAPSDLDAWKDFDAKNWLLFSNVSRLVIQGNGEIDGQGAAWWD---  158

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             RD       +D  PTA+    C    LS +   +SP++H+ +  CN  +I+ L + +P +
Sbjct  159   RD-------SDGKPTALAIYDCDGLHLSGLTHSNSPKSHMHIVRCNHASISKLNIVAPEN  211

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+ +  S HV I +  I  GDDCI+I + T+++ I N+QCGPGHGIS+GSLGK G
Sbjct  212   SPNTDGIDVAHSSHVKIHNCNIGTGDDCIAISEGTSNIHIANIQCGPGHGISIGSLGKDG  271

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
                 VE++ + N    GT  GARIKTWQ G GYAR I+F+ + +  V  PI+IDQ YC+ 
Sbjct  272   TSSSVEDVRVQNCHLKGTMYGARIKTWQGGAGYARKISFQGITLDQVHKPILIDQYYCNG  331

Query  430   PGTCKEQGT-GVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                CK Q T  V++SDV++Q ++GT+ TE A+ L+CS+ V C  I L+ IDI        
Sbjct  332   KTDCKNQQTSAVEVSDVLYQGLHGTSATEVAVELSCSETVGCRNIVLEDIDIRYADSDKI  391

Query  253   VAACCSNAHGEETSVEPG-PCLK  188
               + C +AHG  T+  P   CLK
Sbjct  392   AQSSCDDAHGTSTNTFPAVDCLK  414



>ref|XP_010417741.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=444

 Score =   319 bits (818),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 170/426 (40%), Positives = 249/426 (58%), Gaps = 11/426 (3%)
 Frame = -1

Query  1432  ILSASIF--ALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFL  1259
             ++ A +F  AL     S E  + L      S+   S +  +V  +GAKG+G TDD+QAF 
Sbjct  11    LILAMVFSVALTANANSFESLLQLPRRQKRSTRPRSERLLHVGHFGAKGNGFTDDTQAFA  70

Query  1258  NAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN  1079
             +AWK ACSS       ++++P   T LV+P+  +GPCKS+ +   +SGT++AP  P  W 
Sbjct  71    DAWKAACSS---KAKTRILVPENYTSLVRPIDLSGPCKSR-LTLQISGTIIAPDDPDAWE  126

Query  1078  GLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC-RDHPNMEGCTDLAPTAMKFMFCI  902
             GL+  +WL F GV    V GGG ++G G++WW  SC R+H N   C   APTA+ F  C 
Sbjct  127   GLNRRKWLYFQGVSRFTVEGGGTVNGMGQEWWRISCKRNHSN--PCRG-APTALTFHKCK  183

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             N  L N++ + S Q H+    C    ++ L V +P  SPNTDG+HI  S+ +VI ++ +S
Sbjct  184   NMKLENLNVIDSQQMHIAFTSCRRVTVSRLKVIAPATSPNTDGIHISVSRGIVIDNTTVS  243

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDC+SI   ++ + I+N+ CGPGHGIS+GSLGKS ++ +V++I +  ++   T NG R
Sbjct  244   TGDDCVSIVKNSSQISISNIVCGPGHGISIGSLGKSKSWEEVKDILVDTASISDTENGVR  303

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G    I F N+++ +V NPIIIDQ YC     C  Q + V I ++ F R+ G
Sbjct  304   IKTWQGGSGLVSKIIFRNIKMNNVSNPIIIDQYYCDSRKPCANQTSAVTIENISFVRVRG  363

Query  361   TATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPCLKQ  185
             T+ ++ AI ++CS + PC  I L  ID+ P        + C  A+G  +  V P  CL +
Sbjct  364   TSASKQAIKISCSDSSPCRNILLQDIDLEPLDGDGLTQSFCWKAYGASSGQVYPPSCLSE  423

Query  184   D*FNLF  167
             D  N+ 
Sbjct  424   DETNVL  429



>ref|XP_006356262.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=437

 Score =   319 bits (817),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 172/418 (41%), Positives = 240/418 (57%), Gaps = 16/418 (4%)
 Frame = -1

Query  1423  ASIFA--LYCCFYSMEVFV-------FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDS  1271
              SIFA  LY   +S  +FV       F+    L  S   S     V ++GAKGDG+TDD+
Sbjct  6     VSIFASLLYSIMFSFLLFVNVNSFDSFIQFPTLKDSRDKSLSLLYVNEFGAKGDGITDDT  65

Query  1270  QAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSP  1091
             + F + WK ACSS      P++I+P G +FLV+P+ F GPC+S+ +  I+ G++VAP  P
Sbjct  66    KIFQDVWKKACSS---FLRPKIIVPIGYSFLVRPIDFVGPCRSK-VSLIIEGSIVAPKDP  121

Query  1090  PGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFM  911
               W+ LD  +WL F  V  L V GGG I+G G+KWW  SC+   N       APTAM F 
Sbjct  122   KVWDKLDAHKWLYFVKVRHLTVQGGGTINGMGQKWWATSCK--INTTNPCRHAPTAMSFH  179

Query  910   FCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHS  731
              C N  + +I  ++S Q H+ +  C    ++ + V++P  SPNTDG+HI +S HV I   
Sbjct  180   KCNNLKVRDIRMLNSQQMHISISNCINVEVSRMIVEAPAKSPNTDGIHITSSTHVAIKDC  239

Query  730   KISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTN  551
              I  GDDCISI + ++ + + N+ CGPGHGIS+GSLGKS ++ QV N+ +  + F  T N
Sbjct  240   TIRTGDDCISIVNNSSSILVKNIACGPGHGISIGSLGKSNSWSQVHNVCVDGAYFSNTEN  299

Query  550   GARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQR  371
             G RIKTWQ GRG+ R I+F N+ + +V NPIIIDQ YC     C  Q +G+ I  V F  
Sbjct  300   GVRIKTWQGGRGFVRRISFMNVWMENVSNPIIIDQYYCDSSFPCPNQTSGISIHSVSFVG  359

Query  370   INGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGP  197
             I GT+ T+ AI   CS + PC  + L  + +   +   P  + C  A G  + +   P
Sbjct  360   IRGTSATKNAIKFACSDSSPCKKLFLKDVQLLSYL-GFPTTSFCWKADGSTSGLNNPP  416



>ref|XP_004241700.1| PREDICTED: probable polygalacturonase At1g80170 [Solanum lycopersicum]
Length=437

 Score =   319 bits (817),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 174/419 (42%), Positives = 242/419 (58%), Gaps = 16/419 (4%)
 Frame = -1

Query  1426  SASIFA--LYCCFYSMEVFV-------FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDD  1274
             + SIFA  LY   +S  +FV       F+    L  S   S     V ++GAKGDG+TDD
Sbjct  5     NVSIFASLLYNTIFSFLLFVNVNSFDSFIQFPTLEDSRGKSVSLLYVNEFGAKGDGITDD  64

Query  1273  SQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGS  1094
             ++ F   WK AC+S      P++I+P G +FLV+P+ F GPC+S+ I  I+ G++VAP  
Sbjct  65    TKIFQYVWKRACAS---FLRPKIIVPIGYSFLVQPIDFVGPCRSK-ISLIIEGSIVAPKD  120

Query  1093  PPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKF  914
             P  W+ LD  +WL F  V  L V GGG I+G G+KWW  SC+   N       APTAM F
Sbjct  121   PKVWDKLDAHKWLYFVKVRHLTVQGGGTINGMGQKWWATSCK--INTTNPCRHAPTAMSF  178

Query  913   MFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITH  734
               C N  + +I  ++S Q H+ +  C    ++ + V++P  SPNTDG+HI +S  V I  
Sbjct  179   HKCNNLKVRDIRMLNSQQMHISISNCINVEVSRMIVEAPAKSPNTDGIHITSSIRVAIKD  238

Query  733   SKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTT  554
               I  GDDCISI + ++ + + N+ CGPGHGIS+GSLGKS ++ QV N+ +  + F  T 
Sbjct  239   CTIRTGDDCISIVNNSSSILVKNIACGPGHGISIGSLGKSNSWSQVHNVCVDGAYFSNTE  298

Query  553   NGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQ  374
             NG RIKTWQ GRGY R I+F N+ + +V NPIIIDQ YC  P  C  Q +G+ I  V F 
Sbjct  299   NGVRIKTWQGGRGYVRRISFMNVWMENVSNPIIIDQYYCDSPFPCPNQTSGIHIHSVSFI  358

Query  373   RINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGP  197
              I GT+ T+ AI   CS + PC  + L  + +      +P A+ C  A+G  + +   P
Sbjct  359   GIRGTSATKNAIKFACSDSSPCKKLFLKDVQLV-SYSGLPTASFCWKAYGSTSGLNNPP  416



>gb|KGN52445.1| hypothetical protein Csa_5G635400 [Cucumis sativus]
Length=412

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 172/415 (41%), Positives = 240/415 (58%), Gaps = 19/415 (5%)
 Frame = -1

Query  1387  MEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             ME+F  + I+ L       S K+FNV+DYGA GDG T+D+QAFL+AWK AC S+    SP
Sbjct  1     MELFFLILIISLQFLQINSSSKTFNVLDYGAVGDGNTEDTQAFLDAWKAACKSSNSKTSP  60

Query  1210  QVIIPAGSTFLVKPVQFNG-PCKSQH---IHFIVSGTVVAPGSPPGWN--GLDTSQWLSF  1049
              +++P G +FL++P   +G  CKS     I  ++ G ++AP     W   G    QW+  
Sbjct  61    IMLVPPGKSFLLQPFTLDGYDCKSTKTNIISIVIDGELIAPKDRWAWKYEGKQCRQWILL  120

Query  1048  NGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVS  869
               + GL+V G G I+ QG  WWD       N E      PT++         + NI F  
Sbjct  121   KHMKGLVVKGSGTINAQGNTWWDLCT----NEEKVCTRRPTSLILEDSEKVHIKNIAFKD  176

Query  868   SPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDF  689
             SPQ H+ +       + NL +++PGDSPNTDG+HI  S+ + IT S I  GDDCISIGD 
Sbjct  177   SPQMHMAIENSKYVFVKNLYIEAPGDSPNTDGIHIQHSRKISITSSSIRTGDDCISIGDG  236

Query  688   TNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYA  509
             +  + I+ + CGPGHGIS+GSLGK GN  +VE IH+ + TF  TTNG RIKTWQ G GYA
Sbjct  237   SYRINISKIACGPGHGISIGSLGKHGNHEKVEFIHVKDVTFTDTTNGVRIKTWQGGSGYA  296

Query  508   RNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLN  329
             RNI FE +      NPIIIDQ YC +   CK Q + V++S+V++ R++GT+ ++ A++L 
Sbjct  297   RNIIFEGIVSRGSLNPIIIDQFYCDHE-KCKNQTSAVKVSNVLYNRVSGTSKSKIAVNLA  355

Query  328   CSKAVPCLGIKLDSIDITP----QIPSVPVAACCSN---AHGEETSVEPGPCLKQ  185
             CS+  PC  I +  I +      +      ++ C N    H + + +   PCLKQ
Sbjct  356   CSETEPCRNILMKDIKLKSIIEDEEEEDITSSYCKNVVDGHKDGSVIPNVPCLKQ  410



>ref|XP_009365411.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=586

 Score =   323 bits (828),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 244/408 (60%), Gaps = 9/408 (2%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC--SSTPVHKS  1214
             + + VF     L        K  +V  YGA GDG  DDSQAF  AWKD C  ++      
Sbjct  8     VRILVFFLASSLFIGIGQGQKILDVTKYGAVGDGRADDSQAFFKAWKDLCQGNNDATDDI  67

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
             P +I+P G T+L++ ++F GPC S+ +H  V G ++AP     W   ++  WLSF+ +  
Sbjct  68    PILIVPEGKTYLLQRIKFEGPCNSKSVHVQVLGNLLAPMRG-AWKECNSGDWLSFSNIEN  126

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNME--GCTDLAPT-AMKFMFCINTTLSNIHFVSSP  863
             L+++G G IDGQG  WW  S  D  + +     D  P  A++F  C N  LS + F++SP
Sbjct  127   LMLDGSGKIDGQGAAWWRTSQYDARSRKLLANNDCKPNKALQFHNCQNLKLSGLTFLNSP  186

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             QAH+ +  C+  ++++L + +P DSPNTDG+ I +S HV I +S I  GDDCI+IGD  +
Sbjct  187   QAHIGINSCDNADVSDLNIHAPEDSPNTDGIDISSSTHVTIRNSFIGTGDDCIAIGDGCS  246

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              + I N+ CGPGHGISVGSLG+ G   +V+NI++ + +F GTTNGARIKTWQ G GYARN
Sbjct  247   FLYITNIACGPGHGISVGSLGEDGASNKVDNIYVKDCSFTGTTNGARIKTWQGGSGYARN  306

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             ITFE +++     PIIIDQ YC+    CK Q + V ++DV +    GT+ T+ AI LNC 
Sbjct  307   ITFERIKLDRTKYPIIIDQYYCNGEHNCKSQSSAVVVADVTYSDFEGTSATDEAIKLNCD  366

Query  322   KAV-PCLGIKLDSIDITPQIPSVPVAACCSNAHGEE--TSVEPGPCLK  188
             K    C  I +D I+I   +  + + + C+NA G    T+V    CLK
Sbjct  367   KVSGGCHNILMDRINIVSAVRDMKIFSSCNNADGTYVGTTVPDVACLK  414



>gb|KCW81411.1| hypothetical protein EUGRSUZ_C02788 [Eucalyptus grandis]
Length=406

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 173/406 (43%), Positives = 242/406 (60%), Gaps = 18/406 (4%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRVSCK-------SFNVIDYGAKGDGMTDDSQAFLNAWKDAC  1238
             FY +     ++++   +SS  S         ++NV++YGA G G  DDSQAF+ AW+D C
Sbjct  4     FYEVGFVAAIYLVLFAASSTFSSHGIVAASPTYNVVNYGATGSGDDDDSQAFVKAWEDTC  63

Query  1237  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  1058
               +    +P + +P G  F + PV F GPCKS  I+  + GT+VAP S  GW G  + +W
Sbjct  64    GDSGEKGTPTLAVPGGKKFRLSPVAFKGPCKSSSINVQIDGTLVAPSSLSGWKGCSSGRW  123

Query  1057  LSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIH  878
             L+F  V  L V G G +DGQG  WWD +       +G  +  PTA+ F+ CIN  LS +H
Sbjct  124   LNFQDVANLNVKGSGQVDGQGSLWWDGA-------KGGCEKRPTALVFLNCINLILSGLH  176

Query  877   FVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISI  698
              V+SP+ H+ +  C+   I+NL + +P  SPNTDG+ I  + ++ I    I  GDDCI+I
Sbjct  177   HVNSPRNHISIINCHNGIISNLHITAPESSPNTDGIDISRTNNLDIHDLDIQTGDDCIAI  236

Query  697   GDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGR  518
                ++++ I  V CGPGHGIS+GSLGK+G +  VE + + + TF GTTNG RIKTWQ G 
Sbjct  237   NGGSSNISITRVSCGPGHGISIGSLGKNGAYETVEQVQVRDCTFRGTTNGVRIKTWQGGS  296

Query  517   GYARNITFENLQVFSVDNPIIIDQNYCSYPGTCK-EQGTGVQISDVVFQRINGTATTEAA  341
             GYA+NI F  +++ +V NPIIIDQ Y   PG  +  + + V +SDV F  I GT+ ++ A
Sbjct  297   GYAKNIIFNQIKLDAVSNPIIIDQFY--NPGGAQLNEASSVVVSDVSFTSIRGTSASDQA  354

Query  340   ISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             I L+CS +V C  I LD++ IT   P   V A C N HG  TS  P
Sbjct  355   IKLSCS-SVGCSDITLDNVQITSSKPGETVTASCENCHGSATSTTP  399



>ref|XP_010545769.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=458

 Score =   319 bits (817),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 242/408 (59%), Gaps = 15/408 (4%)
 Frame = -1

Query  1411  ALYCCFYSMEVFVFLFILGLI-SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             +++  F +  +++ L +  L+      S ++ +V  +GA GDG+TDDSQAFL +W+  C 
Sbjct  4     SIHGLFQAKTLYIILILSALVLRDPTSSSQALDVTRFGALGDGITDDSQAFLRSWETVCK  63

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG-SPPGWNGLDTSQW  1058
              T      ++I+PA   F+++P++F GPCKS  I+F V G +VAP  +   W G D   W
Sbjct  64    GTGHGTDTELIVPADKIFMLQPLKFLGPCKSGPINFQVYGDIVAPRRNQKKWKG-DNDNW  122

Query  1057  LSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIH  878
             + F+ +  LIV G G+IDGQG  WW              D  PTA+KF  C N  L  + 
Sbjct  123   IVFSDIDDLIVEGDGLIDGQGSSWWKYE----------NDPRPTALKFKKCKNLQLRGLR  172

Query  877   FVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISI  698
              + SP AH+ +  C G  I++L + +P  SPNTDG+ I  S +V I +  I  GDDCI+I
Sbjct  173   HIDSPMAHIHINNCYGVTISDLRITAPESSPNTDGIDIAGSTNVQIQNCFIGTGDDCIAI  232

Query  697   GDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGR  518
                ++ V I+ VQCGPGHGIS+GSLGK G    VE +++ N +F GTTNGARIKTWQ G 
Sbjct  233   NSGSSLVNISGVQCGPGHGISIGSLGKDGEKASVEEVYVQNCSFTGTTNGARIKTWQGGS  292

Query  517   GYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAI  338
             GYA+NI F  +++  V NPIIIDQ YC     CK Q + V++S+V++    GT++TE  +
Sbjct  293   GYAKNIVFRGIKLDKVRNPIIIDQYYCIRGSKCKNQTSAVKVSNVLYDGFVGTSSTEIGV  352

Query  337   SLNCSKAVPCLGIKLDSIDI-TPQIPSVPVAACCSNAHG-EETSVEPG  200
             + +CS+ VPC  I + +IDI + +   + V   C NA G   T   PG
Sbjct  353   TFSCSETVPCTDIYMSNIDIDSEERGEIAVRGACLNAKGFSSTPTLPG  400



>ref|XP_010557796.1| PREDICTED: polygalacturonase QRT2-like [Tarenaya hassleriana]
Length=456

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/370 (43%), Positives = 235/370 (64%), Gaps = 9/370 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV D+GA+ +G  DDS AF  AW  ACSS+   ++   ++P    + +KPV+F+GPC+S
Sbjct  87    FNVDDFGARANG-ADDSHAFKKAWDAACSSST--RTVFYVVPRNRVYHLKPVKFSGPCRS  143

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
             Q + F V GT+ A  +P  +   D   W+ F+ V+ L V GGG IDG GK WW +SC+ +
Sbjct  144   QVLVFKVYGTLKASRNPSDYE-RDRRHWIVFDTVHNLRVEGGGRIDGNGKIWWQKSCKIN  202

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
             P++  C + APTA+ F  C N  +  I   ++ Q H+    C       L+V SPG+SPN
Sbjct  203   PSLP-CKE-APTAVTFTACKNLMVRQIRLQNAQQMHISFQDCENVKAVGLSVASPGNSPN  260

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+H+  +K+++I+ S +  GDDCISI   + +V    + CGPGHGIS+GSLGK  +  
Sbjct  261   TDGIHVSGTKNILISDSVVRTGDDCISIVSGSENVRATGITCGPGHGISIGSLGKGNSEA  320

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ ++ +T  G TNG RIKTWQ GRGYA+NI F+++ + +V NPIIIDQNYC   G+
Sbjct  321   YVSNVVVNKATIIGATNGVRIKTWQGGRGYAKNIVFQDVVMKNVTNPIIIDQNYCDRDGS  380

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C EQ + VQ+S+VV++ I GT++T  A+  +CSK++PC G+ + ++ +  Q   +  A+C
Sbjct  381   CPEQTSAVQVSNVVYRNIQGTSSTPTAVKFDCSKSIPCRGVSMQNVKLRGQSEEISKASC  440

Query  241   CS---NAHGE  221
              +   N  GE
Sbjct  441   SNVNLNTRGE  450



>ref|XP_009594191.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana tomentosiformis]
Length=454

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/420 (40%), Positives = 251/420 (60%), Gaps = 14/420 (3%)
 Frame = -1

Query  1429  LSASIFALYCCFYSMEVFVFLFILGLISS------SRVSCKSFNVIDYGAKGDGMTDDSQ  1268
             L AS++++Y    S  V  F  ++ L +S      +R S   F+V D+GA GDG+TDD+ 
Sbjct  23    LFASLYSIYFVLISANVNGFDSVIQLPTSASVRNTTRKSETLFDVGDFGAIGDGITDDTN  82

Query  1267  AFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPP  1088
             +F +AW  ACSS    K   ++IP G +FLV+P+ F GPC+S+ +   ++GT++AP    
Sbjct  83    SFKDAWDKACSSASRSK---IVIPGGYSFLVRPLNFAGPCRSK-VSLRIAGTILAPKDLE  138

Query  1087  GWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMF  908
              W+GL+  +WL F  +  L + GGG I+G G++WW +SC+   N       APTA+ F  
Sbjct  139   VWDGLNPRKWLYFRSMKHLTIEGGGTINGMGQEWWARSCK--VNKTNPCQHAPTALTFHR  196

Query  907   CINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSK  728
             C N  + NI  ++S Q H+    C    +++L V +P DSPNTDG+HI +S  V I    
Sbjct  197   CNNLKVRNIEILNSQQMHLAFTDCKHVAVSHLAVLAPADSPNTDGIHISSSTQVNIKDCT  256

Query  727   ISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNG  548
             I  GDDCISI   ++ +++ N+ CGPGHGIS+GSLGKS +  QV N+H++ ++   T NG
Sbjct  257   IGTGDDCISIVGNSSRIKVRNIVCGPGHGISIGSLGKSNSMSQVYNVHVNGASISNTENG  316

Query  547   ARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRI  368
              RIKTWQ G G+ R ITFE++ + +V NPIIIDQ YC     C  + + ++I  + F  I
Sbjct  317   VRIKTWQGGTGFVRKITFESVWMENVSNPIIIDQYYCDSLLPCSNKTSNIRIDSISFVGI  376

Query  367   NGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVE-PGPCL  191
              GT+ TE AI++ CS + PC  + L+ + +T      P+ + C  A+G  + +  P PC 
Sbjct  377   KGTSATEKAITVACSDSCPCRKLYLEDVQLT-SFSGDPITSFCWEAYGSSSGLNYPPPCF  435



>ref|XP_008665639.1| PREDICTED: polygalacturonase ADPG2-like [Zea mays]
 tpg|DAA52083.1| TPA: hypothetical protein ZEAMMB73_529440 [Zea mays]
Length=475

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/384 (43%), Positives = 232/384 (60%), Gaps = 10/384 (3%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD+ A   AW+ AC+S    +   +++P G  +L+K V   GPC+S
Sbjct  68    FSLDRYGARGDGRHDDTGALARAWEAACASP---RPAVLLVPGGRRYLLKLVVLRGPCRS  124

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
             + +   V GT+VA  +   W+  D   W+ F  V  L V+G G IDG G  WW  SC+ +
Sbjct  125   R-VAVTVKGTLVASPNRADWSDSDRRHWIVFRSVDRLTVHGRGSIDGNGHSWWPHSCKIN  183

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +      APTA+ F +C N  + N+  ++S Q H+ +  C    ++ L++ +PG SPN
Sbjct  184   KALP--CKAAPTALSFHYCTNLRVENLKMMNSQQIHMSIEDCASVQVSRLSITAPGTSPN  241

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T+ KI  GDDC+SI D T+ + ++ V CGPGHGISVGSLG   +  
Sbjct  242   TDGIHITRSKDVRVTNCKIKTGDDCMSIEDGTHGLHVSGVVCGPGHGISVGSLGDDDSRA  301

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I +   +GTTNGARIKT+Q G GYAR+ITF+N+ +  V NPI+IDQ+YC     
Sbjct  302   EVSGITIDSVQLHGTTNGARIKTYQGGSGYARDITFQNMAMHGVRNPIVIDQSYCDRAEA  361

Query  421   ---CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPV  251
                C+EQ + VQISDVVF+ I GT  T  AI ++CS+ VPC GI L +ID+  Q      
Sbjct  362   EPPCREQRSAVQISDVVFRNIRGTTVTRDAIRMSCSRDVPCRGIVLQNIDLKMQGGKGHA  421

Query  250   AACCSNAHGEET-SVEPGPCLKQD  182
              + C NA   ++  V P PC  ++
Sbjct  422   ESTCQNAKWRKSGKVVPQPCTSKE  445



>ref|XP_002466242.1| hypothetical protein SORBIDRAFT_01g004220 [Sorghum bicolor]
 gb|EER93240.1| hypothetical protein SORBIDRAFT_01g004220 [Sorghum bicolor]
Length=452

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/387 (44%), Positives = 241/387 (62%), Gaps = 16/387 (4%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ---VIIPAGSTFLVKPVQFNGP  1151
             F++  YGA GDG  DD+QA   AW  AC+S      PQ   +++P G  +L+K V  +GP
Sbjct  75    FSLDRYGACGDGSHDDTQALARAWNAACAS------PQPAVLLVPGGKRYLLKLVTLSGP  128

Query  1150  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
             CKS  +   V GT+VA  +   W+  D   W+ F  V  L VNG G +DG G+ WW  SC
Sbjct  129   CKSS-VTVTVKGTLVASPNRSDWSDEDRRHWIVFRQVDRLTVNGAGTVDGNGETWWKNSC  187

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             + +  +  C + APTA+ F FC +  + +++ V+S Q H+ +  C G  +  L++ +PG 
Sbjct  188   KINKALP-CKE-APTALSFHFCTSLRVQDLNVVNSQQIHMSIEDCTGVQLTGLSITAPGT  245

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+HI  S  V +T+ KI  GDDC+SI   T+++ ++ V CGPGHGIS+GSLG   
Sbjct  246   SPNTDGIHITRSNDVQVTNCKIKTGDDCLSIESGTHNLHVSQVVCGPGHGISIGSLGDDN  305

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
             +  +V  I I +   YGTTNGARIKT+Q G GYA++ITF+N+ ++ V NPIIIDQNYC  
Sbjct  306   SRAEVSGITIDSVQLYGTTNGARIKTYQGGSGYAKDITFQNMVMYDVANPIIIDQNYCDK  365

Query  430   P-GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C+ QG+ V++S+VVF+ I GT  T+ AI LNCS+ VPCLGI L +I++  Q  +  
Sbjct  366   ATAPCELQGSAVEVSNVVFKNIKGTTVTKDAIMLNCSRNVPCLGITLQNINLRMQGSNGK  425

Query  253   VAA--CCSNAHGEET-SVEPGPCLKQD  182
              AA   C NA   ++ +V P PC  ++
Sbjct  426   DAAESTCQNARWRKSGTVLPQPCTSKN  452



>gb|EAZ39077.1| hypothetical protein OsJ_23509 [Oryza sativa Japonica Group]
Length=498

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 233/371 (63%), Gaps = 6/371 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F+V  +GA GDG  DD++A   AW  ACSS+   +   V+IP G  +L K +  +GPCKS
Sbjct  53    FDVRKHGAYGDGQHDDTKALAKAWAAACSSS---QPSIVLIPKGKRYLTKHITLSGPCKS  109

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I F++ GT+VAP     W+      W+ FNGV GL V GGG +D  GK WW  SC+ +
Sbjct  110   S-ITFMIEGTLVAPPKRSDWSKETIRHWIMFNGVSGLTVAGGGTVDENGKIWWQNSCKTN  168

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT+ APTA+ F  C N  + N+  ++S Q H+ +  C    I++LT+ +PG SPN
Sbjct  169   AKLP-CTE-APTALTFYSCSNLKVENLKLLNSQQIHMSVEDCTDVRISSLTITAPGTSPN  226

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK+V +T   I  GDDC+SI D T ++ + N+ CGPGHGIS+GSLG   +  
Sbjct  227   TDGIHITRSKNVQVTGCIIKTGDDCMSIEDGTENLHVKNMVCGPGHGISIGSLGDHNSEA  286

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ +     YGTTNGARIKTWQ G GYA+NI F+N+ + +V NPIIIDQNYC     
Sbjct  287   HVNNVTVDTVRLYGTTNGARIKTWQGGWGYAKNIVFQNMIMENVWNPIIIDQNYCDSATP  346

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CKEQ + VQ+S+VVF+ I GT+ ++ AI L+CS+ VPC GI L  + +T +       + 
Sbjct  347   CKEQTSAVQVSNVVFKNIRGTSASKEAIKLDCSRNVPCQGITLKDVKLTIKGGGSDAKST  406

Query  241   CSNAHGEETSV  209
             C NA  +++ +
Sbjct  407   CGNAKWKKSGI  417



>emb|CAN62658.1| hypothetical protein VITISV_039094 [Vitis vinifera]
Length=435

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/419 (41%), Positives = 250/419 (60%), Gaps = 20/419 (5%)
 Frame = -1

Query  1414  FALYCCF-YSMEVFVFL--FILGLISS--SRVSCK----SFNVIDYGAKGDGMTDDSQAF  1262
             F LY  + Y+M+ F  L   IL + SS  S V+      +FNV+D+GA GDG+TDDSQAF
Sbjct  15    FCLYFKWRYAMQDFSILICLILSMASSGSSNVALNGRTTTFNVLDFGAIGDGVTDDSQAF  74

Query  1261  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  1082
             L AW   C++     S  +II    TFL+ P  F+GPCK   IH +V G + AP +   W
Sbjct  75    LKAWNAVCTARTT--SAMLIIQRKKTFLLSPTVFSGPCKPPQIHVLVLGDITAPKTRSAW  132

Query  1081  NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWW-----DQSCRDHPNMEGCTDLA-PTAM  920
                 +S WL F  + G I+NG G +DGQG  WW      Q   +  N     D+A P A+
Sbjct  133   G--RSSYWLIFQYIDGFIINGKGTLDGQGSSWWPSLYYKQELLNDTNSYDMDDVARPIAL  190

Query  919   KFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVI  740
              F FC N  +  ++  +SP  HV+LF CNG  ++NL +++P +SPNTDG+ I     + +
Sbjct  191   GFSFCNNLQIYGLNXXNSPSKHVKLFRCNGAXLSNLNIKAPKESPNTDGIVIGECSQIQV  250

Query  739   THSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYG  560
               + I  GDDC++I   ++++ I+ V CGPGHGIS+GSLG +G +  VE IH+ +S+F G
Sbjct  251   HDNNIGTGDDCVAILKGSSNINISRVACGPGHGISIGSLGMNGAYDTVEEIHVQDSSFTG  310

Query  559   TTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVV  380
             T NG RIKTWQ G GYAR I+F+ + + + +NPIIIDQ YC     C  + + V++SD+ 
Sbjct  311   TQNGIRIKTWQGGSGYARKISFQGITLNAAENPIIIDQYYCPQL-HCPNKTSAVKVSDIS  369

Query  379   FQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             +  + GT+ T+ AI+L CS+++ C  I+L+ I+IT        ++ C NAHG  +   P
Sbjct  370   YTGVQGTSMTKTAINLRCSQSMACTNIELNRINITSVGQKFITSSFCLNAHGRASRSIP  428



>ref|XP_009396710.1| PREDICTED: polygalacturonase ADPG1-like [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/403 (43%), Positives = 243/403 (60%), Gaps = 19/403 (5%)
 Frame = -1

Query  1423  ASIFALYCCFYSMEVFVFLFILGLISSSRVS--CKSFNVIDYGAKGDGMTDDSQAFLNAW  1250
              S+  +  C   M+ +    +  ++ SS V      F+V+D+GA GDGMTDD +AF   W
Sbjct  15    GSVVNVCVCISCMQEYGGCLVFLILVSSAVGGLATVFSVVDHGAMGDGMTDDLEAFKQTW  74

Query  1249  KDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLD  1070
                C       +P  ++PAG TFL+  V F+GPC S  I   + GT+VA       N LD
Sbjct  75    SAVCGDL---STPTFLVPAGMTFLLSKVSFSGPCNSP-ILVQIDGTIVALN-----NLLD  125

Query  1069  T--SQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINT  896
             T  + W++F  V GL +NG G IDGQG+ WW+  C+   N   C   AP A+      N 
Sbjct  126   TDGNYWINFEHVDGLSINGSGKIDGQGEIWWN--CKRSAN---CV-TAPNALSISGGSNF  179

Query  895   TLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCG  716
             TLS + F +S Q H+ ++   G  ++ + + +PGDSPNTDG++I + +HV +++S I  G
Sbjct  180   TLSGLDFTNSQQKHIGIYGIVGVQVHGINITAPGDSPNTDGIYIRSCQHVTVSNSTIGTG  239

Query  715   DDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIK  536
             DDCISIG+ T+DV I  + CGPGHGIS+GSLG+      VE +H+S+  F+ T NG RIK
Sbjct  240   DDCISIGNGTSDVNITQITCGPGHGISIGSLGEEETQAAVEQVHVSSCNFWETQNGVRIK  299

Query  535   TWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTA  356
             TWQ G GYARNITFEN+   +V +PIIIDQ YC+    C    + VQ+SDV + R  GT+
Sbjct  300   TWQGGSGYARNITFENINFTAVYHPIIIDQYYCNGDYDCPNMTSAVQVSDVHYIRATGTS  359

Query  355   TTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAH  227
             +++ AISLNCS+ + C GI +D +DI P   SV  A+ C NA 
Sbjct  360   SSDMAISLNCSQTIACTGITIDGVDIQPADASVKAASFCYNAQ  402



>gb|ABK26513.1| unknown [Picea sitchensis]
 gb|ABR16831.1| unknown [Picea sitchensis]
Length=429

 Score =   316 bits (810),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 168/386 (44%), Positives = 243/386 (63%), Gaps = 20/386 (5%)
 Frame = -1

Query  1408  LYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  1229
             L C  +S E    +  L L +S+ V    F+V  YGAKG+G++DDSQAFL AW  AC+S+
Sbjct  21    LLCTGFSTE-GPLIKSLDLDASAAV----FSVDSYGAKGNGVSDDSQAFLAAWNAACTSS  75

Query  1228  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSF  1049
                     ++P G T+LVKP+ FNGPCK+ H+   +SG +VAP  P  WN  + S WL F
Sbjct  76    ---SDSIFLVPHGKTYLVKPINFNGPCKTVHLTAQISGKIVAPADPCKWNPKERSVWLQF  132

Query  1048  NGVYGLIVNGGGVIDGQGKKWWDQSC-RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFV  872
             + V GL ++GGG+IDG G+KWW  SC RD  +   C ++ PTA       N  L ++ F 
Sbjct  133   SNVQGLTIHGGGIIDGSGEKWWAGSCSRDTSHR--CLNV-PTAFVLYSSSNVHLRDLTFQ  189

Query  871   SSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGD  692
             +SP+ HVQ+ +     + NL + +PGDSPNTDG+H+  S+HV+I +  I+ GDDCISI  
Sbjct  190   NSPKIHVQIALSTHVQVENLQIVAPGDSPNTDGIHLSISEHVMIQNCTIATGDDCISIVA  249

Query  691   FTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGY  512
              +++++I+ + CGPGHGIS+GSLGK      V ++ ++ ++  GT NG RIKTWQ G GY
Sbjct  250   ESSNIQISELICGPGHGISIGSLGKYNTKDTVSDVVVNGASLSGTQNGLRIKTWQGGSGY  309

Query  511   ARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGT--------GVQISDVVFQRINGTA  356
             A+ I F+++++ +V NPIII+QNYC+   +C+ Q T         VQ+++V +  I GT+
Sbjct  310   AQGIIFQHVKMINVSNPIIINQNYCAPSSSCQNQPTTICNNQSSAVQVNNVTYTDITGTS  369

Query  355   TTEAAISLNCSKAVPCLGIKLDSIDI  278
              T+ AI L CS   PC  I L+ I +
Sbjct  370   ATQDAIKLACSATAPCTNIVLEDISL  395



>gb|KHG04134.1| hypothetical protein F383_30138 [Gossypium arboreum]
 gb|KHG04901.1| hypothetical protein F383_28766 [Gossypium arboreum]
Length=417

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/385 (42%), Positives = 232/385 (60%), Gaps = 9/385 (2%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGP-C  1148
             +FNVI++GA GDG  DDS+ F +AW  AC ++    SP  ++P G T+L++P+ FNG  C
Sbjct  35    TFNVINFGAIGDGQKDDSKMFKHAWDAACDTSA--PSPTFLVPQGKTYLLQPLTFNGKHC  92

Query  1147  KSQHIHFIVSGTVVAPGSPPGWN-GLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
              S +I   + G ++AP  P  W+   + + W+ F    GL + G G I+GQG KWW  SC
Sbjct  93    NSNNITLQIDGRIIAPTKPSAWDCETNCNHWIGFENFDGLHIQGSGTINGQGDKWWKLSC  152

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             +D  N + C    PT        N  +  + F  SPQ H+        +   LT+++PG 
Sbjct  153   KD--NEKSCQHRKPTGFMIGHSKNVDIKGLTFEDSPQMHIAFESSTLIHATELTIRAPGH  210

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+HI  S +V I +S I  GDDCISIG+ +  + I+N++CGPGHGIS+GSLG  G
Sbjct  211   SPNTDGIHIQRSTNVSIDNSTIQTGDDCISIGNESKYINISNIKCGPGHGISIGSLGIMG  270

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
                 VE +H+ N TF+GTTNG RIKTWQ G G+ARNI FE++   S   PIIIDQ YC +
Sbjct  271   KTEDVEFVHVRNVTFHGTTNGVRIKTWQGGHGHARNIKFEDITSHSSTRPIIIDQYYCPH  330

Query  430   PGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPV  251
                CK Q + V+IS++ ++ INGT+  + A+ L+CS+++PC  I +  I++  +      
Sbjct  331   K-QCKNQTSAVEISNIAYENINGTSHKKIAVQLSCSESIPCKNITMKDINLIYEKHKDKT  389

Query  250   AACCSNAHG-EETSVEPG-PCLKQD  182
             ++ C NA G     V P   CL+Q+
Sbjct  390   SSYCLNARGLRNGRVHPSISCLQQE  414



>ref|XP_006465356.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Citrus 
sinensis]
Length=445

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 175/417 (42%), Positives = 236/417 (57%), Gaps = 9/417 (2%)
 Frame = -1

Query  1432  ILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAF  1262
             +L   +  L     S E F  L  L    S+R   KS  VI   D+GAKGDG  DD++AF
Sbjct  15    VLIHVLVCLSASLVSTEGFDSLLELPHSGSNRTRSKSKRVIFVGDFGAKGDGFNDDTEAF  74

