BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24450_g1_i2 len=1041 path=[1097:0-70 1168:71-106 1489:107-195
874:196-367 1746:368-372 1356:373-398 1775:399-416 1283:417-443
3476:444-480 1856:481-521 1022:522-595 1096:596-633 3595:634-669
2043:670-711 2084:712-1040]

Length=1041
                                                                      Score     E

gb|KCW84306.1|  hypothetical protein EUGRSUZ_B01156                     306   4e-99   
ref|XP_006489249.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      303   1e-98   
gb|KCW84305.1|  hypothetical protein EUGRSUZ_B01156                     303   2e-98   
ref|XP_009621644.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    303   3e-98   
ref|XP_010035827.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      302   5e-98   
gb|KDO74854.1|  hypothetical protein CISIN_1g026476mg                   301   6e-98   
ref|XP_009784375.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    302   6e-98   
ref|XP_010035817.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      301   2e-97   
ref|XP_006419784.1|  hypothetical protein CICLE_v10005759mg             300   2e-97   
gb|ABR92334.1|  putative dienelactone hydrolase family protein          300   3e-97   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006489248.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    296   6e-96   
gb|KCW84309.1|  hypothetical protein EUGRSUZ_B01156                     296   1e-95   
ref|XP_004229456.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      295   3e-95   
ref|XP_006339416.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      295   3e-95   
ref|XP_011071518.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      295   3e-95   
gb|KDP40089.1|  hypothetical protein JCGZ_02087                         294   5e-95   
ref|XP_002516793.1|  endo-1,3-1,4-beta-d-glucanase, putative            294   8e-95   Ricinus communis
ref|XP_006419787.1|  hypothetical protein CICLE_v10005761mg             293   9e-95   
ref|XP_010262559.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      293   2e-94   
ref|XP_006489247.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    292   3e-94   
ref|XP_010103447.1|  hypothetical protein L484_010049                   291   7e-94   
ref|XP_006419786.1|  hypothetical protein CICLE_v10005765mg             291   8e-94   
ref|XP_006489278.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      290   4e-93   
ref|XP_010103445.1|  hypothetical protein L484_010047                   289   5e-93   
ref|XP_007034580.1|  Alpha/beta-Hydrolases superfamily protein is...    289   6e-93   
ref|XP_010532701.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      288   9e-93   
ref|XP_010695307.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           288   1e-92   
gb|KDP40090.1|  hypothetical protein JCGZ_02088                         288   1e-92   
ref|XP_007034579.1|  Alpha/beta-Hydrolases superfamily protein is...    288   1e-92   
ref|XP_010649854.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      288   2e-92   
ref|XP_009365790.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      288   2e-92   
gb|EYU38138.1|  hypothetical protein MIMGU_mgv1a012798mg                287   2e-92   
ref|XP_004165841.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      287   3e-92   
ref|XP_007154155.1|  hypothetical protein PHAVU_003G095100g             287   4e-92   
ref|XP_010103443.1|  hypothetical protein L484_010045                   286   5e-92   
ref|XP_006358424.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      286   8e-92   
ref|XP_004134157.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      286   9e-92   
ref|XP_007223756.1|  hypothetical protein PRUPE_ppa010552mg             286   9e-92   
ref|XP_004247494.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    285   1e-91   
ref|XP_009102600.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           285   2e-91   
ref|XP_008438729.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    285   2e-91   
ref|XP_006419793.1|  hypothetical protein CICLE_v10005752mg             285   3e-91   
ref|XP_009352129.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      285   3e-91   
ref|XP_008340903.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    285   3e-91   
emb|CDX85115.1|  BnaC07g07910D                                          284   4e-91   
ref|XP_004296954.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      283   1e-90   
emb|CDX77495.1|  BnaA07g06330D                                          283   1e-90   
ref|XP_009621645.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    282   2e-90   
ref|XP_010527418.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      282   2e-90   
ref|XP_008390813.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      282   3e-90   
ref|XP_002312740.1|  dienelactone hydrolase family protein              282   3e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010326630.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    282   3e-90   
emb|CDP20217.1|  unnamed protein product                                281   4e-90   
ref|XP_008368976.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      282   4e-90   
ref|XP_008340902.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    282   4e-90   
ref|XP_009784376.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    281   5e-90   
gb|KCW84308.1|  hypothetical protein EUGRSUZ_B01156                     281   6e-90   
ref|XP_008438728.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      281   8e-90   
ref|XP_008223022.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    281   9e-90   
gb|KCW60882.1|  hypothetical protein EUGRSUZ_H03614                     281   1e-89   
ref|XP_010527420.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      281   1e-89   
ref|XP_002275763.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           280   1e-89   Vitis vinifera
emb|CAN78076.1|  hypothetical protein VITISV_041962                     280   2e-89   Vitis vinifera
ref|XP_004247139.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      280   2e-89   
ref|XP_008353246.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      280   2e-89   
ref|XP_010041171.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      280   2e-89   
ref|XP_004290676.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      280   2e-89   
gb|KHG15388.1|  Endo-1,3(4)-beta-D-glucanase                            280   2e-89   
gb|KFK39652.1|  hypothetical protein AALP_AA3G271900                    280   3e-89   
ref|XP_011010276.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      279   4e-89   
ref|XP_008368364.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      279   4e-89   
emb|CBI32343.3|  unnamed protein product                                279   4e-89   
ref|XP_003550071.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           279   6e-89   
ref|XP_002275697.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      280   7e-89   Vitis vinifera
ref|XP_008802649.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    278   7e-89   
ref|XP_006406009.1|  hypothetical protein EUTSA_v10021427mg             278   8e-89   
ref|XP_008368374.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      278   9e-89   
ref|XP_008234913.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      278   1e-88   
gb|AFJ92670.1|  GLU protein                                             279   1e-88   
ref|XP_008219062.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      278   1e-88   
ref|XP_006406017.1|  hypothetical protein EUTSA_v10021426mg             277   2e-88   
ref|XP_010035807.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    277   3e-88   
ref|XP_010035799.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    277   3e-88   
ref|XP_007200368.1|  hypothetical protein PRUPE_ppa010677mg             277   3e-88   
gb|EPS69745.1|  hypothetical protein M569_05020                         277   3e-88   
ref|XP_009339925.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    276   4e-88   
ref|XP_010527419.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      276   6e-88   
ref|XP_008223021.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    276   7e-88   
ref|XP_009102607.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           276   1e-87   
ref|XP_002524812.1|  endo-1,3-1,4-beta-d-glucanase, putative            275   1e-87   Ricinus communis
ref|XP_011071517.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      276   1e-87   
ref|XP_010466703.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    275   1e-87   
gb|EYU38136.1|  hypothetical protein MIMGU_mgv1a012773mg                275   1e-87   
ref|XP_010909270.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      275   1e-87   
ref|XP_010512613.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      275   1e-87   
emb|CDX85111.1|  BnaC07g07950D                                          275   2e-87   