Query  1261  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  1082
              NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP  P  W
Sbjct  75    ANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLKISGTIVAPKDPDVW  130

Query  1081  NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCI  902
              GL+  +WL FN V  L V GGG I+G G++WW +SC+   N       APTA+ F  C 
Sbjct  131   KGLNRRRWLYFNRVNHLTVQGGGTINGMGQEWWSRSCK--INTTNPCRHAPTAITFHKCK  188

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             N  + N+  V+S Q H+    C    I+NL V +P +SPNTDG+HI AS+ V + +S + 
Sbjct  189   NLKVQNLRVVNSQQMHIAFTNCLRVVISNLKVIAPAESPNTDGIHISASRGVEVKNSIVG  248

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDCISI   ++ + I N  CGPGHGIS+GSLGKS + V++ +I +  +    T NG R
Sbjct  249   TGDDCISIVGNSSLIRIRNFACGPGHGISIGSLGKSNSSVRIHDIMVYGALISNTQNGVR  308

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G A NI F ++ + +V NPIIIDQ YC  P  C  Q + V++ ++ F  I G
Sbjct  309   IKTWQGGSGSATNIQFLDVLMKNVSNPIIIDQYYCDSPVPCANQTSAVKVENITFIHIKG  368

Query  361   TATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             T+ TE AI   CS   PC G+ L+ + +      +  + C          VEP PC 
Sbjct  369   TSATEEAIKFACSDDSPCEGLFLEDVQLVSHSGGIAKSFCWEAYGSSVGQVEPPPCF  425



>ref|XP_010051184.1| PREDICTED: probable polygalacturonase At3g15720 [Eucalyptus grandis]
Length=495

 Score =   318 bits (814),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 172/401 (43%), Positives = 240/401 (60%), Gaps = 14/401 (3%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSR---VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             +   +++ LF      SS     +  ++NV++YGA G G  DDSQAF+ AW+D C  +  
Sbjct  98    FVAAIYLVLFAASSTFSSHGIVAASPTYNVVNYGATGSGDDDDSQAFVKAWEDTCGDSGE  157

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
               +P + +P G  F + PV F GPCKS  I+  + GT+VAP S  GW G  + +WL+F  
Sbjct  158   KGTPTLAVPGGKKFRLSPVAFKGPCKSSSINVQIDGTLVAPSSLSGWKGCSSGRWLNFQD  217

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V  L V G G +DGQG  WWD +       +G  +  PTA+ F+ CIN  LS +H V+SP
Sbjct  218   VANLNVKGSGQVDGQGSLWWDGA-------KGGCEKRPTALVFLNCINLILSGLHHVNSP  270

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             + H+ +  C+   I+NL + +P  SPNTDG+ I  + ++ I    I  GDDCI+I   ++
Sbjct  271   RNHISIINCHNGIISNLHITAPESSPNTDGIDISRTNNLDIHDLDIQTGDDCIAINGGSS  330

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
             ++ I  V CGPGHGIS+GSLGK+G +  VE + + + TF GTTNG RIKTWQ G GYA+N
Sbjct  331   NISITRVSCGPGHGISIGSLGKNGAYETVEQVQVRDCTFRGTTNGVRIKTWQGGSGYAKN  390

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCK-EQGTGVQISDVVFQRINGTATTEAAISLNC  326
             I F  +++ +V NPIIIDQ Y   PG  +  + + V +SDV F  I GT+ ++ AI L+C
Sbjct  391   IIFNQIKLDAVSNPIIIDQFY--NPGGAQLNEASSVVVSDVSFTSIRGTSASDQAIKLSC  448

Query  325   SKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             S +V C  I LD++ IT   P   V A C N HG  TS  P
Sbjct  449   S-SVGCSDITLDNVQITSSKPGETVTASCENCHGSATSTTP  488



>ref|XP_010429999.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=446

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/414 (41%), Positives = 243/414 (59%), Gaps = 9/414 (2%)
 Frame = -1

Query  1420  SIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDA  1241
             S  AL     S E  + L      S+   S +  +V  +GAKG+G TDD+QAF +AWK A
Sbjct  18    SSVALTANANSFESLLQLPRRQKRSTRPRSERLLHVGHFGAKGNGFTDDTQAFADAWKAA  77

Query  1240  CSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ  1061
             CSS       ++++P   T LV+P+  +GPCKS+ +   +SGTV+AP  P  W GL+  +
Sbjct  78    CSS---KAKTRILVPENYTSLVRPIDLSGPCKSR-LTLQISGTVIAPDDPDAWEGLNRRK  133

Query  1060  WLSFNGVYGLIVNGGGVIDGQGKKWWDQSC-RDHPNMEGCTDLAPTAMKFMFCINTTLSN  884
             WL F+GV    V GGG ++G G++WW  SC R+H N   C   APTA+ F  C N  L N
Sbjct  134   WLYFHGVSRFTVEGGGTVNGMGQEWWRISCKRNHSN--PCRG-APTALTFHKCKNMKLEN  190

Query  883   IHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCI  704
             ++ + S Q H+    C    I+ L V +P  SPNTDG+HI  S+ +VI ++ +S GDDC+
Sbjct  191   LNVIDSQQMHIAFTSCRRVTISRLKVIAPATSPNTDGIHISVSRGIVIDNTTVSTGDDCV  250

Query  703   SIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQT  524
             SI   ++ + I+N+ CGPGHGIS+GS+GKS ++ +V++I +  ++   T NG RIKTWQ 
Sbjct  251   SIVKNSSQISISNLVCGPGHGISIGSIGKSKSWEEVKDILVDTASISDTENGVRIKTWQG  310

Query  523   GRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEA  344
             G G    I F N+++ +V NPIIIDQ YC     C  Q + V I ++ F R+ GT+ ++ 
Sbjct  311   GSGLVSKIIFRNIKMNNVSNPIIIDQYYCDSRKPCANQTSAVTIENISFVRVRGTSASKQ  370

Query  343   AISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPCLKQ  185
             AI ++CS + PC  I L  ID+ P        + C  A+G  +  V P  CL +
Sbjct  371   AIKISCSDSSPCRNILLQDIDLEPLDGDGLTESFCWKAYGASSGQVYPPSCLSE  424



>gb|KHG25769.1| hypothetical protein F383_09976 [Gossypium arboreum]
Length=421

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/421 (40%), Positives = 242/421 (57%), Gaps = 25/421 (6%)
 Frame = -1

Query  1390  SMEVFVFLFILG---LISSSRVSCKS-----------FNVIDYGAKGDGMTDDSQAFLNA  1253
             ++++F F+ ++      SSSR   KS           FNVI +GA GDG  DDS+ F  A
Sbjct  3     TLKIFFFVLLIQCTIFTSSSRQLKKSNLNIDSYGDNTFNVISFGAIGDGKKDDSKGFKRA  62

Query  1252  WKDAC-SSTPVHKSPQVIIPAGSTFLVKPVQFNGP-CKSQHIHFIVSGTVVAPGSPPGWN  1079
             W   C SSTP   SP  ++P G TFL++P+ FNG  C S +I F + G ++AP  P  W 
Sbjct  63    WDAVCDSSTP---SPTFLVPQGKTFLLQPLTFNGKHCNSNNITFQIDGRIIAPTKPSTWE  119

Query  1078  -GLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCI  902
                +   W+ F    GL + G G I+GQG  WW  SC+D  N + C    PT        
Sbjct  120   CNTNCHHWIGFMNFDGLHIQGSGTINGQGDNWWKLSCKD--NQKSCQLRKPTGFMIGHSK  177

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             N  +  + F  SP+ H+        +   LT+++PG+SPNTDG+HI  S +V I ++ I 
Sbjct  178   NVDIKGLTFEDSPKMHIAFEDSTSIHATQLTIKAPGNSPNTDGIHIQRSTNVSIHNTTIQ  237

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDCISIGD +  + I N++CGPGH IS+GSLG  G   +VE +H+ N +F+GTTNG R
Sbjct  238   TGDDCISIGDGSKYINITNIECGPGHKISIGSLGIMGKTEKVEFVHVRNVSFHGTTNGVR  297

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G+ARNI FE++   +   PI+IDQ YC +   CK Q + ++IS++ ++ ING
Sbjct  298   IKTWQGGHGHARNIRFEDITSHASTRPIVIDQYYCPHK-QCKNQTSALEISNIAYENING  356

Query  361   TATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHG-EETSVEPG-PCLK  188
             T+  E A+ L+CS+  PC  I + +I++  +      ++ C NAHG     V P  PCL 
Sbjct  357   TSQKETAVQLSCSEFNPCRNITMKNINLRNKKQKGKTSSYCLNAHGLRNGKVHPNVPCLD  416

Query  187   Q  185
             +
Sbjct  417   K  417



>ref|NP_565232.1| putative polygalacturonase [Arabidopsis thaliana]
 sp|Q94AJ5.1|PGLR5_ARATH RecName: Full=Probable polygalacturonase At1g80170; Short=PG; 
AltName: Full=Pectinase At1g80170; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK76676.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAN13206.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE36366.1| putative polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/385 (41%), Positives = 236/385 (61%), Gaps = 7/385 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V ++GAKG+G+TDD++AF +AWK ACSS       ++++P   T L++P+  +G
Sbjct  49    SERLLHVGNFGAKGNGVTDDTKAFADAWKTACSS---KVKTRILVPENYTCLLRPIDLSG  105

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PCK++ +   +SGT++AP  P  W GL+  +WL F+G+  L V GGG ++G G++WW++S
Sbjct  106   PCKAR-LTLQISGTIIAPNDPDVWEGLNRRKWLYFHGLSRLTVEGGGTVNGMGQEWWERS  164

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+ H +   C   APTA+ F  C N  + N++ + S Q H+ L  C    I+ L V +P 
Sbjct  165   CK-HNHSNPCRG-APTALTFHKCKNMRVENLNVIDSQQMHIALTSCRRVTISGLKVIAPA  222

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+HI  S+ +VI ++ +S GDDCISI   +  + I+N+ CGPGHGIS+GSLGKS
Sbjct  223   TSPNTDGIHISVSRGIVIDNTTVSTGDDCISIVKNSTQISISNIICGPGHGISIGSLGKS  282

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              ++ +V +I +  +    T NG RIKTWQ G G    I F N+++ +V NPIIIDQ YC 
Sbjct  283   KSWEEVRDITVDTAIISDTANGVRIKTWQGGSGLVSKIIFRNIKMNNVSNPIIIDQYYCD  342

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C  Q + + I ++ F  + GT+ ++ AI ++CS + PC  I L  ID+ P      
Sbjct  343   SRKPCANQTSAISIENISFVHVRGTSASKEAIKISCSDSSPCRNILLQDIDLEPSNGDGF  402

Query  253   VAACCSNAHGEET-SVEPGPCLKQD  182
               + C  A+G  +  V P PCL  D
Sbjct  403   TESFCWEAYGSSSGQVYPPPCLSDD  427



>gb|KFK42419.1| hypothetical protein AALP_AA2G253800 [Arabis alpina]
Length=444

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 233/383 (61%), Gaps = 7/383 (2%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             +  +V  +GAKG+G TDD++AF++AWK ACSS       ++++P     LV+P+  +GPC
Sbjct  51    RILHVGHFGAKGNGFTDDTKAFVDAWKTACSS---KSKTRILVPENYASLVRPIDLSGPC  107

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
             K++ +   +SGT++AP  P  W GL+  +W+ F+GV  L V GGG ++G G++WW +SC+
Sbjct  108   KAR-LTLQISGTIIAPSDPDDWEGLNLRKWIYFHGVSRLTVEGGGTVNGMGQEWWRRSCK  166

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
              H +   C   APTA+ F  C N  + NI+ + S Q H+    C   +I+ L V +P  S
Sbjct  167   -HNHSNPCRG-APTALTFHKCKNMRVENINVIDSQQMHIAFTSCRRVSISGLKVIAPASS  224

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+HI  S+ +VI ++ +S GDDC+SI   ++ + I+N+ CGPGHGIS+GSLGKS +
Sbjct  225   PNTDGIHISVSRGIVIDNTTVSTGDDCVSIVKNSSQISISNIVCGPGHGISIGSLGKSKS  284

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
             + +V ++ +  ++   T NG RIKTWQ G G   NI F N+ + +V NPIIIDQ YC   
Sbjct  285   WEEVSDVTVDTASISDTENGVRIKTWQGGSGLVSNIIFRNINMNNVSNPIIIDQYYCDSK  344

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C  Q + + I ++ F RI GT+ ++ AI + CS   PC  I L+ ID+ P        
Sbjct  345   KPCANQTSALTIENIAFVRIRGTSASKQAIKITCSDTSPCRNILLEDIDLEPSNSDGYTK  404

Query  247   ACCSNAHGEET-SVEPGPCLKQD  182
             + C  A+G  +  V P  CL  +
Sbjct  405   SFCWEAYGSSSGQVYPPSCLSHE  427



>ref|XP_006291145.1| hypothetical protein CARUB_v10017263mg [Capsella rubella]
 gb|EOA24043.1| hypothetical protein CARUB_v10017263mg [Capsella rubella]
Length=441

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/412 (40%), Positives = 241/412 (58%), Gaps = 7/412 (2%)
 Frame = -1

Query  1414  FALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
              AL     S E  + L      S+   S +  +V ++GAKG+G TDD++AF  AWK ACS
Sbjct  18    LALTANANSFESLLQLPRRQWRSTRPRSERVLHVGNFGAKGNGFTDDTKAFEEAWKAACS  77

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
             S       ++++P   T LV+P+  +GPCK++ +   +SGT++AP  P  W GL+  +WL
Sbjct  78    S---KAKTRILVPENYTSLVRPIDLSGPCKAR-LTLQISGTIIAPDDPDAWEGLNRRKWL  133

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
              F+G+  L V GGG ++G G++WW +SC+ H +   C   APTA+ F  C N  L NI+ 
Sbjct  134   YFHGLSRLTVEGGGTVNGMGQEWWRRSCK-HNHSNPCQG-APTALTFHKCKNMRLENINV  191

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
             + S Q H+    C    I+ L V +P  SPNTDG+HI  S+ +VI ++ +S GDDC+SI 
Sbjct  192   IDSQQMHIAFTSCRRVTISGLKVIAPSRSPNTDGIHISVSRGIVIDNTTVSTGDDCVSIV  251

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
               ++ + I+N  CGPGHGIS+GSLGKS ++ +V++I +  ++   T NG RIKTWQ G G
Sbjct  252   KNSSQISISNFVCGPGHGISIGSLGKSKSWEEVKDIVVDTASISDTENGVRIKTWQGGSG  311

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
                 I F N+++ +V NPIIIDQ YC     C  Q T V I ++ F  + GT+ ++ AI 
Sbjct  312   LVSKIIFRNIEMNNVSNPIIIDQYYCDSRKPCANQTTAVTIENISFVGVRGTSASKQAIK  371

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPCLKQD  182
             ++CS   PC  I L  ID+ P        + C  A+G  +  V P PCL  +
Sbjct  372   ISCSDTSPCRNILLQDIDLEPLNGDGLTESFCWEAYGSSSGQVYPPPCLSDE  423



>ref|XP_002266543.3| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=388

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 229/379 (60%), Gaps = 14/379 (4%)
 Frame = -1

Query  1318  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  1139
             NV++YGA G+G TDDSQAF+ AW+D C+       P ++IP G TFL++PVQF GPCK  
Sbjct  21    NVMNYGAVGNGATDDSQAFMRAWRDICAGKSY---PNLVIPGGKTFLLRPVQFYGPCKPS  77

Query  1138  HIHFIVSGTVVAPG-SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
              I+  V G +VAP     G N L+   W+ F  V GL V G G I+G+G +WW       
Sbjct  78    KIYVEVYGRIVAPKLYDYGSNNLNC--WIGFWHVNGLTVKGNGQINGRGAEWW------Q  129

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
                 G     PTAM F  C N  L  ++F++S + H+ +   NG  I++LT+ +P  SPN
Sbjct  130   AYTSGKIYQRPTAMGFYSCNNLLLQGLNFINSQRNHISVSGSNGVTISHLTITAPDSSPN  189

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+ I  SK+V ++ S I  GDDCI+ GD T+ V +  V CGPGHGIS+GSLG  G   
Sbjct  190   TDGIDISHSKNVRVSDSTIGTGDDCIAFGDQTSQVFVKGVACGPGHGISIGSLGVGGASA  249

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             QVE IH+ + +F GT NGARIKTWQ G GYAR ITF N+++   +NPIIIDQ YC +   
Sbjct  250   QVEEIHVDSCSFKGTQNGARIKTWQGGSGYARKITFNNIKLEDAENPIIIDQYYCPHS-V  308

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C+   + VQISDV F    GT+ T+ AI L+CS+ V C  I LD I+I     +    + 
Sbjct  309   CQTTTSAVQISDVSFTGFLGTSATDNAIKLSCSETVGCTNISLDYINIKLASGNGNTYSS  368

Query  241   CSNAHGEETSVEPG-PCLK  188
             C NAHG   +  P   CLK
Sbjct  369   CINAHGTAHNTFPSLLCLK  387



>ref|XP_008243707.1| PREDICTED: probable polygalacturonase At1g80170 [Prunus mume]
Length=462

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/400 (43%), Positives = 236/400 (59%), Gaps = 9/400 (2%)
 Frame = -1

Query  1384  EVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             E F     L    S+R   KS  V+   D+GAKGDG+TDDS+AF NAW+ ACS  P+   
Sbjct  33    EDFDSFLQLPQSGSTRTRSKSKRVLFVGDFGAKGDGITDDSKAFKNAWEIACS-LPMRM-  90

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
              +++IP GST+LV PV   GPC+S+ +  ++SGT+VAP  P  W GL+  +WL F+GV  
Sbjct  91    -RIVIPVGSTYLVHPVDIAGPCRSK-VTLMISGTIVAPKDPDAWIGLNPRKWLYFHGVNH  148

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             L + GGG I+G G++WW +SC+   N       APT + F  C N  + ++  V+S Q H
Sbjct  149   LTLEGGGRINGMGQEWWTRSCKT--NSTNPCRHAPTGVTFHRCKNLKVKDLMIVNSQQMH  206

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             +    C     +NL V +P  SPNTDG+HI AS+ V + +S I  GDDCISI   ++ + 
Sbjct  207   MAFTNCMRVVASNLRVMAPAVSPNTDGIHISASRGVEVKNSIIRTGDDCISIVSNSSRIR  266

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             I N+ CGPGHGIS+GSLGKS ++  V ++ +  +    T NG RIKTWQ G G+A NI F
Sbjct  267   IINIACGPGHGISIGSLGKSNSWSHVHDVLVDEALLSNTDNGVRIKTWQGGSGFASNIAF  326

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
              N+ + +V NPIIIDQ YC     C  Q + V++ ++ F  + GT+ TE AIS  CS   
Sbjct  327   RNVLMDNVSNPIIIDQYYCDSWLPCLNQSSAVKVENISFVHVKGTSATEEAISFACSDDS  386

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPC  194
             PC G+ L+ I +   I  +  + C         SV+P  C
Sbjct  387   PCEGLYLEDIQLQSSIGGITRSLCWEAQGSSSGSVDPPAC  426



>gb|KHN39536.1| Putative polygalacturonase [Glycine soja]
Length=360

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 229/377 (61%), Gaps = 18/377 (5%)
 Frame = -1

Query  1312  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  1133
             +DYGA GDG+TDDSQAFL AW   C+    + +  + +P G TF++KP+QF+GPC    +
Sbjct  1     MDYGAIGDGLTDDSQAFLKAWSMVCAMK--NGAATLKVPPGKTFMLKPLQFSGPCSFSSV  58

Query  1132  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNM  953
             HF + G VVAP S   W G D+S+W+ F+ V GLI++GGG IDG G  WW+ SC+     
Sbjct  59    HFQLEGDVVAPKSTEAWKGQDSSKWIDFSNVDGLIIDGGGQIDGSGSVWWN-SCK-----  112

Query  952   EGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDG  773
                      A+    C N  L+    ++S + H+ +   N  +I N+T+ +P DSPNTDG
Sbjct  113   ---------ALSIHNCNNLQLTGTRHLNSARNHISINNSNHTHIFNVTITAPQDSPNTDG  163

Query  772   VHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVE  593
             + +  S +++I  S I+ GDDCI++   T+ V I  + CGPGHGISVGSLGK G    VE
Sbjct  164   IDVSQSSYILIQRSTIATGDDCIAMKSGTSYVNITGITCGPGHGISVGSLGKKGTCQTVE  223

Query  592   NIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKE  413
             ++H++N  F G  NG RIKTW  G GYARNI FE++ + +  NPIIIDQ+Y +     K+
Sbjct  224   HVHVNNCNFKGADNGMRIKTWPGGCGYARNIKFEHILLTNTKNPIIIDQDYENVQNEDKK  283

Query  412   QGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSN  233
             Q + VQIS V ++ +NGT+ +E AI LNC     C  I +D ++IT       V A C+N
Sbjct  284   QTSEVQISGVTYRCVNGTSNSETAIILNCGAGAGCTDIFMDVVNITSTSSGSNVHASCNN  343

Query  232   AHGEETSVEPG-PCLKQ  185
             AHG   S  P   CL Q
Sbjct  344   AHGVAASTSPPVSCLSQ  360



>ref|XP_006427234.1| hypothetical protein CICLE_v10027523mg [Citrus clementina]
 gb|ESR40474.1| hypothetical protein CICLE_v10027523mg [Citrus clementina]
Length=427

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 232/408 (57%), Gaps = 9/408 (2%)
 Frame = -1

Query  1405  YCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACS  1235
             +    S E F  L  L    S+    KS  VI   D+GAKGDG  DD++AF NAWK ACS
Sbjct  6     FSSLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFNDDTEAFANAWKKACS  65

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
                  K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP  P  W GL+  +WL
Sbjct  66    FPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLEISGTIVAPKDPDVWKGLNRRRWL  121

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
              FN V  L V GGG IDG G++WW +SC+   N       APTA+ F  C N  + N+  
Sbjct  122   YFNRVNHLTVQGGGTIDGMGQEWWSRSCK--INTTNPCRHAPTAITFHKCKNLKVQNLRV  179

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
             V+S Q H+    C    I+NL V +P +SPNTDG+HI AS+ V + +S +  GDDCISI 
Sbjct  180   VNSQQMHIAFTNCLRVVISNLEVIAPAESPNTDGIHISASRGVEVKNSIVGTGDDCISIV  239

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
               ++ + I N  CGPGHGIS+GSLGKS + V++ +I +  +    T NG RIKTWQ G G
Sbjct  240   GNSSLIRIRNFACGPGHGISIGSLGKSNSSVRIHDIMVYGALISNTQNGVRIKTWQGGSG  299

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
              A NI F ++ + +V NPIIIDQ YC  P  C  Q + V++ ++ F  I GT+ TE AI 
Sbjct  300   SATNIQFLDVLMKNVSNPIIIDQYYCDSPVPCANQTSAVKVENITFIHIKGTSATEEAIK  359

Query  334   LNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
               CS   PC G+ L+ + +      +  + C          VEP PC 
Sbjct  360   FACSDDSPCEGLFLEDVQLVSHSGGIAKSFCWEAYGSSVGQVEPPPCF  407



>ref|XP_002466241.1| hypothetical protein SORBIDRAFT_01g004190 [Sorghum bicolor]
 gb|EER93239.1| hypothetical protein SORBIDRAFT_01g004190 [Sorghum bicolor]
Length=455

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/377 (46%), Positives = 235/377 (62%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD++A   AWK AC+S    +   V++P G  +L+K V   GPCKS
Sbjct  61    FSLDRYGARGDGRHDDTRALAAAWKAACASP---RPAAVLVPNGRRYLLKVVTLRGPCKS  117

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               +   V GT+VA  +   W+  D   W+ F  +  L +NGGG IDG G KWW  SC+ +
Sbjct  118   T-VAVTVKGTLVASPNRADWSDRDRRLWIVFRSINKLTLNGGGAIDGNGHKWWPYSCKIN  176

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  C + APTA+ F +C N  + N+  V+S Q H+ +       +  L++ +PG SPN
Sbjct  177   KGLP-CKE-APTALSFHYCTNLRVDNLKIVNSQQIHMSVEDSTNVQLAKLSITAPGTSPN  234

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +T+ KI  GDDCISI D T+ + ++NV CGPGHGIS+GSLG   +  
Sbjct  235   TDGIHITRSKDVRVTNCKIKTGDDCISIEDGTHKLHVSNVVCGPGHGISIGSLGDDNSRA  294

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             QV  I I +   +GTTNGARIKT+Q G GYA++ITF+N+ +++V NPIIIDQNYC     
Sbjct  295   QVSGITIDSVQLHGTTNGARIKTYQGGSGYAKDITFQNMIMYNVKNPIIIDQNYCDKAKP  354

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C+EQ + VQIS+VVF+ I GT  T+ AI ++CSK VPC GI L +ID+  Q       + 
Sbjct  355   CREQRSAVQISNVVFKNIRGTTITKDAIKMHCSKNVPCQGITLQNIDLKMQGGKGNTEST  414

Query  241   CSNAHGEET-SVEPGPC  194
             C NA   +   V P PC
Sbjct  415   CQNAKWRKYGKVVPQPC  431



>ref|XP_009362523.1| PREDICTED: probable polygalacturonase At1g80170 [Pyrus x bretschneideri]
Length=462

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/381 (44%), Positives = 230/381 (60%), Gaps = 6/381 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V ++GAKGDG+TDDSQAF NAW+ ACS  PV    +++IPAGST+L  PV   G
Sbjct  55    SKRVLSVGEFGAKGDGVTDDSQAFKNAWEMACS-IPVRT--RILIPAGSTYLFHPVDIAG  111

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L V GGG I+G G++WW +S
Sbjct  112   PCRSK-VTLMISGTVIAPEDPDTWIGLNRRKWLYFHGVNHLTVEGGGTINGMGQEWWARS  170

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+   N       APTA+ F  C N  + N+  V+S Q H+    C     +NL V +P 
Sbjct  171   CKT--NSSNPCRHAPTAVTFHKCKNLKVKNLLIVNSQQMHMTFTNCMRVVASNLRVIAPA  228

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+HI ASK V +  + I  GDDCISI   ++ + I N+ CGPGHGIS+GSLGKS
Sbjct  229   VSPNTDGIHISASKGVELKDTIIRTGDDCISIVSNSSRIRIINIACGPGHGISIGSLGKS  288

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              ++ QV ++ +  +    T NG RIKTWQ G G+A NI F N+ + +V NPIIIDQ YC 
Sbjct  289   NSWSQVHDVVVDTAFLSNTDNGVRIKTWQGGSGFASNIAFRNVLMENVSNPIIIDQYYCD  348

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C  Q + V++ ++ F  I GT+ TE AI   CS   PC G+ ++ I + P +  + 
Sbjct  349   SWLPCLNQTSAVKVENISFVHIKGTSATEEAIKFVCSDYSPCEGLYMEDIQLLPSVGEIT  408

Query  253   VAACCSNAHGEETSVEPGPCL  191
              + C          V+P  C 
Sbjct  409   TSLCWQAQGSSFGLVDPPACF  429



>ref|XP_006377005.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP54802.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=388

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/385 (44%), Positives = 238/385 (62%), Gaps = 10/385 (3%)
 Frame = -1

Query  1342  SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQ  1163
             S  + + FNV+DYGA G+G  D + AF  AW D C ++   + P + +PAG TFL+K V 
Sbjct  11    SEATGRRFNVLDYGADGNGKIDATPAFQKAWGDFCQAS--EEMPTLEVPAGKTFLLKSVS  68

Query  1162  FNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWW  983
             F+GPC S++ H ++ GT+VAP S   W+  D  +W+ F  V GLIV+GGG  DG+G+ WW
Sbjct  69    FSGPCMSKNPHVLIEGTIVAPNSFDSWDDDDYEKWIGFTAVVGLIVDGGGRFDGRGEAWW  128

Query  982   DQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQ  803
              ++C D  N   C+     A+ F  C    LSN+H V+S + H+ +  C+   ++NL + 
Sbjct  129   -KACND--NDSACSKRR-QALHFNKCNGLRLSNLHHVNSQKGHICINACDDVEVSNLQIL  184

Query  802   SPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSL  623
             +P +SPNTDG+ I  S HV I  S I  GDDCI+I  F+  + +  V+CGPGHGIS+GSL
Sbjct  185   APDESPNTDGIDISESNHVNIHDSFIGTGDDCIAINGFSTSINVTGVKCGPGHGISIGSL  244

Query  622   GKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQN  443
             GK G +  VE++H+ +  F GT NG RIKTW+TG GY R ITFE++   + +NPIIIDQ 
Sbjct  245   GKDGAYETVEDVHVKSCAFKGTQNGVRIKTWETGSGYVRKITFEDITFVNSENPIIIDQQ  304

Query  442   YCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIP  263
             Y   P      G+G++ISDV ++ + G++  E AI+LNC+    C  I +D++ IT   P
Sbjct  305   Y--NPNG-NRGGSGIKISDVTYRNVRGSSADEVAIALNCAGKAACTNIVMDNVKITSSNP  361

Query  262   SVPVAACCSNAHGEETSVEPG-PCL  191
                + A C+NA G   S  P  PCL
Sbjct  362   GKQIRASCNNAKGTAISASPTVPCL  386



>ref|XP_006427256.1| hypothetical protein CICLE_v10027137mg [Citrus clementina]
 gb|ESR40496.1| hypothetical protein CICLE_v10027137mg [Citrus clementina]
Length=390

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 236/404 (58%), Gaps = 19/404 (5%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             F+ + + + +  LG  S S      +NV+++GA G+G+TDDSQAF+ AW   C  T    
Sbjct  5     FFIISLLMCMATLGW-SRSYPGTMPYNVMNFGAVGNGVTDDSQAFIKAWNAVCGDTS--N  61

Query  1216  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  1037
             +P + +P G TFL++P  F GPCKS ++   + G ++AP  P  W G D   WL F  V 
Sbjct  62    NPTLQVPQGKTFLLQPTSFQGPCKSSNLQVQIEGNLIAPEGPSSWKGKDRRSWLYFANVN  121

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQA  857
             G  VNG G IDGQG +WW          + C+D    A+ F  C +  +S +  ++S + 
Sbjct  122   GFTVNGNGEIDGQGSQWW----------KLCSD----ALVFEKCTSFQVSGLKHINSQKN  167

Query  856   HVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDV  677
             H+ L  C    ++NL + +P  SPNTDG+ I AS+++ I +S I+ GDDCI+I   ++ +
Sbjct  168   HISLDNCQDATLSNLHISAPESSPNTDGIDISASQNIHILNSNIATGDDCIAINTGSSQI  227

Query  676   EINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNIT  497
              +  + CGPGHGIS+GSLGK G    VE +H+ N T   T NG RIKTWQ G GYAR IT
Sbjct  228   NVTGLTCGPGHGISIGSLGKQGEAAAVEEVHVKNCTLNATQNGLRIKTWQGGSGYARKIT  287

Query  496   FENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKA  317
             F ++ +  VDNPIIIDQ YC +   C  +   V+ISDV +  I+GT+ T+ AI+LNCS+ 
Sbjct  288   FNDITLTDVDNPIIIDQFYCPHE-QCSNETNAVKISDVSYTGIHGTSITQDAIALNCSRT  346

Query  316   VPCLGIKLDSIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCLK  188
             V C  I L+ I I          + C NAHG+ + SV    CLK
Sbjct  347   VGCDNIVLEHIHIASSNSKEGTYSTCINAHGKCDDSVPSVGCLK  390



>ref|XP_008337125.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=393

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/406 (41%), Positives = 240/406 (59%), Gaps = 23/406 (6%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  1208
             + + +F  +L  +     S ++F+V++Y A GDG  DDS+AF+NAWK  C +  V   P 
Sbjct  6     VSLLIFSIVLSGLIDIGYSERTFDVLNYRAVGDGEADDSEAFVNAWKALCGADEVGDVPT  65

Query  1207  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ-WLSFNGVYGL  1031
             ++IP G TFL++P++F GPC+ + +H  V G VVAP +   W    +S  WL F  V  L
Sbjct  66    LVIPKGKTFLLQPIEFEGPCRPKRVHIQVLGNVVAPKTVDAWKECPSSNTWLQFTNVANL  125

Query  1030  IVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHV  851
             I++G G I+GQG  WW                   A+ F  C N  LS +  V+SP+AH+
Sbjct  126   ILDGSGTINGQGSPWWQ------------------ALHFNRCDNLRLSGLTHVNSPKAHI  167

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
              +  C   ++++LT+ +P +SPNTDG+ I  S +V I  S I  GDDCI+I   ++++ I
Sbjct  168   GINHCINVDVSHLTIIAPAESPNTDGIDISNSINVNIHDSFIGTGDDCIAINSGSSNINI  227

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
              N+ CGPGHGISVGSLGK+G    VEN+++ + +F GT NGARIKTWQ G GYA+NI FE
Sbjct  228   TNIACGPGHGISVGSLGKNGAHETVENVYVRDCSFNGTQNGARIKTWQGGSGYAKNIVFE  287

Query  490   NLQVFSVDNPIIIDQNYCSYPGTC---KEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
              + + + +NPIIIDQ YC           Q + V +S+V +    GT+ +E AI+LNC++
Sbjct  288   KITLVAAENPIIIDQFYCDAKAKVSCDNHQTSAVTVSEVRYIAFEGTSGSEEAITLNCNQ  347

Query  319   AVPCLGIKLDSIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCLKQ  185
                C  I ++ I IT  +PS  + A CS+A G    S  P  CL +
Sbjct  348   IHGCQNIVMEEIHITSAVPSKKIYASCSHAKGTCNDSTVPVSCLDK  393



>ref|XP_004486686.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X1 [Cicer arietinum]
Length=446

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/380 (43%), Positives = 228/380 (60%), Gaps = 8/380 (2%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             + F + D+GAKGDG  +D++AFL  WK ACS   +     VI P G  FLV P+   GPC
Sbjct  52    RVFPITDFGAKGDGFHNDTKAFLEVWKIACS---LSGFVNVIFPYGKNFLVYPIDIGGPC  108

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
             +S+ I   + GT+VAP +P  W GL+  +W+ F+GV  L ++GGG +DG+G++WW +SC+
Sbjct  109   RSK-ITLRILGTIVAPRNPEAWRGLNKRKWIYFHGVNHLSIDGGGTLDGKGQEWWSRSCK  167

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
                N       APTAM F  C N  + N+  ++S Q H+    C     +NL V +P  S
Sbjct  168   --INSTNPCQHAPTAMTFHKCKNLKVRNLMLLNSQQMHMAFTSCMRVVASNLKVLAPASS  225

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+HI A+K V +  S I  GDDCISI   ++ + I N+ CGPGHGIS+GSLGKS  
Sbjct  226   PNTDGIHISATKGVEVRDSLIRTGDDCISIVRNSSRILIRNISCGPGHGISIGSLGKSKA  285

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
             + +++N+++  +  Y T NG RIKTWQ G G+A  ITF+N+ +++V NPIIIDQ YC   
Sbjct  286   WEKIQNVNVDGAYLYNTDNGLRIKTWQGGSGFASKITFKNILMYNVSNPIIIDQYYCDSR  345

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C+ Q + VQ+ ++ F  I GT+ T+ AI   CS A PC G+ L++I   P        
Sbjct  346   NPCENQTSAVQVENISFINIKGTSATKEAIKFACSDASPCEGLYLENI-FLPSCLGGNTR  404

Query  247   ACCSNAHGEETS-VEPGPCL  191
             + C  AHG     + P  C 
Sbjct  405   SYCWQAHGSAQGFMYPSACF  424



>ref|XP_002889308.1| hypothetical protein ARALYDRAFT_316947 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65567.1| hypothetical protein ARALYDRAFT_316947 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 226/380 (59%), Gaps = 12/380 (3%)
 Frame = -1

Query  1312  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  1133
             + YGA GDG+ DD+ AF  AW+DAC  +   K   V +PAG  FL+  + F GPC  + +
Sbjct  1     MKYGAVGDGIADDTSAFQKAWEDACKGSS--KMGSVNVPAGKVFLLNSLHFTGPCIPKPL  58

Query  1132  HFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH-  962
              FI+ G ++A   P  W   +     WL F+ V GL + G G++DGQGK WWD  CRDH 
Sbjct  59    LFIIDGEMIAQSDPKKWENGENGVIPWLIFDQVDGLAIVGRGLLDGQGKSWWDIHCRDHA  118

Query  961   -PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
              PN   C  LAPT M F  C N TL ++ F +S Q HV +       IN++ V SP  SP
Sbjct  119   GPN---CIWLAPTMMTFSNCGNVTLKSLRFRNSAQTHVLVMGSQNVYINDIKVTSPEASP  175

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+HI +S  V I HS I+ GDDC+SIGD  N++ +  + CGPGHG S+GSLG+ G  
Sbjct  176   NTDGIHITSSTVVSINHSDIATGDDCVSIGDQVNNLNVTFMNCGPGHGDSIGSLGRGGTE  235

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
             V VENI + +  F GTTNGARIKTW  G GY R I F ++   SV NPIIIDQ Y   P 
Sbjct  236   VAVENIRVWHVNFTGTTNGARIKTWPGGTGYVRGIEFFDIHFSSVQNPIIIDQFYGCAP-  294

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCS-KAVPCLGIKLDSIDITPQIPSVPVA  248
              C E   GV I  V + +++GT+ T+ A+ L CS ++VPC  + +  ID++P      V+
Sbjct  295   KCVETRKGVHIEKVRYMKMSGTSATKVAMKLECSGESVPCSNLLMRDIDLSPADGIGSVS  354

Query  247   ACCSNAHGE-ETSVEPGPCL  191
             + CS  HG  +  + P  CL
Sbjct  355   SLCSFVHGSAQGLIRPSSCL  374



>ref|XP_007013438.1| F18B13.22 protein isoform 3, partial [Theobroma cacao]
 gb|EOY31057.1| F18B13.22 protein isoform 3, partial [Theobroma cacao]
Length=276

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 195/271 (72%), Gaps = 2/271 (1%)
 Frame = -1

Query  1318  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  1139
             +V+D+GA G+G  D S+AFL AW   CS     +S ++I+P   TFL+ PV F+G CK++
Sbjct  7     DVLDFGAVGNGKADSSEAFLKAWNFVCSRET--ESVRLIVPGKHTFLLHPVTFSGQCKAR  64

Query  1138  HIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHP  959
              I F++ GT+V+P SP  W GLD  +WL+F GV GL V G G I+G+G  WW+QSCR+HP
Sbjct  65    EIKFLIHGTIVSPVSPKAWEGLDQGKWLTFYGVSGLKVKGTGEINGRGWGWWNQSCRNHP  124

Query  958   NMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNT  779
              +EGCT LAPTA+ F  C  ++LS +  ++S Q HV +   + F + ++ + +P  SPNT
Sbjct  125   GLEGCTSLAPTAITFQSCKTSSLSELRIINSSQTHVLIEGSDHFIVKDVIITAPETSPNT  184

Query  778   DGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQ  599
             DG+HI ++ ++VI +S+I  GDDC+SIGD T +++I+ V+CGPGHGIS+GSLG++GNFVQ
Sbjct  185   DGIHISSASNIVIRNSRIGTGDDCVSIGDHTTNIDISRVKCGPGHGISIGSLGRAGNFVQ  244

Query  598   VENIHISNSTFYGTTNGARIKTWQTGRGYAR  506
             V+NI +S   F GT NGARIKTWQ GRGY R
Sbjct  245   VQNIRVSRVAFKGTANGARIKTWQVGRGYVR  275



>gb|ABD28723.1| Glycoside hydrolase, family 28 [Medicago truncatula]
Length=392

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/393 (40%), Positives = 240/393 (61%), Gaps = 8/393 (2%)
 Frame = -1

Query  1381  VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
             + + +F LGL  ++     +FNV+ YGA GDG T+DS AFL AWKD C+S     + ++I
Sbjct  1     MILSMFKLGLSITT-----TFNVLQYGAVGDGKTNDSPAFLKAWKDVCNSK--SGTSRLI  53

Query  1201  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  1022
             IPA  TFL++P+ F GPCKS +I+  +SG ++AP +   ++G   + W+ F+ V GLI++
Sbjct  54    IPAAKTFLLRPIAFRGPCKSNYIYIELSGNIIAPKTKSEYSGSPINTWIGFSFVNGLIIS  113

Query  1021  GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLF  842
             G G +DG+G  WW Q C  +P   G +   PTA+    C    +     ++  ++H+ L 
Sbjct  114   GKGTVDGRGSMWWKQPCIGNPP-PGTSCRPPTAITLNRCYRFQIKGYTSINPARSHITLT  172

Query  841   VCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNV  662
              C    I+N+ + +PG+SPNTDG+ I AS+ + + +S I+ GDDCI+I   ++ ++I  +
Sbjct  173   SCKKGIISNIRLIAPGESPNTDGIDISASRDIQVLNSFIATGDDCIAISAGSSVIKITAI  232

Query  661   QCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQ  482
              CGPGHGIS+GSLG  G+   VE++H+ N T   T  G RIKT Q G G+AR ITFEN++
Sbjct  233   TCGPGHGISIGSLGARGDTDIVEDVHVKNCTLTETLTGVRIKTKQGGGGFARRITFENIK  292

Query  481   VFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLG  302
                  NPI IDQ YC     C+     +++SDV ++ I+GT+ T+ AI+LNC + V C  
Sbjct  293   FVRAHNPIWIDQFYCVNQMVCRNMTKAIKVSDVTYRGISGTSLTDKAINLNCDQNVGCSN  352

Query  301   IKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             +  D + +   +P + V + C NAHG  +  +P
Sbjct  353   LVFDRVYVRSAVPKMKVFSFCHNAHGRASHTKP  385



>ref|XP_004302967.1| PREDICTED: probable polygalacturonase At1g80170-like [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   315 bits (806),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/401 (41%), Positives = 235/401 (59%), Gaps = 9/401 (2%)
 Frame = -1

Query  1384  EVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             E F  L  L    S+R   +S  V+    +GAKGDG+TDDS+AF NAW+ ACS   +   
Sbjct  35    EKFDSLLQLPHSGSTRTRLRSKRVLFLGAFGAKGDGITDDSKAFQNAWEVACS---IPTR  91

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  1034
              +++IP+G T+L+ PV   GPC+S+ +  ++SGT++AP SP  W GL+  +W+ F+GV  
Sbjct  92    TRILIPSGRTYLIHPVDIAGPCRSK-VTLMISGTIIAPISPDAWIGLNARKWIYFHGVNH  150

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             L V GGG +DG G++WW +SC+   N       APTA+ F  C N  + N+  V+S + H
Sbjct  151   LTVEGGGTVDGMGQEWWARSCKS--NSTNPCRHAPTAITFHRCKNLKVRNLMIVNSQKMH  208

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             +Q   C     ++L V +P  SPNTDG+HI  SK V +  S I  GDDCISI   ++ ++
Sbjct  209   MQFTNCMRVVASHLQVIAPATSPNTDGIHISVSKGVQVKDSIIRTGDDCISIVSNSSRIQ  268

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             I N+ CGPGHGIS+GSLGKS ++ QV ++ I  +    T NG RIKTWQ G G+A NI F
Sbjct  269   IVNIVCGPGHGISIGSLGKSNSWSQVRDVIIDTALLSNTENGVRIKTWQGGSGFASNIAF  328

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
              N+ + +V NPIIIDQ YC     C  Q   V++ ++ F  I GT+ TE AI   CS   
Sbjct  329   RNVVMDNVSNPIIIDQYYCDSQLPCLNQTLAVKVENISFTHIKGTSATEEAIRFACSDDS  388

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
              C G+ L+ + + P    +  + C         +V+P  C 
Sbjct  389   QCEGLYLEDVQLLPSTGEIARSFCWEAQGSSLGTVDPPACF  429



>ref|XP_004305760.1| PREDICTED: probable polygalacturonase At3g15720-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/380 (43%), Positives = 237/380 (62%), Gaps = 8/380 (2%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             ++NV+D+GA GDG  DDS+AFL AW  +C       +P+++IP   T+L++P  F+GPC+
Sbjct  2     TYNVLDHGAVGDGHRDDSEAFLKAWNASCLD---KGTPRLVIPGEKTYLLQPTNFSGPCQ  58

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQ-SCR  968
             S  IH  +SG ++AP SP  W       WL+F+ V  L V+G G I+GQG  WW++    
Sbjct  59    SSSIHVEISGKLLAP-SPDAWKEC-VDLWLTFSEVTNLTVSGSGEINGQGSLWWNKYDLL  116

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
             ++ N        P A++F  C +  LS +    SP+ H+ +  CN  N++ L +++P DS
Sbjct  117   NYVNNYKVQCERPKALRFYRCDSLQLSGLTLADSPRTHISIQYCNYANVSYLQIRAPEDS  176

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+ I  S +V I    I  GDDCI++ + T  ++I N+ CGPGHGIS+GSLGK+G+
Sbjct  177   PNTDGIDISMSSNVNIHDCNIGTGDDCIAVNNGTFIIDIKNIACGPGHGISIGSLGKNGD  236

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
                VENIH+ N +F  T NGARIKT+Q G GYAR I+FE + + +  +PIIIDQ YC   
Sbjct  237   HNTVENIHVKNCSFNSTMNGARIKTFQGGSGYARRISFEEITLTTAGHPIIIDQYYCP-E  295

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C+   + VQ+SDV F   +GT+  E AI+LNCS++V C+ I +++I+IT  + S  V 
Sbjct  296   HDCENSTSSVQVSDVTFSGFHGTSKNEQAITLNCSQSVNCVNIVMNNINITSAVASEEVR  355

Query  247   ACCSNAHGEETSVEPG-PCL  191
             A CS  +G   +  P  PCL
Sbjct  356   ASCSYVNGTSYATVPQVPCL  375



>ref|XP_010654779.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=414

 Score =   313 bits (802),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/380 (42%), Positives = 231/380 (61%), Gaps = 11/380 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV+D+GA GDG+TDDSQAFL AW   C++     S  +II    TFL+ P  F+GPCK
Sbjct  33    TFNVLDFGAIGDGVTDDSQAFLKAWNAVCTARTT--SAMLIIQRKKTFLLSPTVFSGPCK  90

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWW-----D  980
                IH +V G + AP +   W    +S WL F  + G I+NG G +DGQG  WW      
Sbjct  91    PPQIHVLVLGDITAPKTRSAWG--RSSYWLIFQYIDGFIINGKGTLDGQGSSWWPSLYYK  148

Query  979   QSCRDHPNMEGCTDLA-PTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQ  803
             Q   +  N     D+A P A+ F FC N  +  ++ ++SP  HV+LF CNG  ++NL ++
Sbjct  149   QELLNDTNSYDMDDVARPIALGFSFCNNLQIYGLNVINSPSKHVKLFRCNGAILSNLNIK  208

Query  802   SPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSL  623
             +P +SPNTDG+ I     + +  + I  GDDC++I   ++++ I+ V CGPGHGIS+GSL
Sbjct  209   APKESPNTDGIVIGECSQIQVHDNNIGTGDDCVAILKGSSNINISRVACGPGHGISIGSL  268

Query  622   GKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQN  443
             G +G +  VE IH+ + +F GT NG RIKTWQ G GYAR I+F+ + + + +NPIIIDQ 
Sbjct  269   GMNGAYDTVEEIHVQDCSFTGTQNGIRIKTWQGGSGYARKISFQGITLNAAENPIIIDQY  328

Query  442   YCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIP  263
             YC     C  + + V++SD+ +  + GT+ T+ AI+L CS+++ C  I+L  I+IT    
Sbjct  329   YCPQL-HCPNKTSAVKVSDISYAGVQGTSMTKTAINLRCSQSMACTNIELKRINITSVGQ  387

Query  262   SVPVAACCSNAHGEETSVEP  203
                 ++ C NAHG  +   P
Sbjct  388   KFVTSSFCLNAHGRASRSIP  407



>ref|XP_010030771.1| PREDICTED: probable polygalacturonase At1g80170 [Eucalyptus grandis]
Length=420

 Score =   313 bits (802),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/412 (41%), Positives = 240/412 (58%), Gaps = 16/412 (4%)
 Frame = -1

Query  1384  EVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTP  1226
              + +  F+L  + +S  S  S       F+V++YGA GDG TDD++AF  AW DAC S+ 
Sbjct  11    RILLCFFVLARVCASTGSQPSVDDGQNFFDVVEYGAVGDGRTDDTKAFKKAWTDACKSSV  70

Query  1225  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLS  1052
                 P + +P   T L++P+   GPC SQ++   + GT+VA G P  W  +  D   W+ 
Sbjct  71    --SMPIMHVPHNKTCLLQPLVLRGPCNSQNLTIQIDGTLVASGDPSAWKCDKKDCRHWIM  128

Query  1051  FNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFV  872
              + V GL V G G I+G G +WWD S   H ++ GC    PT +    C    LS + F 
Sbjct  129   ISDVDGLSVLGSGAINGNGSEWWDHSLCHHHHV-GCGK-KPTGLVIDKCNEVRLSELTFK  186

Query  871   SSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGD  692
              SPQ H+ +         NLT+ SPG SPNTDG+HI  S+HV++    I  GDDCISIG 
Sbjct  187   DSPQMHIAIEGSTRVTAANLTITSPGHSPNTDGIHIQRSQHVLVRDCYIGTGDDCISIGQ  246

Query  691   FTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGY  512
              +  ++I+ + CGPGHG+S+GSLGK G+   VE++H+ +  F GT+NG RIKTWQ G+GY
Sbjct  247   GSAHLDISGISCGPGHGVSIGSLGKHGSRETVEDVHVRDVHFVGTSNGVRIKTWQGGKGY  306

Query  511   ARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISL  332
             AR+I FE + V +  +PIIIDQ YC +   CK Q + VQIS+V + ++NGT+  +AA+ L
Sbjct  307   ARDIVFERITVTNSSHPIIIDQFYCDHE-HCKNQTSAVQISNVTYSQVNGTSHAKAAVEL  365

Query  331   NCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPG-PCLKQD  182
              CS+  PC  I +  I +   +      + CSN  G   S + P   CL++D
Sbjct  366   ACSETHPCRDILMKDITLNLTVKGKETTSHCSNVRGRRNSNIFPNISCLEED  417



>gb|EMS53069.1| Polygalacturonase [Triticum urartu]
Length=416

 Score =   313 bits (801),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 173/406 (43%), Positives = 247/406 (61%), Gaps = 18/406 (4%)
 Frame = -1

Query  1375  VFLFILGLISSSRV-----SCKS------FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  1229
             +FL +L + +++ V     S KS      F + +YGA+GDG  DD+QA   AW  ACSS+
Sbjct  13    LFLLLLSMSNANSVQETGSSLKSSTQKNVFVLDNYGARGDGKHDDTQALAKAWNAACSSS  72

Query  1228  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSF  1049
                +   +++P G T+L+K +  +GPC+S  I F V GT++AP S   W   +  +W+  
Sbjct  73    ---RPAVLLVPKGKTYLLKAITLSGPCRSS-IVFKVKGTLIAPPSMSAWTENNRRRWIFL  128

Query  1048  NGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVS  869
               + GL VNGGG I+G G+ WW  SC+ +  +  C   APTA+ F  C N  + N+  V+
Sbjct  129   QRITGLTVNGGGTINGNGEIWWQNSCKTNKALP-CKG-APTALTFHLCTNLKVDNLKLVN  186

Query  868   SPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDF  689
             S Q HV +  C+  ++  LT+ +PG SPNTDG+H+  SK+V +    I  GDDCISI + 
Sbjct  187   SQQIHVSVQDCSNVHLARLTITAPGTSPNTDGIHVTHSKYVQVRDCLIKTGDDCISIENG  246

Query  688   TNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYA  509
             T+D+ +  V CGPGHGIS+GSLG   +  +V  I+I     YGTTNGARIKTWQ G GYA
Sbjct  247   THDLHVTKVVCGPGHGISIGSLGDGNSRAEVSRIYIDTVRLYGTTNGARIKTWQGGSGYA  306

Query  508   RNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLN  329
              +I F+N+ + +V NPIIIDQNYC     CK Q + V++ DV F+ I GT  ++ AI L+
Sbjct  307   EDIVFQNMIMDAVQNPIIIDQNYCDSAKPCKSQNSAVEVRDVAFKNIRGTTISKDAIKLS  366

Query  328   CSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPC  194
             CSK +PC GI L++ID+  +       + C NA   ++ +V P PC
Sbjct  367   CSKDLPCSGIALENIDLKLEGGKGDTESTCQNAKWRKSGNVVPLPC  412



>emb|CBI36307.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 178/408 (44%), Positives = 239/408 (59%), Gaps = 20/408 (5%)
 Frame = -1

Query  1375  VFLFILGLISSSRVSCKSF----------NVIDYGAKGDGMTDDSQAFLNAWKDACSSTP  1226
             +F   L L  ++  +C+S           NV++YGA G+G TDDSQAF+ AW+D C+   
Sbjct  4     LFTIFLVLCMAAMGTCRSVDFSLLQGGQTNVMNYGAVGNGATDDSQAFMRAWRDICAGKS  63

Query  1225  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG-SPPGWNGLDTSQWLSF  1049
                 P ++IP G TFL++PVQF GPCK   I+  V G +VAP     G N L+   W+ F
Sbjct  64    Y---PNLVIPGGKTFLLRPVQFYGPCKPSKIYVEVYGRIVAPKLYDYGSNNLNC--WIGF  118

Query  1048  NGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVS  869
               V GL V G G I+G+G +WW      +  +   T     AM F  C N  L  ++F++
Sbjct  119   WHVNGLTVKGNGQINGRGAEWWQAYTSTYCKLNAST--PSIAMGFYSCNNLLLQGLNFIN  176

Query  868   SPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDF  689
             S + H+ +   NG  I++LT+ +P  SPNTDG+ I  SK+V ++ S I  GDDCI+ GD 
Sbjct  177   SQRNHISVSGSNGVTISHLTITAPDSSPNTDGIDISHSKNVRVSDSTIGTGDDCIAFGDQ  236

Query  688   TNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYA  509
             T+ V +  V CGPGHGIS+GSLG  G   QVE IH+ + +F GT NGARIKTWQ G GYA
Sbjct  237   TSQVFVKGVACGPGHGISIGSLGVGGASAQVEEIHVDSCSFKGTQNGARIKTWQGGSGYA  296

Query  508   RNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLN  329
             R ITF N+++   +NPIIIDQ YC +   C+   + VQISDV F    GT+ T+ AI L+
Sbjct  297   RKITFNNIKLEDAENPIIIDQYYCPHS-VCQTTTSAVQISDVSFTGFLGTSATDNAIKLS  355

Query  328   CSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCLK  188
             CS+ V C  I LD I+I     +    + C NAHG   +  P   CLK
Sbjct  356   CSETVGCTNISLDYINIKLASGNGNTYSSCINAHGTAHNTFPSLLCLK  403



>ref|XP_009595648.1| PREDICTED: probable polygalacturonase At3g15720 isoform X3 [Nicotiana 
tomentosiformis]
Length=365

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/364 (43%), Positives = 229/364 (63%), Gaps = 6/364 (2%)
 Frame = -1

Query  1273  SQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGS  1094
             ++AF  AW   CSS    ++P ++IP+  +FL++P+ F GPCKS +IH  +SG++VAP  
Sbjct  6     TRAFKQAWTATCSSKS--RNPSMLIPSEKSFLIRPITFQGPCKSSNIHLQLSGSIVAPED  63

Query  1093  PPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKF  914
             P  W G +   W+ F GV+GL +NG G I+G G++WW        N   CT   PTA+ F
Sbjct  64    PKEWRGCENVSWIYFTGVFGLFINGSGTINGNGQRWWKIPSGIRVNGT-CTK--PTAVHF  120

Query  913   MFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITH  734
              +C    LS I  V+S + H+ L    G  I+N+ + +P  S NTDG+ I  S  + I  
Sbjct  121   NYCNGLQLSGIKLVNSSRNHISLTYSKGVTISNIHISAPKYSRNTDGIDISNSSQLHIQD  180

Query  733   SKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTT  554
             S I  GDDCI+I     D+ I+ + CGPGHGISVGSLG    +  V+N++++N    GT 
Sbjct  181   STIQTGDDCIAINTGCVDIHISGISCGPGHGISVGSLGPDNTYAYVDNVYVTNCNLVGTQ  240

Query  553   NGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQ  374
             NG RIKTWQ G GYAR+I FE++ + +V+NPIIIDQNYC+   +C+ Q + V++S + ++
Sbjct  241   NGVRIKTWQGGSGYARSIHFEDIHLKNVENPIIIDQNYCNGDHSCQPQESAVKVSYITYK  300

Query  373   RINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-P  197
              I+G+ +++AAI+LNCS +  C  I +++I+ITP +    V A C+NA G+ +S  P  P
Sbjct  301   NIHGSTSSKAAINLNCSNSTACTNIDMENINITPVVSGQKVFAICNNAKGKASSTSPPVP  360

Query  196   CLKQ  185
             CL +
Sbjct  361   CLDK  364



>ref|XP_009338342.1| PREDICTED: probable polygalacturonase At1g80170 [Pyrus x bretschneideri]
Length=462

 Score =   314 bits (804),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 230/381 (60%), Gaps = 6/381 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V ++GAKGDG+TDDSQAF NAW+ ACS  PV    +++IP+GST+L  PV   G
Sbjct  55    SKRVLSVGEFGAKGDGVTDDSQAFKNAWEIACS-IPVRT--RILIPSGSTYLFHPVDIAG  111

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L V GGG I+G G++WW +S
Sbjct  112   PCRSK-VTLMISGTVIAPEDPDTWIGLNRRKWLYFHGVNHLTVEGGGTINGMGQEWWARS  170

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+   N       APTA+ F  C N  + N+  V+S Q H+    C     +NL V +P 
Sbjct  171   CKT--NSSNPCRHAPTAVTFHKCKNLKVKNLLIVNSQQMHMTFTNCMRVVASNLRVIAPA  228

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+HI ASK V +  + I  GDDCISI   ++ + I N+ CGPGHGIS+GSLGKS
Sbjct  229   VSPNTDGIHISASKGVELKDTIIRTGDDCISIVSNSSRIRIINIACGPGHGISIGSLGKS  288

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              ++ QV ++ +  +    T NG RIKTWQ G G+A NI F N+ + +V NPIIIDQ YC 
Sbjct  289   NSWSQVHDVVVDTAFLSNTDNGVRIKTWQGGSGFASNIAFRNVLMENVSNPIIIDQYYCD  348

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C  Q + V++ ++ F  I GT+ TE AI   CS   PC G+ ++ I + P +  + 
Sbjct  349   SWLPCLNQTSAVKVENISFVHIKGTSATEEAIKFVCSDYSPCEGLYMEDIQLLPSVGEIT  408

Query  253   VAACCSNAHGEETSVEPGPCL  191
              + C          V+P  C 
Sbjct  409   TSLCWQAQGSSFGLVDPPACF  429



>ref|XP_003613981.1| Polygalacturonase [Medicago truncatula]
 gb|AES96939.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=400

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 231/376 (61%), Gaps = 14/376 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV+ YGA GDG TDDS AF+ AW D C +T    +P +IIP G TF+++P+ F GPCK
Sbjct  28    NFNVLTYGANGDGNTDDSNAFVKAWNDVCGTT--QGTPTLIIPEGKTFMLQPLSFQGPCK  85

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQ--WLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
             S  I   V GT+ AP     W   D  +  W+ F+ + GL V G G IDGQG  WW +  
Sbjct  86    STTIQVEVKGTITAPKDIEAWKWKDNKRRSWVQFSKINGLAVYGEGTIDGQGAPWWKKYH  145

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
                 N        PTA +F+ C + T+SN++ ++SP+ H+ +  C   +I+NL + +P +
Sbjct  146   DGDSNR-------PTAFQFIGCESLTISNLNHINSPRNHISIDSCKNASISNLQIIAPEN  198

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+ I +S +++I +  I  GDDCI+I   +N + I  V CGPGHGISVGSLGK G
Sbjct  199   SPNTDGIDIASSSNIIINNLSIKTGDDCIAINSGSNFINITGVLCGPGHGISVGSLGKGG  258

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
              +  VE +H+ + TF GTTNGARIKTW+ G GYAR IT+EN+++  V NPIII+QNY   
Sbjct  259   EYATVEEVHVKDCTFTGTTNGARIKTWKGGSGYARKITYENIKLVEVKNPIIINQNY--N  316

Query  430   PGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPV  251
             P         V++SDV F  I+GT+  E  + LNC   + C  I +D I+IT      P 
Sbjct  317   PHIYDSSSEVVKVSDVTFLNIHGTSVNENTVQLNCDPKIGCDNIIIDHINITSVAGGEPH  376

Query  250   AACCSNAHGEETSVEP  203
             A+ C+NAHG  +S  P
Sbjct  377   AS-CTNAHGTCSSSYP  391



>ref|XP_007216032.1| hypothetical protein PRUPE_ppa014982mg, partial [Prunus persica]
 gb|EMJ17231.1| hypothetical protein PRUPE_ppa014982mg, partial [Prunus persica]
Length=449

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/388 (43%), Positives = 233/388 (60%), Gaps = 9/388 (2%)
 Frame = -1

Query  1345  SSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  1175
             S+R   KS  V+   D+GAKGDG+TDDS+AF NAW+ ACS  P+    +++IP GST+LV
Sbjct  46    STRTRPKSKRVLFVGDFGAKGDGITDDSKAFKNAWEIACS-LPMRM--RIVIPVGSTYLV  102

Query  1174  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQG  995
              P+   GPC+S+ +  ++SG +VAP  P  W GL+  +WL F+GV  L + GGG I+G G
Sbjct  103   HPLDIAGPCRSK-VTLMISGNIVAPKDPDAWIGLNPRKWLYFHGVNHLTLEGGGRINGMG  161

Query  994   KKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINN  815
             ++WW +SC+   N       APTA+ F  C N  + ++  V+S Q H+    C     +N
Sbjct  162   QEWWARSCKT--NSTNPCRHAPTAVTFHRCKNLKVKDLMIVNSQQMHMAFTNCMRVVASN  219

Query  814   LTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGIS  635
             L V +P  SPNTDG+HI AS+ V + +S I  GDDCISI   ++ + I N+ CGPGHGIS
Sbjct  220   LRVMAPAVSPNTDGIHISASRGVEVKNSIIRTGDDCISIVSNSSRIRIINIACGPGHGIS  279

Query  634   VGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPII  455
             +GSLGKS ++  V ++ +  +    T NG RIKTWQ G G+A NI F N+ + +V NPII
Sbjct  280   IGSLGKSNSWSHVHDVLVDVALLSNTDNGVRIKTWQGGSGFASNIAFRNVLMDNVSNPII  339

Query  454   IDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDIT  275
             IDQ YC     C  Q + V++ ++ F  + GT+ TE AIS  CS   PC G+ L+ I + 
Sbjct  340   IDQYYCDSWLPCLNQSSAVKVENISFVHVKGTSATEEAISFACSDDSPCEGLYLEDIQLQ  399

Query  274   PQIPSVPVAACCSNAHGEETSVEPGPCL  191
               I  +  + C         SV+P  C 
Sbjct  400   SSIGGITRSLCWEAQGSSSGSVDPPACF  427



>ref|NP_001275837.1| polygalacturonase precursor [Citrus sinensis]
 gb|ABM67700.1| polygalacturonase [Citrus sinensis]
Length=445

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/428 (40%), Positives = 238/428 (56%), Gaps = 28/428 (7%)
 Frame = -1

Query  1408  LYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI----------------------DYGAK  1295
             L  C +S    V + +L  +S+S VS + F+ +                      D+GAK
Sbjct  4     LKFCSFSTFFIVLIHVLVCLSASLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAK  63

Query  1294  GDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSG  1115
             GDG  DD++AF NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SG
Sbjct  64    GDGFNDDTEAFANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLKISG  119

Query  1114  TVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDL  935
             T+VAP  P  W GL+  +WL FN V  L V GGG I+G G++WW +SC+   N       
Sbjct  120   TIVAPKDPDVWKGLNRRRWLYFNRVNHLTVQGGGTINGMGQEWWSRSCK--INTTNPCRH  177

Query  934   APTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHAS  755
             APTA+ F  C N  + N+  V+S Q H+    C    I+NL V +P +SPNTDG+HI AS
Sbjct  178   APTAITFHKCKNLKVQNLRVVNSQQMHIAFTNCLRVVISNLEVIAPAESPNTDGIHISAS  237

Query  754   KHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISN  575
             + V + +S +  GDDCISI   ++ + I N  CGPGHGIS+GSLGKS + V++ +I +  
Sbjct  238   RGVEVKNSIVGTGDDCISIVGNSSLIRIRNFACGPGHGISIGSLGKSNSSVRIHDIMVYG  297

Query  574   STFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQ  395
             +    T NG RIKTWQ G G A NI F ++ + +V NPIIIDQ YC  P  C  Q + V+
Sbjct  298   ALISNTQNGVRIKTWQGGSGSATNIQFLDVLMKNVSNPIIIDQYYCDSPVPCANQTSAVK  357

Query  394   ISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET  215
             + ++ F  I GT+ TE AI   CS   PC G+ L+ + +      +  + C         
Sbjct  358   VENITFIHIKGTSATEEAIKFACSDDSPCEGLFLEDVQLVSHSGGIAKSFCWEAYGSSVG  417

Query  214   SVEPGPCL  191
              VEP PC 
Sbjct  418   QVEPPPCF  425



>gb|KDO45233.1| hypothetical protein CISIN_1g013309mg [Citrus sinensis]
Length=445

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/428 (40%), Positives = 238/428 (56%), Gaps = 28/428 (7%)
 Frame = -1

Query  1408  LYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI----------------------DYGAK  1295
             L  C +S    V + +L  +S+S VS + F+ +                      D+GAK
Sbjct  4     LKFCSFSTFFIVLIHVLVCLSASLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAK  63

Query  1294  GDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSG  1115
             GDG  DD++AF NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SG
Sbjct  64    GDGFNDDTEAFANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLEISG  119

Query  1114  TVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDL  935
             T+VAP  P  W GL+  +WL FN V  L V GGG I+G G++WW +SC+   N       
Sbjct  120   TIVAPKDPDVWKGLNRRRWLYFNRVNHLTVQGGGTINGMGQEWWSRSCK--INTTNPCRH  177

Query  934   APTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHAS  755
             APTA+ F  C N  + N+  V+S Q H+    C    I+NL V +P +SPNTDG+HI AS
Sbjct  178   APTAITFHKCKNLKVQNLRVVNSQQMHIAFTNCLRVVISNLEVIAPAESPNTDGIHISAS  237

Query  754   KHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISN  575
             + V + +S +  GDDCISI   ++ + I N  CGPGHGIS+GSLGKS + V++ +I +  
Sbjct  238   RGVEVKNSIVGTGDDCISIVGNSSLIRIRNFACGPGHGISIGSLGKSNSSVRIHDIMVYG  297

Query  574   STFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQ  395
             +    T NG RIKTWQ G G A NI F ++ + +V NPIIIDQ YC  P  C  Q + V+
Sbjct  298   ALISNTQNGVRIKTWQGGSGSATNIQFLDVLMKNVSNPIIIDQYYCDSPVPCANQTSAVK  357

Query  394   ISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET  215
             + ++ F  I GT+ TE AI   CS   PC G+ L+ + +      +  + C         
Sbjct  358   VENITFIHIKGTSATEEAIKFACSDDSPCEGLFLEDVQLVSHSGGIAKSFCWEAYGSSVG  417

Query  214   SVEPGPCL  191
              VEP PC 
Sbjct  418   QVEPPPCF  425



>ref|XP_009595647.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Nicotiana 
tomentosiformis]
Length=359

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/362 (43%), Positives = 227/362 (63%), Gaps = 6/362 (2%)
 Frame = -1

Query  1267  AFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPP  1088
             AF  AW   CSS    ++P ++IP+  +FL++P+ F GPCKS +IH  +SG++VAP  P 
Sbjct  2     AFKQAWTATCSSKS--RNPSMLIPSEKSFLIRPITFQGPCKSSNIHLQLSGSIVAPEDPK  59

Query  1087  GWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMF  908
              W G +   W+ F GV+GL +NG G I+G G++WW        N   CT   PTA+ F +
Sbjct  60    EWRGCENVSWIYFTGVFGLFINGSGTINGNGQRWWKIPSGIRVNGT-CTK--PTAVHFNY  116

Query  907   CINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSK  728
             C    LS I  V+S + H+ L    G  I+N+ + +P  S NTDG+ I  S  + I  S 
Sbjct  117   CNGLQLSGIKLVNSSRNHISLTYSKGVTISNIHISAPKYSRNTDGIDISNSSQLHIQDST  176

Query  727   ISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNG  548
             I  GDDCI+I     D+ I+ + CGPGHGISVGSLG    +  V+N++++N    GT NG
Sbjct  177   IQTGDDCIAINTGCVDIHISGISCGPGHGISVGSLGPDNTYAYVDNVYVTNCNLVGTQNG  236

Query  547   ARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRI  368
              RIKTWQ G GYAR+I FE++ + +V+NPIIIDQNYC+   +C+ Q + V++S + ++ I
Sbjct  237   VRIKTWQGGSGYARSIHFEDIHLKNVENPIIIDQNYCNGDHSCQPQESAVKVSYITYKNI  296

Query  367   NGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             +G+ +++AAI+LNCS +  C  I +++I+ITP +    V A C+NA G+ +S  P  PCL
Sbjct  297   HGSTSSKAAINLNCSNSTACTNIDMENINITPVVSGQKVFAICNNAKGKASSTSPPVPCL  356

Query  190   KQ  185
              +
Sbjct  357   DK  358



>ref|XP_010472976.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=445

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 233/385 (61%), Gaps = 9/385 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V  +GAKG+G TDD+QAF +AWK ACSS       ++++P   T LV P+  +G
Sbjct  46    SERLLHVGHFGAKGNGFTDDTQAFADAWKAACSS---KAKTRILVPENYTSLVLPIDLSG  102

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PCKS+ +   +SGT++AP  P  W GL+  +WL F+GV    V GGG ++G G++WW  S
Sbjct  103   PCKSR-LTLQISGTIIAPDDPDAWEGLNRRKWLYFHGVSRFTVEGGGTVNGMGQEWWRIS  161

Query  973   C-RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSP  797
             C R+H N   C   APTA+ F  C N  L N++ + S Q H+    C    I+ L V +P
Sbjct  162   CKRNHSN--PCRG-APTALTFHKCKNMKLENLNVIDSQQMHIAFTSCRRVTISRLKVIAP  218

Query  796   GDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGK  617
               SPNTDG+HI  S+ +VI ++ +S GDDC+SI   ++ + I+N+ CGPGHGIS+GS+GK
Sbjct  219   ATSPNTDGIHISVSRGIVIDNTTVSTGDDCVSIVKNSSQISISNIVCGPGHGISIGSIGK  278

Query  616   SGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYC  437
             S ++ +V+++ +  ++   T NG RIKTWQ G G    I F N+++ +V NPIIIDQ YC
Sbjct  279   SKSWEEVKDVLVDTASISDTDNGVRIKTWQGGSGLVSKIIFRNIKMNNVSNPIIIDQYYC  338

Query  436   SYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSV  257
                  C  Q + V I ++ F R+ GT+ ++ AI ++CS + PC  I L  ID+ P     
Sbjct  339   DSRKPCANQTSAVTIENISFVRVRGTSASKQAIKISCSDSSPCRNILLQDIDLEPLDGDG  398

Query  256   PVAACCSNAHGEET-SVEPGPCLKQ  185
                + C  A+G  +  V P  CL +
Sbjct  399   LTESFCWKAYGASSGQVYPPSCLSE  423



>ref|XP_009362540.1| PREDICTED: probable polygalacturonase At1g80170 [Pyrus x bretschneideri]
Length=462

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 229/381 (60%), Gaps = 6/381 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V ++GAKGDG+TDDSQAF NAW+ ACS  PV    +++IP GST+L  PV   G
Sbjct  55    SKRVLSVGEFGAKGDGVTDDSQAFKNAWEMACS-IPVRT--RILIPDGSTYLFHPVDIAG  111

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L V GGG I+G G++WW +S
Sbjct  112   PCRSK-VTLMISGTVIAPEDPDTWIGLNRRKWLYFHGVNHLTVEGGGTINGMGQEWWARS  170

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+   N       APTA+ F  C N  + N+  V+S Q H+    C     +NL V +P 
Sbjct  171   CKT--NSSNPCRHAPTAVTFHKCKNLKVKNLLIVNSQQMHMTFTNCMRVVASNLRVIAPA  228

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+HI ASK V +  + I  GDDCISI   ++ + I N+ CGPGHGIS+GSLGKS
Sbjct  229   VSPNTDGIHISASKGVELKDTIIRTGDDCISIVSNSSRIRIINIACGPGHGISIGSLGKS  288

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              ++ QV ++ +  +    T NG RIKTWQ G G+A NI F N+ + +V NPIIIDQ YC 
Sbjct  289   NSWSQVHDVVVDTAFLSNTDNGVRIKTWQGGSGFASNIAFRNVLMENVSNPIIIDQYYCD  348

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C  Q + V++ ++ F  I GT+ TE AI   CS   PC G+ ++ I + P +  + 
Sbjct  349   SWLPCLNQTSAVKVENISFVHIKGTSATEEAIKFVCSDYSPCEGLYMEDIQLLPSVGEIT  408

Query  253   VAACCSNAHGEETSVEPGPCL  191
              + C          V+P  C 
Sbjct  409   TSLCWQAQGSSFGLVDPPACF  429



>gb|KDO61713.1| hypothetical protein CISIN_1g037736mg [Citrus sinensis]
Length=377

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 222/374 (59%), Gaps = 22/374 (6%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV+D+GA GDG TDDS AF  AW D CS+T    S  + IPA   FL+K   F GPCK
Sbjct  16    TFNVVDFGAIGDGKTDDSDAFAKAWTDFCSATG--DSATLEIPANKAFLLKSTTFRGPCK  73

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S  ++  VSGT+VAP S   W    +  WLS   V GL ++G G IDG G+ WW+Q    
Sbjct  74    SNSVNIQVSGTIVAPDSKS-WKQCGSQCWLSLYDVQGLSIDGSGTIDGNGRGWWNQ----  128

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
                          A+ F  C N  +  I  V+SP++H+ +  CNG +++N+ + SP DSP
Sbjct  129   -------------AVYFHNCNNLQVKGITIVNSPKSHISINTCNGVSVSNIHIDSPEDSP  175

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S  V I  S I  GDDC++I   ++++ I  V CGPGHGISVGSLG  G  
Sbjct  176   NTDGIDISFSTQVNILDSSIKSGDDCVAINGGSSNINITGVACGPGHGISVGSLGLDGAD  235

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
              +VE +H+ N  F GT NGARIKT   G GYAR I+FE++ + +  NPIIIDQ+YC   G
Sbjct  236   DKVEEVHVRNCNFTGTQNGARIKTSPGGSGYARRISFEHITLIASKNPIIIDQHYCVGGG  295

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK   + V +S+V +  + G++  E AI+ +CS+   C GIK++ + IT  +P     A
Sbjct  296   GCKGT-SAVNVSEVTYSDVQGSSADEKAITFDCSEE-GCFGIKMEQVSITSSVPGKETTA  353

Query  244   CCSNAHGEETSVEP  203
              C NAHG  TS  P
Sbjct  354   YCQNAHGTSTSTSP  367



>ref|NP_001140231.1| uncharacterized protein LOC100272271 precursor [Zea mays]
 gb|ACF83387.1| unknown [Zea mays]
Length=472

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/384 (43%), Positives = 233/384 (61%), Gaps = 11/384 (3%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F++  YGA+GDG  DD+ A   AW+ AC+S    +   +++P G  +L+K V   GPC+S
Sbjct  64    FSLDRYGARGDGRHDDTGALARAWEAACASP---RPAVLLVPGGRRYLLKLVVLRGPCRS  120

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
             + +   V GT+VA  +   W+  D   W+ F  V  L V+G G IDG G  WW  SC+ +
Sbjct  121   R-VAVTVKGTLVASPNRADWSDSDRRHWIVFRSVDRLTVHGRGSIDGNGHSWWPHSCKIN  179

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  C + APTA+ F +C N  + N+  V+S Q H+ +  C    ++ L++ +PG SPN
Sbjct  180   KALP-CKE-APTALSFHYCTNLRVENLKMVNSQQIHMSIEDCASVQVSRLSITAPGTSPN  237

Query  781   TDGVHIHASKHVVITHSKISCG-DDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             TDG+HI  SK V +T+ KI  G DDC+SI D T+ + ++ V CGPGHGISVGSLG   + 
Sbjct  238   TDGIHITRSKDVRVTNCKIKTGSDDCMSIEDGTHGLHVSGVVCGPGHGISVGSLGDDDSR  297

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
              +V  I I +   +GTTNGARIKT+Q G GYAR+ITF+N+ +  V NPI+IDQ+YC    
Sbjct  298   AEVSGITIDSVQLHGTTNGARIKTYQGGSGYARDITFQNMAMHGVRNPIVIDQSYCDRAE  357