ref|XP_010103440.1|  hypothetical protein L484_010042                   275   2e-87   
emb|CAN80740.1|  hypothetical protein VITISV_016685                     275   2e-87   Vitis vinifera
gb|KCW84310.1|  hypothetical protein EUGRSUZ_B01156                     274   2e-87   
ref|XP_011071533.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      275   2e-87   
gb|KHN03434.1|  Endo-1,3(4)-beta-D-glucanase                            274   5e-87   
ref|XP_008353277.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      274   5e-87   
ref|XP_010488428.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    273   1e-86   
ref|XP_010938744.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      273   1e-86   
ref|XP_010466706.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      273   1e-86   
ref|XP_009362383.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    273   1e-86   
ref|XP_008352794.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    272   2e-86   
emb|CDX77499.1|  BnaA07g06370D                                          272   2e-86   
ref|XP_010532702.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      272   3e-86   
ref|XP_008802648.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      272   3e-86   
ref|XP_010512630.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    271   3e-86   
ref|XP_002275597.2|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           271   7e-86   Vitis vinifera
ref|XP_002275501.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           271   8e-86   Vitis vinifera
emb|CBI32342.3|  unnamed protein product                                270   1e-85   
emb|CBI32341.3|  unnamed protein product                                270   2e-85   
ref|XP_009339923.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      270   2e-85   
ref|XP_010905246.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      270   3e-85   
ref|NP_566732.1|  alpha/beta-Hydrolases superfamily protein             269   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010038123.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      269   3e-85   
ref|XP_003529605.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      269   3e-85   
ref|XP_010488433.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      269   4e-85   
ref|XP_002885571.1|  dienelactone hydrolase family protein              268   7e-85   
ref|XP_010695954.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    269   7e-85   
gb|AFK41285.1|  unknown                                                 268   8e-85   
ref|XP_008390811.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      268   1e-84   
gb|EEC79184.1|  hypothetical protein OsI_19879                          268   1e-84   Oryza sativa Indica Group [Indian rice]
ref|XP_010466702.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    268   2e-84   
ref|XP_008808248.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    267   2e-84   
gb|ACU19417.1|  unknown                                                 267   3e-84   Glycine max [soybeans]
ref|XP_010035774.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      266   3e-84   
gb|KHN03435.1|  Endo-1,3(4)-beta-D-glucanase                            266   3e-84   
ref|XP_010527412.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           266   6e-84   
ref|XP_002309880.2|  dienelactone hydrolase family protein              265   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_007224354.1|  hypothetical protein PRUPE_ppa020844mg             266   1e-83   
ref|XP_010038125.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      265   1e-83   
ref|XP_011023033.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      265   1e-83   
ref|XP_007034581.1|  Alpha/beta-Hydrolases superfamily protein is...    264   2e-83   
gb|AFK34617.1|  unknown                                                 265   2e-83   
ref|XP_009417917.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    265   2e-83   
emb|CDY09037.1|  BnaC01g30540D                                          265   2e-83   
ref|XP_003568483.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      265   2e-83   
ref|XP_007223790.1|  hypothetical protein PRUPE_ppa010646mg             265   2e-83   
gb|AAN65058.1|  Unknown protein                                         264   3e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566731.1|  alpha/beta-Hydrolases superfamily protein             264   3e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242164.1|  uncharacterized protein LOC100801095               264   4e-83   
ref|XP_002883437.1|  hydrolase                                          264   4e-83   
ref|XP_006361507.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    264   5e-83   
ref|XP_004508363.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   6e-83   
ref|XP_006361508.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    264   6e-83   
ref|XP_006361509.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    263   6e-83   
ref|XP_010488431.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    263   7e-83   
ref|XP_008223023.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   7e-83   
ref|XP_006654368.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   9e-83   
ref|XP_006361506.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    265   1e-82   
ref|XP_009106630.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   1e-82   
ref|XP_006361504.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    265   2e-82   
ref|XP_006419788.1|  hypothetical protein CICLE_v10006994mg             263   2e-82   
ref|NP_001030749.1|  alpha/beta-Hydrolases superfamily protein          262   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362382.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    263   2e-82   
ref|XP_002439762.1|  hypothetical protein SORBIDRAFT_09g019630          262   2e-82   Sorghum bicolor [broomcorn]
gb|KDP40091.1|  hypothetical protein JCGZ_02089                         262   3e-82   
gb|KFK39658.1|  hypothetical protein AALP_AA3G272500                    262   3e-82   
emb|CDO98981.1|  unnamed protein product                                261   3e-82   
ref|XP_004290675.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      262   3e-82   
ref|XP_008352792.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    262   3e-82   
gb|ACU23923.1|  unknown                                                 261   6e-82   Glycine max [soybeans]
ref|XP_009417919.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      261   7e-82   
ref|XP_003529606.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    261   7e-82   
ref|XP_009339924.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    261   9e-82   
ref|XP_009599203.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    260   1e-81   
ref|XP_004962159.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      260   1e-81   
ref|XP_009599202.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    260   2e-81   
ref|XP_006361505.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    261   2e-81   
ref|XP_006850805.1|  hypothetical protein AMTR_s00025p00112220          259   2e-81   
ref|XP_009588353.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      259   3e-81   
ref|XP_010035787.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      259   3e-81   
ref|XP_009788741.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      259   4e-81   
ref|XP_010532693.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      259   4e-81   
ref|XP_008367180.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      258   5e-81   
gb|KCW84301.1|  hypothetical protein EUGRSUZ_B01152                     260   5e-81   
gb|KFK39657.1|  hypothetical protein AALP_AA3G272500                    258   8e-81   
gb|KEH32209.1|  endo-1,3-1,4-beta-D-glucanase-like protein              258   8e-81   
ref|NP_001055474.1|  Os05g0399100                                       259   1e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004296955.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      258   1e-80   
ref|XP_008223025.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      258   1e-80   
ref|XP_009365787.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      257   2e-80   
ref|XP_010532707.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      257   2e-80   
ref|XP_007224824.1|  hypothetical protein PRUPE_ppa023469mg             257   2e-80   
emb|CDY09036.1|  BnaC01g30550D                                          257   2e-80   
gb|AAU10802.1|  putative endo-1,3;1,4-beta-D-glucanase                  257   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010024431.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   3e-80   
ref|XP_010024435.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   3e-80   
ref|XP_009352128.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   3e-80   
gb|KEH32215.1|  endo-1,3-1,4-beta-D-glucanase-like protein              256   3e-80   
gb|AFK33996.1|  unknown                                                 256   3e-80   
gb|KCW60874.1|  hypothetical protein EUGRSUZ_H03607                     259   3e-80   
ref|XP_010024432.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   4e-80   
ref|XP_010024440.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   6e-80   
ref|XP_010024439.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   6e-80   
ref|XP_010101277.1|  hypothetical protein L484_011641                   257   6e-80   
ref|XP_002516791.1|  endo-1,3-1,4-beta-d-glucanase, putative            256   7e-80   Ricinus communis
ref|XP_010024430.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      255   8e-80   
ref|XP_002516792.1|  endo-1,3-1,4-beta-d-glucanase, putative            255   8e-80   Ricinus communis
dbj|BAJ98176.1|  predicted protein                                      255   8e-80   
gb|ACJ85031.1|  unknown                                                 255   1e-79   Medicago truncatula
gb|KEH32211.1|  endo-1,3-1,4-beta-D-glucanase-like protein              257   1e-79   
ref|XP_008340899.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      254   1e-79   
ref|XP_007150409.1|  hypothetical protein PHAVU_005G151000g             254   2e-79   
ref|XP_006654369.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      254   2e-79   
gb|EAY97963.1|  hypothetical protein OsI_19880                          254   2e-79   Oryza sativa Indica Group [Indian rice]
gb|KCW60880.1|  hypothetical protein EUGRSUZ_H03611                     256   6e-79   
ref|XP_006339415.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      253   1e-78   
gb|AFK37956.1|  unknown                                                 253   1e-78   
ref|XP_010327302.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    252   1e-78   
ref|XP_010322752.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      252   1e-78   
ref|XP_008367178.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      251   2e-78   
ref|XP_010327300.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    252   3e-78   
ref|XP_008223020.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      251   3e-78   
ref|NP_001148765.1|  endo-1,3;1,4-beta-D-glucanase                      251   3e-78   Zea mays [maize]
gb|AFK40311.1|  unknown                                                 251   3e-78   
ref|XP_010650032.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      251   5e-78   
ref|XP_007150406.1|  hypothetical protein PHAVU_005G150700g             251   5e-78   
gb|KCW60872.1|  hypothetical protein EUGRSUZ_H03606                     251   6e-78   
ref|XP_010024433.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      250   9e-78   
ref|XP_010551668.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      250   1e-77   
ref|NP_001140497.1|  hypothetical protein                               250   1e-77   Zea mays [maize]
ref|XP_008360320.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      250   1e-77   
ref|XP_009352126.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   1e-77   
gb|ACN40022.1|  unknown                                                 249   2e-77   Picea sitchensis
gb|ABK24087.1|  unknown                                                 249   2e-77   Picea sitchensis
ref|XP_009365788.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   2e-77   
ref|XP_010024428.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   3e-77   
ref|XP_007154161.1|  hypothetical protein PHAVU_003G095400g             249   3e-77   
gb|EYU45608.1|  hypothetical protein MIMGU_mgv1a012169mg                249   4e-77   
ref|XP_011090811.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      248   8e-77   
ref|XP_009417916.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    249   1e-76   
gb|KEH32213.1|  endo-1,3-1,4-beta-D-glucanase-like protein              248   1e-76   
emb|CBI26172.3|  unnamed protein product                                247   2e-76   
ref|XP_006601393.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      247   2e-76   
gb|EYU45607.1|  hypothetical protein MIMGU_mgv1a012169mg                247   2e-76   
ref|XP_009352130.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      246   3e-76   
ref|XP_010103444.1|  hypothetical protein L484_010046                   255   4e-76   
gb|KCW60876.1|  hypothetical protein EUGRSUZ_H03609                     246   6e-76   
ref|XP_003542895.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      245   7e-76   
ref|XP_002439763.1|  hypothetical protein SORBIDRAFT_09g019650          245   9e-76   Sorghum bicolor [broomcorn]
gb|AGV54685.1|  endo-13;14-beta-D-glucanase-like protein                245   1e-75   
gb|ABK22216.1|  unknown                                                 245   1e-75   Picea sitchensis
gb|KHN37559.1|  Endo-1,3(4)-beta-D-glucanase                            245   1e-75   
ref|XP_009365791.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      244   1e-75   
gb|EYU45606.1|  hypothetical protein MIMGU_mgv1a012169mg                244   3e-75   
gb|ABR16847.1|  unknown                                                 243   4e-75   Picea sitchensis
ref|XP_010103439.1|  hypothetical protein L484_010041                   243   6e-75   
ref|XP_007147786.1|  hypothetical protein PHAVU_006G155000g             243   8e-75   
ref|XP_003529603.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           242   1e-74   
ref|XP_006419796.1|  hypothetical protein CICLE_v10005724mg             242   2e-74   
ref|XP_003568487.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      241   3e-74   
gb|EMS62534.1|  Endo-1,3;1,4-beta-D-glucanase                           241   4e-74   
ref|XP_004962158.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      241   5e-74   
gb|EAY97964.1|  hypothetical protein OsI_19881                          239   1e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_003529604.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      239   1e-73   
ref|NP_001148665.1|  LOC100282281                                       239   2e-73   Zea mays [maize]
emb|CDP16397.1|  unnamed protein product                                237   9e-73   
ref|XP_007150408.1|  hypothetical protein PHAVU_005G150900g             236   2e-72   
ref|NP_001055475.1|  Os05g0399200                                       236   2e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007226805.1|  hypothetical protein PRUPE_ppa024774mg             238   5e-72   
ref|XP_003568485.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    235   6e-72   
emb|CDY18109.1|  BnaA01g23700D                                          232   4e-71   
ref|XP_009352125.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      233   5e-71   
gb|KDO38826.1|  hypothetical protein CISIN_1g025027mg                   233   1e-70   
ref|XP_006489279.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      233   1e-70   
ref|XP_009365792.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      231   2e-70   
ref|XP_007154163.1|  hypothetical protein PHAVU_003G095600g             231   3e-70   
ref|XP_006419795.1|  hypothetical protein CICLE_v10005738mg             230   4e-70   
gb|KEH32210.1|  endo-1,3-1,4-beta-D-glucanase-like protein              230   5e-70   
ref|XP_008351228.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      230   5e-70   
ref|XP_008340900.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      230   7e-70   
ref|XP_007150410.1|  hypothetical protein PHAVU_005G151100g             230   9e-70   
ref|XP_010938801.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      229   2e-69   
ref|XP_010103442.1|  hypothetical protein L484_010044                   228   3e-69   
gb|KDO74852.1|  hypothetical protein CISIN_1g0265102mg                  226   3e-69   
gb|KDO74846.1|  hypothetical protein CISIN_1g024721mg                   228   4e-69   
ref|XP_010041172.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      224   3e-68   
ref|XP_003566261.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      227   3e-68   
ref|NP_001132740.1|  uncharacterized protein LOC100194227               225   4e-68   
emb|CDO98982.1|  unnamed protein product                                225   6e-68   
ref|XP_007154156.1|  hypothetical protein PHAVU_003G095100g             219   2e-66   
ref|XP_006406008.1|  hypothetical protein EUTSA_v10021427mg             219   2e-66   
gb|AES64349.2|  endo-1,3-1,4-beta-D-glucanase-like protein              219   6e-66   
ref|XP_010512634.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    218   9e-66   
ref|XP_003594098.1|  Carboxymethylenebutenolidase-like protein          220   1e-65   
gb|ACU23709.1|  unknown                                                 216   5e-65   
ref|XP_010488429.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    216   6e-65   
dbj|BAK05899.1|  predicted protein                                      219   7e-65   