Query  424   T---CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C+E+ + VQISDVVF+ I GT  T  AI ++CS+ VPC GI L +ID+  Q     
Sbjct  358   AEPPCRERRSAVQISDVVFRNIRGTTVTRDAIRMSCSRNVPCRGIVLQNIDLKMQGGQGH  417

Query  253   VAACCSNAHGEET-SVEPGPCLKQ  185
               + C NA   ++  V P PC  +
Sbjct  418   AESTCRNAKWRKSGKVVPQPCTSK  441



>ref|XP_010088223.1| Polygalacturonase QRT2 [Morus notabilis]
 gb|EXB32775.1| Polygalacturonase QRT2 [Morus notabilis]
Length=406

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 223/363 (61%), Gaps = 16/363 (4%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             FNV D+GAK DG  DDSQAF  AWK ACSS    K   V++P    + +KP++F+GPC+S
Sbjct  46    FNVDDFGAKADGR-DDSQAFNKAWKRACSS----KEGVVLVPKNKVYHLKPIKFSGPCRS  100

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
              ++   +SG + A      +   D   W+ F  V  L V GGG IDG G+KWW  SC+ +
Sbjct  101   -YVTMRISGVIKASPRQSDYEK-DRLHWIQFENVQNLRVEGGGTIDGNGRKWWRNSCKIN  158

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
              ++         A+ F+ C N  ++N+ F ++ Q H+ +  C      NL V +PG+SPN
Sbjct  159   DSL---------AVTFLECNNLVVANLRFKNAQQMHLIIQKCVNVKAMNLRVIAPGNSPN  209

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+H+  S+++ I +S I  GDDCISI   + +V   ++ CGPGHGIS+GSLG   +  
Sbjct  210   TDGIHVTESQNIQIMNSVIRTGDDCISIVSGSKNVRATDITCGPGHGISIGSLGADNSEA  269

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V N+ ++ +TF GTTNG RIKTWQ G GYA+NI F+N+ + +V NPIIIDQNYC     
Sbjct  270   VVSNVMVNRATFSGTTNGVRIKTWQGGSGYAKNIIFQNISMRNVSNPIIIDQNYCDQDEA  329

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C EQG+ VQIS+V++  I GT+ ++ A+  +CS+  PC GI L ++D  P+     + A 
Sbjct  330   CHEQGSAVQISNVIYSNIKGTSDSKVAVKFDCSRTFPCKGISLQNVDFAPEDDGESIEAS  389

Query  241   CSN  233
             C N
Sbjct  390   CEN  392



>ref|NP_001234256.1| polygalacturonase [Solanum lycopersicum]
 gb|AAF61444.1|AF138858_1 polygalacturonase [Solanum lycopersicum]
Length=452

 Score =   313 bits (801),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 240/396 (61%), Gaps = 9/396 (2%)
 Frame = -1

Query  1372  FLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIP  1196
              L +L   +S R   +S F V D+GA GDG+TDD+++F + W  ACSS P H   +++IP
Sbjct  45    LLQLLPASASLRTKSESLFRVNDFGATGDGITDDTKSFKDVWDMACSS-PSHA--KIVIP  101

Query  1195  AGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGG  1016
             AG +FLV+ + F GPC+S+ +   ++GT++AP  P  W+ L+  +W+ F  V  L V GG
Sbjct  102   AGYSFLVRQINFAGPCRSK-VSIRIAGTILAPKDPDVWDDLNPRKWIYFFKVKHLTVEGG  160

Query  1015  GVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVC  836
             G+IDG G++WW +SC+   N       APTA+ F  C N  + NI   +S Q H+    C
Sbjct  161   GIIDGMGQEWWARSCK--VNRTNPCHHAPTALTFHKCNNLKVKNIKIFNSQQMHLAFTGC  218

Query  835   NGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQC  656
                 I+ L V++PGDSPNTD +HI +S  V +    I  GDDCISI   ++ +++ ++ C
Sbjct  219   KHVTISQLVVKAPGDSPNTDAIHISSSTQVNVKDCIIGTGDDCISIVGNSSRIKVKDIVC  278

Query  655   GPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVF  476
             GPGHGIS+GSLGKS +F QV N+H++ ++   T NG RIKTWQ G G+ + ++FEN+ + 
Sbjct  279   GPGHGISIGSLGKSNSFSQVYNVHVNGASISNTENGVRIKTWQGGSGFVKKVSFENVWME  338

Query  475   SVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIK  296
             +V NPIIIDQ YC     C  + + + I ++ F  I GT+ TE AI+L CS + PC  + 
Sbjct  339   NVSNPIIIDQYYCDSRKPCSNKTSNIHIDNISFMGIKGTSATERAITLACSDSFPCRRLY  398

Query  295   LDSIDITPQIPSVPVAACCSNAHGEETSVE-PGPCL  191
             L+ I +T      P    C  A+G  + +  P PC 
Sbjct  399   LEDIQLTSS-SGDPTTFFCWQAYGTTSGLNYPPPCF  433



>gb|KCW81410.1| hypothetical protein EUGRSUZ_C02787, partial [Eucalyptus grandis]
Length=391

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/401 (40%), Positives = 233/401 (58%), Gaps = 22/401 (5%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSR---VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  1223
             +   +++ LF      SS     +  ++NV++YGA G G  DD+QAF+ AW+D C  +  
Sbjct  2     FVAAIYLVLFAASSTFSSHGIVAASTTYNVVNYGATGSGDDDDAQAFVKAWEDTCGDSGE  61

Query  1222  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
               +P + +P G  F + PV F GPCKS  I+  + GT+VAP S  GW G  + +WL+F  
Sbjct  62    KGTPTLAVPGGKKFRLSPVAFKGPCKSSSINVQIDGTLVAPSSLSGWKGCSSGKWLNFQD  121

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             V  L V G G +DGQG  WWD                  A+ F  C+N  LS +  V+SP
Sbjct  122   VANLNVKGSGQVDGQGSPWWD---------------GAEALAFSQCVNLVLSGLKHVNSP  166

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             + H+ +  C+   ++NL + +P  SPNTDG+ I  + ++ I    I  GDDCI+I   ++
Sbjct  167   RNHISISGCDNGIVSNLQITAPESSPNTDGIDISHTNNLDIHDLDIQTGDDCIAINGGSS  226

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
             ++ I  V CGPGHG+S+GSLGK+G +  VE + + + +F GTTNG RIKTWQ G GYA+N
Sbjct  227   NISITRVSCGPGHGVSIGSLGKNGAYETVEQVQVRDCSFSGTTNGVRIKTWQGGSGYAKN  286

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCK-EQGTGVQISDVVFQRINGTATTEAAISLNC  326
             I F+ +++ +V NPIIIDQ Y   PG  +  + +GV +SDV F    G++ ++ AI L+C
Sbjct  287   IIFDQIKLDAVSNPIIIDQFY--NPGGAQPNEASGVVVSDVTFTGFRGSSASDQAIKLSC  344

Query  325   SKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             S +V C  I LD++ IT   P   V A C NAHG  T   P
Sbjct  345   S-SVGCSDITLDNVQITSSKPGDTVTASCENAHGSATLTTP  384



>gb|AAU43991.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG92404.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97396.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/377 (42%), Positives = 225/377 (60%), Gaps = 8/377 (2%)
 Frame = -1

Query  1309  DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCKSQHI  1133
             D+GA GDG+T+D+QAFL+AW  AC+ST     P V+ +PAG T+ + PV+  GPCK + +
Sbjct  39    DFGAVGDGITNDTQAFLDAWNAACAST----EPAVLAVPAGKTYQIWPVRLAGPCK-KKL  93

Query  1132  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNM  953
               ++SGT+ AP SP  W G D ++WL    V  L V+GGG IDG G +WW +SC+     
Sbjct  94    KLMISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDGMGAEWWARSCKRKKTK  153

Query  952   EGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDG  773
                T  AP A++F  C   ++  I   + PQ H+    C     + L V +P  SPNTDG
Sbjct  154   PCSTVSAPKALQFEECRRVSVQGITMQNGPQFHLMFTRCTDVKASFLRVVAPESSPNTDG  213

Query  772   VHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVE  593
             +H++ + H  I  + IS GDDC+S+    +DV + ++ CGPGHGIS+GSLGK+    ++E
Sbjct  214   IHLNDTTHAQIMDNLISTGDDCVSMVGNCSDVRVKDISCGPGHGISIGSLGKNRTTDRIE  273

Query  592   NIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKE  413
             N+ +       TTNG RIK+WQ G GYA N+ FE + + +V NPIIIDQ YC  P  C  
Sbjct  274   NVRVDTCLLTNTTNGVRIKSWQGGMGYAHNLRFEGIVMKNVSNPIIIDQYYCDQPTPCAN  333

Query  412   QGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSN  233
             Q   V++  + F  I GT+ TE AI L CS AVPC  ++L ++++T  +     +A C  
Sbjct  334   QTQAVEVRKIEFAGIRGTSATEQAIKLACSDAVPCRDLELRNVNLT-MVGGGAASAFCHR  392

Query  232   AHGEET-SVEPGPCLKQ  185
             A G+   +V P  CL +
Sbjct  393   ASGKAAGAVVPASCLAK  409



>gb|EMT24271.1| Polygalacturonase [Aegilops tauschii]
Length=410

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 236/382 (62%), Gaps = 8/382 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F V +YGA+GDG  DD Q    AW  ACSS+   +   +++P   T+L+  V  +GPCKS
Sbjct  35    FVVDNYGARGDGKHDDVQPLAKAWNAACSSS---RPAVLLVPEDKTYLLSSVTLSGPCKS  91

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               + F+V GT+ AP S   W+  D S+W+   GV GL V+GGG I+G G  WW  SC+ +
Sbjct  92    SVV-FMVKGTLAAPRSRSAWSQNDRSRWILIQGVNGLTVSGGGTINGNGDVWWTNSCKVN  150

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  CT  APTA+ F  C N  + N+  V+S Q H+ +  C+   +  L++ +PG SPN
Sbjct  151   KALP-CTK-APTALTFHQCNNLQVENLKLVNSQQIHLSVEDCSAVQLARLSITAPGTSPN  208

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK V +    I  GDDCISI +  ++++++ V CGPGHGISVGSLG   +  
Sbjct  209   TDGIHITRSKDVQVKDCVIKTGDDCISIENGAHNLDVSKVVCGPGHGISVGSLGDDNSRA  268

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I I +   YGTTNGARIKTWQ G GYA+ ITF+N+ + +V NPIIIDQ+YC     
Sbjct  269   EVSGITIDSVQLYGTTNGARIKTWQGGSGYAKGITFQNMIMDNVQNPIIIDQSYCDSAKP  328

Query  421   C-KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
             C +  G+ V++S+V+F+ I GT  ++ AI L+CS  + C GI L++ID+  +       +
Sbjct  329   CNRGHGSAVEVSNVIFKNIRGTTVSKDAIKLSCSNTISCSGIVLENIDLKMEGGKGDTES  388

Query  244   CCSNAHGEET-SVEPGPCLKQD  182
              C NA  +++ +V P PC  Q+
Sbjct  389   TCQNAKWQKSGTVIPQPCQFQN  410



>ref|XP_009418868.1| PREDICTED: polygalacturonase ADPG1-like [Musa acuminata subsp. 
malaccensis]
Length=392

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/405 (43%), Positives = 247/405 (61%), Gaps = 18/405 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISS---SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             M+  + +  L ++ S     V+  +++V+D+GAKGDG TDD+QAF +AW   CS      
Sbjct  1     MQGLISVLTLSVLVSWTIGGVTAANYSVVDHGAKGDGKTDDTQAFTDAWNAVCSDA---A  57

Query  1216  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  1037
             +P  ++P+G TFL+  V F GPCKS ++H  +SG ++ P     W+G   S W+ FN V 
Sbjct  58    APTFLVPSGMTFLLGQVLFQGPCKS-NVHVEISGNILRPSGL--WSGGVVS-WIVFNNVN  113

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQA  857
             GL +   GVIDGQG  +W  +CR   N   C D AP+A+  +    + LS +  ++SP  
Sbjct  114   GLSIASTGVIDGQGSAYW--TCR---NNYQCND-APSALTVLNANGSRLSGLKLINSPSK  167

Query  856   HVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDV  677
             H+ +    G  I+ + V +PGDSPNTDGV I  S+HV +++S I  GDDC++IG+ T DV
Sbjct  168   HLIVGRSVGVTIDRINVTAPGDSPNTDGVFIQQSQHVSLSNSIIGTGDDCVAIGNGTLDV  227

Query  676   EINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNIT  497
              +  + CGPGHGIS+GSLG   +  QVE IH+SNS  +  TNG RIKTWQ G GYA+NI+
Sbjct  228   TVTGITCGPGHGISIGSLGSENSEAQVEQIHVSNSRIFNATNGLRIKTWQGGSGYAKNIS  287

Query  496   FENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKA  317
             FE + + +VDNPI+IDQ YC        Q + +Q+S+V +  I+GT T + AI+LNCS++
Sbjct  288   FEAINLAAVDNPILIDQYYCPRGDCALNQSSSLQVSNVHYSDISGTTTGKIAINLNCSQS  347

Query  316   VPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPG-PCLK  188
             V C  I L +I+I        V A C+N  G     V+P  PCL 
Sbjct  348   VICTDISLQNINIQSADAGGTVVANCTNVQGTAVGIVKPTVPCLN  392



>ref|XP_008337027.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=373

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 217/341 (64%), Gaps = 6/341 (2%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC--SSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             K  +V  YGA GDG  DDSQAF  AWKD C  ++      P +I+P G T+L++ ++F G
Sbjct  28    KILDVTKYGAMGDGRADDSQAFFKAWKDLCZGNNDATDDIPILIVPEGKTYLLQRIKFEG  87

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC S+ +H  + G ++AP     W   D+  WLSF+ +  L+++G G IDGQG  WW  S
Sbjct  88    PCNSKSVHVQILGNLLAP-VRGAWKECDSGDWLSFSNIENLMLDGSGKIDGQGAAWWSTS  146

Query  973   CRDHPNME--GCTDLAPT-AMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQ  803
               +  + +     D  P  A++F  C N  LS + F++SPQAH+ +  C+  ++++L + 
Sbjct  147   QYNARSRKLLANNDCKPNKALQFHNCQNLKLSGLTFLNSPQAHIGINSCDNADVSDLNIH  206

Query  802   SPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSL  623
             +P DSPNTDG+ I +S HV I +S I  GDDCI+IGD  + + I N+ CGPGHGISVGSL
Sbjct  207   APEDSPNTDGIDISSSTHVTIRNSFIGTGDDCIAIGDGCSFLYITNIACGPGHGISVGSL  266

Query  622   GKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQN  443
             G+ G   +V+NI++ + +F GTTNGARIKTWQ G GYARNITFE +++     PIIIDQ 
Sbjct  267   GEDGASNKVDNIYVKDCSFTGTTNGARIKTWQGGSGYARNITFERIKLDRAKYPIIIDQY  326

Query  442   YCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
             YC+    CK Q + V ++DV +    GT+ T+ AI LNC K
Sbjct  327   YCNGEHNCKSQSSAVVVADVTYNDFEGTSATDEAIKLNCDK  367



>ref|XP_011072232.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Sesamum 
indicum]
Length=469

 Score =   313 bits (801),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 230/378 (61%), Gaps = 8/378 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
              ++ D+GAKGDG +DD+++F + WK ACSS    K   ++IP    +LV+P  F GPC+S
Sbjct  73    LSIDDFGAKGDGFSDDTKSFQDVWKVACSSPSRAK---IVIPVDKFYLVRPTDFTGPCRS  129

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
             + +   VSG +VAP  P  W+GL+  +WL F+ V  L + GGG+IDG G +WW +SC+ +
Sbjct  130   K-VTLSVSGFIVAPRDPEVWDGLNIRKWLYFHQVKHLKIEGGGIIDGMGWEWWSRSCKKN  188

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
              +   CT  AP A+ F  C N  L NI   +  Q H+    CN    +++TV +P DSPN
Sbjct  189   -DSNPCTQ-APAAVTFHRCKNLKLRNITLFNGQQLHMAFTHCNRVAASHVTVIAPADSPN  246

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
              DG+HI AS  V +    I+ GDDCIS+   ++ + + NV CGPG+GIS+GSLGK  +  
Sbjct  247   MDGIHISASTRVELKDIIITTGDDCISVVSNSSRISVKNVVCGPGNGISIGSLGKYNSSA  306

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
              V+++ +S +  + + NG RIKTWQ G G+ARNITFEN+ + +V NPI+IDQ YC+ P T
Sbjct  307   SVQDVIVSGAALFDSENGVRIKTWQGGSGFARNITFENIWMRNVSNPIVIDQYYCASPET  366

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             C  Q   V I  + F+ I GT+ TE AI   CS + PC  + L++I +T     +   + 
Sbjct  367   CGNQTAAVSIDRIYFRNIKGTSATEKAIRFACSDSYPCKRLYLENIQLTTS-SGIAAKSF  425

Query  241   CSNAHGEETS-VEPGPCL  191
             C  A+G  T  V P  C+
Sbjct  426   CWKAYGTSTGLVYPPSCI  443



>gb|KHN45091.1| Polygalacturonase [Glycine soja]
Length=388

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/363 (42%), Positives = 230/363 (63%), Gaps = 19/363 (5%)
 Frame = -1

Query  1342  SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQ  1163
             S  S +  N+ DYGAK     DD++AF  AW +ACS+  +     +++P    + +KP+ 
Sbjct  10    STRSQRRINIDDYGAKASDGRDDTEAFEKAWDEACSTGGI-----LVVPEEKIYHLKPIT  64

Query  1162  FNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ-----WLSFNGVYGLIVNGGGVIDGQ  998
             F+GPC + +  F V GT+ A      W  + T Q     W+ F  V  L V+GGG I+G 
Sbjct  65    FSGPCLT-NTAFRVYGTIKA------WPKMSTYQNDRLHWIKFENVTNLRVDGGGTINGN  117

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G+KWW+ SC+ + N+      APTA+ F  C N  ++N+ F ++ Q H++   CN    +
Sbjct  118   GRKWWENSCKRNENLP--CKPAPTAVTFYQCNNLRVTNLRFKNAQQMHIRFQKCNNVTAS  175

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             NL V++PG+SPNTDG+H+  +++++I++S I  GDDCISI   + +V   +V+CGPGHGI
Sbjct  176   NLIVRAPGNSPNTDGIHVTETRNILISNSIIGTGDDCISIVSGSQNVRAIDVKCGPGHGI  235

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLG   +  QV N+ ++ +TF GTTNG RIKTWQ G GYA+N+ F N+ + +V NPI
Sbjct  236   SIGSLGAGDSKAQVSNVLVNRATFTGTTNGVRIKTWQGGSGYAKNVKFVNITMRNVTNPI  295

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             I+DQNYC     C E+ + V++S++V+Q I GT+ +E AI  +CSK VPC GI L  + +
Sbjct  296   IVDQNYCDQDKPCHEKDSAVKLSNIVYQNIRGTSASEVAIKFDCSKTVPCKGIYLQDVIL  355

Query  277   TPQ  269
             TP+
Sbjct  356   TPE  358



>ref|XP_006299494.1| hypothetical protein CARUB_v10015662mg [Capsella rubella]
 gb|EOA32392.1| hypothetical protein CARUB_v10015662mg [Capsella rubella]
Length=437

 Score =   311 bits (796),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 227/371 (61%), Gaps = 8/371 (2%)
 Frame = -1

Query  1339  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  1160
             R S ++FNV  +GAK +G  DDSQAF+ AW+ ACSST +     V++P    + +KPV F
Sbjct  63    RSSPQAFNVNSFGAKANG-NDDSQAFMKAWQSACSSTGI---VYVVVPKNRKYTIKPVTF  118

Query  1159  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWD  980
             +GPCKS  I F + G + A  +P  +      +W+ F  V  L V GGG IDG G  WW 
Sbjct  119   SGPCKSSMIVFKIYGMIEAWENPSDYK--VRRRWIVFENVTNLRVEGGGRIDGNGHIWWS  176

Query  979   QSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQS  800
             +SC+ +P +  C   APTA+ FM C N  +SNI   ++ Q H+    C       L V S
Sbjct  177   KSCKINPKLP-CLG-APTAVMFMECNNLRVSNIRLENAQQMHLTFQNCQNVKALRLRVTS  234

Query  799   PGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLG  620
             PGDSPNTDG+H+  S++++I  S +  GDDCISI   + +V    + CGPGHGIS+GSLG
Sbjct  235   PGDSPNTDGIHVSGSRNILIQDSVVGTGDDCISIVSGSENVRATGITCGPGHGISIGSLG  294

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
                +   V N+ I+ +T  GTTNG RIKTWQ GRG A+NI F+++ + +V NPI+I+Q+Y
Sbjct  295   AGNSEAYVSNVVINKATLIGTTNGVRIKTWQGGRGMAKNIIFQDILMKNVTNPILINQDY  354

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPS  260
             C    +C EQ + VQ+S+V+++ I GT++T  A+   CSK++PC GI +  +++  Q   
Sbjct  355   CDRVESCPEQKSAVQVSNVLYKNIQGTSSTPVAVKFQCSKSIPCRGISMQDVELVDQTQQ  414

Query  259   VPVAACCSNAH  227
                 A CSN  
Sbjct  415   DVSKASCSNVR  425



>emb|CBI36306.3| unnamed protein product [Vitis vinifera]
Length=495

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 166/405 (41%), Positives = 241/405 (60%), Gaps = 16/405 (4%)
 Frame = -1

Query  1393  YSMEVFVFL--FILGLISS--SRVSCK----SFNVIDYGAKGDGMTDDSQAFLNAWKDAC  1238
             Y+M+ F  L   IL + SS  S V+      +FNV+D+GA GDG+TDDSQAFL AW   C
Sbjct  92    YAMQDFSILICLILSMASSGSSNVALNGRTTTFNVLDFGAIGDGVTDDSQAFLKAWNAVC  151

Query  1237  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  1058
             ++     S  +II    TFL+ P  F+GPCK   IH +V G + AP +   W    +S W
Sbjct  152   TARTT--SAMLIIQRKKTFLLSPTVFSGPCKPPQIHVLVLGDITAPKTRSAWG--RSSYW  207

Query  1057  LSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIH  878
             L F  + G I+NG G +DGQG  WW      +   E   D    A+ F FC N  +  ++
Sbjct  208   LIFQYIDGFIINGKGTLDGQGSSWWPSL---YYKQELLNDTNSYALGFSFCNNLQIYGLN  264

Query  877   FVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISI  698
              ++SP  HV+LF CNG  ++NL +++P +SPNTDG+ I     + +  + I  GDDC++I
Sbjct  265   VINSPSKHVKLFRCNGAILSNLNIKAPKESPNTDGIVIGECSQIQVHDNNIGTGDDCVAI  324

Query  697   GDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGR  518
                ++++ I+ V CGPGHGIS+GSLG +G +  VE IH+ + +F GT NG RIKTWQ G 
Sbjct  325   LKGSSNINISRVACGPGHGISIGSLGMNGAYDTVEEIHVQDCSFTGTQNGIRIKTWQGGS  384

Query  517   GYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAI  338
             GYAR I+F+ + + + +NPIIIDQ YC     C  + + V++SD+ +  + GT+ T+ AI
Sbjct  385   GYARKISFQGITLNAAENPIIIDQYYCPQL-HCPNKTSAVKVSDISYAGVQGTSMTKTAI  443

Query  337   SLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
             +L CS+++ C  I+L  I+IT        ++ C NAHG  +   P
Sbjct  444   NLRCSQSMACTNIELKRINITSVGQKFVTSSFCLNAHGRASRSIP  488



>ref|XP_008231375.1| PREDICTED: probable polygalacturonase At3g15720 [Prunus mume]
Length=468

 Score =   311 bits (798),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 163/391 (42%), Positives = 235/391 (60%), Gaps = 12/391 (3%)
 Frame = -1

Query  1357  GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
               + +      +FNV+DYGA G+G+ DD++AFL AW   C+S+    +  +++P G  FL
Sbjct  86    AFLEAWEAKTNTFNVVDYGAVGNGLVDDTKAFLKAWGAMCASS-TQGTLTLVVPKGKRFL  144

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             +  V F GPCK+ +++F + G++VAP +   W   +   W+ F+ V GL VNGGG IDG 
Sbjct  145   LNAVAFEGPCKASNVNFQIQGSIVAPNNIGAWT--NKEMWIHFSDVQGLSVNGGGRIDGN  202

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G  WW ++C    + +      PTA+ F  C    LS +   +SP+ H+ +  CNG  + 
Sbjct  203   GAVWW-KACGSSKDCQ-----RPTALHFNKCHGFQLSRLAIFNSPKNHISICGCNGPRVF  256

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
              L + +P DSPNTDG+ I  S  V I  S I+ GDDCI+I   ++ ++I +++CGPGHGI
Sbjct  257   GLLIWAPKDSPNTDGIDISRSTRVTIQSSHIATGDDCIAINSGSSYIKIRDIKCGPGHGI  316

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLG+ G + QVE + +SN TF GTTNG RIKTW+ G GYAR ITFE +      NPI
Sbjct  317   SIGSLGQHGEYSQVEEVQVSNCTFKGTTNGVRIKTWEGGSGYARKITFEGITFEDTKNPI  376

Query  457   IIDQNYC-SYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSID  281
             IIDQ+Y    P +  +    VQ+SDV ++ INGT T E AI+L C+    C  I +++++
Sbjct  377   IIDQHYFDKRPTSATDINKSVQVSDVTYRNINGTCTDEKAITLACAGG-GCTNIVMNNVN  435

Query  280   ITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             I   +P+    A C NAHG  +   P  PCL
Sbjct  436   IKSDLPNKRSYAYCDNAHGTSSFSLPSVPCL  466



>ref|XP_007207616.1| hypothetical protein PRUPE_ppa019727mg, partial [Prunus persica]
 gb|EMJ08815.1| hypothetical protein PRUPE_ppa019727mg, partial [Prunus persica]
Length=382

 Score =   309 bits (791),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 162/390 (42%), Positives = 233/390 (60%), Gaps = 13/390 (3%)
 Frame = -1

Query  1354  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  1175
              + +      +FNV+DYGA G+G+ DD++AFL AW   C+S+    +  +++P G  FL+
Sbjct  2     FLEAWEAKTNTFNVVDYGAVGNGLVDDTKAFLKAWGAMCASS-TQGTLTLVVPKGKRFLL  60

Query  1174  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQG  995
               V F GPC++  ++F + G++VAP +   W   +   W+ F+ V GL VNGGG IDG G
Sbjct  61    NAVAFEGPCRAGKVNFQIQGSIVAPNNIGAWT--NKEMWIHFSDVQGLTVNGGGRIDGNG  118

Query  994   KKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINN  815
               WW ++C      +GC    PTA+ F  C    LS +   +SP+ H+ +  CNG  +  
Sbjct  119   AVWW-KAC----GSKGCQ--RPTALHFNKCHGFQLSRLAIFNSPKNHISICSCNGPRVYG  171

Query  814   LTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGIS  635
             L + +P DSPNTDG+ I  S  V I  S I+ GDDCI+I   ++ ++I +++CGPGHGIS
Sbjct  172   LLIWAPKDSPNTDGIDISRSTRVTIQSSHIATGDDCIAINSGSSYIKIRDIRCGPGHGIS  231

Query  634   VGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPII  455
             +GSLG+ G + QVE + +SN +F GTTNG RIKTW+ G GYAR ITFE +      NPII
Sbjct  232   IGSLGEHGEYSQVEEVQVSNCSFKGTTNGVRIKTWEGGSGYARKITFEGITFEDTKNPII  291

Query  454   IDQNYC-SYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             IDQ+Y    P +  +    VQ+SDV ++ I GT T E AI+L C+    C  I ++++ I
Sbjct  292   IDQHYFDKRPTSAMDISKSVQVSDVTYRNIKGTCTDEKAITLACAGG-GCTNIVMNNVSI  350

Query  277   TPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
                +P+    A C NAHG  +   P  PCL
Sbjct  351   KSDLPNKRSYAYCDNAHGTSSFSLPSVPCL  380



>ref|XP_008243390.1| PREDICTED: probable polygalacturonase At3g15720 [Prunus mume]
Length=453

 Score =   311 bits (796),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 163/381 (43%), Positives = 230/381 (60%), Gaps = 13/381 (3%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             + V+DYGA G+G+ DD++AFL AW   C+S P   +  +++P G  FL+  V F GPC++
Sbjct  84    YEVVDYGAVGNGLVDDTKAFLKAWGAMCAS-PTQGTLTLVVPQGKRFLLNAVAFEGPCRA  142

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               ++F + G++VAP +   W   +   W+ F+ V GL VNGGG IDG G  WW ++C   
Sbjct  143   SKVNFQIQGSIVAPNNIGAWT--NKEMWIQFSNVQGLSVNGGGRIDGNGAVWW-KAC---  196

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
                +GC    PTA+ F  C    LS +   +SP+ H+ +  CNG  +  L + +P DSPN
Sbjct  197   -GSKGCQR--PTALHFNKCHGFQLSRLALFNSPKNHISICSCNGPRVFGLLIWAPEDSPN  253

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+ I  S  V I  S I+ GDDCI+I   ++ ++I ++ CGPGHGIS+GSLG+ G + 
Sbjct  254   TDGIDISHSTRVTIQSSHIATGDDCIAINSGSSYIKIRDINCGPGHGISIGSLGEHGEYS  313

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             QVE + +SN TF GTTNG RIKTW+ G GYAR ITFE +      NPI+IDQ+Y + P +
Sbjct  314   QVEEVQVSNCTFKGTTNGVRIKTWEGGSGYARKITFEGITFEDTKNPIVIDQHYFAKPTS  373

Query  421   C-KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
                +    VQ+SDV ++ INGT   E AI+L C+    C  I +D++ I   +P+    A
Sbjct  374   AIMDISKSVQVSDVTYRNINGTCADEKAITLACAGG-GCTNIVMDNVTIKSDLPNKRSYA  432

Query  244   CCSNAHGEET-SVEPGPCLKQ  185
              C NAHG  + SV   PCL  
Sbjct  433   YCDNAHGTSSFSVPSVPCLSH  453



>ref|XP_009135014.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Brassica rapa]
Length=437

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 236/373 (63%), Gaps = 9/373 (2%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  1169
             ++ R S ++FNV  +GAK +G  DDSQAF+ AW+ ACSS     +  +++P    + +KP
Sbjct  59    AAPRSSPRAFNVNSFGAKANG-NDDSQAFMKAWEAACSSK---GTAYIVVPENRAYTLKP  114

Query  1168  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKK  989
             V+F+GPCKS  I F + G + A  +P  +   +   W+ F  V  L V GGG +DG GK 
Sbjct  115   VKFSGPCKSSMIVFKIYGKIEAWKNPSDYR--ERGFWIVFQTVDNLRVEGGGRVDGNGKI  172

Query  988   WWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLT  809
             WW +SC+ +P +  C + APTA+ F+ C N  + NI   ++ Q H+++  C      NL 
Sbjct  173   WWPKSCKINPELP-CQE-APTAVTFVECNNLMVRNIRLENAQQMHMRVQKCENVKALNLM  230

Query  808   VQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVG  629
             V+SPGDSPNTDG+H+  +++++I  S I  GDDCISI   + +V    + CGPGHGIS+G
Sbjct  231   VKSPGDSPNTDGIHVTGTRNILIQDSIIRTGDDCISIVSGSENVRATGITCGPGHGISIG  290

Query  628   SLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIID  449
             SLG   +   V N+ +S +T  GTTNG RIKTWQ G G A+NI F+++ + +V NPIII+
Sbjct  291   SLGAHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGGHGMAKNIIFKDILMKNVTNPIIIN  350

Query  448   QNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             QNYC     C EQ + VQ+S+V+++ I+GT+++  AI   CSK++PC GI L ++++  Q
Sbjct  351   QNYCDQTKACPEQKSAVQVSNVLYKNIHGTSSSPEAIKFVCSKSIPCQGISLQNVELVDQ  410

Query  268   IPSVPVA-ACCSN  233
                  V+ A CSN
Sbjct  411   NTKQDVSKATCSN  423



>ref|XP_004305261.1| PREDICTED: probable polygalacturonase At3g15720-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/416 (42%), Positives = 241/416 (58%), Gaps = 21/416 (5%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  1220
             M   + L IL  I+SS  S      +FNV+DYGA GDG  DDS+AFL AW  +CS+    
Sbjct  1     MRNALVLLILHTIASSNFSFGHGQTTFNVLDYGAAGDGERDDSKAFLEAWNASCSTYASE  60

Query  1219  KSPQVIIPAGSTFLVKPVQFNGPCKSQH-IHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  1043
              +  ++IPA  TFL++P  F+G C S + I   + G +VAP +P  W     S WLSF  
Sbjct  61    GTTTLVIPAEKTFLLQPTTFSGSCNSGNGIRVEIMGKIVAPKNPDEWKECVES-WLSFGN  119

Query  1042  VYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSP  863
             +  LI+NG G I+GQG  WW                   A+ F  C N  LS +  V SP
Sbjct  120   LSNLIINGTGEINGQGSPWWSN-----------ITTQVNALHFFNCSNLRLSGVTHVDSP  168

Query  862   QAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTN  683
             +AH+ +   N   ++++ + +P DSPNTDG+ I  S +V I  SKI+ GDDCI+I + ++
Sbjct  169   KAHISINRSNNVTVSDIHILAPHDSPNTDGIDISVSTYVNIHDSKIATGDDCIAINNGSS  228

Query  682   DVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARN  503
              + I N+ CGPGHGISVGSLG + ++   E I++ N +F GT NGAR+KTWQ G GYAR 
Sbjct  229   FINITNIACGPGHGISVGSLGVNRSYQTAEQINVRNCSFNGTQNGARLKTWQGGSGYARK  288

Query  502   ITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS  323
             ITFEN+ +    +PIIIDQ+YC+    C      VQ+SDV +  I GT+++  AI  NC+
Sbjct  289   ITFENITLTDAKHPIIIDQHYCNGKHDCPNSTQAVQVSDVTYSNIQGTSSSMEAIVFNCT  348

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGE-ETSVEPGPCLKQD---*FNLF  167
             +   C  I +  I+IT  I    ++A C NA+G   T+V    CLK +    FNL+
Sbjct  349   QIPGCTNIVMKQINITSAIAYQNISASCINANGTCSTTVPQVSCLKTNETMSFNLY  404



>ref|XP_009799918.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=451

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 231/376 (61%), Gaps = 8/376 (2%)
 Frame = -1

Query  1315  VIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQH  1136
             V ++GAKGDG+TDD+++F + WK ACSS P+   P+++IP+G +FLV+P+ F GPC+S+ 
Sbjct  63    VNEFGAKGDGITDDTKSFHDVWKIACSS-PLR--PKIVIPSGYSFLVRPIDFVGPCRSK-  118

Query  1135  IHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPN  956
             +   ++G++VAP  P  W+GL+  +WL F  V  L V GGG ++G G+KWW  SC+   N
Sbjct  119   VSLSIAGSIVAPKDPQVWDGLNPHKWLYFFKVKYLTVEGGGTVNGMGQKWWSSSCKI--N  176

Query  955   MEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTD  776
                    APTAM F  C N  + +I  ++S Q H+ +  C    +++L VQ+P  SPNTD
Sbjct  177   TTNPCRHAPTAMTFHKCNNLKVRDIRMLNSQQMHISISKCIHVEVSHLIVQAPAKSPNTD  236

Query  775   GVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQV  596
             G+HI +S HV I  S I  GDDCISI   ++ + + N+ CGPGHGIS+GSLGKS ++ QV
Sbjct  237   GIHISSSIHVGIRDSSIGTGDDCISIVGNSSRILVKNIACGPGHGISIGSLGKSNSWSQV  296

Query  595   ENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCK  416
              ++ +  +    T NG RIKTWQ G G+ R I F NL + +V NPIIIDQ YC     C 
Sbjct  297   HDVSVDGAYLSNTENGVRIKTWQGGSGFVRKIAFANLWMENVSNPIIIDQYYCDSRQACP  356

Query  415   EQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCS  236
              Q   + I+ V F  I G++ T+ AI+  CS + PC  + L+ I +   +   P  + C 
Sbjct  357   NQTLAISINSVSFVGIRGSSATKNAITFACSDSSPCRNLYLEDIQLVSFL-EFPTTSFCW  415

Query  235   NAHGEETSV-EPGPCL  191
             NA+G  + +  P  C 
Sbjct  416   NAYGSTSGLNNPSSCF  431



>gb|EEC79626.1| hypothetical protein OsI_20838 [Oryza sativa Indica Group]
Length=426

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 224/377 (59%), Gaps = 8/377 (2%)
 Frame = -1

Query  1309  DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCKSQHI  1133
             D+GA GDG+ +D+QAFL+AW  AC+ST     P V+ +PAG T+ + PV+  GPCK + +
Sbjct  39    DFGAVGDGIANDTQAFLDAWNAACAST----EPAVLAVPAGKTYQIWPVRLAGPCK-KKL  93

Query  1132  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNM  953
               ++SGT+ AP SP  W G D ++WL    V  L V+GGG IDG G +WW +SC+     
Sbjct  94    KLMISGTIAAPASPDEWAGRDPTKWLFVFRVDDLSVSGGGTIDGMGAEWWARSCKRKKTK  153

Query  952   EGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDG  773
                T  AP A++F  C   ++  I   + PQ H+    C     + L V +P  SPNTDG
Sbjct  154   PCSTVSAPKALQFEECRRVSVQGITMQNGPQFHLMFTRCTDVKASFLRVVAPESSPNTDG  213

Query  772   VHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVE  593
             +H++ + H  I  + IS GDDC+S+    +DV + ++ CGPGHGIS+GSLGK+    ++E
Sbjct  214   IHLNDTTHAQIMDNLISTGDDCVSMVGNCSDVRVKDISCGPGHGISIGSLGKNRTTDRIE  273

Query  592   NIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKE  413
             N+ +       TTNG RIK+WQ G GYA N+ FE + + +V NPIIIDQ YC  P  C  
Sbjct  274   NVRVDTCLLTNTTNGVRIKSWQGGMGYAHNLRFEGIVMKNVSNPIIIDQYYCDQPTPCAN  333

Query  412   QGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSN  233
             Q   V++  + F  I GT+ TE AI L CS AVPC  ++L ++++T  +     +A C  
Sbjct  334   QTQAVEVRKIEFAGIRGTSATEQAIKLACSDAVPCRDLELRNVNLT-MVGGGAASAFCHR  392

Query  232   AHGEET-SVEPGPCLKQ  185
             A G+   +V P  CL +
Sbjct  393   ASGKAAGAVVPASCLAK  409



>ref|XP_010472981.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Camelina 
sativa]
Length=397

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/401 (43%), Positives = 235/401 (59%), Gaps = 12/401 (3%)
 Frame = -1

Query  1381  VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  1202
             + V + ILGL+  S       +V+ YGA GDG+ DD+ AF  AW++AC  +   K+  V 
Sbjct  5     LLVLVAILGLLWLS----NGESVMKYGAVGDGIADDTSAFQKAWENACKGS--SKTGSVH  58

Query  1201  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLI  1028
             +PAG  FL+  + F GPC  + + F + G ++A   P  W   +     WL F+ V GL 
Sbjct  59    VPAGKVFLLNSLHFTGPCIPKPLLFTIDGEMIAQSDPNKWENGENGVIPWLIFDQVDGLA  118

Query  1027  VNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQ  848
             + G G+++GQGK WWD  CRDHP    C  LAPT M F  C N TL ++ F  S Q HV 
Sbjct  119   IVGRGLLNGQGKAWWDIHCRDHPG-PNCIWLAPTMMTFSNCGNVTLKSLRFRDSAQTHVL  177

Query  847   LFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEIN  668
             +       I+++ + SP  SPNTDG+HI +S  V I HS I+ GDDC+SIGD  N+V ++
Sbjct  178   VMGSQNVYISDIKITSPEASPNTDGIHITSSTSVSINHSDIAAGDDCVSIGDQVNNVTVS  237

Query  667   NVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFEN  488
              V CGPGHG+SVGSLG+ G  V VENI + +  F GTTNGARIKTW  G GY R I F +
Sbjct  238   FVNCGPGHGVSVGSLGRGGTEVAVENIRVWHVNFTGTTNGARIKTWPGGTGYVRGIEFFD  297

Query  487   LQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS-KAVP  311
             ++  SV NPIIIDQ Y   P  C +    V I  V + +++GT+ T+ A+ L+CS ++VP
Sbjct  298   IRFSSVQNPIIIDQFYGCAP-NCPQTRKAVHIEKVRYMKMSGTSATKVAMKLDCSGESVP  356

Query  310   CLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
             C  + +  I ++P      V++ CS   G     + P  CL
Sbjct  357   CSILFMRDIALSPADGIDSVSSLCSFVQGSAQGIIRPSSCL  397



>ref|XP_011078892.1| PREDICTED: polygalacturonase [Sesamum indicum]
Length=457

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 224/353 (63%), Gaps = 6/353 (2%)
 Frame = -1

Query  1336  VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFN  1157
              S K+ NV+ +GAKGDG TDD++AF NAW++ACSS+   ++   I+P   ++L+KP++F+
Sbjct  82    ASIKTINVLSFGAKGDGSTDDTKAFENAWEEACSSS---ENVTFIVPQSRSYLLKPLRFS  138

Query  1156  GPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQ  977
             GPC S  I   + GT++A      +   D   WL F+ V  L+V GGG IDG G  WW  
Sbjct  139   GPCNSNIIKMEIGGTLIASDDRSDYKK-DKRHWLRFDSVENLVVEGGGTIDGNGNVWWQN  197

Query  976   SCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSP  797
             SC+ + N + C D APTA+ F  C +  + N+   ++ Q HV    C     + L V SP
Sbjct  198   SCKINKN-KPCKD-APTALTFYKCTDLVVKNLKIQNAQQIHVSFERCKSVEASKLVVNSP  255

Query  796   GDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGK  617
              +SPNTDG+HI A++ + ++   I+ GDDCISI   +  V  +++ CGPGHGIS+GSLG 
Sbjct  256   ENSPNTDGIHITATQDIHVSTCTIATGDDCISIVSGSKKVRASDITCGPGHGISIGSLGS  315

Query  616   SGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYC  437
               +   V ++ ++ +   GTTNG RIKTWQ G G A NI F+N+++ +V NPIIIDQNYC
Sbjct  316   GNSEAHVSDVVVNRAKLSGTTNGVRIKTWQGGSGSANNIGFKNIEMENVKNPIIIDQNYC  375

Query  436   SYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
                  C++Q + VQ+ +VV++ I GT+ +  AI L CSK+ PC GI L+++++
Sbjct  376   DQDEPCQDQSSAVQVKNVVYENIQGTSASTVAIDLECSKSYPCQGIVLENVNL  428



>ref|XP_007023876.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY26498.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=448

 Score =   310 bits (795),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/379 (42%), Positives = 229/379 (60%), Gaps = 6/379 (2%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             +  +V D+GAKGD   +D++AF NAWK ACS        +++IPAG T+L+ PV+  GPC
Sbjct  56    RVLSVHDFGAKGDAHHNDTKAFQNAWKMACS---FPARTRILIPAGYTYLIHPVELGGPC  112

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
             +S+ +  ++SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G G++WW +SC+
Sbjct  113   ESK-VTLMISGTIVAPEDPDVWDGLNPRKWLYFHGVNHLHVDGGGTINGMGQEWWARSCK  171

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
                    C   APTA+ F  C N  + N+  V+S Q H+    C    ++NL V +P  S
Sbjct  172   -RKKTNPCRH-APTALTFHKCKNLKVHNLMVVNSQQMHIAFTNCLRVTVSNLKVIAPAAS  229

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+HI AS+ V + +S +  GDDC+SI   ++ V+I N+ CGPGHGIS+GSLGKS +
Sbjct  230   PNTDGIHISASRGVEVKNSIVRTGDDCVSIVSNSSRVKIRNIVCGPGHGISIGSLGKSKS  289

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
             + QV ++ +  +    T NG RIKTWQ G GYA NI F+N+ + +V  PIIIDQ YC   
Sbjct  290   WAQVHDVLVDGAFISNTENGVRIKTWQGGSGYAANIKFQNVLMENVSYPIIIDQYYCDST  349

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C  Q   V++ ++ F  I GT+ TE  I   CS ++PC G+ L+ I +      +  +
Sbjct  350   QPCANQTLAVKVDNISFAHIKGTSATEETIRFACSDSLPCEGLYLEDIQLVSYTGGIAKS  409

Query  247   ACCSNAHGEETSVEPGPCL  191
              C          ++P  CL
Sbjct  410   FCWEAYGSSLGLLQPNSCL  428



>ref|XP_006838303.1| hypothetical protein AMTR_s00103p00121270 [Amborella trichopoda]
 gb|ERN00872.1| hypothetical protein AMTR_s00103p00121270 [Amborella trichopoda]
Length=463

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/379 (44%), Positives = 229/379 (60%), Gaps = 15/379 (4%)
 Frame = -1

Query  1351  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVK  1172
             + S   S K  +V D+GAKGDG TDD+QAF  AWK+ACSS P      + +P G+T+LVK
Sbjct  85    VGSPEASLKVVSVDDFGAKGDG-TDDTQAFAEAWKEACSSAP----GILEVPQGNTYLVK  139

Query  1171  PVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGK  992
             P+ F+GPCKS  +   +SGT+ AP     W    +  WL F+ V  L V GGG I+G G+
Sbjct  140   PISFSGPCKSA-MTVKISGTIEAPSDRDLWIKNGSRHWLLFSHVNNLSVEGGGTINGNGE  198

Query  991   KWWDQSCR---DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNI  821
              WW+ SC+     P + G     PTA+ F  C N  +  +    S Q H+    C     
Sbjct  199   IWWENSCKIDKSKPCISG-----PTALTFESCENLIVQELRIKDSQQMHLTFQKCVNVMA  253

Query  820   NNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHG  641
             +NL VQ+P  SPNTDG+H+  SK+VVI +S I  GDDCISI   + +++  ++ CGPGHG
Sbjct  254   SNLMVQAPEHSPNTDGIHVTGSKNVVIQNSTIGTGDDCISIVSGSQNIKAVDINCGPGHG  313

Query  640   ISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNP  461
             IS+GSLG   +   V  I +  +  +GTTNG RIKTWQ G G A+NI F+N+ + +V NP
Sbjct  314   ISIGSLGAGNSEAHVSAITVDRANLHGTTNGLRIKTWQGGSGNAKNIIFQNVAMHNVSNP  373

Query  460   IIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSID  281
             IIIDQNYC     C EQ + VQIS+V+++ + GT+ T+ A+  NCS++ PC  I +  I+
Sbjct  374   IIIDQNYCDSKKPCPEQASAVQISNVIYRNVKGTSATKLAMKFNCSRSYPCERILVQDIN  433

Query  280   ITPQIPSVPVAACCSNAHG  224
             +  +  S P  + C N HG
Sbjct  434   LLME-SSEPATSYCRNVHG  451



>ref|XP_006655543.1| PREDICTED: probable polygalacturonase At1g80170-like [Oryza brachyantha]
Length=414

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/402 (39%), Positives = 230/402 (57%), Gaps = 5/402 (1%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVID-YGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             M +   L ++ L+ S     +    +D +GA GDG+ +D+QAFL+AW  AC+S+   +  
Sbjct  1     MAMVWLLAVVALVFSGAGEARVLLTLDDFGAVGDGIANDTQAFLDAWNAACASS---EQA  57

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  1031
              + +PAG T+ + PVQ  GPCK + +  ++SGT+ AP SP  W G D  +WL    V  L
Sbjct  58    VLAVPAGKTYQIWPVQLAGPCK-KRLKLMISGTIAAPASPDEWAGRDPMKWLYVFRVDDL  116

Query  1030  IVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHV  851
              V GGG IDG+G +WW +SC+        T  AP A++F  C   ++  I   + PQ H+
Sbjct  117   SVTGGGTIDGKGTEWWARSCKRKKTKPCNTVSAPKALQFEECRGVSVQGITMQNGPQFHL  176

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
                 C G   + L V +P DSPNTDG+H++ + HV I  + IS GDDC+S+    +DV +
Sbjct  177   MFTRCTGVKASFLRVVAPEDSPNTDGIHLNDTSHVHIMDNLISTGDDCVSMVGNCSDVRV  236

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
              ++ CGPGHGIS+GSLGK+    +VEN+ +       TTNG RIK+WQ G GYA ++ FE
Sbjct  237   KDISCGPGHGISIGSLGKNRTTDRVENVRVDTCLLTNTTNGVRIKSWQGGMGYAHDLRFE  296

Query  490   NLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVP  311
             ++ + +V NPIIIDQ YC     C  Q   V++  + F  I GT+ TE AI L CS  VP
Sbjct  297   SIVMKNVSNPIIIDQYYCDQSTPCANQTEAVEVRKIEFVDIRGTSATEQAIKLACSDTVP  356

Query  310   CLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCLKQ  185
             C  ++L ++++T        A C   +     +V P  CL +
Sbjct  357   CRELELRNVNLTMAGGGAASAFCYRASGKTAGAVAPASCLAK  398



>ref|XP_006483708.1| PREDICTED: probable polygalacturonase At3g15720-like [Citrus 
sinensis]
Length=473

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/374 (44%), Positives = 223/374 (60%), Gaps = 15/374 (4%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV+D+GA GDG TDDS AF  AW D CS+T    S  + IPA   FL+K   F GPCK
Sbjct  29    TFNVVDFGAIGDGKTDDSDAFAKAWTDFCSATG--DSATLEIPANKAFLLKSTTFRGPCK  86

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S  ++  VSGT+VAP S   W    +  WLS   V GL ++G G IDG G+ WW+     
Sbjct  87    SNSVNIQVSGTIVAPDSKS-WKQCGSQCWLSLYDVQGLSIDGSGTIDGNGRGWWNH----  141

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
                     ++   A+ F  C N  +  I  V+SP++H+ +  CNG +++N+ + SP DSP
Sbjct  142   ------VVNMQLQAVYFHNCNNLQVKGITIVNSPKSHISINTCNGVSVSNIHIDSPEDSP  195

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I  S  V I  S I  GDDC++I   ++++ I  V CGPGHGISVGSLG  G  
Sbjct  196   NTDGIDISFSTQVNILDSSIKSGDDCVAINGGSSNINITGVACGPGHGISVGSLGLDGAD  255

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
              +VE +H+ N  F GT NGARIKT   G GYAR I+FE++ + +  NPIIIDQ+YC   G
Sbjct  256   DKVEEVHVRNCNFTGTQNGARIKTSPGGSGYARRISFEHITLIASKNPIIIDQHYCVGGG  315

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK   + V +S+V +  + G++  E AI+ +CS+   C GIK++ + IT  +P     A
Sbjct  316   GCKGT-SAVNVSEVTYSDVQGSSADEKAITFDCSEE-GCFGIKMEQVSITSSVPGKETTA  373

Query  244   CCSNAHGEETSVEP  203
              C NAHG  TS  P
Sbjct  374   YCQNAHGTSTSTSP  387


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -1

Query  406  TGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAH  227
            + V +S+V +  + G++  E AI+ +CS+   C GIK++ + IT  +P     A C NAH
Sbjct  397  SAVNVSEVTYSDVQGSSADEKAITFDCSEE-GCFGIKMEQVSITSSVPGKETTAYCQNAH  455

Query  226  GEETSVEP  203
            G  TS  P
Sbjct  456  GTSTSTSP  463



>ref|XP_003545985.2| PREDICTED: polygalacturonase-like [Glycine max]
Length=439

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/363 (42%), Positives = 230/363 (63%), Gaps = 19/363 (5%)
 Frame = -1

Query  1342  SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQ  1163
             S  S +  N+ DYGAK     DD++AF  AW +ACS+  +     +++P    + +KP+ 
Sbjct  61    STRSQRRINIDDYGAKASDGRDDTEAFEKAWDEACSTGGI-----LVVPEEKIYHLKPIT  115

Query  1162  FNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ-----WLSFNGVYGLIVNGGGVIDGQ  998
             F+GPC + +  F V GT+ A      W  + T Q     W+ F  V  L V+GGG I+G 
Sbjct  116   FSGPCLT-NTAFRVYGTIKA------WPKMSTYQNDRLHWIKFENVTNLRVDGGGTINGN  168

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G+KWW+ SC+ + N+      APTA+ F  C N  ++N+ F ++ Q H++   CN    +
Sbjct  169   GRKWWENSCKRNENLP--CKPAPTAVTFYQCNNLRVTNLRFKNAQQMHIRFQKCNNVTAS  226

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             NL V++PG+SPNTDG+H+  +++++I++S I  GDDCISI   + +V   +V+CGPGHGI
Sbjct  227   NLIVRAPGNSPNTDGIHVTETRNILISNSIIGTGDDCISIVSGSQNVRAIDVKCGPGHGI  286

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLG   +  QV N+ ++ +TF GTTNG RIKTWQ G GYA+N+ F N+ + +V NPI
Sbjct  287   SIGSLGAGDSKAQVSNVLVNRATFTGTTNGVRIKTWQGGSGYAKNVKFVNITMRNVTNPI  346

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             I+DQNYC     C E+ + V++S++V+Q I GT+ +E AI  +CSK VPC GI L  + +
Sbjct  347   IVDQNYCDQDKPCHEKDSAVKLSNIVYQNIRGTSASEVAIKFDCSKTVPCKGIYLQDVIL  406

Query  277   TPQ  269
             TP+
Sbjct  407   TPE  409



>ref|XP_004959739.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=477

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/386 (45%), Positives = 231/386 (60%), Gaps = 17/386 (4%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCK  1145
             F+V  +GA GDG TDD+ AF NAW  ACSS    + P V+ +PAG ++LVK    +GPCK
Sbjct  81    FDVGSFGATGDGQTDDTGAFQNAWAQACSS----EQPAVLLVPAGKSYLVKETSLSGPCK  136

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S+ + F + GT+VAP    GW+      W+SF+ V  L V G G +DG+GK  W  SCR 
Sbjct  137   SK-VTFKLEGTLVAPEDKSGWSKQGHPHWVSFSNVDSLTVTGKGAMDGKGKTSWKNSCRR  195

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
             +  M  CT  AP A+ F  C +  + NI  +++PQ H+ +  C+   ++ LT+ SPGDSP
Sbjct  196   NHKMP-CT-FAPAALTFSSCNHLKVENIKLLNAPQIHLWVEFCSDVTLSRLTIASPGDSP  253

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
               DG+H+  S  V I  +KI  GDDCISI   T ++    ++CGPGHGISVGSLGK    
Sbjct  254   ENDGIHVAHSDGVRILGAKIKAGDDCISIAMGTTNLYATKIECGPGHGISVGSLGKGSTR  313

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYC----  437
              +V N+ I  +   GT  GARIKTWQ G GYAR+I F N+ +  V NPI+IDQNYC    
Sbjct  314   AEVSNVTIDGAHVSGTLFGARIKTWQGGTGYARDIKFLNMVMDKVKNPIVIDQNYCTTSD  373

Query  436   -SYPGTC-KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIP  263
              S P  C +++   V+IS+V F  I GT+    AI L+CS+A PC G+ L  I++  +  
Sbjct  374   PSKPKACSQKESAAVEISNVEFSNIRGTSVNRDAIRLHCSEAFPCRGVVLRDIELKTRGG  433

Query  262   SVPVAA--CCSNA-HGEETSVEPGPC  194
                 AA   C NA  GE ++V P PC
Sbjct  434   DEKNAATSTCENAVLGETSNVSPAPC  459



>ref|XP_006597127.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X4 [Glycine max]
Length=436

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 234/390 (60%), Gaps = 8/390 (2%)
 Frame = -1

Query  1357  GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             GL  +   S    +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFL
Sbjct  39    GLKRTRTRSKWVLSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFL  95

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             V PV   GPC+S+ I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G 
Sbjct  96    VHPVDIGGPCRSK-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRINGM  154

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G++WW +SC+   N       APTAM F  C +  + N+  ++S + H+    C     +
Sbjct  155   GQEWWARSCK--INSTNPCHPAPTAMTFHRCKDLKVRNLMLINSQRMHLSFTNCMRIVAS  212

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             +L V +P  SPNTDG+HI A+K V +  S I  GDDCISI   ++ V I N+ CGPGHGI
Sbjct  213   HLKVLAPAFSPNTDGIHISATKGVEVRDSVIRTGDDCISIVRNSSRVWIRNISCGPGHGI  272

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLGKS  + +V+N+ +     Y T NG RIKTWQ G G+A  ITF+++ + +V NPI
Sbjct  273   SIGSLGKSKKWEKVQNVIVDGVYLYNTDNGVRIKTWQGGSGFASKITFQHILMENVSNPI  332

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             I+DQ YC     CK + + V++ ++ F  I GT+ TE AI  +CS A PC G+ L++I +
Sbjct  333   IVDQYYCDSRNPCKNETSAVRVENISFIDIQGTSATEEAIKFSCSDAFPCEGLYLENIFL  392

Query  277   TPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
                      ++ C  AHG     + P  CL
Sbjct  393   ASCFGG-NTSSFCWQAHGSARGFLHPSTCL  421



>emb|CDY07963.1| BnaC03g35600D [Brassica napus]
Length=438

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 232/370 (63%), Gaps = 9/370 (2%)
 Frame = -1

Query  1339  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  1160
             R S ++FNV  +GAK +G  DDSQAF+ AW+ ACSS     +  +++P    + +K V+F
Sbjct  63    RSSDRAFNVNSFGAKANG-NDDSQAFMKAWEAACSS---EGTVYIVVPENRAYTLKSVKF  118

Query  1159  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWD  980
             +GPCKS  I F + G + A  +P  +   +   W+ F  V  L V GGG IDG GK WW 
Sbjct  119   SGPCKSSLIVFKIYGKIEAWKNPSDYR--ERRFWIVFQTVDNLRVEGGGRIDGNGKIWWP  176

Query  979   QSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQS  800
             +SC+ +P +  C + APTA+ F+ C N  + NI   ++ Q H+++  C      NL V S
Sbjct  177   KSCKINPELP-CQE-APTAVTFVECNNLMVRNIRLENAQQMHMRVQNCENVKALNLMVTS  234

Query  799   PGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLG  620
             PGDSPNTDG+H+  +++++I  S I  GDDCISI   + +V    + CGPGHGIS+GSLG
Sbjct  235   PGDSPNTDGIHVTGTRNILIQDSIIRTGDDCISIVSGSENVRATGITCGPGHGISIGSLG  294

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
                +   V N+ +S +T  GTTNG RIKTWQ G G A+NI F+++ + +V NPIII+QNY
Sbjct  295   AHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGGHGMAKNIIFQDILMKNVTNPIIINQNY  354

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPS  260
             C     C EQ + VQ+S+V+++ I+GT++   AI   CSK++PC GI L ++++  QI  
Sbjct  355   CDQTKACPEQKSAVQVSNVLYKNIHGTSSRPEAIKFECSKSIPCQGISLQNVELVDQITK  414

Query  259   VPVA-ACCSN  233
               V+ A CSN
Sbjct  415   QDVSKATCSN  424



>ref|XP_004289976.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=449

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/363 (44%), Positives = 234/363 (64%), Gaps = 8/363 (2%)
 Frame = -1

Query  1363  ILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGST  1184
             +   + S+  S K  +V D+GAKG+G  DD+QAF+ AWK ACSST    +P +++P  S 
Sbjct  72    LRARLFSTSASVKQVSVDDFGAKGNGAADDTQAFVKAWKTACSST---GAPVLLVPKKS-  127

Query  1183  FLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVID  1004
             +LVKP+ F+GPCKSQ +   + GT+ A G    ++  D + W+ F+ V  L+V G G I+
Sbjct  128   YLVKPITFSGPCKSQ-LTMQIYGTIEASGDRSVYSK-DLNHWIMFDNVKNLLVQGPGTIN  185

Query  1003  GQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFN  824
             G G+ WW  SC+     + C   APTA+ F  C N  + N+ F  + Q HV    C    
Sbjct  186   GNGQVWWKNSCK-RKETKPCGTHAPTAVTFYKCNNLVVKNLKFQDAQQMHVSFEGCTNVQ  244

Query  823   INNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGH  644
              + LTV +P  SPNTDG+HI ++K++ I++S I  GDDCISI   + +V+ +++ CGPGH
Sbjct  245   ASYLTVTAPETSPNTDGIHITSTKNMTISNSNIGTGDDCISIVSGSQNVQASSITCGPGH  304

Query  643   GISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDN  464
             GIS+GSLGK G+   V  + ++ + F GTTNG RIKTWQ G G A NI F+N+++ +V N
Sbjct  305   GISIGSLGKDGSEDYVSKVTVNGAKFSGTTNGVRIKTWQGGSGMASNIAFQNIEMKNVYN  364

Query  463   PIIIDQNYC-SYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDS  287
             PIIIDQNYC +  G CK+Q   V++ +V++Q I GT+ ++ AI+ +CSK++PC GI L +
Sbjct  365   PIIIDQNYCDTSDGKCKQQSKAVKVRNVLYQNIRGTSASQDAITFDCSKSIPCQGIVLQN  424

Query  286   IDI  278
             + +
Sbjct  425   VQL  427



>ref|XP_003559271.2| PREDICTED: polygalacturonase ADPG1-like [Brachypodium distachyon]
Length=407

 Score =   308 bits (789),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/412 (41%), Positives = 248/412 (60%), Gaps = 12/412 (3%)
 Frame = -1

Query  1423  ASIFALYCCFYSMEVFVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWK  1247
             ASI     C       + LF+L   ++S V+    F++ +YGA+GDG  DD++A   AW 
Sbjct  2     ASIMTKLVC----SALIVLFLLSRSNASSVNTSVEFSIDNYGARGDGKHDDTEALAKAWT  57

Query  1246  DACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT  1067
              ACSS+   +   +++P G T+L+K +  +GPCKS  + F+V GT+ AP S   W+  + 
Sbjct  58    AACSSS---RPAVLLVPKGKTYLLKSITLSGPCKSNLV-FMVKGTLAAPRSLSDWSEENR  113

Query  1066  SQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLS  887
               W+  +G+ GL V GGG I+G G+ WW  SC+   N       APTA+ F  C N T+ 
Sbjct  114   RHWIVLHGINGLTVTGGGTINGNGELWWKNSCK--TNKARPCKQAPTALTFHLCSNLTVE  171

Query  886   NIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDC  707
             N+  V+S Q ++ +  C+   +  L++ +PG SPNTDG+HI  SK V +    I  GDDC
Sbjct  172   NLKIVNSQQINMSVEDCSDVQLARLSITAPGTSPNTDGIHITRSKDVQVRDCVIRTGDDC  231

Query  706   ISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQ  527
             +SI D T+++ +  V CGPGHGIS+GSLG   +  +V  I+I     YGTTNGARIKT+Q
Sbjct  232   MSIEDGTHNLHVTKVVCGPGHGISIGSLGDDNSRAEVSGIYIDTVQLYGTTNGARIKTYQ  291

Query  526   TGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTE  347
              G GYA++I F+N+ + +V NPIIIDQNYC     CK Q + V+IS+VVF+ I GT  ++
Sbjct  292   GGSGYAKDIVFQNIIMDNVQNPIIIDQNYCDSAKPCKNQESAVEISNVVFKNIRGTTMSK  351

Query  346   AAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPC  194
              AI L+CS +  C  I L++ID+  +  +    + C NA   ++ +V P PC
Sbjct  352   DAIKLDCSNSDSCTDIVLENIDLKMEGGNGETQSTCQNAKWRKSGNVTPQPC  403



>gb|AAD55472.1|AC009322_12 Similar to polygalacturonases [Arabidopsis thaliana]
Length=381

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 228/385 (59%), Gaps = 15/385 (4%)
 Frame = -1

Query  1312  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  1133
             + YGA GDG+ DD+ AF  AW+DAC  +   K   V +PAG  FL+  + F GPC  + +
Sbjct  1     MKYGAVGDGIVDDTSAFQKAWEDACKGS--SKMGSVNVPAGKVFLLNSLHFTGPCIPKPL  58

Query  1132  HFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHP  959
              FI+ G ++A   P  W   +     WL F+ V GL + G G++DGQGK WWD  CRDHP
Sbjct  59    LFIIDGEMIAQSDPQKWGNGENGVIPWLIFDQVDGLAIVGRGLLDGQGKSWWDIHCRDHP  118

Query  958   NMEGCTDLAPT-----AMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
                 C  LAPT      M F  C N TL ++ F +S Q HV +       I+++ + SP 
Sbjct  119   G-PNCICLAPTIYFSQMMTFSNCGNVTLKSLRFRNSAQTHVLVMGSQNVYIDDIKITSPE  177

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI--SVGSLG  620
              SPNTDG+HI +S  V I HS I+ GDDC+SIGD  N++ +  + CGPGHG+  S+GSLG
Sbjct  178   ASPNTDGIHITSSTAVSINHSDIATGDDCVSIGDQVNNLNVTFMNCGPGHGVRDSIGSLG  237

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
             + G  V VENI +S+  F GTTNGARIKTW  G GY R I F +++  SV NPIIIDQ Y
Sbjct  238   RGGTEVTVENIRVSHVNFTGTTNGARIKTWPGGTGYVRGIEFFDIRFSSVQNPIIIDQFY  297

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS-KAVPCLGIKLDSIDITPQIP  263
                P TC E   GV I  V + +++GT+ T+ A+ L CS ++VPC  + +  ID++P   
Sbjct  298   GCAP-TCVETMKGVHIEKVRYMKMSGTSATKVAMKLECSGESVPCSNLFMRDIDLSPADG  356

Query  262   SVPVAACCSNAHGEETS-VEPGPCL  191
                V++ CS AHG     + P  C 
Sbjct  357   IDSVSSLCSFAHGSAQGIIRPLSCF  381



>emb|CDY39404.1| BnaAnng05350D [Brassica napus]
Length=399

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/401 (41%), Positives = 246/401 (61%), Gaps = 13/401 (3%)
 Frame = -1

Query  1387  MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             +E+ V  +F+L L++   V+ + ++V+ +GA+GDG TDDS+AF+ AWK  CSS   +K+ 
Sbjct  9     IEIIVRVVFVLTLLNFGFVNSQIYDVLKFGAEGDGTTDDSKAFVAAWKAMCSSGGSNKT-  67

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  1031
              ++IP+ +TFL++P+ F GPC S  +   + G +VAP +   W+GL + +W+SF+ + GL
Sbjct  68    -LLIPSDNTFLLQPLVFQGPCNSPSVQVQLDGKIVAPLNKAAWSGLKSYEWVSFHKIIGL  126

Query  1030  IVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHV  851
              V G G I+G+G  +W+       NM       PT + F  C N  ++ I    SP+ H+
Sbjct  127   TVLGSGTINGRGSSFWE------ANMPASK--RPTQLHFKGCNNLEINGITSFDSPRNHI  178

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
              +  C    I  + + +PGDSPNTDG+ I  S +V I  + +  GDDC+++   + ++ I
Sbjct  179   SIRDCRQVKITQIKLIAPGDSPNTDGIDISTSTNVEIYDTIVGTGDDCVALNSGSININI  238

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
               +QCGPGHGISVGSLG+ G    VEN+ ++N TF  TTNGARIKTW  G+GYARNI F+
Sbjct  239   TRMQCGPGHGISVGSLGRDGEESIVENVQVTNCTFSETTNGARIKTWPNGKGYARNIVFK  298

Query  490   NLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVP  311
             ++ +    NPIIIDQ+Y        E+ + V IS+V+F  I+GT+  +  I ++CS    
Sbjct  299   DITLTETKNPIIIDQHYMDKGHIHVEESSAVAISNVIFTDIHGTSQKDEIIKIDCSGVTS  358

Query  310   CLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCLK  188
             C  I LD IDIT    + P+   CSNA+G+ T+   G CLK
Sbjct  359   CKDIVLDRIDITTVDGNKPIIE-CSNAYGKSTNTYDG-CLK  397



>gb|EMT24270.1| Polygalacturonase [Aegilops tauschii]
Length=417

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 236/377 (63%), Gaps = 7/377 (2%)
 Frame = -1

Query  1321  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  1142
             F + +YGA+GDG  DD+QA   AW  ACSS+   +   +++P G T+L+K +  +GPC+S
Sbjct  43    FVLDNYGARGDGKHDDTQALARAWNAACSSS---RPAVLLVPKGKTYLLKAITLSGPCRS  99

Query  1141  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDH  962
               I F V GT++AP S   W   D  +W+    + GL VNGGG I+G G+ WW+ SC+ +
Sbjct  100   S-IVFKVKGTLIAPPSMSAWTDNDRRRWIFLQRITGLTVNGGGTINGNGEIWWNNSCKTN  158

Query  961   PNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPN  782
               +  C   APTA+ F  C N  + N+  V+S Q HV +  C+  ++  L++ +PG SPN
Sbjct  159   KALP-CKG-APTALTFHLCNNLKVENLKLVNSQQIHVSVQDCSNVHLARLSITAPGTSPN  216

Query  781   TDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFV  602
             TDG+HI  SK+V +    +  GDDCISI + T+D+ +  V CGPGHGIS+GSLG   +  
Sbjct  217   TDGIHITHSKYVQVRDCLVKTGDDCISIENGTHDLHVTKVVCGPGHGISIGSLGDGNSRA  276

Query  601   QVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGT  422
             +V  I+I     YGTTNGARIKTWQ G GYA++I F+N+ + +V NPIIIDQNYC     
Sbjct  277   EVSRIYIDTVRLYGTTNGARIKTWQGGSGYAKDIVFQNMIMDNVQNPIIIDQNYCDSAKP  336

Query  421   CKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAAC  242
             CK Q + V++ +V F+ I GT  ++ AI L+CSK +PC GI L++ID+  +       + 
Sbjct  337   CKGQNSAVEVRNVAFKNIQGTTISKDAIKLSCSKNLPCSGIALENIDLKLEGGKGDTEST  396

Query  241   CSNAHGEET-SVEPGPC  194
             C NA   ++ +V P PC
Sbjct  397   CQNAKWRKSGNVIPLPC  413



>ref|XP_008240888.1| PREDICTED: polygalacturonase [Prunus mume]
Length=451

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/376 (44%), Positives = 240/376 (64%), Gaps = 11/376 (3%)
 Frame = -1

Query  1363  ILGLISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAG  1190
             +L L S  +V  +  S NV D+GA+GDG TDD++AF  AWK ACSS        V++   
Sbjct  67    VLSLKSFDKVDGNSASVNVNDFGAEGDGETDDTEAFEKAWKAACSSN----DEAVLVVPE  122

Query  1189  STFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGV  1010
               + +KP++F+GPCKS+ +   + GT+ A  + P + G D   WL F+ V  L+V GGGV
Sbjct  123   KIYHLKPIRFSGPCKSE-VTVQILGTLKASDNRPDF-GQDGRHWLVFDTVRNLLVEGGGV  180

Query  1009  IDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNG  830
             I+G G++WW  SC+ + + + C D APTA+ F  C N  ++N++   + Q HV    C  
Sbjct  181   INGNGEQWWQNSCKINKS-KPCED-APTALIFQKCKNLRVNNLNVQDAQQIHVSFQKCMN  238

Query  829   FNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGP  650
                +NL++ +P  SPNTDG+H+  +++++IT+S I+ GDDC+SI +    V+  N+ CGP
Sbjct  239   VQASNLSIIAPEKSPNTDGIHVTDTQNILITNSVIATGDDCLSIVNGCEKVQAKNITCGP  298

Query  649   GHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSV  470
             GHGIS+GSLG   +   V  I ++ + F GTTNG RIKTWQ G G A NITFEN+++ +V
Sbjct  299   GHGISIGSLGSRNSKAYVSEITVNGAVFSGTTNGVRIKTWQGGSGSASNITFENIEMHNV  358

Query  469   DNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLD  290
              NPIIIDQNYC    TCKEQ + VQ+ +VV++ I+GT+ ++ AI  +CSK+ PC GI L 
Sbjct  359   SNPIIIDQNYCDRK-TCKEQRSAVQVENVVYKNISGTSASDVAIKFDCSKSFPCKGIVLQ  417

Query  289   SIDITPQIPSVPVAAC  242
              I++  +      A+C
Sbjct  418   GINLQREGGKAAKASC  433



>gb|ABR18059.1| unknown [Picea sitchensis]
Length=493

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 230/387 (59%), Gaps = 13/387 (3%)
 Frame = -1

Query  1345  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPV  1166
             SS V C    V ++GAKGDG  DD++AF NAW  ACSS P       ++P G  +LVKP+
Sbjct  85    SSNVVC----VDEFGAKGDGENDDTKAFNNAWSKACSSAPA----VFLVPHGKKYLVKPI  136

Query  1165  QFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKW  986
             +F+GPCKS  +   VSGT++AP  P  W+GL+  QWL F  V  L V GGG+  G G++W
Sbjct  137   KFSGPCKSA-LTMQVSGTIIAPADPRVWDGLNRRQWLRFKEVDDLTVEGGGIFYGSGEQW  195

Query  985   WDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTV  806
             W +SC+   N       APTA+ F  C N  + N+   +S Q H++   C G   +NL V
Sbjct  196   WAESCK--INKTNPCRPAPTAITFELCNNLRVMNLIVQNSQQMHIKFRKCVGVKADNLKV  253

Query  805   QSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGS  626
              +PG SPNTDG+H+ ASK VVI ++    GDDCISI   + ++ I N+ CGPGHGIS+GS
Sbjct  254   LAPGHSPNTDGIHVSASKDVVIKNTITGTGDDCISIVSDSFNIYIENITCGPGHGISIGS  313

Query  625   LGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQ  446
             LG+     +V ++ +  +  + TTNG RIKTWQ   G AR I F+N+ + +V +PIIIDQ
Sbjct  314   LGEGSAKARVADVMVHGAFLHNTTNGLRIKTWQGSSGSARRILFQNVHMENVKHPIIIDQ  373

Query  445   NYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQI  266
              YC     C  + + V++S+V +  I GT+ ++  +   CS+ VPC  I L  ID+T   
Sbjct  374   YYCDSKKPCSNKTSAVKVSEVAYLNIKGTSASKEVMRFACSQTVPCENILLADIDLTATS  433

Query  265   PSVPVAACCSNAHGEET-SVEPGPCLK  188
                P    C NA G  T SV P  CL+
Sbjct  434   GCTPTTY-CENAIGCTTGSVSPHSCLQ  459



>emb|CDY69377.1| BnaCnng63250D [Brassica napus]
Length=400

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 245/403 (61%), Gaps = 13/403 (3%)
 Frame = -1

Query  1393  YSMEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  1217
             + ME+ V  +F+L L++   V+ + ++V+ +GA+GDG TDDS+AF+ AWK  CSS   +K
Sbjct  8     HRMEIIVRVVFVLTLVNFGFVNGQIYDVLKFGAEGDGTTDDSKAFVEAWKAMCSSGGSNK  67

Query  1216  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  1037
             +  ++IP+ +TFL++P+ F GPC S  +   + G +VAP +   W+ L + +W+SF+ + 
Sbjct  68    T--LLIPSDNTFLLQPLVFQGPCNSPSVQVQLDGKIVAPLNKAAWSDLKSYEWVSFHKII  125

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQA  857
             GL V G G I+G+G  +W+       NM       PT + F  C N  ++ I    SP+ 
Sbjct  126   GLTVLGSGTINGRGSSFWE------ANMPASK--RPTQLHFKGCNNLEINGITSFDSPRN  177

Query  856   HVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDV  677
             H+ +  C    I  + + +PGDSPNTDG+ I  S  V I  + +  GDDC+++   + ++
Sbjct  178   HISIRDCRQVKITQIKIIAPGDSPNTDGIDISTSTDVEIYDTIVGTGDDCVALNSGSINI  237

Query  676   EINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNIT  497
              I  +QCGPGHGISVGSLG+ G    VEN+ ++N TF  TTNGARIKTW  G+GYARNI 
Sbjct  238   NITRMQCGPGHGISVGSLGRDGEESIVENVQVTNCTFNETTNGARIKTWPNGKGYARNIV  297

Query  496   FENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKA  317
             F+++ +    NPIIIDQ+Y        E+ + V IS+V+F  I+GT+  +  I ++CS  
Sbjct  298   FKDITLTETQNPIIIDQHYIDKGHIHVEESSAVAISNVIFTNIHGTSQKDEIIKIDCSDV  357

Query  316   VPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCLK  188
               C  I LD IDIT    + P+   CSNA+G+ T+   G CLK
Sbjct  358   TSCKDIVLDRIDITTFDGNKPLIE-CSNAYGKSTNAYDG-CLK  398



>ref|NP_001056198.1| Os05g0542800 [Oryza sativa Japonica Group]
 gb|AAU43992.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18112.1| Os05g0542800 [Oryza sativa Japonica Group]
Length=408