gb|EAY97970.1|  hypothetical protein OsI_19888                          218   1e-64   
gb|ABK24067.1|  unknown                                                 216   1e-64   
ref|XP_006850804.1|  hypothetical protein AMTR_s00025p00111790          214   2e-64   
ref|XP_002441061.1|  hypothetical protein SORBIDRAFT_09g019640          216   2e-64   
gb|EYU38137.1|  hypothetical protein MIMGU_mgv1a012773mg                214   3e-64   
dbj|BAD05237.1|  putative Endo-1,3;1,4-beta-D-glucanase precursor       216   5e-64   
ref|XP_004305461.1|  PREDICTED: carboxymethylenebutenolidase homolog    214   5e-64   
ref|NP_001061323.1|  Os08g0238200                                       216   6e-64   
ref|XP_009599216.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      213   7e-64   
ref|XP_010488432.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    213   1e-63   
ref|XP_008802650.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    212   2e-63   
gb|EMS61726.1|  Endo-1,3;1,4-beta-D-glucanase                           212   3e-63   
gb|AAU10811.1|  putative endo-1,3;1,4-beta-D-glucanase                  213   7e-63   
gb|ADE76752.1|  unknown                                                 212   8e-63   
dbj|BAB02775.1|  unnamed protein product                                211   9e-63   
ref|XP_008370576.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      213   2e-62   
gb|EMT08698.1|  Endo-1,3;1,4-beta-D-glucanase                           209   2e-61   
gb|KEH32214.1|  endo-1,3-1,4-beta-D-glucanase-like protein              205   3e-61   
gb|AFW77924.1|  hypothetical protein ZEAMMB73_089561                    206   5e-61   
ref|XP_004972493.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      207   8e-61   
ref|XP_003573585.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      207   8e-61   
ref|XP_008808249.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    205   9e-61   
ref|XP_008390954.1|  PREDICTED: uncharacterized protein LOC103453179    210   2e-60   
ref|XP_010695962.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    205   2e-60   
gb|EAZ25219.1|  hypothetical protein OsJ_09019                          206   4e-60   
ref|NP_001067684.1|  Os11g0275500                                       206   4e-60   
gb|KEH36746.1|  endo-1,3-1,4-beta-D-glucanase-like protein              204   5e-60   
gb|ABA92618.2|  Endo-1,3;1,4-beta-D-glucanase precursor, putative...    206   5e-60   
ref|XP_002447789.1|  hypothetical protein SORBIDRAFT_06g015650          204   1e-59   
ref|XP_006584060.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    202   1e-59   
ref|NP_001061329.1|  Os08g0239300                                       204   2e-59   
gb|KCW49939.1|  hypothetical protein EUGRSUZ_K03401                     201   2e-59   
ref|XP_006655299.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      204   3e-59   
gb|EEC83150.1|  hypothetical protein OsI_28358                          202   4e-59   
ref|XP_002447792.1|  hypothetical protein SORBIDRAFT_06g015670          202   5e-59   
gb|EMT26818.1|  Endo-1,3;1,4-beta-D-glucanase                           201   6e-59   
ref|XP_002447791.1|  hypothetical protein SORBIDRAFT_06g015660          201   2e-58   
ref|NP_001055479.1|  Os05g0400100                                       201   6e-58   
ref|XP_003573587.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      199   1e-57   
ref|XP_004972492.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      198   2e-57   
ref|XP_004972505.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    197   5e-57   
ref|XP_007034582.1|  Alpha/beta-Hydrolases superfamily protein, p...    195   2e-56   
ref|XP_006659958.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      194   2e-56   
ref|XP_008438730.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    192   7e-56   
ref|NP_001061324.1|  Os08g0238500                                       194   1e-55   
ref|XP_002973848.1|  hypothetical protein SELMODRAFT_173745             192   1e-55   
ref|XP_009799861.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      192   4e-55   
ref|XP_006659959.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      192   4e-55   
gb|AAX92852.1|  Dienelactone hydrolase family, putative                 192   7e-55   
emb|CAN78075.1|  hypothetical protein VITISV_041961                     187   1e-54   
ref|XP_010938802.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      189   3e-54   
ref|NP_001067682.1|  Os11g0275200                                       189   9e-54   
dbj|BAK00071.1|  predicted protein                                      187   2e-53   
ref|XP_004972504.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      187   9e-53   
ref|XP_008340904.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    182   1e-52   
ref|XP_007154157.1|  hypothetical protein PHAVU_003G095100g             182   2e-52   
gb|EAZ06121.1|  hypothetical protein OsI_28357                          186   3e-52   
ref|XP_008678529.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      184   5e-52   
ref|XP_010231396.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    184   5e-52   
ref|XP_002439764.1|  hypothetical protein SORBIDRAFT_09g019670          184   1e-51   
gb|EMT10879.1|  hypothetical protein F775_52638                         184   1e-51   
gb|KHN03436.1|  Endo-1,3(4)-beta-D-glucanase                            180   2e-51   
ref|XP_008678528.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      184   2e-51   
ref|XP_002983153.1|  hypothetical protein SELMODRAFT_179981             180   8e-51   
ref|NP_001067681.2|  Os11g0275000                                       184   1e-50   
gb|EMT30982.1|  Endo-1,3;1,4-beta-D-glucanase                           181   2e-50   
ref|XP_009352313.1|  PREDICTED: uncharacterized AIM2 family prote...    183   3e-50   
ref|XP_002965911.1|  hypothetical protein SELMODRAFT_266933             176   3e-49   
gb|KCW84311.1|  hypothetical protein EUGRSUZ_B01156                     166   2e-46   
ref|XP_008779366.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      165   5e-46   
gb|KCW60878.1|  hypothetical protein EUGRSUZ_H03609                     166   5e-46   
ref|NP_001288380.1|  endo-1,3;1,4-beta-D-glucanase-like precursor       166   5e-45   
gb|EMT26819.1|  Endo-1,3;1,4-beta-D-glucanase                           164   2e-44   
gb|ABK21331.1|  unknown                                                 161   4e-44   
gb|EEE68290.1|  hypothetical protein OsJ_26538                          160   4e-43   
gb|AAX92849.1|  Dienelactone hydrolase family                           158   2e-42   
gb|KDO74845.1|  hypothetical protein CISIN_1g025842mg                   156   2e-42   
ref|XP_004508356.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    156   3e-42   
gb|KCW44571.1|  hypothetical protein EUGRSUZ_L01916                     154   5e-42   
gb|EMS50557.1|  Endo-1,3;1,4-beta-D-glucanase                           155   3e-41   
ref|XP_010532694.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      157   5e-41   
gb|EEE63655.1|  hypothetical protein OsJ_18472                          152   2e-40   
gb|EMS54749.1|  Endo-1,3;1,4-beta-D-glucanase                           150   8e-40   
ref|XP_008390955.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      145   1e-38   
ref|XP_009788743.1|  PREDICTED: LOW QUALITY PROTEIN: carboxymethy...    145   6e-38   
gb|ACJ85204.1|  unknown                                                 143   6e-38   
ref|XP_004974306.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      145   6e-38   
ref|XP_010231398.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    144   1e-37   
gb|KDO74851.1|  hypothetical protein CISIN_1g0314641mg                  141   1e-37   
ref|XP_001762960.1|  predicted protein                                  144   2e-37   
ref|XP_001778568.1|  predicted protein                                  144   3e-37   
ref|XP_009417960.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      140   8e-37   
ref|NP_001061325.1|  Os08g0238600                                       140   1e-36   
ref|XP_010024438.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      137   9e-36   
ref|XP_006355882.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      137   1e-35   
ref|NP_001104915.1|  endo-1,3;1,4-beta-D-glucanase precursor            141   2e-35   
ref|XP_006419792.1|  hypothetical protein CICLE_v10006579mg             135   3e-35   
gb|EMT08699.1|  Endo-1,3;1,4-beta-D-glucanase                           134   1e-34   
gb|KHN03432.1|  Endo-1,3(4)-beta-D-glucanase                            133   5e-34   
ref|NP_001175458.1|  Os08g0239100                                       135   6e-34   
gb|EMT07197.1|  Endo-1,3;1,4-beta-D-glucanase                           135   1e-33   
ref|XP_006589951.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      129   7e-33   
ref|XP_001780729.1|  predicted protein                                  130   2e-32   