 Score =   308 bits (789),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/361 (43%), Positives = 220/361 (61%), Gaps = 8/361 (2%)
 Frame = -1

Query  1309  DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCKSQHI  1133
             D+GA GDG+T+D+QAFL+AW  AC+ST     P V+ +PAG T+ + PV+  GPCK + +
Sbjct  39    DFGAVGDGITNDTQAFLDAWNAACAST----EPAVLAVPAGKTYQIWPVRLAGPCK-KKL  93

Query  1132  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNM  953
               ++SGT+ AP SP  W G D ++WL    V  L V+GGG IDG G +WW +SC+     
Sbjct  94    KLMISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDGMGAEWWARSCKRKKTK  153

Query  952   EGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDG  773
                T  AP A++F  C   ++  I   + PQ H+    C     + L V +P  SPNTDG
Sbjct  154   PCSTVSAPKALQFEECRRVSVQGITMQNGPQFHLMFTRCTDVKASFLRVVAPESSPNTDG  213

Query  772   VHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVE  593
             +H++ + H  I  + IS GDDC+S+    +DV + ++ CGPGHGIS+GSLGK+    ++E
Sbjct  214   IHLNDTTHAQIMDNLISTGDDCVSMVGNCSDVRVKDISCGPGHGISIGSLGKNRTTDRIE  273

Query  592   NIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKE  413
             N+ +       TTNG RIK+WQ G GYA N+ FE + + +V NPIIIDQ YC  P  C  
Sbjct  274   NVRVDTCLLTNTTNGVRIKSWQGGMGYAHNLRFEGIVMKNVSNPIIIDQYYCDQPTPCAN  333

Query  412   QGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSN  233
             Q   V++  + F  I GT+ TE AI L CS AVPC  ++L ++++T  +  VP A+C + 
Sbjct  334   QTQAVEVRKIEFAGIRGTSATEQAIKLACSDAVPCRDLELRNVNLT-MVGVVP-ASCLAK  391

Query  232   A  230
             A
Sbjct  392   A  392



>ref|XP_003546932.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X1 [Glycine max]
Length=443

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 234/390 (60%), Gaps = 8/390 (2%)
 Frame = -1

Query  1357  GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             GL  +   S    +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFL
Sbjct  39    GLKRTRTRSKWVLSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFL  95

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             V PV   GPC+S+ I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G 
Sbjct  96    VHPVDIGGPCRSK-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRINGM  154

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G++WW +SC+   N       APTAM F  C +  + N+  ++S + H+    C     +
Sbjct  155   GQEWWARSCK--INSTNPCHPAPTAMTFHRCKDLKVRNLMLINSQRMHLSFTNCMRIVAS  212

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             +L V +P  SPNTDG+HI A+K V +  S I  GDDCISI   ++ V I N+ CGPGHGI
Sbjct  213   HLKVLAPAFSPNTDGIHISATKGVEVRDSVIRTGDDCISIVRNSSRVWIRNISCGPGHGI  272

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLGKS  + +V+N+ +     Y T NG RIKTWQ G G+A  ITF+++ + +V NPI
Sbjct  273   SIGSLGKSKKWEKVQNVIVDGVYLYNTDNGVRIKTWQGGSGFASKITFQHILMENVSNPI  332

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             I+DQ YC     CK + + V++ ++ F  I GT+ TE AI  +CS A PC G+ L++I +
Sbjct  333   IVDQYYCDSRNPCKNETSAVRVENISFIDIQGTSATEEAIKFSCSDAFPCEGLYLENIFL  392

Query  277   TPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
                      ++ C  AHG     + P  CL
Sbjct  393   ASCFGG-NTSSFCWQAHGSARGFLHPSTCL  421



>ref|XP_006450449.1| hypothetical protein CICLE_v10010440mg, partial [Citrus clementina]
 gb|ESR63689.1| hypothetical protein CICLE_v10010440mg, partial [Citrus clementina]
Length=419

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 221/374 (59%), Gaps = 22/374 (6%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNV+D+GA GDG TDDS AF  AW D CS+T    S  + IPA   FL++   F GPCK
Sbjct  27    TFNVVDFGAIGDGKTDDSDAFAKAWTDFCSATG--DSSTLEIPANKAFLLQSTTFRGPCK  84

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S  ++  VSGT+VAP S   W    +  WLS   V GL ++G G IDG G+ WW+Q    
Sbjct  85    SNSVNIQVSGTIVAPDSKS-WKQCGSQCWLSLYDVQGLSIDGSGTIDGNGRGWWNQ----  139

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
                          A+ F  C N  +  I  V+SP++H+ +  CNG +++N+ + SP DSP
Sbjct  140   -------------AVYFHNCNNLQVKGITIVNSPKSHISINTCNGVSVSNIHIDSPEDSP  186

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I +S  V I  S I  GDDC++I   ++ + I  V CGPGHGISVGSLG  G  
Sbjct  187   NTDGIDISSSTQVNILDSSIKSGDDCVAINGGSSKINITGVACGPGHGISVGSLGLDGAD  246

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
              +VE +H+ N  F GT NGARIKT   G GYAR I+FE++ +    NPIIIDQ+YC   G
Sbjct  247   DKVEEVHVRNCNFTGTQNGARIKTSPGGSGYARGISFEHITLIESKNPIIIDQHYCVGGG  306

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
              CK   + V +S+V +  + G++  E AI+ +CS+   C GIK++ + IT  +P     A
Sbjct  307   GCKGT-SAVNVSEVTYSDVRGSSADEKAITFDCSEE-GCFGIKMEQVSITSSVPGKETIA  364

Query  244   CCSNAHGEETSVEP  203
              C NAHG  +S  P
Sbjct  365   YCQNAHGTSSSTSP  378



>gb|KFK38249.1| hypothetical protein AALP_AA3G088700 [Arabis alpina]
Length=437

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 230/369 (62%), Gaps = 8/369 (2%)
 Frame = -1

Query  1339  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  1160
             R S K+FNV ++GAK +G  DDSQAF+ AW+ ACSST +      ++P    +++KPV+F
Sbjct  63    RSSPKAFNVNNFGAKANG-NDDSQAFMKAWEAACSSTGI---VYFVVPKNRNYILKPVKF  118

Query  1159  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWD  980
             +GPCKS  I F + G + A  +P  +   +   W+ F  V  L V GGG IDG GK WW 
Sbjct  119   SGPCKSSLIIFKIYGMIEAWKNPSDYK--ERRHWIVFENVTNLRVEGGGRIDGNGKIWWP  176

Query  979   QSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQS  800
              SC+ +P +  C   APTA+ F+ C N  +SNI   ++ Q H+    C      +L V+S
Sbjct  177   NSCKINPQLP-CLG-APTAVTFVECKNLRVSNIRLENAQQMHMTFQDCQNVKAFHLMVES  234

Query  799   PGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLG  620
             PG+SPNTDG+H+  +++++I  S +  GDDCISI   + +V +  + CGPGHGIS+GSLG
Sbjct  235   PGNSPNTDGIHVSGTRNILIQDSIVRTGDDCISIVSGSENVRVTGITCGPGHGISIGSLG  294

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
                +   V N+ ++ +T  GTTNG RIKTWQ G G A+NI F+++ + +V NPIII+Q+Y
Sbjct  295   ADNSEAYVSNVVVNKATLIGTTNGVRIKTWQGGHGMAKNIIFQDIIMKNVTNPIIINQDY  354

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPS  260
             C  P  C EQ + VQ+S+V+++ I GT++   A+   CSK++PC GI + ++ +  Q   
Sbjct  355   CDRPEACPEQKSAVQVSNVLYKNIQGTSSRPIAVKFVCSKSIPCRGISMQNVKLVDQTQQ  414

Query  259   VPVAACCSN  233
                 A CSN
Sbjct  415   DVSKASCSN  423



>ref|XP_004981339.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=529

 Score =   311 bits (797),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 236/386 (61%), Gaps = 7/386 (2%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  1169
             +SS +    F++  YGA+GDG  DD++A   A     ++    +   V++P G  +L+K 
Sbjct  137   TSSLLGSSVFSLDRYGARGDGRHDDTRALARA---WRAACASRRPAVVLVPRGRRYLLKV  193

Query  1168  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKK  989
             +  +GPC+S  +   V GT+VA  +   W+  +   W+ F  V  L V+GGG +DG G+ 
Sbjct  194   ITLHGPCRSS-VAVAVKGTLVASPNRDDWSEKERRHWIVFRRVDRLTVDGGGAVDGNGET  252

Query  988   WWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLT  809
             WW  SC+ +P++  C   APTA+ F  C N  + ++  V+S Q HV +  C    +  L+
Sbjct  253   WWKHSCKINPDLP-CKG-APTALSFHLCKNLRVEDLKIVNSQQIHVSVEDCTNVQLARLS  310

Query  808   VQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVG  629
             + +P  SPNTDG+HI  SK V +T+ KI  GDDC+SI D T+++ ++ V CGPGHGIS+G
Sbjct  311   ITAPHSSPNTDGIHITRSKDVKVTNCKIRTGDDCVSIEDGTHNLHVSKVVCGPGHGISIG  370

Query  628   SLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIID  449
             SLG   ++ QV  I I     YGTTNGARIKT+Q G GYA++ITF+N+ + +VDNPIIID
Sbjct  371   SLGDHNSWAQVSGITIDTVQLYGTTNGARIKTYQGGSGYAKDITFQNMIMHAVDNPIIID  430

Query  448   QNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             QNYC     C+EQ + V++S+VVF+ I GT  T+ AI LNCS +VPC GI L +ID+   
Sbjct  431   QNYCDKATPCEEQRSAVEVSNVVFKNIRGTTMTKDAIKLNCSMSVPCHGITLQNIDLRMH  490

Query  268   IPSVPVAACCSNAHGEET-SVEPGPC  194
                    + C NA   +  +V P PC
Sbjct  491   SGMGNTVSTCQNAKWRKYGTVRPQPC  516



>ref|XP_011014845.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Populus 
euphratica]
Length=441

 Score =   308 bits (790),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 173/414 (42%), Positives = 235/414 (57%), Gaps = 10/414 (2%)
 Frame = -1

Query  1420  SIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNA  1253
             +I  L C CF  ++ F  L  L   + SR+   S  V+   D+GAKGDG+++D+QAF  A
Sbjct  15    TIRVLICACFVCVQGFDSLLQLPQSAPSRIRPSSKRVLLVGDFGAKGDGLSNDTQAFKEA  74

Query  1252  WKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGL  1073
             W+ ACS        +++IPAG  FLV PV F GPCKS+ I   +SGT+VAP  P  W GL
Sbjct  75    WEMACS---FRGRTRILIPAGYNFLVHPVDFGGPCKSKVI-LDISGTIVAPEDPAAWKGL  130

Query  1072  DTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTT  893
             +  +WL F+GV  L V GGG ++G+G  WW QSC+ +     C + APTA+ F  C +  
Sbjct  131   NRRKWLYFHGVKHLTVEGGGTVNGRGWLWWAQSCKIN-KTNPCRN-APTAITFHKCKDLK  188

Query  892   LSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGD  713
             + N+  V   + H+    C      +L V SP  SPNTDG+HI AS  V I  S +  GD
Sbjct  189   VENLKVVCGQKMHIAFTNCLRVMTFHLIVTSPAVSPNTDGIHISASHGVKIKDSVVRTGD  248

Query  712   DCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKT  533
             DCISI   ++ ++I N+ CGPGHGIS+GSLGKS +   V ++ +  +    T NG RIKT
Sbjct  249   DCISIVSNSSRIKIRNIACGPGHGISIGSLGKSNSSSLVRDVMVDGAFLSNTDNGVRIKT  308

Query  532   WQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTAT  353
             WQ G G A NITF+N+ + +V NPIIIDQ YC     C  Q + V + ++ F+RI GT+ 
Sbjct  309   WQGGGGNATNITFQNIFMENVSNPIIIDQYYCDAGVPCANQTSAVIVENISFRRIKGTSA  368

Query  352   TEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             TE AI   CS   PC G+ L+ + +         + C          V P PC 
Sbjct  369   TEEAIKFVCSDDFPCKGLYLEDVQLLSHTGGTTRSFCWQAYGSSRGLVHPSPCF  422



>emb|CDY37571.1| BnaA02g19990D [Brassica napus]
Length=374

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 226/378 (60%), Gaps = 7/378 (2%)
 Frame = -1

Query  1312  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  1133
             + YGA GDG++DD+ A   AW  AC+ +   K   V +PAG  FL+K + F GPCK + +
Sbjct  1     MKYGAVGDGISDDTSALQKAWDSACNGSS--KIGSVYVPAGKVFLLKSLHFTGPCKLKPL  58

Query  1132  HFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHP  959
              F + G + A   P  W   +     WL F  V GL+++G G++DGQGK WWD  CRDHP
Sbjct  59    IFTIDGEMKAQSDPNKWQKGENGIIPWLIFERVEGLVLSGRGLLDGQGKGWWDIHCRDHP  118

Query  958   NMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNT  779
                 C  LAPT M F  C N  L ++ F +S Q+H+ +      +I ++ ++SP  SPNT
Sbjct  119   G-PNCIWLAPTMMTFSNCRNVILKSLRFRNSAQSHILVMGSQNVHIKDVKIKSPEISPNT  177

Query  778   DGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQ  599
             DGVHI +S  V ITHS  + GDDC+SIGD  +++ +  V CGPGHG+SVGSLG+ G  V+
Sbjct  178   DGVHITSSSDVSITHSDFATGDDCVSIGDQVHNLSVTFVNCGPGHGVSVGSLGRGGTEVE  237

Query  598   VENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTC  419
             VE+I +++  F GTTNGARIKTW  G GY R I F +++  +V NPIIIDQ Y   P  C
Sbjct  238   VEDIRVAHVNFTGTTNGARIKTWPGGTGYVRGIEFFDIRFSNVQNPIIIDQFYGCAP-NC  296

Query  418   KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACC  239
              +    V I  V + +++GT+ TE A+ L CS    C  + +  ID++P      V++ C
Sbjct  297   VQTEKAVHIEKVKYMKMSGTSRTEVAMKLECSGKNACSNVFMRDIDLSPANGIGSVSSTC  356

Query  238   SNAHGE-ETSVEPGPCLK  188
             S   G  + ++ P  C++
Sbjct  357   SFVQGSTQGTIRPSSCIQ  374



>ref|XP_006597125.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X2 [Glycine max]
 ref|XP_006597126.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X3 [Glycine max]
Length=458

 Score =   309 bits (791),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 234/390 (60%), Gaps = 8/390 (2%)
 Frame = -1

Query  1357  GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             GL  +   S    +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFL
Sbjct  39    GLKRTRTRSKWVLSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFL  95

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             V PV   GPC+S+ I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G 
Sbjct  96    VHPVDIGGPCRSK-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRINGM  154

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G++WW +SC+   N       APTAM F  C +  + N+  ++S + H+    C     +
Sbjct  155   GQEWWARSCK--INSTNPCHPAPTAMTFHRCKDLKVRNLMLINSQRMHLSFTNCMRIVAS  212

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             +L V +P  SPNTDG+HI A+K V +  S I  GDDCISI   ++ V I N+ CGPGHGI
Sbjct  213   HLKVLAPAFSPNTDGIHISATKGVEVRDSVIRTGDDCISIVRNSSRVWIRNISCGPGHGI  272

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLGKS  + +V+N+ +     Y T NG RIKTWQ G G+A  ITF+++ + +V NPI
Sbjct  273   SIGSLGKSKKWEKVQNVIVDGVYLYNTDNGVRIKTWQGGSGFASKITFQHILMENVSNPI  332

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             I+DQ YC     CK + + V++ ++ F  I GT+ TE AI  +CS A PC G+ L++I +
Sbjct  333   IVDQYYCDSRNPCKNETSAVRVENISFIDIQGTSATEEAIKFSCSDAFPCEGLYLENIFL  392

Query  277   TPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
                      ++ C  AHG     + P  CL
Sbjct  393   ASCFGG-NTSSFCWQAHGSARGFLHPSTCL  421



>ref|XP_010445667.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=427

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 234/379 (62%), Gaps = 12/379 (3%)
 Frame = -1

Query  1396  FYSMEVFVFLFILGLISSSRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  1229
             F+S  + + LF    ++ SR +     K+FNV+DYGA GDG  DDS+AF +AW+D C+  
Sbjct  7     FFSFLLSLTLFHTFQLAQSRSTLYHDNKNFNVLDYGAIGDGFFDDSKAFKDAWEDTCNY-  65

Query  1228  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWL  1055
              +     + IP G TFL++P++F+GPCKS+ I   +SG V+APGSP  W        QW+
Sbjct  66    -IGSQSIMEIPEGYTFLLQPIEFHGPCKSKKIILSISGYVIAPGSPDEWECKKNHCHQWI  124

Query  1054  SFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHF  875
              F  + GL ++G G++DGQG KWW  +C+ +   + C    P  +      N  +SNI  
Sbjct  125   EFAHINGLHIDGPGILDGQGPKWWSLNCKKYK--KACLK-RPRGVVISHSSNVHISNIMV  181

Query  874   VSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIG  695
               SP   + L      ++  LT+ + GDSPNTDG+HI  S++V++ +S I  GDDCISIG
Sbjct  182   KDSPNFQMSLEDSKWVSVKQLTITADGDSPNTDGIHIQRSQNVIVHNSNIRTGDDCISIG  241

Query  694   DFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRG  515
             D +  + I+ + CGPGHGIS+GSLG+ G    VE++ + + TF  TTNG +IKTWQ GRG
Sbjct  242   DGSKYINISRISCGPGHGISIGSLGRYGTKETVEDVVVQDCTFRETTNGVKIKTWQGGRG  301

Query  514   YARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAIS  335
             + RN+ FE +++     PIIIDQ YC +   CK Q   V+I +V++  I+GT+  +  + 
Sbjct  302   HVRNVLFERIKLHGATRPIIIDQFYCPHR-QCKNQTKAVEIKNVMYNHIHGTSIKKPFVQ  360

Query  334   LNCSKAVPCLGIKLDSIDI  278
             L CSK+VPC GI ++ I+I
Sbjct  361   LLCSKSVPCRGIFMNDINI  379



>ref|XP_002313308.2| hypothetical protein POPTR_0009s06520g, partial [Populus trichocarpa]
 gb|EEE87263.2| hypothetical protein POPTR_0009s06520g, partial [Populus trichocarpa]
Length=436

 Score =   308 bits (788),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 224/364 (62%), Gaps = 8/364 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S K  NV D+GAK DG TDDSQAF  AW++ACSS     S  ++IP    + +KPV F+G
Sbjct  65    SAKVVNVDDFGAKADG-TDDSQAFKKAWEEACSS---KGSAIIVIPKNKIYYLKPVTFSG  120

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S  + F + GT+ A      +   D   WL F  V    V GGG IDG GK WW+ S
Sbjct  121   PCESDLV-FKIFGTIKASAKVSDYEN-DRRHWLVFENVQNFRVRGGGTIDGNGKIWWENS  178

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+   N       APTA+ F+ C +  ++N+ F ++ Q H+    C      NL V +PG
Sbjct  179   CK--INKSQPCQHAPTAVTFLECKSLIVANLRFQNAQQMHLSFQNCVNVRALNLMVIAPG  236

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+H+  ++++ I +  I  GDDCISI   + +VE  ++ CGPGHGIS+GSLG  
Sbjct  237   TSPNTDGIHVTGTQNIRIRNCVIRTGDDCISIVSGSKNVEATDITCGPGHGISIGSLGAD  296

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              +  +V N+ ++ +T  GTTNG RIKTWQ G GYARNI F+N+ + +V NPIII+QNYC 
Sbjct  297   NSGAEVSNVFVNRATISGTTNGVRIKTWQGGSGYARNIVFQNVVMRNVTNPIIINQNYCD  356

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C+EQ + VQIS+V+++ I GT+ ++ A+  +CSK +PC GI L  ++I  +    P
Sbjct  357   QDSPCEEQTSAVQISNVMYKNIKGTSASDVAVKFDCSKNIPCRGILLQDVNIALEENGKP  416

Query  253   VAAC  242
              A+C
Sbjct  417   EASC  420



>ref|XP_008226204.1| PREDICTED: probable polygalacturonase At3g15720 [Prunus mume]
Length=705

 Score =   315 bits (808),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 176/424 (42%), Positives = 242/424 (57%), Gaps = 32/424 (8%)
 Frame = -1

Query  1381  VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDS---------------QAFLNAWK  1247
             V + +F +G     R    +F+V+ YGA GDG TDDS               QAFL AW 
Sbjct  6     VLILIFWIGFGHCQR----TFDVLKYGAAGDGKTDDSKLKGAITYGLFTLQIQAFLKAWG  61

Query  1246  DAC-SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLD  1070
             + C ++   +  P ++IP    FL++P++F GPC S  +H  + G +VAP    GW   +
Sbjct  62    ELCGAADEPNGVPTLVIPEMKAFLLQPIKFQGPCNSISVHVQIMGKLVAPKMQDGWTECE  121

Query  1069  T-SQWLSFNGVYGLIVNGGGVIDGQGKKWW------DQSCRD-HPNMEGCTDLAPTAMKF  914
             + S WL F  V  L+V+G G IDGQG  WW      D+  R    N + C   AP A+ F
Sbjct  122   SNSDWLQFKDVGNLVVDGSGEIDGQGSSWWTTPNQYDRLSRKLMMNKQNCQ--APDALHF  179

Query  913   MFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITH  734
               C N  LS +  ++S +AH+ +  C    +++LT+ +P DSPNTDG+ I  S +V I H
Sbjct  180   QGCDNLKLSGLTHLNSARAHIAISGCKYVYVSHLTITAPEDSPNTDGIDISNSHNVFIQH  239

Query  733   SKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTT  554
               I  GDDCI+I    +D+ I N+ CGPGHGISVGSLG  G   +V+N+++ +S+F GTT
Sbjct  240   CAIGTGDDCIAINGGCSDLNIANIACGPGHGISVGSLGAHGALEKVQNVYVRDSSFSGTT  299

Query  553   NGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQ  374
             NGARIKTWQ G GYA+NITFE + + +  NPIIIDQ YC+    CK Q + + + DV + 
Sbjct  300   NGARIKTWQGGSGYAKNITFEKITLDAAKNPIIIDQFYCNQDHDCKSQASALLVEDVKYI  359

Query  373   RINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEE--TSVEPG  200
                GT+  E AI L+C +   C  I +D I IT  +P   + A C+NA G    T V   
Sbjct  360   DFEGTSANEEAIKLDCDQNSGCRNIIMDRIKITSAVPDKKIYASCNNAIGTSIGTIVPNV  419

Query  199   PCLK  188
             PCLK
Sbjct  420   PCLK  423



>ref|XP_011001322.1| PREDICTED: probable polygalacturonase At3g15720 [Populus euphratica]
Length=388

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/380 (43%), Positives = 232/380 (61%), Gaps = 10/380 (3%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             + FNV+DYGA G+G  D + AF  AW   C ++   + P + +PAG TFL+K V F+GPC
Sbjct  16    RRFNVLDYGADGNGKIDATPAFQKAWGHFCRAS--EEMPTLEVPAGKTFLLKSVSFSGPC  73

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
              S++ H ++ GT+VAP S   W+  D  +W+ F    GLIV+GGG  DG+G+ WW ++C 
Sbjct  74    MSKNPHVLIEGTIVAPNSFDSWDDDDYEKWIGFTASIGLIVDGGGRFDGRGEAWW-KACN  132

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
             D  N   C+     A+ F  C    LSN+H V+S + H+ +  C+   ++NL + +P +S
Sbjct  133   D--NDSACSKRR-QALHFNKCNGLRLSNLHHVNSQKGHISINACDDVEVSNLQILAPDES  189

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+ I  S HV I  S I  GDDCI+I  F+  + + +VQCGPGHGIS+GSLGK G 
Sbjct  190   PNTDGIDISESNHVNIHDSFIGTGDDCIAINGFSTSINVTSVQCGPGHGISIGSLGKDGA  249

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
             +  VE +H+ +  F GT NG RIKTW++G GY R ITFE++   + +NPIIIDQ    Y 
Sbjct  250   YETVEEVHVKSCAFKGTQNGVRIKTWESGSGYVRKITFEDITFVNSENPIIIDQ---QYN  306

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
                    +G++ISDV ++ + G++  E AI+LNC+    C  I +D++ IT   P   + 
Sbjct  307   PNGNRGSSGIKISDVTYRNVQGSSADEVAIALNCAGRAACTNIVMDNVKITSSNPGKQIR  366

Query  247   ACCSNAHGEETSVEPG-PCL  191
             A C+NA G   S  P  PCL
Sbjct  367   ASCNNAMGTAISASPTVPCL  386



>ref|XP_007011881.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY29500.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=437

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/377 (44%), Positives = 227/377 (60%), Gaps = 18/377 (5%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             + NV+ +GA GDG TDDS AFL AW+  C +    ++  ++IPA  TFLV  VQF GPC 
Sbjct  69    TLNVLKFGAVGDGNTDDSHAFLKAWEALCGARG--RTSTLVIPASKTFLVSHVQFLGPCS  126

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQ--SC  971
             S  +H  V G +VAP     W+G +   WL F GV+GL+++G G IDG G+ WW++  SC
Sbjct  127   SSSVHVQVLGKIVAP-EANAWSGCNYDCWLCFMGVHGLVIDGSGQIDGNGETWWNKPPSC  185

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             R            PTA+ F  C N  LS +  + SP  H+ +  CNG +I+NL + +P D
Sbjct  186   RR-----------PTALHFHVCHNLKLSGLTHLDSPNNHITIHSCNGVSISNLRITAPAD  234

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+ I  S  V I+ S I  GDDCI+I    +++ I  V CGPGHGIS+GSLG+ G
Sbjct  235   SPNTDGIDIAGSTQVQISGSFIGTGDDCIAIKGGCSNINITKVTCGPGHGISIGSLGQGG  294

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS-  434
                QVE++H+ + TF GT NGARIKT   G G+AR I+FE + + +  NPI IDQ YC+ 
Sbjct  295   AHEQVEHVHVRDCTFNGTQNGARIKTIPGGSGFARQISFEQITLIASGNPIYIDQYYCNG  354

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                 C + G    +S V +   +GT+  + AI+L+CS    C GI +++++IT  +   P
Sbjct  355   KANRCPDVGKATAVSGVAYIGFHGTSANDEAINLDCSNR-GCTGITIENVNITSSVQGQP  413

Query  253   VAACCSNAHGEETSVEP  203
             + A C+NAHG   S  P
Sbjct  414   LQAICNNAHGRAISTVP  430



>ref|XP_010419394.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=410

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/405 (41%), Positives = 233/405 (58%), Gaps = 20/405 (5%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             Y   + V + ILGL+      C   +V+ YGA GDG+ DD+ AF  AW++AC  +   K+
Sbjct  22    YDRGLLVLVAILGLL----WLCNGESVMKYGAVGDGIADDTSAFQKAWENACKGS--SKT  75

Query  1213  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGV  1040
               V +PAG  FL+  + F+GPC  + + F + G ++A   P  W   +     WL F+ V
Sbjct  76    GSVHVPAGKVFLLNSLHFSGPCIPKPLLFTIDGEMIAQSDPNKWENGENGVIPWLIFDQV  135

Query  1039  YGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
              GL + G G+++GQGK WWD  CRDHP            M F  C N TL ++ F  S Q
Sbjct  136   DGLAIVGRGLLNGQGKAWWDIHCRDHPG---------PMMTFSNCGNVTLKSLRFRDSAQ  186

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
              HV +       I+++ + SP  SPNTDG+HI +S  V I HS I+ GDDC+SIGD  N+
Sbjct  187   THVLVMGSQNVYISDIKITSPEASPNTDGIHITSSTAVSINHSDIAAGDDCVSIGDQVNN  246

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             V ++ V CGPGHG+S+GSLG+ G  V VENI + +  F GTTNGARIKTW  G GY R I
Sbjct  247   VTVSFVNCGPGHGVSIGSLGRGGTEVAVENIRVWHVNFTGTTNGARIKTWPGGTGYVRGI  306

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCS-  323
              F +++  SV NPIIIDQ Y   P  C +    V I  V + +++GT+ T+ A+ L+CS 
Sbjct  307   EFFDIRFSSVQNPIIIDQFYGCAP-NCPQTRKAVHIEKVRYMKMSGTSATKVAMKLDCSG  365

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
             ++VPC  + +  ID++P      V+  CS   G     + P PCL
Sbjct  366   ESVPCSNLFMRDIDLSPADGIDSVSTLCSFVQGSAQGIIRPSPCL  410



>gb|KHM99207.1| Polygalacturonase [Glycine soja]
Length=436

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 225/358 (63%), Gaps = 9/358 (3%)
 Frame = -1

Query  1342  SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQ  1163
             S  S +  NV DYGAK     DD++AF  AW + CS+  +     V++P    F +KP+ 
Sbjct  59    STRSQRRINVDDYGAKTIDGRDDTEAFEKAWDEVCSTGGI-----VVVPEEKIFHLKPIT  113

Query  1162  FNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWW  983
             F+GPC+  +I F V GT+ A      +   D   W+ F  V  L V+GGG I+G G+KWW
Sbjct  114   FSGPCQP-NIAFRVYGTIKAWPKMSAYQN-DRLHWIKFENVTNLRVDGGGTINGNGRKWW  171

Query  982   DQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQ  803
             + SC+ + N+      APTA+ F  C N  ++N+ F ++ Q H++   CN    +NL V+
Sbjct  172   ENSCKRNKNLP--CKPAPTAVTFYQCNNLKVTNLRFKNAQQMHIRFQKCNNVAASNLVVR  229

Query  802   SPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSL  623
             +PG+SPNTDG+H+  +K+++I++S I  GDDCISI   + +V   +++CGPGHGIS+GSL
Sbjct  230   APGNSPNTDGIHVTETKNILISNSIIGTGDDCISIVSGSQNVRAIDIKCGPGHGISIGSL  289

Query  622   GKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQN  443
             G   +  QV N+ ++ +T   TTNG RIKTWQ G GYA NI F N+ + +V NPII+DQN
Sbjct  290   GAGDSKAQVSNVLVNRATLTRTTNGVRIKTWQGGSGYAENIIFVNIAMRNVTNPIIVDQN  349

Query  442   YCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             YC     C E+ + V++S++++Q I GT+ +E AI  NCSK VPC GI L  + +TP+
Sbjct  350   YCDQEKPCHEKDSAVKLSNIMYQNIRGTSASEVAIKFNCSKTVPCKGIYLQDVILTPE  407



>emb|CDO98133.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/431 (39%), Positives = 245/431 (57%), Gaps = 26/431 (6%)
 Frame = -1

Query  1426  SASIFALYCCFYSMEVFVFLFI----------------LGLISSSRVSCKS--FNVIDYG  1301
             +A I ++  CF      +FLF+                 G  +S  VS  S    + D+G
Sbjct  17    TAIISSISLCFVQRASIIFLFLNFTNVSGAKFDPPIQLPGSRTSQYVSNSSTVLYIHDFG  76

Query  1300  AKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIV  1121
             A+G+GM+DD++AF  AWK ACS   +    ++++PAG  FLV+P+ F+GPC+S  +   +
Sbjct  77    ARGNGMSDDTKAFQKAWKIACS---LSSEAKIVVPAGKKFLVRPIDFSGPCRSG-LTLWI  132

Query  1120  SGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR-DHPNMEGC  944
             SGT+VAP  P  WNGLD ++WL F+GV  L V GGG +DG GK+WW +SC+ +H N    
Sbjct  133   SGTIVAPRDPDVWNGLDPNKWLYFHGVNYLTVEGGGTVDGSGKEWWARSCKINHTNP---  189

Query  943   TDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHI  764
                AP A+ F  C N  + NI  ++S Q H+         ++ L + +P  SPNTDG+HI
Sbjct  190   CRRAPKAITFHRCKNLIVRNIMSINSQQMHMAFTGSKQIVVSYLRISAPAHSPNTDGIHI  249

Query  763   HASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIH  584
              ASK+V +    I  GDDCISI   ++ + +  + CGPGHGIS+GSLGKS ++ QV ++ 
Sbjct  250   SASKNVEVKDCIIRTGDDCISIVSNSSKILVEGITCGPGHGISIGSLGKSNSWDQVHDVK  309

Query  583   ISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGT  404
             ++ +    T NG RIKTWQ G G+A  ITF+N+ + +V NPIII+Q YC     C  Q +
Sbjct  310   VNGANLTNTENGVRIKTWQGGSGFASGITFQNVWMENVSNPIIINQYYCDSFVPCANQTS  369

Query  403   GVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHG  224
              V I+ + F  I GT+ TE A+S  CS + PC  + L+ + +T     +  + C      
Sbjct  370   AVSINKISFVGIKGTSATETAVSFACSDSSPCRMLYLEDVQLTSYTGEITTSFCWQAYGS  429

Query  223   EETSVEPGPCL  191
                 V P  CL
Sbjct  430   SSGLVYPPSCL  440



>ref|XP_003537159.2| PREDICTED: polygalacturonase-like [Glycine max]
Length=438

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 225/358 (63%), Gaps = 9/358 (3%)
 Frame = -1

Query  1342  SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQ  1163
             S  S +  NV DYGAK     DD++AF  AW + CS+  +     V++P    F +KP+ 
Sbjct  61    STRSQRRINVDDYGAKTIDGRDDTEAFEKAWDEVCSTGGI-----VVVPEEKIFHLKPIT  115

Query  1162  FNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWW  983
             F+GPC+  +I F V GT+ A      +   D   W+ F  V  L V+GGG I+G G+KWW
Sbjct  116   FSGPCQP-NIAFRVYGTIKAWPKMSAYQN-DRLHWIKFENVTNLRVDGGGTINGNGRKWW  173

Query  982   DQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQ  803
             + SC+ + N+      APTA+ F  C N  ++N+ F ++ Q H++   CN    +NL V+
Sbjct  174   ENSCKRNKNLP--CKPAPTAVTFYQCNNLKVTNLRFKNAQQMHIRFQKCNNVAASNLVVR  231

Query  802   SPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSL  623
             +PG+SPNTDG+H+  +K+++I++S I  GDDCISI   + +V   +++CGPGHGIS+GSL
Sbjct  232   APGNSPNTDGIHVTETKNILISNSIIGTGDDCISIVSGSQNVRAIDIKCGPGHGISIGSL  291

Query  622   GKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQN  443
             G   +  QV N+ ++ +T   TTNG RIKTWQ G GYA NI F N+ + +V NPII+DQN
Sbjct  292   GAGDSKAQVSNVLVNRATLTRTTNGVRIKTWQGGSGYAENIIFVNIAMRNVTNPIIVDQN  351

Query  442   YCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             YC     C E+ + V++S++++Q I GT+ +E AI  NCSK VPC GI L  + +TP+
Sbjct  352   YCDQEKPCHEKDSAVKLSNIMYQNIRGTSASEVAIKFNCSKTVPCKGIYLQDVILTPE  409



>ref|XP_011099731.1| PREDICTED: probable polygalacturonase At3g15720 [Sesamum indicum]
Length=406

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/408 (42%), Positives = 242/408 (59%), Gaps = 23/408 (6%)
 Frame = -1

Query  1393  YSMEVFVFLFILGLISSSR-------VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  1235
             +S    + L+I   ++++R           + +V  +GA GDG TDDS+AF +AW+ AC 
Sbjct  3     FSSYFMILLWIFSELTTTRNAHATSVFQQTTLDVTKFGAVGDGKTDDSRAFQSAWEAACK  62

Query  1234  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  1055
                   + +V +P+G TFLV P++F GPC+   I F + G +VAP     W       WL
Sbjct  63    KGT--NNGKVTVPSGKTFLVYPIEFEGPCRLSSITFEILGVIVAP-PKSAWMKKSADAWL  119

Query  1054  SFNGVYGLIV--NGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNI  881
             SF+GV  LIV  NG GVIDG+G  WW        N+ G     PTA++F  C    +  +
Sbjct  120   SFHGVDRLIVAGNGQGVIDGRGASWW--------NLHGDDGSRPTALRFSQCNGLQVKGL  171

Query  880   HFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCIS  701
                +S Q HV +  C+G +I+NL +++   SPNTDG+ I AS +V I    ++ GDDCI+
Sbjct  172   KHRNSQQNHVSINGCDGADISNLDIRATATSPNTDGIDISASTNVRIHDCLVATGDDCIA  231

Query  700   IGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTG  521
             I   T++V I+N+ CGPGHGIS+GSLG++G   QVE I I+NS+F  T NG RIKTWQ G
Sbjct  232   IKGGTSNVHISNIACGPGHGISIGSLGEAGGHDQVEGISITNSSFTRTENGVRIKTWQGG  291

Query  520   RGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTAT-TEA  344
              G+A+NITF  +   + DNP+IIDQ YC +   C ++   V+ISDV +  ++GT+   +A
Sbjct  292   SGFAKNITFSRITFVAADNPVIIDQYYCPHK-KCADKTFAVKISDVRYSGLHGTSIGKQA  350

Query  343   AISLNCSKAVPCLGIKLDSIDITPQIPS-VPVAACCSNAHGEETSVEP  203
              I+ +CS+ VPC  I +D +DI    PS     A C+NAHG   +V P
Sbjct  351   TINFSCSEVVPCTNIVMDDVDIESADPSHHSTTAHCNNAHGTAHAVHP  398



>ref|XP_008461801.1| PREDICTED: polygalacturonase-like [Cucumis melo]
Length=446

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 226/369 (61%), Gaps = 9/369 (2%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  1169
             SS   S K  NV D+GAKG+G  DD++AF  AWK+ACSS    +   +++P G T+ +KP
Sbjct  72    SSFSSSTKVVNVDDFGAKGNGQ-DDTKAFELAWKEACSS----RKATLLVPKGRTYYLKP  126

Query  1168  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKK  989
             + F+GPC+S  +   ++G + A      +   D   WL F GV   +V G G+I+G G+K
Sbjct  127   ITFSGPCRSP-LTLKINGMIKASTRISDYEN-DRRHWLKFEGVDNFVVEGNGIINGNGRK  184

Query  988   WWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLT  809
             WW  SC+   N E     APTA+ F  CIN  +SN+ F  + Q H+    C      NL 
Sbjct  185   WWQNSCK--VNKELPCKRAPTAVTFYQCINLVVSNLMFKDAQQMHLTFQKCTNVKALNLR  242

Query  808   VQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVG  629
             V +PG+SPNTDG+HI  +++ +I +  I  GDDCISI   + +V   ++ CGPGHGIS+G
Sbjct  243   VVAPGNSPNTDGIHITETQNAIIRNCVIGTGDDCISIVSGSRNVRAMDITCGPGHGISIG  302

Query  628   SLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIID  449
             SLG   +  +V NI ++ +   GT+NG RIKTWQ G GYA+NI F+N+ + +V NPIIID
Sbjct  303   SLGAENSEAEVSNIRVNRALISGTSNGVRIKTWQGGSGYAKNIMFQNVVMKNVSNPIIID  362

Query  448   QNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             QNYC    +C EQ + V++S+VV++ I GT+ ++ AI  +CSK+ PC  I L  + I  Q
Sbjct  363   QNYCDKEDSCPEQNSAVKVSNVVYKNIRGTSASDDAIKFDCSKSFPCQEISLLGVHIVGQ  422

Query  268   IPSVPVAAC  242
                V  A+C
Sbjct  423   GNEVATASC  431



>ref|XP_010450754.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/382 (43%), Positives = 231/382 (60%), Gaps = 17/382 (4%)
 Frame = -1

Query  1390  SMEVFVFLFILGLISS-----SRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  1238
             S+  F FL  L L  +     SR +     K FNV+DYGA GDG +DDS+AF +AW+D C
Sbjct  4     SVMFFTFLLSLTLFHTFQFAHSRSTLYNENKIFNVLDYGAIGDGFSDDSKAFKDAWEDTC  63

Query  1237  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--  1064
             +      + +  IP G TFL++P++F+GPCKS+ I   +SG V+APGSP  W        
Sbjct  64    NYIGSQSTME--IPEGYTFLLQPIEFHGPCKSKKIILSISGYVIAPGSPDEWECKKNHCH  121

Query  1063  QWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSN  884
             QW+ F  + GL ++G G +DGQG KWW  +C+ +   + C    P  +      N  +SN
Sbjct  122   QWIEFAHINGLHIDGRGTLDGQGTKWWSLNCKKYK--KACLK-RPRGVVISHSSNVHISN  178

Query  883   IHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCI  704
             I    SP   + L      ++  LT+ + GDSPNTDG+HI  S++V++ +S I  GDDCI
Sbjct  179   IMVKDSPNFQMSLEDSKWVSVKQLTITADGDSPNTDGIHIQRSQNVIVHNSNIRTGDDCI  238

Query  703   SIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQT  524
             SIGD +  V I+ + CGPGHGIS+GSLG+ G    VE++ + + TF  TTNG RIKTWQ 
Sbjct  239   SIGDGSKYVNISRISCGPGHGISIGSLGRYGTKETVEDVVVQDCTFRETTNGVRIKTWQG  298

Query  523   GRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEA  344
             GRG+ RN+ FE +++     PIIIDQ YC +   CK     V+I +V++  I+GT+  + 
Sbjct  299   GRGHVRNVLFERIKLHGATRPIIIDQFYCPHR-QCKNHTEAVEIKNVMYNHIHGTSIKKP  357

Query  343   AISLNCSKAVPCLGIKLDSIDI  278
              + L CSK+VPC GI ++ I+I
Sbjct  358   FVQLLCSKSVPCRGIFMNDINI  379



>ref|XP_002517618.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF44782.1| polygalacturonase, putative [Ricinus communis]
Length=770

 Score =   316 bits (810),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 216/356 (61%), Gaps = 15/356 (4%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S + +NV+ YGA G+G+ DD+ AF+ AW D C  +   + P +++P G TF V PV   G
Sbjct  7     SQRKYNVLSYGAVGNGIVDDTMAFMKAWNDTCKDS---RRPVMVVPMGKTFFVYPVTLFG  63

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIV--NGGGVIDGQGKKWWD  980
             PC S ++  ++ GT++AP  P  WNG     WL+F  V  L V  NG GV+DG+G +WW+
Sbjct  64    PCNSSNLIVMILGTIIAPDHPNVWNGRFHGTWLAFRYVNDLTVSGNGVGVLDGRGHRWWE  123

Query  979   QSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQS  800
              SCR + +           + F  C N  L  I  V S   H+ +F C     + L +QS
Sbjct  124   ISCRYNKS---------KIISFEMCKNVNLRRISTVRSGGGHIAVFGCENVRFSILNLQS  174

Query  799   PGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLG  620
             PG SPNTDG+HI  S  V I  S I  GDDCIS+ D + +V I N+ CGPGHGIS+GSLG
Sbjct  175   PGKSPNTDGIHISHSNFVHIHKSVIGSGDDCISMLDRSYNVNITNINCGPGHGISIGSLG  234

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
               G  V V+NI I N  FY TTNGARIKTWQ G GY RN+ FEN+ + +  NPI IDQ Y
Sbjct  235   SDGTKVDVQNITIRNVNFYKTTNGARIKTWQGGSGYVRNVLFENITLLNTSNPINIDQYY  294

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITP  272
             C   G C EQ + V++S + F +  G++ T+ AI++ CS+ V C  I LD+IDITP
Sbjct  295   CPR-GNCAEQASAVKVSGITFTKFKGSSFTDPAINIACSETVGCSNIVLDNIDITP  349


 Score =   209 bits (532),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 161/263 (61%), Gaps = 4/263 (2%)
 Frame = -1

Query  979  QSCRDHP-NMEGCTDLA---PTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNL  812
            +SC+  P N++   ++    PTA+ F  C N  LS +  ++S Q H+    C+   +++L
Sbjct  450  RSCKSSPINIQKFDEIGGRRPTALTFDQCNNLQLSGLTHINSAQDHIHFSGCSNVLVSDL  509

Query  811  TVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISV  632
             + +P  SPNTDG++I  S ++ I    I  GDDC++IG  ++++ I  V CGPGHGIS+
Sbjct  510  HITAPESSPNTDGINISHSSNIQIHDCTIGTGDDCVAIGGGSSNINITGVTCGPGHGISI  569

Query  631  GSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIII  452
            GSLGK+G    VE +++ + T  GTTNG RIKTWQ G G+AR I FE + + +VDNPIII
Sbjct  570  GSLGKNGKSDTVEEVYVKDCTLKGTTNGLRIKTWQGGSGHARQIHFEGITLDAVDNPIII  629

Query  451  DQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITP  272
            DQ YC +   CK Q + V++S++ ++ ++GT+ TE AI L CS++  C  I L  IDI  
Sbjct  630  DQYYCEHKSACKNQTSAVKVSNIFYKGVHGTSITEEAIQLRCSQSTSCSNIFLSDIDIIS  689

Query  271  QIPSVPVAACCSNAHGEETSVEP  203
                +   A C NA+G  +   P
Sbjct  690  ANQGIQTHAFCFNAYGTASYSTP  712



>ref|XP_011035674.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Populus 
euphratica]
Length=441

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/414 (42%), Positives = 234/414 (57%), Gaps = 10/414 (2%)
 Frame = -1

Query  1420  SIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNA  1253
             +I  L C CF  ++ F  L  L   + SR+   S  V+   D+GAKGDG+++D+QAF   
Sbjct  15    TIRVLICACFVCVQGFDSLLQLPQSAPSRIRPSSKRVLLVGDFGAKGDGLSNDTQAFKEV  74

Query  1252  WKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGL  1073
             W+ ACS        +++IPAG  FLV PV F GPCKS+ I   +SGT+VAP  P  W GL
Sbjct  75    WEMACS---FRGRTRILIPAGYNFLVHPVDFGGPCKSKVI-LDISGTIVAPEDPAAWKGL  130

Query  1072  DTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTT  893
             +  +WL F+GV  L V GGG ++G+G  WW QSC+ +     C + APTA+ F  C +  
Sbjct  131   NRRKWLYFHGVKHLTVEGGGTVNGRGWLWWAQSCKIN-KTNPCRN-APTAITFHKCKDLK  188

Query  892   LSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGD  713
             + N+  V   + H+    C      +L V SP  SPNTDG+HI AS  V I  S +  GD
Sbjct  189   VENLKVVCGQKMHIAFTNCLRVMTFHLIVTSPAVSPNTDGIHISASHGVKIKDSVVRTGD  248

Query  712   DCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKT  533
             DCISI   ++ ++I N+ CGPGHGIS+GSLGKS +   V ++ +  +    T NG RIKT
Sbjct  249   DCISIVSNSSRIKIRNIACGPGHGISIGSLGKSNSSSLVRDVMVDGAFLSNTDNGVRIKT  308

Query  532   WQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTAT  353
             WQ G G A NITF+N+ + +V NPIIIDQ YC     C  Q + V + ++ F+RI GT+ 
Sbjct  309   WQGGGGNATNITFQNIFMENVSNPIIIDQYYCDAGVPCANQTSAVIVENISFRRIKGTSA  368

Query  352   TEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGPCL  191
             TE AI   CS   PC G+ L+ + +         + C          V P PC 
Sbjct  369   TEEAIKFVCSDDFPCKGLYLEDVQLLSHTGGTTRSFCWQAYGSSRGLVHPSPCF  422



>emb|CDX74019.1| BnaA03g30280D [Brassica napus]
Length=437

 Score =   306 bits (785),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 234/373 (63%), Gaps = 9/373 (2%)
 Frame = -1

Query  1348  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  1169
             ++ R S ++FNV  +GAK +G  DDSQAF+ AW+ ACSS     +  +++P    + +KP
Sbjct  59    AAPRSSPRAFNVNSFGAKANG-NDDSQAFMKAWEAACSSK---GTVYIVVPENRAYTLKP  114

Query  1168  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKK  989
             V+F+GPC S  I F + G + A  +P  +   +   W+ F  V  L V GGG IDG GK 
Sbjct  115   VKFSGPCISSMIVFKIYGKIEAWKNPSDYR--ERRFWIVFQTVDNLRVEGGGRIDGNGKI  172

Query  988   WWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLT  809
             WW +SC+ +P +  C + APTA+ F+ C N  + NI   ++ Q H+++  C      NL 
Sbjct  173   WWPKSCKINPELP-CQE-APTAVTFVECNNLMVRNIRLENAQQMHMRVQKCENVKALNLM  230

Query  808   VQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVG  629
             V SPG SPNTDG+H+  +++++I  S I  GDDCISI   + +V    + CGPGHGIS+G
Sbjct  231   VTSPGHSPNTDGIHVTGTRNILIQDSIIRTGDDCISIVSGSENVRATGITCGPGHGISIG  290

Query  628   SLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIID  449
             SLG   +   V N+ +S +T  GTTNG RIKTWQ G G A+NI F+++ + +V NPIII+
Sbjct  291   SLGAHNSEAYVSNVVVSKATLIGTTNGVRIKTWQGGHGMAKNIIFKDILMKNVTNPIIIN  350

Query  448   QNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQ  269
             QNYC     C EQ + VQ+S+V+++ I+GT+++  AI   CSK++PC GI L ++++  Q
Sbjct  351   QNYCDQTKACPEQKSAVQVSNVLYKNIHGTSSSPEAIKFVCSKSIPCQGISLQNVELVDQ  410

Query  268   IPSVPVA-ACCSN  233
             I    V+ A CSN
Sbjct  411   ITKQDVSKATCSN  423



>ref|XP_009420908.1| PREDICTED: polygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=397

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 220/351 (63%), Gaps = 9/351 (3%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGP  1151
             K  NV  YGAKGD    DS AF  AWK ACSS+    +P ++ IP    +L+KP+ F GP
Sbjct  24    KVVNVQYYGAKGD-EDSDSMAFEKAWKKACSSS----TPTILLIPKNKRYLLKPMNFRGP  78

Query  1150  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSC  971
             CKS+ + F + GT+ A  +   W+G  +  W+ F+ +  L V GGG I+G GK WW  SC
Sbjct  79    CKSR-VSFTIMGTLEASRNQKDWDGRISRHWILFSNIDNLTVRGGGTINGNGKIWWRGSC  137

Query  970   RDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGD  791
             +   +M   +  APTA+ F  C N  + N+  + SP+ H+ L  C G + ++LT+ +P +
Sbjct  138   KMDASMPCIS--APTALSFNSCKNLRVENLKVMDSPRMHISLEKCTGVDASHLTITAPHE  195

Query  790   SPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSG  611
             SPNTDG+HI  SK+V I +S I  GDDCISI   + +V   N+ CGPGHGIS+GSLG   
Sbjct  196   SPNTDGIHITHSKNVKIANSFIGTGDDCISIVSGSKNVMATNIVCGPGHGISIGSLGAHN  255

Query  610   NFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSY  431
             +  QV N+ +  + F GT NG RIKTWQ G+GYA+ +TF+N+ + +V NPIIIDQNYC  
Sbjct  256   SEAQVSNVTVDTARFIGTANGVRIKTWQGGKGYAKGLTFKNIVMHNVLNPIIIDQNYCDS  315

Query  430   PGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
                C+ Q + VQ+ DV++Q I GT+ +E AI+L CS   PC  + L  +++
Sbjct  316   QNPCQRQVSAVQVMDVLYQNIKGTSASEVAINLQCSNDRPCRHVLLQDVNL  366



>emb|CDY38648.1| BnaC02g23310D [Brassica napus]
Length=374

 Score =   304 bits (779),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 158/378 (42%), Positives = 226/378 (60%), Gaps = 7/378 (2%)
 Frame = -1

Query  1312  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  1133
             + YGA GDG++DD+ A   AW  AC+ +   K   V +PAG  FL+  + F GPCK + +
Sbjct  1     MKYGAVGDGISDDTSALQKAWDSACNGSS--KIGSVYVPAGKVFLLSSLHFTGPCKLKPL  58

Query  1132  HFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHP  959
              F + G + A   P  W   +     WL F+ V GL+++G G++DGQGK WWD  CRDHP
Sbjct  59    IFTIDGEMKAQSDPNKWQKGENGIIPWLIFDRVEGLVLSGRGLLDGQGKGWWDIHCRDHP  118

Query  958   NMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNT  779
                 C  LAPT M F  C N  L ++ F +S Q+H+ +      +I ++ ++SP  SPNT
Sbjct  119   G-PNCIWLAPTMMTFSNCRNVILKSLRFRNSAQSHILVMGSQNVHIKDVKIKSPEISPNT  177

Query  778   DGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQ  599
             DGVHI +S  V ITHS  + GDDC+SIGD  +++ +  V CGPGHG+SVGSLG+ G  V+
Sbjct  178   DGVHITSSSDVSITHSDFATGDDCVSIGDQVHNLSVTFVNCGPGHGVSVGSLGRGGTEVE  237

Query  598   VENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTC  419
             VE+I +++  F GTTNGARIKTW  G GY R I F +++  +V NPI+IDQ Y   P  C
Sbjct  238   VEDIRVAHVNFTGTTNGARIKTWPGGTGYVRGIEFFDIRFSNVQNPIVIDQFYGCAP-NC  296

Query  418   KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACC  239
              +    V I  V + +++GT+ TE A+ L CS    C  + +  ID++P      V++ C
Sbjct  297   VQTEKAVHIEKVKYMKMSGTSRTEVAMKLECSGKNACSNVFMRDIDLSPASGIGSVSSLC  356

Query  238   SNAHGE-ETSVEPGPCLK  188
             S   G  + ++ P  C++
Sbjct  357   SFVQGATQGTIRPSSCIQ  374



>gb|AAD55489.1|AC009322_29 Similar to polygalacturonases [Arabidopsis thaliana]
Length=459

 Score =   307 bits (787),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 158/400 (40%), Positives = 237/400 (59%), Gaps = 22/400 (6%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S +  +V ++GAKG+G+TDD++AF +AWK ACSS       ++++P   T L++P+  +G
Sbjct  49    SERLLHVGNFGAKGNGVTDDTKAFADAWKTACSS---KVKTRILVPENYTCLLRPIDLSG  105

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PCK++ +   +SGT++AP  P  W GL+  +WL F+G+  L V GGG ++G G++WW++S
Sbjct  106   PCKAR-LTLQISGTIIAPNDPDVWEGLNRRKWLYFHGLSRLTVEGGGTVNGMGQEWWERS  164

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+ H +   C   APTA+ F  C N  + N++ + S Q H+ L  C    I+ L V +P 
Sbjct  165   CK-HNHSNPCRG-APTALTFHKCKNMRVENLNVIDSQQMHIALTSCRRVTISGLKVIAPA  222

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
              SPNTDG+HI  S+ +VI ++ +S GDDCISI   +  + I+N+ CGPGHGIS+GSLGKS
Sbjct  223   TSPNTDGIHISVSRGIVIDNTTVSTGDDCISIVKNSTQISISNIICGPGHGISIGSLGKS  282

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              ++ +V +I +  +    T NG RIKTWQ G G    I F N+++ +V NPIIIDQ YC 
Sbjct  283   KSWEEVRDITVDTAIISDTANGVRIKTWQGGSGLVSKIIFRNIKMNNVSNPIIIDQYYCD  342

Query  433   YPGTC---------------KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGI  299
                 C               K Q + + I ++ F  + GT+ ++ AI ++CS + PC  I
Sbjct  343   SRKPCANQLNIEPEKLSKTQKLQTSAISIENISFVHVRGTSASKEAIKISCSDSSPCRNI  402

Query  298   KLDSIDITPQIPSVPVAACCSNAHGEET-SVEPGPCLKQD  182
              L  ID+ P        + C  A+G  +  V P PCL  D
Sbjct  403   LLQDIDLEPSNGDGFTESFCWEAYGSSSGQVYPPPCLSDD  442



>gb|KCW81409.1| hypothetical protein EUGRSUZ_C02785 [Eucalyptus grandis]
Length=395

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/385 (41%), Positives = 227/385 (59%), Gaps = 19/385 (5%)
 Frame = -1

Query  1357  GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             G++++S +    +NVI+YGA G+G+ DD+QAF+ AW D+C  +    +P +++P G  F 
Sbjct  23    GIVAASPI----YNVINYGAIGNGVDDDTQAFVKAWGDSCGDSGARGTPTLVVPGGKKFK  78

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             + PV F GPCKS      + GT+VAP SP  W G     WL F  V  L V G G +DGQ
Sbjct  79    LSPVSFKGPCKSSSFIVKIDGTLVAPSSPSEWKGCSADSWLVFQDVANLNVKGSGQVDGQ  138

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G  WW  +  ++  +         A+ F  CIN  LS +  ++SP+ H+ +  C+G  I+
Sbjct  139   GSLWWGGAKNNNKTVS-------QALSFFHCINLVLSGLQHINSPKNHISISGCDGGTIS  191

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             NL + +P  SPNTDG+ I ++ H+ I    I  GDDCI+I   ++ + I  V CGPGHGI
Sbjct  192   NLRISAPETSPNTDGIDISSTNHLNIQELNIQTGDDCIAINGNSSYITITGVSCGPGHGI  251

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLG+ G    VE + + + TF G+TNGARIKTWQ G GYA+ ITF+ + + +V NPI
Sbjct  252   SIGSLGEHGISDTVEGVQVQHCTFTGSTNGARIKTWQGGSGYAKGITFDQITLNAVKNPI  311

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             IIDQ Y         + + V +S+V +    GT+ ++ AI L+CS ++ CL I+LD+  I
Sbjct  312   IIDQFY-------TNEASSVAVSNVTYTGFRGTSASDQAIILSCS-SIGCLDIRLDNNMI  363

Query  277   TPQIPSVPVAACCSNAHGEETSVEP  203
             T   P   V + C NAHG  T   P
Sbjct  364   TSSTPGKTVTSWCKNAHGSATLTTP  388



>ref|XP_007148884.1| hypothetical protein PHAVU_005G022500g [Phaseolus vulgaris]
 gb|ESW20878.1| hypothetical protein PHAVU_005G022500g [Phaseolus vulgaris]
Length=440

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/364 (42%), Positives = 228/364 (63%), Gaps = 11/364 (3%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             +  +V D+GAK +   DD++AF  AW +ACS   V     +++P    + +KP+ F+GPC
Sbjct  68    RRISVDDFGAKANDGRDDTEAFEKAWNEACSRGGV-----LVVPEAKIYHLKPITFSGPC  122

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
                +  F V GT+ A      + G     W+ F  +  L V+GGG I+G G+KWW+ SC+
Sbjct  123   HP-NTAFRVYGTIRAWPVISAY-GKQRLLWIMFQNLTNLRVDGGGTINGNGRKWWENSCK  180

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
              + N+  C   APTA+ F  C N  ++N+   ++ Q HV+   CN    +NL +++PG+S
Sbjct  181   TNENLP-CKH-APTAVTFFGCNNLIVTNLRLKNAQQMHVRFQKCNNVTASNLILRAPGNS  238

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+H+  +K+++I++S I  GDDCISI   + +V + +V CGPGHGIS+GSLG   +
Sbjct  239   PNTDGIHVTETKNIMISNSSIGTGDDCISIVSGSQNVRVTDVTCGPGHGISIGSLGAGNS  298

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
               QV N+ ++ +T  GTTNG RIKTWQ G GYA+NI FEN+ + +V NPII+DQNYC   
Sbjct  299   KAQVSNVLVNRATITGTTNGVRIKTWQGGSGYAKNIKFENIAMRNVTNPIIVDQNYCDQE  358

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITP--QIPSVP  254
               CKE+ + VQ+S++V+Q I GT+ +E AI   CSK+ PC GI  + + +TP     S  
Sbjct  359   KPCKEKVSAVQVSNIVYQNIRGTSASEVAIKFECSKSFPCKGIHFEDVVLTPHGHAASKT  418

Query  253   VAAC  242
             +A C
Sbjct  419   IATC  422



>ref|XP_002282759.1| PREDICTED: polygalacturonase [Vitis vinifera]
 emb|CBI29906.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 230/386 (60%), Gaps = 9/386 (2%)
 Frame = -1

Query  1360  LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  1181
             +G +  S  S K+ +V DYGAKGDG +D ++AF  AW+ ACSS    +   +++P    +
Sbjct  63    IGKVGRSLASVKTVSVNDYGAKGDG-SDATEAFKKAWEAACSS----QGSVLVVPQTKNY  117

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             L+KP+ F GPCKS  I   + GTV A      ++  D ++WL F  V  L V GGG I+G
Sbjct  118   LLKPITFQGPCKS-SITVQIYGTVQASADRSAYSN-DMTRWLVFENVQNLAVQGGGTING  175

Query  1000  QGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNI  821
              GK WW+ SC+ + ++  C D APTA+ F  C N  + N+   ++ Q HV    C G   
Sbjct  176   NGKTWWENSCKVNDDLS-CKD-APTALTFYNCKNLVVKNLKIQNAQQMHVSFEKCVGVQA  233

Query  820   NNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHG  641
             + LTV +PGDSPNTDG+H+  ++++ I+ S +  GDDCISI   T +++   + CGPGHG
Sbjct  234   SGLTVTAPGDSPNTDGIHVTDTQNIQISSSVLGTGDDCISIVSGTQNLQATGITCGPGHG  293

Query  640   ISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNP  461
             IS+GSLG   +   V +I ++ +T  GTTNG RIKTWQ G G A NI F+N+++ +V NP
Sbjct  294   ISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIKTWQGGSGSASNIKFQNIEMHNVKNP  353

Query  460   IIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSID  281
             IIIDQ YC     CK Q   VQ+ +V++Q I GT+++  AI L+CS   PC G+ L  ID
Sbjct  354   IIIDQKYCDQDKPCKSQSRAVQVQNVLYQNIKGTSSSNEAIQLDCSDKFPCQGVVLQDID  413

Query  280   ITPQIPSVPVAACCSNAHGEETSVEP  203
             I         A C +    E+  V P
Sbjct  414   IEIGGGRATKAVCNNAKVTEKGDVSP  439



>ref|XP_010486374.1| PREDICTED: polygalacturonase QRT2 [Camelina sativa]
Length=439

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/371 (43%), Positives = 230/371 (62%), Gaps = 8/371 (2%)
 Frame = -1

Query  1339  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  1160
             R S ++FNV  +GAK +G  DDSQAF+ AW+ ACSST +     +++P    +++KPVQF
Sbjct  65    RSSPQAFNVNSFGAKANG-NDDSQAFMKAWQSACSSTGI---VYIVVPNNRKYMLKPVQF  120

Query  1159  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWD  980
             +GPCKS  I F + G + A  +P  +       W+ F  V  L V GGG IDG G  WW 
Sbjct  121   SGPCKSSLIVFKIYGMIEAWENPSDYKV--RRHWIVFENVDNLRVEGGGRIDGNGHIWWP  178

Query  979   QSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQS  800
             +SC+ +P +  C   APTA+ F+ C N  +SNI   ++ Q H+    C      +L V S
Sbjct  179   KSCKINPKLP-CLG-APTAVTFVECNNLKVSNIRLENAQQMHLTFQDCQNVKALHLMVTS  236

Query  799   PGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLG  620
             PGDSPNTDG+H+  +++++I  S I  GDDCISI   + +V    + CGPGHGIS+GSLG
Sbjct  237   PGDSPNTDGIHVSGTRNILIQDSIIRTGDDCISIVSGSENVRATGITCGPGHGISIGSLG  296

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
             +  +   V N+ ++ +T  GTTNG RIKTWQ GRG A+NI F+++ + +V NPIII+Q+Y
Sbjct  297   EGNSKAYVSNVVVNKATLIGTTNGVRIKTWQGGRGMAKNIIFQDIIMKNVTNPIIINQDY  356

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPS  260
             C    +C EQ + VQ+S+V+++ I GT++   A++  CSK++PC GI + ++ +  Q   
Sbjct  357   CDRVESCPEQKSAVQVSNVLYKNIQGTSSRPVAVNFACSKSIPCRGISMQNVKLVDQTQQ  416

Query  259   VPVAACCSNAH  227
                 A CSN  
Sbjct  417   DVSKASCSNVR  427



>ref|XP_010254365.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=446

 Score =   306 bits (785),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 220/379 (58%), Gaps = 6/379 (2%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             K  +V +YGAKGDG+ DD++AF +AWK ACS   +   P++ +PAG  +LV P+   GPC
Sbjct  52    KVISVKEYGAKGDGLVDDTRAFKDAWKVACS---LSSRPRIEVPAGRNYLVGPIDLGGPC  108

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
             +S+ +   V G + AP  P  WNG +  +WL F+G+    V GGG I+G G++WW +SC+
Sbjct  109   RSR-VTLRVFGNITAPKDPASWNGFNRRKWLYFHGLNRFTVEGGGTINGMGEEWWARSCK  167

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
                N       APTA+ F  C N  + +I  V+S Q H+    CN    +NL + SPG+S
Sbjct  168   --INTTNPCRHAPTAVTFHRCKNLKVQSIRIVNSQQMHMAFTKCNRVIASNLELISPGES  225

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+HI AS  V I  S I  GDDC+SI   ++ +++ N+ CGPGHGIS+GSLGKS +
Sbjct  226   PNTDGIHISASTRVEIEDSMIKTGDDCVSIVSNSSMIQVRNISCGPGHGISIGSLGKSNS  285

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
                V N+ +  +    T NG RIKTWQ G G+AR I F+N+ + +V +PIIIDQ YC   
Sbjct  286   SAIVSNVLVDGAFLSNTANGLRIKTWQGGHGFARQILFQNVVMENVSHPIIIDQYYCDSF  345

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C  Q   VQ+S+V +  + GT  TE A+   CS   PC GI L+ + +   +      
Sbjct  346   LPCSNQSMAVQVSNVSYVGVKGTCATEEAVRFACSDNFPCKGIYLEDVQLVSHLGEPTRT  405

Query  247   ACCSNAHGEETSVEPGPCL  191
              C  +      +V P  C 
Sbjct  406   FCWESWGTSHGTVYPPHCF  424



>ref|XP_004149736.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=435

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 225/371 (61%), Gaps = 8/371 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S K  NV D+GAKG+G  DD++AF  AWK+ACSS    +   +++P G T+ +KP+ F+G
Sbjct  64    STKVVNVDDFGAKGNGQ-DDTKAFELAWKEACSS----RKATLLVPKGRTYYLKPIIFSG  118

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S  +   ++G + A      +       WL F+ V   +V G G+I+G G+KWW  S
Sbjct  119   PCRSP-LTLKINGMIKASTRISDYENDGRRHWLKFHEVDNFVVEGNGIINGNGRKWWQNS  177

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+ +  +      APTA+ F  CIN  +SN+ F  + Q H+    C      NL V +PG
Sbjct  178   CKVNKGLP--CKRAPTAVTFYQCINLVVSNLMFKDAQQMHLTFQKCTNVKALNLRVVAPG  235

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG+HI  +++ +I +  I  GDDCISI   + +V+  ++ CGPGHGIS+GSLG  
Sbjct  236   NSPNTDGIHITETQNAIIRNCVIGTGDDCISIVSGSRNVQAMDITCGPGHGISIGSLGAD  295

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              +  +V NI ++ +   GT+NG RIKTWQ G GYA+NI F+N+ + +V NPIIIDQNYC 
Sbjct  296   NSEAEVSNIRVNRALISGTSNGVRIKTWQGGSGYAKNIMFQNVVMRNVSNPIIIDQNYCD  355

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                +C EQ + V++S+VV++ I GT+ +  AI  +CSK+ PC GI L  I I  Q     
Sbjct  356   KKESCPEQKSAVKVSNVVYKNIRGTSASGDAIKFDCSKSFPCQGISLLGIRIVGQGNEEA  415

Query  253   VAACCSNAHGE  221
             V A C N   E
Sbjct  416   VTASCENVRWE  426



>emb|CAN64004.1| hypothetical protein VITISV_043286 [Vitis vinifera]
Length=442

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 229/386 (59%), Gaps = 9/386 (2%)
 Frame = -1

Query  1360  LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  1181
             +G +  S  S K+ +V DYGAKGDG +D ++AF  AW+ ACSS    +   +++P    +
Sbjct  63    IGKVGRSLASVKTVSVNDYGAKGDG-SDATEAFKKAWEAACSS----QGSVLVVPXXKNY  117

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             L+KP+ F GPCKS  I   + GTV A      ++  D ++WL F  V  L V GGG I+G
Sbjct  118   LLKPITFEGPCKS-SITVQIYGTVQASADRSAYSN-DMTRWLVFENVQNLAVQGGGTING  175

Query  1000  QGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNI  821
              GK WW+ SC+ + ++  C D APTA+ F  C N  + N+   ++ Q HV    C G   
Sbjct  176   NGKTWWENSCKVNDDLS-CKD-APTALTFYNCKNLVVKNLKIQNAQQMHVSFEKCVGVQA  233

Query  820   NNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHG  641
             + LTV +PGDSPNTDG+H+  ++++ I+ S I  GDDCISI   T +++   + CGPGHG
Sbjct  234   SGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTGDDCISIVSGTQNLQATGITCGPGHG  293

Query  640   ISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNP  461
             IS+GSLG   +   V +I ++ +T  GTTNG RIKTWQ G G A NI F+N+++ +V NP
Sbjct  294   ISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIKTWQGGSGSASNIKFQNIEMHNVXNP  353

Query  460   IIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSID  281
             IIIDQ YC     CK Q   VQ+ +V++Q I GT+++  AI L+CS   PC G  L  ID
Sbjct  354   IIIDQKYCDQDKPCKSQSRAVQVQNVLYQNIKGTSSSXEAIQLDCSBKFPCQGXVLQDID  413

Query  280   ITPQIPSVPVAACCSNAHGEETSVEP  203
             I         A C +    E+  V P
Sbjct  414   IEXGGGXAXKAVCNNAKVTEKGDVSP  439



>ref|XP_010435969.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score =   305 bits (782),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 222/352 (63%), Gaps = 8/352 (2%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             K+FNV+DYGA GDG +DDS+AF +AW+D C+      + +  IP G TFL++P++F+GPC
Sbjct  34    KNFNVLDYGAIGDGFSDDSKAFKDAWEDTCNYIGSQSTME--IPEGYTFLLQPIEFHGPC  91

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             KS+ I   ++G V+APGSP  W        QW+ F  + GL ++G G++DGQG KWW  +
Sbjct  92    KSKKIILSINGYVIAPGSPDEWECKKNHCHQWIEFAHINGLHIDGRGILDGQGTKWWSLN  151

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+ +   + C    P  +      N  +SNI    SP   + L      ++  LT+ + G
Sbjct  152   CKKYK--KACLK-RPRGVVISHSSNVHISNIMVKDSPNFQMSLEDSKWVSVKQLTITADG  208

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             DSPNTDG+HI  S++V++ +S I  GDDCISIGD +  + I+ + CGPGHGIS+GSLG+ 
Sbjct  209   DSPNTDGIHIQRSQNVIVHNSNIRTGDDCISIGDGSKYINISRISCGPGHGISIGSLGRY  268

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
             G    VE++ + + TF  TTNG RIKTWQ GRG+ RN+ FE +++     PIIIDQ YC 
Sbjct  269   GTKETVEDVVVQDCTFRETTNGVRIKTWQGGRGHVRNVLFERIKLHGATRPIIIDQFYCP  328

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             +   CK     V+I +V++  I+GT+  +  + L CSK+VPC GI ++ I+I
Sbjct  329   HR-QCKNHTNAVEIKNVMYNHIHGTSIKKPFVQLLCSKSVPCRGIFMNDINI  379



>gb|KHN22462.1| Putative polygalacturonase [Glycine soja]
Length=587

 Score =   310 bits (795),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 234/390 (60%), Gaps = 8/390 (2%)
 Frame = -1

Query  1357  GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             GL  +   S    +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFL
Sbjct  39    GLKRTRTRSKWVLSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFL  95

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             V PV   GPC+S+ I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G 
Sbjct  96    VHPVDIGGPCRSK-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRINGM  154

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G++WW +SC+   N       APTAM F  C +  + N+  ++S + H+    C     +
Sbjct  155   GQEWWARSCK--INSTNPCHPAPTAMTFHRCKDLKVRNLMLINSQRMHLSFTNCMRIVAS  212

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             +L V +P  SPNTDG+HI A+K V +  S I  GDDCISI   ++ V I N+ CGPGHGI
Sbjct  213   HLKVLAPAFSPNTDGIHISATKGVEVRDSVIRTGDDCISIVRNSSRVWIRNISCGPGHGI  272

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLGKS  + +V+N+ +     Y T NG RIKTWQ G G+A  ITF+++ + +V NPI
Sbjct  273   SIGSLGKSKKWEKVQNVIVDGVYLYNTDNGVRIKTWQGGSGFASKITFQHILMENVSNPI  332

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             I+DQ YC     CK + + V++ ++ F  I GT+ TE AI  +CS A PC G+ L++I +
Sbjct  333   IVDQYYCDSRNPCKNETSAVRVENISFIDIQGTSATEEAIKFSCSDAFPCEGLYLENIFL  392

Query  277   TPQIPSVPVAACCSNAHGEETS-VEPGPCL  191
                      ++ C  AHG     + P  CL
Sbjct  393   ASCFGG-NTSSFCWQAHGSARGFLHPSTCL  421



>ref|XP_002299601.2| hypothetical protein POPTR_0001s17180g [Populus trichocarpa]
 gb|EEE84406.2| hypothetical protein POPTR_0001s17180g [Populus trichocarpa]
Length=447

 Score =   306 bits (783),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 173/422 (41%), Positives = 238/422 (56%), Gaps = 16/422 (4%)
 Frame = -1

Query  1426  SASIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA--  1265
             + +I  L C CF  ++ F  L  L   + +R+   S  V+   D+GAKGDG+++D+QA  
Sbjct  13    TTTIRVLICACFVCVQGFDSLLQLPQSAPARIRPSSKRVLVVGDFGAKGDGLSNDTQACH  72

Query  1264  ----FLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  1097
                 F  AW+ ACS        +++IPAG  FLV PV F GPCKS+ +   +SGT+VAP 
Sbjct  73    HYTAFKEAWEMACS---FRGRTRIVIPAGYNFLVHPVDFGGPCKSK-VTLDISGTIVAPE  128

Query  1096  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMK  917
              P  W GL+  +WL F+GV  L V GGG ++G+G  WW QSC+ +     C + APTA+ 
Sbjct  129   DPAAWKGLNHRKWLYFHGVKHLTVEGGGTVNGRGWLWWAQSCKIN-KTNPCRN-APTAIT  186

Query  916   FMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVIT  737
             F  C +  + N+  V   + HV    C      NL V SP  SPNTDG+HI AS  V I 
Sbjct  187   FHKCKDLKVENLKVVCGQKMHVAFTNCLRVMTFNLIVTSPAVSPNTDGIHISASHGVKIK  246

Query  736   HSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGT  557
              S +  GDDCISI   ++ ++I N+ CGPGHGIS+GSLGKS +   V ++ +  +    T
Sbjct  247   DSVVRTGDDCISIVSNSSRIKIRNIACGPGHGISIGSLGKSNSSSLVRDVMVDGAFLSNT  306

Query  556   TNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVF  377
              NG RIKTWQ G G A NITF+N+ + +V NPIIIDQ YC     C  Q + V++ ++ F
Sbjct  307   DNGVRIKTWQGGGGNATNITFQNIFMENVSNPIIIDQYYCDAHVPCANQTSAVKVENISF  366

Query  376   QRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPGP  197
             +RI GT+ TE AI   CS  +PC G+ L+ + +         + C          V P P
Sbjct  367   RRIKGTSATEEAIKFACSDDLPCKGLYLEDVQLLSLTGGTTRSFCWQAYGSSRGLVHPSP  426

Query  196   CL  191
             C 
Sbjct  427   CF  428



>gb|KGN58587.1| hypothetical protein Csa_3G690840 [Cucumis sativus]
Length=448

 Score =   306 bits (783),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 225/371 (61%), Gaps = 8/371 (2%)
 Frame = -1

Query  1333  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  1154
             S K  NV D+GAKG+G  DD++AF  AWK+ACSS    +   +++P G T+ +KP+ F+G
Sbjct  77    STKVVNVDDFGAKGNGQ-DDTKAFELAWKEACSS----RKATLLVPKGRTYYLKPIIFSG  131

Query  1153  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQS  974
             PC+S  +   ++G + A      +       WL F+ V   +V G G+I+G G+KWW  S
Sbjct  132   PCRSP-LTLKINGMIKASTRISDYENDGRRHWLKFHEVDNFVVEGNGIINGNGRKWWQNS  190

Query  973   CRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPG  794
             C+ +  +      APTA+ F  CIN  +SN+ F  + Q H+    C      NL V +PG
Sbjct  191   CKVNKGLP--CKRAPTAVTFYQCINLVVSNLMFKDAQQMHLTFQKCTNVKALNLRVVAPG  248

Query  793   DSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKS  614
             +SPNTDG+HI  +++ +I +  I  GDDCISI   + +V+  ++ CGPGHGIS+GSLG  
Sbjct  249   NSPNTDGIHITETQNAIIRNCVIGTGDDCISIVSGSRNVQAMDITCGPGHGISIGSLGAD  308