gb|AHA61360.1|  hypothetical protein Lr546b_ref                         120   9e-30   
dbj|BAD05244.1|  Endo-1,3;1,4-beta-D-glucanase precursor-like pro...    122   9e-30   
gb|EPS29102.1|  hypothetical protein PDE_04051                          123   3e-29   
gb|AFK48155.1|  unknown                                                 119   5e-29   
gb|EAY97969.1|  hypothetical protein OsI_19887                          121   2e-28   
gb|EKG21151.1|  Dienelactone hydrolase                                  120   3e-28   
ref|XP_002558981.1|  Pc13g05470                                         120   4e-28   
gb|KHN29750.1|  Endo-1,3(4)-beta-D-glucanase                            117   5e-28   
gb|EME45097.1|  hypothetical protein DOTSEDRAFT_52470                   119   2e-27   
gb|EEE61614.1|  hypothetical protein OsJ_16031                          118   2e-27   
gb|KGO72034.1|  Dienelactone hydrolase                                  118   2e-27   
gb|KGO48026.1|  Dienelactone hydrolase                                  117   3e-27   
ref|XP_007582340.1|  putative dienelactone hydrolase family protein     117   3e-27   
ref|XP_007783199.1|  hypothetical protein W97_07379                     117   6e-27   
ref|XP_007805356.1|  hypothetical protein EPUS_06695                    116   8e-27   
ref|XP_003071965.1|  Dienelactone hydrolase family protein              116   1e-26   
gb|EKG17503.1|  Dienelactone hydrolase                                  116   1e-26   
gb|ACN36517.1|  unknown                                                 112   1e-26   
gb|EKV06996.1|  Dienelactone hydrolase family protein                   115   2e-26   
gb|AFW62026.1|  hypothetical protein ZEAMMB73_756786                    113   4e-26   
emb|CDR43330.1|  CYFA0S11e04192g1_1                                     114   6e-26   
ref|XP_007586365.1|  putative dienelactone hydrolase family protein     114   8e-26   
gb|EPT00991.1|  hypothetical protein FOMPIDRAFT_1023529                 113   1e-25   
gb|KCW49936.1|  hypothetical protein EUGRSUZ_K03398                     109   1e-25   
gb|EPS33247.1|  hypothetical protein PDE_08209                          112   2e-25   
ref|XP_009552054.1|  hypothetical protein HETIRDRAFT_390196             112   2e-25   
ref|XP_005809917.1|  PREDICTED: carboxymethylenebutenolidase homolog    112   2e-25   
ref|XP_010763374.1|  hypothetical protein PADG_08034                    112   2e-25   
ref|XP_002714112.1|  PREDICTED: carboxymethylenebutenolidase homolog    112   2e-25   
ref|XP_008296773.1|  PREDICTED: carboxymethylenebutenolidase homolog    112   3e-25   
ref|XP_010039262.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      108   3e-25   
gb|KGO73417.1|  Dienelactone hydrolase                                  112   3e-25   
ref|XP_008777225.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      107   4e-25   
ref|XP_001877120.1|  dienelactone hydrolase endo-1,3,1,4-beta-D-g...    112   5e-25   
gb|EEH16486.1|  hypothetical protein PABG_06573                         111   5e-25   
ref|XP_007547897.1|  PREDICTED: carboxymethylenebutenolidase homolog    111   6e-25   
ref|XP_002791818.1|  dienelactone hydrolase family protein              111   6e-25   
ref|XP_005871109.1|  PREDICTED: carboxymethylenebutenolidase homo...    111   7e-25   
ref|XP_006769521.1|  PREDICTED: carboxymethylenebutenolidase homo...    111   7e-25   
ref|XP_005356731.1|  PREDICTED: carboxymethylenebutenolidase homolog    111   8e-25   
ref|XP_006634660.1|  PREDICTED: carboxymethylenebutenolidase homolog    110   9e-25   
ref|XP_005386170.1|  PREDICTED: carboxymethylenebutenolidase homo...    110   9e-25   
ref|XP_001238942.1|  hypothetical protein CIMG_09964                    110   1e-24   
ref|XP_009882052.1|  PREDICTED: carboxymethylenebutenolidase homolog    110   1e-24   
emb|CCX07018.1|  Similar to Protein AIM2; acc. no. P39721               110   1e-24   
gb|KGU29965.1|  hypothetical protein MGK_03429                          110   2e-24   
dbj|GAD93040.1|  dienelactone hydrolase family protein                  110   2e-24   
ref|XP_722827.1|  hypothetical protein CaO19.12079                      109   2e-24   
gb|KGU26040.1|  hypothetical protein MG7_03415                          109   2e-24   
ref|XP_001817722.2|  dienelactone hydrolase family protein              109   3e-24   
ref|XP_008436851.1|  PREDICTED: carboxymethylenebutenolidase homolog    109   3e-24   
ref|XP_010133699.1|  PREDICTED: carboxymethylenebutenolidase homolog    109   3e-24   
gb|KGQ86435.1|  hypothetical protein MEO_03377                          109   3e-24   
ref|XP_005871107.1|  PREDICTED: carboxymethylenebutenolidase homo...    109   3e-24   
ref|XP_006769524.1|  PREDICTED: carboxymethylenebutenolidase homo...    109   3e-24   
ref|XP_001364031.1|  PREDICTED: carboxymethylenebutenolidase homo...    109   4e-24   
ref|XP_001268328.1|  dienelactone hydrolase family protein              108   4e-24   
ref|XP_002564197.1|  Pc22g01530                                         108   5e-24   
ref|XP_007739569.1|  esterase/lipase                                    108   5e-24   
ref|XP_002150690.1|  dienelactone hydrolase family protein              108   5e-24   
gb|KFX45036.1|  Protein AIM2                                            108   6e-24   
ref|XP_010026993.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      103   7e-24   
ref|XP_001877118.1|  chlorocatechol-degradation protein                 108   7e-24   
ref|XP_005871108.1|  PREDICTED: carboxymethylenebutenolidase homo...    108   7e-24   
ref|XP_006769525.1|  PREDICTED: carboxymethylenebutenolidase homo...    108   8e-24   
ref|XP_009160375.1|  esterase/lipase                                    108   8e-24   
emb|CDM37794.1|  Protein AIM2                                           108   8e-24   
gb|KDQ50688.1|  hypothetical protein JAAARDRAFT_211518                  108   8e-24   
gb|KGU07644.1|  hypothetical protein MEQ_03398                          107   9e-24   
gb|KGU26037.1|  hypothetical protein MG7_03412                          107   9e-24   
ref|XP_003683503.1|  hypothetical protein TDEL_0H04330                  108   9e-24   
gb|ETE71655.1|  Carboxymethylenebutenolidase-like protein               110   1e-23   
ref|XP_451148.1|  hypothetical protein                                  107   1e-23   
gb|KGU29962.1|  hypothetical protein MGK_03426                          107   1e-23   
ref|XP_009470325.1|  PREDICTED: carboxymethylenebutenolidase homolog    107   1e-23   
gb|KGQ97138.1|  hypothetical protein MG1_03433                          107   1e-23   
gb|KGQ90134.1|  hypothetical protein MEU_03421                          107   1e-23   
ref|XP_007924324.1|  hypothetical protein MYCFIDRAFT_61202              107   1e-23   
emb|CCH41404.1|  Carboxymethylenebutenolidase                           107   1e-23   
ref|XP_007730070.1|  esterase/lipase                                    107   1e-23   
gb|KHC35057.1|  hypothetical protein MGO_03401                          107   1e-23   
ref|XP_004625254.1|  PREDICTED: carboxymethylenebutenolidase homolog    107   1e-23   
gb|ABA92619.2|  Endo-1,3;1,4-beta-D-glucanase precursor, putative...    106   1e-23   
ref|XP_002614989.1|  hypothetical protein CLUG_05004                    107   1e-23   
gb|KHC63084.1|  hypothetical protein MGE_03406                          107   1e-23   
gb|KGQ97135.1|  hypothetical protein MG1_03430                          107   2e-23   
ref|XP_007865398.1|  dienelactone hydrolase endo-1,3,1,4-beta-D-g...    107   2e-23   
gb|KGQ90131.1|  hypothetical protein MEU_03418                          107   2e-23   
gb|AAX92845.1|  Dienelactone hydrolase family, putative                 105   2e-23   
ref|XP_003443530.1|  PREDICTED: carboxymethylenebutenolidase homo...    107   2e-23   
ref|XP_008305807.1|  PREDICTED: carboxymethylenebutenolidase homolog    107   2e-23   
ref|XP_004081062.1|  PREDICTED: carboxymethylenebutenolidase homolog    107   2e-23   
ref|XP_006095455.1|  PREDICTED: LOW QUALITY PROTEIN: carboxymethy...    107   2e-23   
ref|XP_005065526.1|  PREDICTED: carboxymethylenebutenolidase homolog    107   2e-23   
emb|CBN81887.1|  Carboxymethylenebutenolidase homolog                   107   2e-23   
ref|XP_007848207.1|  dienelactone hydrolase endo- -beta-d-glucanase     107   2e-23   
emb|CAF97999.1|  unnamed protein product                                107   2e-23   
ref|XP_002483450.1|  dienelactone hydrolase family protein              107   2e-23   
dbj|BAG37783.1|  unnamed protein product                                107   2e-23   
ref|XP_008718327.1|  hypothetical protein HMPREF1541_05768              107   2e-23   
ref|XP_005239799.1|  PREDICTED: carboxymethylenebutenolidase homolog    107   3e-23   
ref|XP_506055.1|  YALI0F30547p                                          106   3e-23   
ref|XP_007677009.1|  hypothetical protein BAUCODRAFT_71902              107   3e-23   
ref|XP_008149879.1|  PREDICTED: carboxymethylenebutenolidase homolog    106   3e-23   



>gb|KCW84306.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=269

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 188/260 (72%), Gaps = 1/260 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    G+G V+QLGGL  YV G  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D   ++ K +I+ LK+ GISK
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FVT+DDI+GVKVPI VLGAE D+ +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH*  781
            +KQFE  L AK+EVD  VKIF  V+HGWT+RY  +D+ AVK AEEAH DM++WF+K ++ 
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFVNV  240

Query  782  VPLHFKKDVDLVLRDIFSVL  841
              +  +    L    +FS L
Sbjct  241  RAISIRPLESLFESTVFSQL  260



>ref|XP_006489249.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Citrus sinensis]
Length=238

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 182/237 (77%), Gaps = 0/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + GAG V++LGGLN YV+G  DSKLA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFYV VPDFFHGDPYV +G KP+  W+KDH VD   ++AK VI+ LK+ GI+ +
Sbjct  61   DKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV L K   ++A VLLHP+FVT+DDI+GV+VP+ +LGAE D  +PP +V
Sbjct  121  GAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALV  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+FE AL A +EVDS VKIF  V HGWTVRY+ +D+ AVK AEEAHQ++L+WF K++
Sbjct  181  KEFEEALNAISEVDSFVKIFPKVAHGWTVRYNVEDESAVKAAEEAHQNLLEWFAKYV  237



>gb|KCW84305.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=247

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 181/239 (76%), Gaps = 1/239 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    G+G V+QLGGL  YV G  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D   ++ K +I+ LK+ GISK
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FVT+DDI+GVKVPI VLGAE D+ +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +KQFE  L AK+EVD  VKIF  V+HGWT+RY  +D+ AVK AEEAH DM++WF+K ++
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFVN  239



>ref|XP_009621644.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=241

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 180/240 (75%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYG---AGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS P C  NPPKL        AG VQQLGG +CYVSG + S LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGNSGGEAGHVQQLGGFSCYVSGSVHSTLALLLVSDVFGYEAPKLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            KLADK+  AGFYVVVPDF  GDP++ N  +P+ +W+KDH  D   +DAK VIE LK+ G+
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHIANDVRPLELWIKDHGPDQGFEDAKPVIEALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            +K+G  G C G K VV+LAK   ++A VLLHP+FV +DD+  VKVPI +LGAE D+ +PP
Sbjct  121  TKIGAVGFCWGAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++VKQFE+AL AK EVD+ VKIF GV HGW+VRY ++D++AVK AEEAHQDML WF KHL
Sbjct  181  ELVKQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  240



>ref|XP_010035827.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW84307.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=239

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 180/238 (76%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    G+G V+QLGGL  YV G  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D   ++ K +I+ LK+ GISK
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FVT+DDI+GVKVPI VLGAE D+ +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK+EVD  VKIF  V+HGWT+RY  +D+ AVK AEEAH DM++WF+K +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFV  238



>gb|KDO74854.1| hypothetical protein CISIN_1g026476mg [Citrus sinensis]
Length=238

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 181/237 (76%), Gaps = 0/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + GAG V++LGGLN YV+G  DSKLA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFYV VPDFFHGDPYV +G KP+  W+KDH VD   ++AK VI+ LK+ GI+ +
Sbjct  61   DKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV L K   ++A VLLHP+FVT+DDI+GV+VP+ +LGAE D  +PP +V
Sbjct  121  GAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALV  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+FE AL AK+ VDS VKIF  V HGWTVRY+ +D+ AVK AEEAH ++L+WF K++
Sbjct  181  KEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHHNLLEWFAKYV  237



>ref|XP_009784375.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Nicotiana 
sylvestris]
Length=241

 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 179/240 (75%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYG---AGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS P C  NPPKL        AG VQQLGG +CY+SGP  S LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGSSGGEAGHVQQLGGFSCYISGPPHSTLALLLVSDVFGYEAPKLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            KLADK+  AGFYVVVPDF  GDP+V N  +P+ +W+KDH  D   +DAK VIE LK+ G+
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHVANDVRPLELWIKDHGPDQGFEDAKPVIEALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            +K+G  G C G K VV+LAK   ++A VLLHP+FV +DD+  VKVPI +LGAE D+ +PP
Sbjct  121  TKIGAVGFCWGAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++V QFE+AL AK EVD+ VKIF GV HGW+VRY ++D++AVK AEEAHQDML WF KHL
Sbjct  181  ELVMQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  240



>ref|XP_010035817.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW84304.1| hypothetical protein EUGRSUZ_B01155 [Eucalyptus grandis]
Length=246

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 179/236 (76%), Gaps = 1/236 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  S GAG+V+QLGGL+ YV G  DSKLA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPNLDPSSGAGRVEQLGGLDAYVVGSQDSKLAMLLLSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPD+F GDP+  EN  +P  VW+KDH  D   +D K  I+ LK+ GIS 
Sbjct  61   DKVAAAGFYVVVPDYFCGDPFAPENHERPFMVWIKDHGTDKGFEDTKPAIQALKSKGIST  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK  V+LAK   V+A VLLHP+FVTLDDI+G KVPI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGGKVAVELAKCELVQAAVLLHPSFVTLDDIKGAKVPIAVLGAEIDQMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            +KQFE  L AK+E+D+ VKIF  V+HGWTVRY  +D+ AVK AEEAH DM++WF+K
Sbjct  181  LKQFEEVLSAKSEIDAFVKIFPKVSHGWTVRYKVEDEAAVKSAEEAHSDMIQWFVK  236



>ref|XP_006419784.1| hypothetical protein CICLE_v10005759mg [Citrus clementina]
 gb|ESR33024.1| hypothetical protein CICLE_v10005759mg [Citrus clementina]
Length=238

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 182/237 (77%), Gaps = 0/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + GAG V++LGGLN YV+G  DSKLA+LL+SD+ GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNGGAGHVEKLGGLNAYVTGSPDSKLAVLLISDIHGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFYV VPDFFHGDPYV +G KP+  W+KDH VD   ++AK VI+ LK+ GI+ +
Sbjct  61   DKVAAAGFYVGVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITSI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV LAK   ++A VLLHP+FVT+DDI+GV+VP+ +LGAE D  +PP +V
Sbjct  121  GAAGFCWGAKVVVQLAKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPVLV  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+FE AL AK+ VDS VKIF  V HGWTVRY+ +D+ AVK AEEAHQ++L+WF K++
Sbjct  181  KEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHQNLLEWFAKYV  237



>gb|ABR92334.1| putative dienelactone hydrolase family protein [Salvia miltiorrhiza]
Length=237