Query  613   GNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCS  434
              +  +V NI ++ +   GT+NG RIKTWQ G GYA+NI F+N+ + +V NPIIIDQNYC 
Sbjct  309   NSEAEVSNIRVNRALISGTSNGVRIKTWQGGSGYAKNIMFQNVVMRNVSNPIIIDQNYCD  368

Query  433   YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVP  254
                +C EQ + V++S+VV++ I GT+ +  AI  +CSK+ PC GI L  I I  Q     
Sbjct  369   KKESCPEQKSAVKVSNVVYKNIRGTSASGDAIKFDCSKSFPCQGISLLGIRIVGQGNEEA  428

Query  253   VAACCSNAHGE  221
             V A C N   E
Sbjct  429   VTASCENVRWE  439



>ref|XP_010250040.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=450

 Score =   306 bits (783),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 160/375 (43%), Positives = 223/375 (59%), Gaps = 6/375 (2%)
 Frame = -1

Query  1318  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  1139
             +V D+GAKGDG+TDDSQAF +AW  ACS   +   P++ +PAG T+LV P  F+GPC+S 
Sbjct  53    SVKDFGAKGDGLTDDSQAFTDAWTFACS---LPYRPRLEVPAGRTYLVGPTDFSGPCRSS  109

Query  1138  HIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHP  959
              +   VSG + AP +P  W G    +WL F  +    V GGG I+G GK+WW +SC+   
Sbjct  110   -LTLRVSGNITAPKNPASWKGFSRRRWLYFYRLNRFTVEGGGTINGMGKEWWARSCKI--  166

Query  958   NMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNT  779
             N       APTA+ F  C N  + ++  V+S Q H+     +    + L V +P +SPNT
Sbjct  167   NATYPCRHAPTAITFRRCKNLKVQHLIIVNSQQMHMAFSKSHWVMASYLQVIAPRESPNT  226

Query  778   DGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQ  599
             DG+HI AS HVVI +S I  GDDC+SI   ++ +++ N+ CGPGHGIS+GSLGKS +   
Sbjct  227   DGIHISASTHVVIKYSVIKTGDDCVSIVSNSSMIQVRNIYCGPGHGISIGSLGKSNSLDS  286

Query  598   VENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTC  419
             V ++ +  +    T NG RIKTWQ G G+A++ITF+++Q+ +V NPIIIDQ YC  P  C
Sbjct  287   VSHVLVDGAIISNTENGLRIKTWQGGHGFAKDITFQSVQMENVSNPIIIDQYYCDSPLPC  346

Query  418   KEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAACC  239
               Q + VQ+ +V +  I GT+ T  AI   CS   PC  I L++I +   +  +    C 
Sbjct  347   PNQTSAVQVVNVSYVGIKGTSATGEAIRFACSDTFPCKKIYLENIHLRSYLGELTRTFCW  406

Query  238   SNAHGEETSVEPGPC  194
                     SV P PC
Sbjct  407   KARGSSYGSVCPPPC  421



>ref|XP_004504535.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=399

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/400 (41%), Positives = 233/400 (58%), Gaps = 19/400 (5%)
 Frame = -1

Query  1375  VFLFILGLISSSRVSCKS-----FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             +++ ++ +I+S  +  +      FNV+ YGA GDG TDD+ AFL AW+D C +  V   P
Sbjct  4     LYVLLMFVIASRSLCARETPTPFFNVLSYGAIGDGQTDDTNAFLEAWQDVCGT--VDGIP  61

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN--GLDTSQWLSFNGVY  1037
              + IP G TF+++P+ F GPCKS +I   + G ++AP S   W     + + W+ F  + 
Sbjct  62    TLFIPRGKTFMLQPLLFQGPCKSAYIMIALKGIIIAPHSVEAWKWPNNERTAWIQFWQIS  121

Query  1036  GLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDL-APTAMKFMFCINTTLSNIHFVSSPQ  860
             GL + GGG  +GQG  WW +         G  ++  PTA+ F  C N  L  +  + SP+
Sbjct  122   GLNIYGGGTFNGQGAPWWSKYL-------GSEEINRPTALVFSGCENLQLHRLTHIDSPR  174

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
              H+ +  CNG  I+ L + +P  S NTDG+ I  S +++I +S I  GDDC++I   ++ 
Sbjct  175   NHISIGSCNGIIISKLNIIAPETSHNTDGIDIAHSSNILIRNSNIQTGDDCVAINSGSSF  234

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             + I  V CGPGHGISVGSLG+ G +  VE IH+ N TF GT NGARIKTW+ G GYAR I
Sbjct  235   INITGVFCGPGHGISVGSLGRGGEYAMVEEIHVRNCTFNGTQNGARIKTWKGGSGYARKI  294

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNC-S  323
             T+E++++    NP+IIDQ+Y     +     T V++SDV F++  GT+  E AI LNC S
Sbjct  295   TYEDIEIVGAYNPLIIDQHYHPNGKSESTSSTAVEVSDVTFRKFRGTSAQENAIQLNCDS  354

Query  322   KAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEP  203
               + C  I LD I+IT  +      A C+NAH    S  P
Sbjct  355   NNIGCTNIVLDDINIT-NVAGGTTKASCTNAHATSISCHP  393



>gb|KGN53196.1| hypothetical protein Csa_4G025750 [Cucumis sativus]
Length=393

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 248/403 (62%), Gaps = 17/403 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  1211
             +   +FL+ + ++SS  V   S FNV+DYGA G+G TDDS+AFL AW D C +T   +SP
Sbjct  4     LSAAIFLYSIAILSSWTVLGSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT--EESP  61

Query  1210  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  1031
              + +P G T+L+ P++F GPCKS+ +     GT++AP +   W      QW+ F  + GL
Sbjct  62    TLHVPDGKTYLLNPLKFQGPCKSKQL----GGTLMAP-TKDEWISDGKGQWIQFFDIEGL  116

Query  1030  IVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHV  851
              + GGG  DGQG  WW + C DH + +      PTA+ F  C    +  +  ++S + H+
Sbjct  117   NLQGGGRFDGQGSLWW-KDC-DHKHCK-----RPTALFFHNCNGLQMKGMKHINSAKNHI  169

Query  850   QLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEI  671
              + +C+    ++L + +P DSPNTDG+ I  S ++ I  S ++ GDDCI+I + ++++ I
Sbjct  170   SINMCHDVIFSHLHISAPEDSPNTDGIDISESTNIFIEDSFMATGDDCIAINNGSSNINI  229

Query  670   NNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFE  491
             N + CGPGHGIS+GSLGK G +  VEN+H+SN     T NG RIKTW+ G GYA+NITFE
Sbjct  230   NGITCGPGHGISIGSLGKDGEYNVVENVHVSNCLLRSTQNGIRIKTWEGGYGYAKNITFE  289

Query  490   NLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVP  311
              + + +  NPIIIDQ Y SY  + K +G  +++SDV ++ +NGT+  E AI+ NCS+A  
Sbjct  290   KITMKNAKNPIIIDQYYSSYAYSRKMKGMDIKVSDVTYREVNGTSANEDAITFNCSQA-R  348

Query  310   CLGIKLDSIDITPQIPSVPVAACCSNAHGEETS-VEPGPCLKQ  185
             C  I LD+++I    P     A C NA G+  S V P  CL +
Sbjct  349   CSNIILDNVNIKMTNPGEKAKAVCQNADGKVLSAVPPVSCLSK  391



>ref|XP_006367078.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=394

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 226/372 (61%), Gaps = 16/372 (4%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  1208
             + +FV L +  LI S+      FNV+DYGA GDG+TD + AF+  W+  C+++    SP 
Sbjct  8     ISIFVALLLPSLIFSAP-DFPVFNVVDYGAVGDGLTDATNAFIKTWEATCTAS--FTSPT  64

Query  1207  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYG  1034
             + +P+ +TFL+ P++  GPC S  +   ++G + AP  P  W   D    +W+ F    G
Sbjct  65    MYVPSENTFLLHPIKLEGPCVSAGVTVEINGNITAPREPSRWRCYDNRCDKWIHFKHANG  124

Query  1033  LIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAH  854
             L V G G I+G+G KWW+ + R          L PTA +     N +L+ + F+ SP+ H
Sbjct  125   LTVRGNGTINGRGHKWWNVNDR----------LRPTAFEISHSENISLTGLSFMDSPRMH  174

Query  853   VQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVE  674
             +         + N+T+ SPG+SPNTDG+H+  S+ V I + +I  GDDCISI D  + + 
Sbjct  175   IHFEKSKSARVTNITIDSPGESPNTDGIHVSGSRDVFIDYCQIGTGDDCISIVDGCSHLN  234

Query  673   INNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITF  494
             I+N+ CGPGHGIS+GSLGK G+   VENI +S+  F  +TNGARIKTWQ G+G+A NI F
Sbjct  235   ISNIICGPGHGISIGSLGKHGSNDNVENIFVSDVLFVNSTNGARIKTWQGGKGHASNIIF  294

Query  493   ENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
             E L   +  NPIIIDQ YC     C E  + VQ+S+V F+ ++GT+  E A+ L CS ++
Sbjct  295   ERLWTQNSYNPIIIDQFYCDGE-HCTEHDSAVQVSNVTFRHVHGTSQGEFAVKLGCSASI  353

Query  313   PCLGIKLDSIDI  278
             PC GI L+ IDI
Sbjct  354   PCTGIVLEDIDI  365



>ref|XP_006407776.1| hypothetical protein EUTSA_v10020758mg [Eutrema salsugineum]
 gb|ESQ49229.1| hypothetical protein EUTSA_v10020758mg [Eutrema salsugineum]
Length=437

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 227/369 (62%), Gaps = 8/369 (2%)
 Frame = -1

Query  1339  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  1160
             R S ++FNV  +GAK +G  DDSQAF+ AW+ ACSST    +  V++P    +++KPV+F
Sbjct  63    RSSPRAFNVNTFGAKANG-NDDSQAFMKAWEAACSST---GTVYVVVPKNRAYILKPVKF  118

Query  1159  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWD  980
             +GPCKS  I F + G + A   P  +   +   W+ F  V  L V GGG IDG G  WW 
Sbjct  119   SGPCKSSLIVFKIYGKIEAWSDPSDYK--ERRHWIVFETVNNLRVEGGGRIDGNGNIWWP  176

Query  979   QSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQS  800
             +SC+ +P +  C   APTA+ F+ C N  +SNI   ++ Q H+    C       L V S
Sbjct  177   KSCKINPQLP-CLG-APTAVTFVECKNLMVSNIRLENAQQMHMTFQDCENVKALRLMVTS  234

Query  799   PGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLG  620
             PGDSPNTDG+H+  +++++I  S I  GDDCISI   + +V    + CGPGHGIS+GSLG
Sbjct  235   PGDSPNTDGLHVTGTRNILIQDSIIRTGDDCISIVSGSENVRATGITCGPGHGISIGSLG  294

Query  619   KSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNY  440
             +  +   V N+ ++ +T  GTTNG RIKTWQ G G A+NI F+++ + +V NPIII+Q+Y
Sbjct  295   EDNSEAYVSNVVVNKATLIGTTNGVRIKTWQGGHGMAKNIIFQDIIMKNVTNPIIINQDY  354

Query  439   CSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPS  260
             C    +C EQ + VQ+S+V+++ I GT++   A+   CSK++PC GI + ++ +  Q   
Sbjct  355   CDRVESCPEQKSAVQVSNVLYKNIQGTSSRPVAVKFECSKSIPCRGISMQNVRLVDQTQR  414

Query  259   VPVAACCSN  233
                 A CSN
Sbjct  415   DVSKASCSN  423



>ref|XP_010537985.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010537986.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Tarenaya 
hassleriana]
Length=446

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/386 (41%), Positives = 237/386 (61%), Gaps = 12/386 (3%)
 Frame = -1

Query  1432  ILSASIFALYCCFYSMEVFVFLFILGLISS--SRVSCKSFNVI-DYGAKGDGMTDDSQAF  1262
             +LS  IF+      + E F  L  L    S  +R  C+   ++ D+GAKGDG  DD+ AF
Sbjct  19    LLSVLIFSEA---VTAEAFESLLELPRSGSRPTRSKCRRVLLVSDFGAKGDGYNDDTGAF  75

Query  1261  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  1082
             ++AWK ACSST      ++++P   T LV+PV F+GPCK++ +   VSGT++AP  P  W
Sbjct  76    VDAWKRACSSTV---KTRILVPENYTCLVRPVDFSGPCKAK-LTLQVSGTIIAPKDPSAW  131

Query  1081  NGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCI  902
              GL+  +WL F GV  L V GGG ++G G++WW +SC+ + + + C   APTA+ F  C 
Sbjct  132   EGLNPRKWLYFRGVNHLTVEGGGAVNGMGQEWWRRSCKVNES-KPCRG-APTALTFHKCK  189

Query  901   NTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKIS  722
             +  + ++    S Q H+    C    +++L V +PG SPNTDG+H+  S+ VV+ ++ + 
Sbjct  190   DLRVRDLKVEDSQQMHMAFTSCYRVTLSDLKVIAPGSSPNTDGIHVSGSRGVVVKNALVR  249

Query  721   CGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGAR  542
              GDDC+SI + ++ + I+N+ CGPGHGIS+GSLGKS ++VQVE++ +  +    T NG R
Sbjct  250   TGDDCVSIVNNSSKISISNIVCGPGHGISIGSLGKSESWVQVEDVIVDTAYLSDTENGVR  309

Query  541   IKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRING  362
             IKTWQ G G    ITF+N+ + +V NPIIIDQ YC     C  Q + V + ++ F  I G
Sbjct  310   IKTWQGGHGSVSRITFQNIFMKNVSNPIIIDQYYCDSKKPCVNQTSAVNVENISFIHIRG  369

Query  361   TATTEAAISLNCSKAVPCLGIKLDSI  284
             T+ TE A++ +CS   PC  I ++ I
Sbjct  370   TSATEEAVTFSCSDDSPCRKIVMEDI  395



>ref|XP_008385626.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=403

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 231/379 (61%), Gaps = 10/379 (3%)
 Frame = -1

Query  1324  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  1145
             +FNVIDYGA G+G  DDS AFL AW   C ST       +++P   TFL+  V F GPC+
Sbjct  32    TFNVIDYGAVGNGQADDSIAFLKAWGALCVST-TRGIATLVVPKSKTFLLNSVAFQGPCR  90

Query  1144  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCRD  965
             S +I+F + G+++AP +   W   D  +W+ F  V GL++NGGG IDG G  WW      
Sbjct  91    SSNINFQIQGSIIAPNNIGAWKNKD--KWIQFANVPGLMINGGGRIDGNGAGWWKLCGNK  148

Query  964   HPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDSP  785
               + +      PT++    C    LS + F++SP+ H+ +  CNG  +  L + +P +SP
Sbjct  149   KSHCQ-----RPTSLHIHKCDGFLLSRLTFLNSPKNHISINSCNGGRVFGLLISAPKESP  203

Query  784   NTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGNF  605
             NTDG+ I +S  + I +S I+ GDDCI+I   ++ ++IN V+CGPGHGIS+GSLG++G  
Sbjct  204   NTDGIDISSSTKLTIHNSLIATGDDCIAINSGSSFIKINGVKCGPGHGISIGSLGQNGEH  263

Query  604   VQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYPG  425
               VE I +SN +F GT NG RIKTW+ G GYAR ITFE +    ++NPIIIDQ+Y + P 
Sbjct  264   SAVEEIQVSNCSFRGTQNGMRIKTWEGGSGYARKITFEGITFTDIENPIIIDQHYFANPT  323

Query  424   TCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVAA  245
             +  +    VQ+SDV F+ I G++    AI+L+C +   C  I +D+++I   +P+  V A
Sbjct  324   SVMDINKCVQVSDVTFRNIAGSSGVSQAITLDCGQNC-CTNIIMDNVNIRSGVPNKDVYA  382

Query  244   CCSNAHGEETSVEPG-PCL  191
              C+NA G  +   P  PCL
Sbjct  383   YCNNAQGTSSFSTPYVPCL  401



>ref|XP_004486687.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X2 [Cicer arietinum]
Length=443

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 225/380 (59%), Gaps = 11/380 (3%)
 Frame = -1

Query  1327  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  1148
             + F + D+GAKGDG  +D++AFL  WK ACS   +     VI P G  FLV P+   GPC
Sbjct  52    RVFPITDFGAKGDGFHNDTKAFLEVWKIACS---LSGFVNVIFPYGKNFLVYPIDIGGPC  108

Query  1147  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQGKKWWDQSCR  968
             +S+ I   + GT+VAP +P  W GL+  +W+ F+GV  L ++GGG +DG+G++WW +SC+
Sbjct  109   RSK-ITLRILGTIVAPRNPEAWRGLNKRKWIYFHGVNHLSIDGGGTLDGKGQEWWSRSCK  167

Query  967   DHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNINNLTVQSPGDS  788
                N       APTAM F  C N  + N+  ++S Q H+    C     +NL V +P  S
Sbjct  168   --INSTNPCQHAPTAMTFHKCKNLKVRNLMLLNSQQMHMAFTSCMRVVASNLKVLAPASS  225

Query  787   PNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGISVGSLGKSGN  608
             PNTDG+HI A+K V +  S I  GDDCISI   ++ + I N+ CGPGHGIS   LGKS  
Sbjct  226   PNTDGIHISATKGVEVRDSLIRTGDDCISIVRNSSRILIRNISCGPGHGIS---LGKSKA  282

Query  607   FVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPIIIDQNYCSYP  428
             + +++N+++  +  Y T NG RIKTWQ G G+A  ITF+N+ +++V NPIIIDQ YC   
Sbjct  283   WEKIQNVNVDGAYLYNTDNGLRIKTWQGGSGFASKITFKNILMYNVSNPIIIDQYYCDSR  342

Query  427   GTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDITPQIPSVPVA  248
               C+ Q + VQ+ ++ F  I GT+ T+ AI   CS A PC G+ L++I   P        
Sbjct  343   NPCENQTSAVQVENISFINIKGTSATKEAIKFACSDASPCEGLYLENI-FLPSCLGGNTR  401

Query  247   ACCSNAHGEETS-VEPGPCL  191
             + C  AHG     + P  C 
Sbjct  402   SYCWQAHGSAQGFMYPSACF  421



>ref|XP_008337131.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=423

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/404 (40%), Positives = 234/404 (58%), Gaps = 16/404 (4%)
 Frame = -1

Query  1390  SMEVFVFL--FILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST-PVH  1220
             S+ +++ L  F+ G +  +R +   FNV+DYGA  DG  DDS+AFL AWK+ C +    +
Sbjct  14    SLMLYIALTSFVFGAVDETRSNI--FNVLDYGAFADGQHDDSEAFLKAWKELCEAEGSYY  71

Query  1219  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  1040
               P + IP G TF +KPV F GPCKS+ +     GT++AP    GW G   + WL F+ V
Sbjct  72    GLPMLEIPCGKTFKLKPVHFQGPCKSRSVQIKFFGTIIAPAYISGWTGCVGNSWLLFSNV  131

Query  1039  YGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQ  860
               L++NG G IDGQG+ WW +  ++H   +        A++   C N  L  +  V+SP+
Sbjct  132   DNLMINGSGKIDGQGENWWHKP-KEHQKHK--------ALRLSNCSNLHLRGLTHVNSPR  182

Query  859   AHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTND  680
             +H+ +       + NL + +P  SPNTDG+H+ +SK+V I  S I+ GDDCI+I    + 
Sbjct  183   SHIYISNSENVTLTNLNITAPESSPNTDGIHLSSSKNVSIHESTIATGDDCIAIKRNCSK  242

Query  679   VEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNI  500
             + I  + CGPGHGISVGSLG  G +  VE + + N TF  +  GARIKTWQ G GYARNI
Sbjct  243   INIKGIMCGPGHGISVGSLGAQGAYETVEEVFVGNCTFTESMYGARIKTWQGGSGYARNI  302

Query  499   TFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSK  320
              F+++ +    NPIIIDQ YC+    CK     V +S+V +  + GT+  + AI+L C+ 
Sbjct  303   HFQHIHLREAKNPIIIDQFYCNGRHDCKNSTEAVSVSNVTYFGVRGTSARKDAITLKCA-  361

Query  319   AVPCLGIKLDSIDITPQIPSVPVAACCSNAHGEETSVEPG-PCL  191
             +  C  I ++ I+I+       V+A C NA G  +   P  PCL
Sbjct  362   STNCTNISMNKINISSWDYGSEVSAYCLNAKGTSSCTTPTVPCL  405



>emb|CDP18643.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 232/374 (62%), Gaps = 9/374 (2%)
 Frame = -1

Query  1357  GLISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGST  1184
             GL   SR+  S +  NV  +GAKG+G  DDS AF +AW++AC ST    +  +++  G  
Sbjct  70    GLTKLSRLESSGRIINVDRFGAKGNGAEDDSNAFQSAWREACLSTV---AVTLVVSQGKD  126

Query  1183  FLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVID  1004
             +L+KPV+F+GPCKS+ I   ++G ++A      + G D  QW+ F+ V GLIV GGGVI+
Sbjct  127   YLLKPVKFSGPCKSE-ITVQINGVLLASDDRSDY-GRDGRQWIRFDSVQGLIVEGGGVIN  184

Query  1003  GQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFN  824
             G+G  WW  SC+ +  +  C D APTA+ F  C N  + N+ F  + Q H+    C    
Sbjct  185   GRGNIWWQNSCKINKALP-CKD-APTAVIFYNCKNLVVQNLRFQDAQQIHMAFEKCINVQ  242

Query  823   INNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGH  644
              +NL V +P +SPNTDG+H+  ++++ I+   I  GDDCISI   + +V+  ++ CGPGH
Sbjct  243   ASNLIVTAPEESPNTDGIHVTNTQNIQISGCTIGTGDDCISIVSGSQNVQATDITCGPGH  302

Query  643   GISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDN  464
             GIS+GSLG   +   V ++ +  +   GTTNG RIKTWQ   G   NI F+N+QV  V N
Sbjct  303   GISIGSLGSENSEAHVSDVTVHGARLSGTTNGVRIKTWQGAAGSVSNIKFQNIQVHDVQN  362

Query  463   PIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSI  284
             PIIIDQNYC     C +Q T +QIS+V++Q I GT+ + AAI+LNCSK+ PC GI L ++
Sbjct  363   PIIIDQNYCDQATPCTQQHTAIQISNVLYQNIYGTSASAAAINLNCSKSFPCRGIVLQNV  422

Query  283   DITPQIPSVPVAAC  242
             ++  +      A+C
Sbjct  423   NLVGEGGGAAKASC  436



>ref|XP_002277214.2| PREDICTED: polygalacturonase isoform X1 [Vitis vinifera]
 emb|CBI29907.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 229/386 (59%), Gaps = 9/386 (2%)
 Frame = -1

Query  1360  LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  1181
             +G +  S  S K+ +V DYGAKGDG +D ++AF  AW+ ACSS    +   +++P    +
Sbjct  63    IGKVGRSLASVKTVSVNDYGAKGDG-SDATEAFKKAWEAACSS----QGSVLVVPKNKNY  117

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             L+KP+ F GPCKS  I   + GTV A      ++  D ++WL F  V  L V GGG I+G
Sbjct  118   LLKPITFEGPCKS-SITVQIYGTVQASADRSAYSN-DMTRWLVFENVQNLAVQGGGTING  175

Query  1000  QGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNI  821
              GK WW+ SC+ + ++  C D APTA+ F  C N  + N+   ++ Q HV    C G   
Sbjct  176   NGKTWWENSCKVNDDLS-CKD-APTALTFYNCKNLVVKNLKIQNAQQMHVSFEKCVGVQA  233

Query  820   NNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHG  641
             + LTV +PGDSPNTDG+H+  ++++ I+ S I  GDDCISI   T +++   + CGPGHG
Sbjct  234   SGLTVTAPGDSPNTDGIHVTDTQNIQISSSVIGTGDDCISIVSGTQNLQATGITCGPGHG  293

Query  640   ISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNP  461
             IS+GSLG   +   V +I ++ +T  GTTNG RIKTW  G G A NI F+N+++ +V NP
Sbjct  294   ISIGSLGSGNSEAHVSDITVNGATLSGTTNGVRIKTWPGGSGSASNIKFQNIEMHNVKNP  353

Query  460   IIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSID  281
             IIIDQ YC     CK Q   VQ+ +V++Q I GT+++  AI L+CS   PC GI L  ID
Sbjct  354   IIIDQKYCDGDKPCKSQSRAVQVQNVLYQNIKGTSSSSEAIQLDCSDKFPCQGIVLQDID  413

Query  280   ITPQIPSVPVAACCSNAHGEETSVEP  203
             I         A C +    E+  V P
Sbjct  414   IEIGGGKAAQAVCNNAKVTEKGDVSP  439



>gb|KDP37111.1| hypothetical protein JCGZ_06167 [Jatropha curcas]
Length=445

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/389 (42%), Positives = 229/389 (59%), Gaps = 7/389 (2%)
 Frame = -1

Query  1354  LISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             L++++R   K  F V D+GAKGDG ++D++AF++AW+ ACS        ++IIPAG  FL
Sbjct  44    LLANTRPRSKRVFFVGDFGAKGDGFSNDTKAFIDAWRMACSCP---ARTRIIIPAGFIFL  100

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             V PV   GPCKS+ I  I+SGT+ AP  P  W GL+  +WL F+GV  L ++GGG I+G 
Sbjct  101   VHPVDLAGPCKSR-ITLIISGTITAPKDPAHWKGLNPRKWLYFHGVNHLTIDGGGTINGM  159

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G+ WW +SC+ +P +  C   APTA+ F  C N  + N+  V   Q H+    C      
Sbjct  160   GRGWWARSCKINP-VYPCRH-APTAITFHKCKNLKVRNLSVVHGQQMHISFTNCIRVMAF  217

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             +L V SP  SPNTDG+HI AS+ V +  S +  GDDCISI   ++ ++I N  CGPGHGI
Sbjct  218   HLVVISPSFSPNTDGIHISASRGVEVRDSIVRTGDDCISIVSNSSRIKIKNFACGPGHGI  277

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLGK  +  +V +I +  +    T NG RIKTWQ G G A  I F+N+ + +V NPI
Sbjct  278   SIGSLGKYNSSSRVYDIMVDGAFLSNTDNGVRIKTWQGGSGNATEIRFQNVFMENVSNPI  337

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             IIDQ YC  P +C  Q + V+++++ F  I GT+ TE AI   CS   PC G+ L+ I +
Sbjct  338   IIDQYYCDSPISCANQTSAVKVANISFVHIKGTSATENAIKFACSDYSPCEGLYLEDIQL  397

Query  277   TPQIPSVPVAACCSNAHGEETSVEPGPCL  191
                   +  + C          V P PC 
Sbjct  398   VSHTGDISKSFCWEAYGSSLDPVYPPPCF  426



>gb|ACN40008.1| unknown [Picea sitchensis]
Length=440

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 240/393 (61%), Gaps = 24/393 (6%)
 Frame = -1

Query  1354  LISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  1181
             LI SS +  S   F+V  YGAKG+G++DDSQAFL AW  AC+S+        ++P G+++
Sbjct  45    LIKSSDLDPSAAVFSVDSYGAKGNGVSDDSQAFLAAWNAACTSS---SDSIFLVPHGNSY  101

Query  1180  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  1001
             LVKP+ FNGPC +  +   +SG +VAP  P  WN  D + WL F+ V GL ++GGG+IDG
Sbjct  102   LVKPISFNGPCNTGSLTAQISGRIVAPADPCNWNPEDRTIWLQFSKVQGLTIHGGGIIDG  161

Query  1000  QGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIH-----FVSSPQAHVQLFVC  836
              G+KWW  SC    N          ++ F F +N++ SN+H     F +S + HV + + 
Sbjct  162   SGEKWWAGSCSRDQNK------VCLSVPFAFVVNSS-SNVHLRDLTFQNSQKFHVVISLS  214

Query  835   NGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQC  656
                 + NL + +PGDSPNTDG+HI  S+HV+I +  I+ GDDC+SI   ++ +++N++ C
Sbjct  215   KHVEVENLQIVAPGDSPNTDGIHIFTSEHVMIRNCTIATGDDCVSIIAQSSHIQVNDIIC  274

Query  655   GPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVF  476
             GPGHGIS+GSLGK      V ++ ++ ++  GT NG RIKTWQ G GYA+ I F+++++ 
Sbjct  275   GPGHGISIGSLGKYNATDTVSDVVVNRASLSGTQNGLRIKTWQGGSGYAQGIIFQHVKMI  334

Query  475   SVDNPIIIDQNYCS------YPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAV  314
             +V NPIIIDQ YC+       P  C  Q + VQ+++V +  I GT+ T+ AI L CS  V
Sbjct  335   NVSNPIIIDQYYCAGSSRCNQPAPCNNQTSAVQVNNVTYTGITGTSATQEAIKLACSATV  394

Query  313   PCLGIKLDSIDITPQIPSVPVAACCSNAHGEET  215
             PC  I L+ I +       P ++  +N  G  T
Sbjct  395   PCTNIVLEDISLQLNNGDTP-SSLSANVQGSST  426



>dbj|BAJ53238.1| JHL06P13.19 [Jatropha curcas]
Length=443

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/389 (42%), Positives = 227/389 (58%), Gaps = 9/389 (2%)
 Frame = -1

Query  1354  LISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  1178
             L++++R   K  F V D+GAKGDG ++D++AF++AW+ ACS        ++IIPAG  FL
Sbjct  44    LLANTRPRSKRVFFVGDFGAKGDGFSNDTKAFIDAWRMACSCP---ARTRIIIPAGFIFL  100

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  998
             V PV   GPCKS+ I  I+SGT+ AP  P  W GL+  +WL F+GV  L ++GGG I+G 
Sbjct  101   VHPVDLAGPCKSR-ITLIISGTITAPKDPAHWKGLNPRKWLYFHGVNHLTIDGGGTINGM  159

Query  997   GKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVCNGFNIN  818
             G+ WW +SC+ +P        APTA+ F  C N  + N+  V   Q H+    C      
Sbjct  160   GRGWWARSCKINPPCRH----APTAITFHKCKNLKVRNLSVVHGQQMHISFTNCIRVMAF  215

Query  817   NLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQCGPGHGI  638
             +L V SP  SPNTDG+HI AS+ V +  S +  GDDCISI   ++ ++I N  CGPGHGI
Sbjct  216   HLVVISPSFSPNTDGIHISASRGVEVRDSIVRTGDDCISIVSNSSRIKIKNFACGPGHGI  275

Query  637   SVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVFSVDNPI  458
             S+GSLGK  +  +V +I +  +    T NG RIKTWQ G G A  I F+N+ + +V NPI
Sbjct  276   SIGSLGKYNSSSRVYDIMVDGAFLSNTDNGVRIKTWQGGSGNATEIRFQNVFMENVSNPI  335

Query  457   IIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIKLDSIDI  278
             IIDQ YC  P +C  Q + V+++++ F  I GT+ TE AI   CS   PC G+ L+ I +
Sbjct  336   IIDQYYCDSPISCANQTSAVKVANISFVHIKGTSATENAIKFACSDYSPCEGLYLEDIQL  395

Query  277   TPQIPSVPVAACCSNAHGEETSVEPGPCL  191
                   +  + C          V P PC 
Sbjct  396   VSHTGDISKSFCWEAYGSSLDPVYPPPCF  424



>emb|CDP14857.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 241/410 (59%), Gaps = 26/410 (6%)
 Frame = -1

Query  1387  MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  1214
             M VF+ +     +  S V  +SF  NV+DYGA GDG  DD+ AF +AW+ AC+STP   S
Sbjct  1     MGVFIPILFAAFVLPSSVVAQSFVYNVLDYGAVGDGYNDDTNAFKHAWEAACTSTPDSSS  60

Query  1213  --PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN--GLDTSQWLSFN  1046
               P + IP+ ++F ++PV F GPC+S  I+  +SG ++AP +P  W   G     W+ F 
Sbjct  61    SAPTMQIPSNTSFFIQPVIFRGPCRSPIINVEISGELLAPVNPTDWRCIGGYCGMWIHFK  120

Query  1045  GVYGLIVNGGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSS  866
              + GL + GGG I G+G+KWW +                 A++     +  +++++F  +
Sbjct  121   SLRGLRLYGGGRIHGRGEKWWQK----------------LALEISDSDDVQITSLNFKDN  164

Query  865   PQAHVQLFVCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFT  686
             P+ H+ L      +++ + + +P DS NTDG+HI  S  V I   KI  GDDC+SI + +
Sbjct  165   PKMHLVLNNIRSVSVSTIHIDAPADSKNTDGIHITGSTDVTIDSCKIGTGDDCVSIVNGS  224

Query  685   NDVEINNVQCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQT-GRGYA  509
              +V + N+ CGPGHGIS+GSLGK G   +VENI++S+  F  T NGARIK+WQ  G+GYA
Sbjct  225   ANVRVTNIFCGPGHGISIGSLGKHGAEDKVENIYVSDVVFRNTENGARIKSWQQGGKGYA  284

Query  508   RNITFENLQVFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLN  329
             RNI +E + +   DNPIIIDQ YC +   CK Q + VQI D+ F+++ GT+  + A+ L+
Sbjct  285   RNIIYERIMLQDADNPIIIDQFYCDHE-KCKTQESAVQIHDITFRQVIGTSKNKVAVKLD  343

Query  328   CSKAVPCLGIKLDSIDITPQIPSVPVAACCSNAHGE-ETSVEPGP-CLKQ  185
             CS+ VPC  I LD I I          + C NAHG  +  + P P CL Q
Sbjct  344   CSETVPCNNIILDDIYILSSEDQSTTTSDCKNAHGTIQGRMAPNPSCLTQ  393



>ref|XP_010663872.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=399

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 233/399 (58%), Gaps = 18/399 (5%)
 Frame = -1

Query  1369  LFILGLISS--SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIP  1196
             LF++ L S   + + C  F+V  YGA G+G TDDS AF+ AW D C+S+    +P   IP
Sbjct  8     LFLVSLFSVLLTPLHCSVFDVTQYGAIGNGSTDDSPAFMLAWTDVCNSSA--STPIFHIP  65

Query  1195  AGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVN  1022
                TFL+ PV F GPC+S +I F + G + A   P  W        +W+ F  V GL +N
Sbjct  66    GNKTFLLNPVFFQGPCRSTNIQFQIDGIITAESEPSNWKCTRNRCDKWIHFKRVDGLFIN  125

Query  1021  GGGVIDGQGKKWWDQSCRDHPNMEGCTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLF  842
             G G+IDG GK WW     +        DL P+A++        L+ + F ++P  HV   
Sbjct  126   GSGIIDGNGKNWWSSGYIN-------ADLRPSALEVTSSNKVQLTGLSFRNNPHMHVVFD  178

Query  841   VCNGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNV  662
              C+  +I+N+++ +PGDSPNTDG+H+  S HV I    I  GDDCISI D  +++ I N+
Sbjct  179   SCDMVHISNVSIDAPGDSPNTDGIHLKESTHVNIEFCSIRTGDDCISIVDKCSNITIQNI  238

Query  661   QCGPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQ  482
             +CGPGHGIS+GS+G+ G +  VENI++S+  F G+ +G RIKTWQ G+G+AR + F+ + 
Sbjct  239   ECGPGHGISIGSMGQYGAYETVENIYVSDVQFKGSLSGVRIKTWQGGKGHARKMVFKGIT  298

Query  481   VFSVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLG  302
               +   PI IDQ YC +   C EQ   V+ISD+ +  I GT+  + A+ L CS++VPC  
Sbjct  299   SLNTQYPIQIDQFYCPH-AKCDEQADAVEISDISYIDIKGTSMRKTAVKLACSESVPCKN  357

Query  301   IKLDSIDITPQIPSVPVAACCSNAHGEETSV-EPG-PCL  191
             I +  I+++ Q      +A C N +G    + EP  PCL
Sbjct  358   IFMQDINLSYQ--GTNASAYCKNVNGTSQGIMEPSVPCL  394



>ref|XP_011024398.1| PREDICTED: probable polygalacturonase At1g80170 [Populus euphratica]
Length=419

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 230/366 (63%), Gaps = 13/366 (4%)
 Frame = -1

Query  1348  SSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDAC--SSTPVHKSPQVIIPAGSTFL  1178
             S S  SC   +NVIDYG  GDG TDD+QAF +AWKD C  SS PV   P + +P+G +FL
Sbjct  23    SRSLRSCNQVYNVIDYGGVGDGDTDDTQAFKDAWKDVCKSSSCPV---PIIQVPSGKSFL  79

Query  1177  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT---SQWLSFNGVYGLIVNGGGVI  1007
             ++P+ FNG CK   I F + GT+ AP  P  W   +     QW++F+ V  L++ G G +
Sbjct  80    LQPLTFNGECKPDQIIFQIDGTMKAPSDPSDWKCQEHRYCKQWITFDEVDNLMIRGSGTM  139

Query  1006  DGQGKKWWDQ--SCRDHPNMEG-CTDLAPTAMKFMFCINTTLSNIHFVSSPQAHVQLFVC  836
             DGQG  WW++  SC+DH + +       PT +      N  L  + F  SPQ HV     
Sbjct  140   DGQGSTWWERHSSCKDHKHRDKRVCGRKPTGLVISHSQNVHLEGLTFKDSPQMHVAFERS  199

Query  835   NGFNINNLTVQSPGDSPNTDGVHIHASKHVVITHSKISCGDDCISIGDFTNDVEINNVQC  656
                + +NLT+Q+PGDSPNTDG+H+  +K++ I +S+I  GDDCISIGD ++ + I ++ C
Sbjct  200   EWVHASNLTIQAPGDSPNTDGIHLQHAKNIFIDYSRIMTGDDCISIGDGSSQINITHIAC  259

Query  655   GPGHGISVGSLGKSGNFVQVENIHISNSTFYGTTNGARIKTWQTGRGYARNITFENLQVF  476
             GPGHGIS+GSLG  G    VE++H+S   F  TTNGARIKTWQ G+G+ARNI FEN++  
Sbjct  260   GPGHGISIGSLGIDGKSETVEDVHVSYVVFTETTNGARIKTWQGGKGFARNIVFENIRSE  319

Query  475   SVDNPIIIDQNYCSYPGTCKEQGTGVQISDVVFQRINGTATTEAAISLNCSKAVPCLGIK  296
                NPIIIDQ YC +   C +  + V+IS + F+ I GT+  + A+ + CS++VPC  I 
Sbjct  320   GARNPIIIDQYYCDHK-HCTDHSSAVKISRIRFENIYGTSHRKPAVHIACSESVPCTDIV  378

Query  295   LDSIDI  278
             L ++ +
Sbjct  379   LSNVHL  384



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3851970174216