 Score =   300 bits (768),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 181/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C  NPP L    G+GKV+++GG++ YVSGP DSK AI+L+SDVFGYEA NLRKLA
Sbjct  1    MAGAQCCENPPTLSSGSGSGKVEEIGGISSYVSGPADSKAAIILISDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+G AGF  VVPDFF GDPYV +  KPI  WLKDH  D   +DAK +IE LK+ GI+K+
Sbjct  61   DKVGAAGFSAVVPDFFRGDPYVPD-QKPITDWLKDHGPDQGFEDAKPIIEALKSKGITKI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV+L+K P V+A VL+HP+ V+++DIQGVKVPI +LGAETD  +PP++V
Sbjct  120  GAVGFCWGAKVVVELSKYPYVQAGVLIHPSLVSVEDIQGVKVPISILGAETDHISPPELV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE AL AK EVDS VKIF   +HGW+VRY ++D+ AVK A EAH+DML WFIKHL
Sbjct  180  KQFEAALNAKPEVDSFVKIFARCSHGWSVRYKDEDEGAVKSAGEAHKDMLDWFIKHL  236



>ref|XP_006489248.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Citrus 
sinensis]
Length=238

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 176/237 (74%), Gaps = 0/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + G G V+ LGGLN YV+G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTTGVGHVENLGGLNTYVNGSPHSKLAVLLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D   +DAK VI+ +K+ GI+ +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEDAKPVIQAIKSKGITAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+GV+VPI VLGAE D+ +PP +V
Sbjct  121  GAAGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKGVEVPISVLGAEIDQFSPPALV  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+FE AL AK+EVDS VKIF  V HGW+VRY+ +D+ AVK AEEAHQ++L+W  K++
Sbjct  181  KEFEEALTAKSEVDSFVKIFPKVAHGWSVRYNAEDEFAVKAAEEAHQNLLEWLTKYV  237



>gb|KCW84309.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=238

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 179/238 (75%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    G+G V+QLGGL  YV G  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D   ++ K +I+ LK+ GISK
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C   K VV+LAK   ++A VLLHP+FVT+DDI+GVKVPI VLGAE D+ +PP +
Sbjct  121  IGAAGFC-WAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK+EVD  VKIF  V+HGWT+RY  +D+ AVK AEEAH DM++WF+K +
Sbjct  180  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFV  237



>ref|XP_004229456.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum lycopersicum]
Length=248

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 179/245 (73%), Gaps = 4/245 (2%)
 Frame = +2

Query  53   HNNIMSAPHCIANPPKLC----YSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYE  220
            +N +MS P C  NPP          GAG VQQLGG NCY+SGPLDS  AI+LVSDVFGYE
Sbjct  3    NNIVMSGPECCENPPNYLSGGGGGGGAGHVQQLGGFNCYLSGPLDSAQAIILVSDVFGYE  62

Query  221  ATNLRKLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDL  400
            A  LRKLADK+  AGFYVVVPDF  GDP + N  KP+ VW+ DH  D   + AK VIE L
Sbjct  63   APKLRKLADKVAAAGFYVVVPDFLRGDPRIPNDEKPLEVWIVDHGPDQGFEYAKPVIEAL  122

Query  401  KAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETD  580
            K+ G++K+G  G C G K VV+LAK   ++A VLLHP+FV +DD+  VK+PI +LGAE D
Sbjct  123  KSKGVTKIGAAGFCWGAKVVVELAKYAYIQAAVLLHPSFVVIDDMHAVKIPISILGAEID  182

Query  581  ETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKW  760
              + P++VKQFE+AL AK EVD+ VKIF GVTHGW VRY+++D++AVK AEE+HQDML W
Sbjct  183  RYSSPELVKQFEMALNAKPEVDAFVKIFPGVTHGWAVRYNDEDELAVKSAEESHQDMLGW  242

Query  761  FIKHL  775
            F KHL
Sbjct  243  FEKHL  247



>ref|XP_006339416.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum tuberosum]
Length=241

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 177/240 (74%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLC---YSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS P C  NPP         GAG VQQ GG NCY+SGP+DS  A++LVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPNYLSGGGGGGAGHVQQFGGFNCYLSGPVDSTQAVILVSDVFGYEAPKLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            KLADK+  AGFYVVVPDF  GDP + N  KP+ VW+ DH  D   +DAK VIE LK+ G+
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPRIPNDEKPLEVWIIDHGPDQGFEDAKPVIEALKSNGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            +K+G  G C G K VV+LAK   ++A VLLHP+FV +DD+  VKVPI +LGAE D  +PP
Sbjct  121  TKIGAAGFCWGAKVVVELAKYAYIQAAVLLHPSFVVVDDMHAVKVPISILGAEIDRRSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++VKQFE+AL AK EVD+ VKIF GVTHGW+VRY+++D++ VK AEE+HQDML WF KHL
Sbjct  181  ELVKQFEMALNAKPEVDAFVKIFPGVTHGWSVRYNDEDELDVKSAEESHQDMLGWFEKHL  240



>ref|XP_011071518.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=256

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 177/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            +S+  C  NPP L  + GAGKVQ+LGGLNCYVSG  DS  +++L+SDV+GYEA +LR LA
Sbjct  18   VSSHQCTDNPPTLSATRGAGKVQELGGLNCYVSGSADSNFSVILISDVYGYEAPHLRMLA  77

Query  245  DKIGGAGFYVVVPDFFHGDPYVE-NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFF GDP+V  N  KP  +W K H  D   +DAK +++ +K  GIS+
Sbjct  78   DKVAAAGFYTVVPDFFRGDPFVNGNPHKPFHIWFKHHGYDQGFEDAKAIVKAIKRNGISR  137

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G+ G C GGK  V+L K   +EA VLLHP+ V++ DI+GVKVPI +LGAE D+ +PPK+
Sbjct  138  IGVAGFCWGGKVNVELTKHAYIEAGVLLHPSNVSIQDIRGVKVPISILGAEIDQFSPPKL  197

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V++FE  L+ K EVDS VKIF GV HGWT+RY++DDK+AVK AEEAH  ML WFIKHL
Sbjct  198  VRKFEAVLKKKPEVDSFVKIFPGVQHGWTIRYNDDDKLAVKSAEEAHNAMLHWFIKHL  255



>gb|KDP40089.1| hypothetical protein JCGZ_02087 [Jatropha curcas]
Length=239

 Score =   294 bits (753),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 177/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + GAG V+++GG N YV+G  DSKLAILL+SD++GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPASGAGHVEKVGGFNSYVTGSPDSKLAILLISDIYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGFYVVVPDFF+GDPY  +N  +PI VWLKDH  D   +DAK V++ LK+ G++ 
Sbjct  61   DKIAAAGFYVVVPDFFYGDPYSPDNAERPIQVWLKDHEADKGFEDAKPVVQALKSKGVTA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV LAK   ++A VLLHP+F+T+DDI+GV+VPI +LGAE D  +PP +
Sbjct  121  IGAAGFCWGAKVVVQLAKREFIQAAVLLHPSFITVDDIKGVEVPIAILGAEIDHLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EVD  VKIF  V HGWTVRY+ +D  AVK AEEAH ++L WF KH+
Sbjct  181  VKQFEEVLTAKPEVDCHVKIFPKVAHGWTVRYNVEDANAVKAAEEAHGNLLDWFTKHV  238



>ref|XP_002516793.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF45407.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   294 bits (752),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 179/238 (75%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + G+G V++LGGLN Y++GP DSK AILL+SDV+G+EA NLRKLA
Sbjct  1    MSGPQCCANPPTLDPASGSGHVEKLGGLNSYITGPSDSKRAILLISDVYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+GDPY  +N  +PI VWLKDH  D   +DAK +++ LK+ G+S 
Sbjct  61   DKVATAGFYVVVPDFFYGDPYAPDNADRPIQVWLKDHGTDKGFEDAKPLVQTLKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV LAK   ++A V+LHP+FVT+DDI+ V+VPI +LGAETD  +PP +
Sbjct  121  IGAAGFCWGAKVVVQLAKPEFIQAAVMLHPSFVTVDDIKAVEVPISILGAETDHLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+EV S  KIF  V HGWTVRY+ +D+ A K A+EAH DM++WF KH+
Sbjct  181  VKQFEEVLNAKSEVGSRCKIFPKVAHGWTVRYNVEDENAAKCADEAHGDMIEWFTKHV  238



>ref|XP_006419787.1| hypothetical protein CICLE_v10005761mg [Citrus clementina]
 gb|ESR33027.1| hypothetical protein CICLE_v10005761mg [Citrus clementina]
Length=237

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 180/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + GAG V++LGGL+ YV+G  DSKLA LL+SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNSGAGHVEKLGGLSTYVTGSPDSKLATLLISDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFYV VPDFFHGDP V +G +P+  W+KDH VD   ++AK VI+ LK  GI+  
Sbjct  61   DKVAAAGFYVAVPDFFHGDPKV-DGGRPLQEWIKDHGVDKGFEEAKPVIQALKCKGITAT  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV LAK   ++A VLLHP+FVT+DDI+GV+VPI VLGAE D+ +PP +V
Sbjct  120  GAVGFCWGAKVVVQLAKHEFIQAAVLLHPSFVTVDDIKGVEVPISVLGAEIDQFSPPALV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+FE AL AK+EVDS VKIF  V HGW+VRY+ +D+ AVK AEEAHQ++L+W  K++
Sbjct  180  KEFEEALTAKSEVDSFVKIFPKVAHGWSVRYNAEDEFAVKAAEEAHQNLLEWLTKYV  236



>ref|XP_010262559.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Nelumbo nucifera]
Length=238

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 173/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP LC S G G V +LGGL  YV+G  DSK  ILLVSD+FGYEA NLRKLA
Sbjct  1    MSGPQCCDNPPTLCSSCGEGSVLELGGLKAYVAGSQDSKRGILLVSDIFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGFYVVVPDF +GDPYV +N  +P+ VW+K H  D   +DAK VI+ LK  GI+ 
Sbjct  61   DKIAAAGFYVVVPDFLYGDPYVPDNAERPLPVWIKSHGPDKAFEDAKPVIDALKVKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV LA+   ++A VLLH +FVT+DDI+ VKVPI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVVVQLARFDQIQAAVLLHASFVTVDDIKEVKVPIAVLGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            +KQFE  L +K+EVD  VKIF GV HGWTVRY  +DK  VK AEEAH+DML+WF K+
Sbjct  181  LKQFEEVLSSKSEVDGFVKIFPGVAHGWTVRYSAEDKAVVKSAEEAHRDMLEWFTKY  237



>ref|XP_006489247.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Citrus 
sinensis]
Length=238

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 175/238 (74%), Gaps = 0/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + G G V+ LGGLN YV+G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTTGVGHVENLGGLNTYVNGSPHSKLAVLLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D   +DAK VI+ +K+ GI+ +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEDAKPVIQAIKSKGITAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+ V+VP  VLGAE D+ +PP ++
Sbjct  121  GAAGFCWGAKVGVQLAKREFIQAAVLLHPSFVTVDDIKTVEVPTAVLGAEFDQISPPALL  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            KQFE  L AK+EVD  VKIF  V+HGWTVRY+ +DK AVK AEEAHQ+ML+WF K+++
Sbjct  181  KQFEEVLTAKSEVDGYVKIFPKVSHGWTVRYNVEDKSAVKCAEEAHQNMLEWFAKYVN  238



>ref|XP_010103447.1| hypothetical protein L484_010049 [Morus notabilis]
 gb|EXB95850.1| hypothetical protein L484_010049 [Morus notabilis]
Length=240

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 181/239 (76%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S GAG V +LGG+N YV+G  +S+LA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGNVNKLGGINSYVTGASNSRLAVLLISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVE-NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGF+V +PDF HGDP+V  + ++PI VW+KDH  D   ++AK VIEDLK+ G S 
Sbjct  61   DKIAEAGFFVAIPDFLHGDPFVPGDASRPISVWIKDHGTDKGCEEAKPVIEDLKSKGFSA  120

Query  422  VGIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            +G  G+C G K VV+LAK+   ++A  LLHP+FVT+DDI+ V V I +LGAE D  +PP 
Sbjct  121  IGAAGLCWGAKVVVELAKLDNLIQAAALLHPSFVTVDDIKEVNVSIAILGAEHDNLSPPP  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L+AK+E+DS VKI+ GV+HGWTVRYD  D+ A K A+EAH+D+L WFIKH+
Sbjct  181  LVKQFEEVLKAKSEIDSFVKIYPGVSHGWTVRYDVHDEAASKRADEAHKDLLAWFIKHV  239



>ref|XP_006419786.1| hypothetical protein CICLE_v10005765mg [Citrus clementina]
 gb|ESR33026.1| hypothetical protein CICLE_v10005765mg [Citrus clementina]
Length=237

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 179/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + GAG V++LGGL+ YV+G  DSKLA LL+SD+FGYEA NLRKLA
Sbjct  1    MSGPRCCANPPTLNPNSGAGHVEKLGGLDTYVTGSPDSKLAALLISDIFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            D++  AGFYV VPDFFHGDP+V +G +P+  W+ DH VD   ++AK +I+ LK  GI+  
Sbjct  61   DRVAAAGFYVAVPDFFHGDPHV-DGGRPLQEWINDHGVDKGFEEAKPLIQALKCKGITAT  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+GV+VPI VLGAE D+ +PP +V
Sbjct  120  GAVGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKGVEVPISVLGAEIDQVSPPALV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+FE AL AK+EVDS VKIF  V HGW+VRY+ +D+ AVK AEEAHQ++L+W  KH+
Sbjct  180  KEFEEALTAKSEVDSFVKIFPKVAHGWSVRYNVEDESAVKAAEEAHQNLLEWLAKHV  236



>ref|XP_006489278.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Citrus sinensis]
Length=238

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 173/238 (73%), Gaps = 0/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + G G V+ LGGLN YV+G   SKLA+LLVSDV+ YEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTAGGGHVENLGGLNAYVNGSPHSKLAVLLVSDVYVYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D   ++AK VI  +K+ GI+ +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEEAKPVIHAIKSKGITAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+ V+VP  VLGAE D+ +PP ++
Sbjct  121  GAAGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKAVEVPTAVLGAEFDQISPPDLL  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            KQFE  L AK+EVD  VKIF  V+HGWTVRY+ +DK AVK AEEAHQDML+WF K+++
Sbjct  181  KQFEEVLTAKSEVDGYVKIFPKVSHGWTVRYNVEDKSAVKCAEEAHQDMLEWFAKYVN  238



>ref|XP_010103445.1| hypothetical protein L484_010047 [Morus notabilis]
 gb|EXB95848.1| hypothetical protein L484_010047 [Morus notabilis]
Length=240

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 178/239 (74%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S GAG VQ+LGGL+ YV+G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPECCSNPPTLNPSSGAGHVQKLGGLDSYVTGTPSSKLAVLLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVE-NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGF+V VPDFFHGDP+V  + ++P+ VWLKDH  D   ++AK V EDLK+ G S 
Sbjct  61   DKIAAAGFFVAVPDFFHGDPFVAGDASRPLPVWLKDHGTDKGFEEAKPVTEDLKSKGFSA  120

Query  422  VGIGGVCSGGKTVVDLAKIP-CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            +G  G C GGK VV+L+K    ++A  LLHP+FV +DDI+ VKVPI +LG E D+ +PP 
Sbjct  121  IGAAGFCWGGKVVVELSKFTNFIQAAALLHPSFVAVDDIKEVKVPIAILGGERDQISPPP  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L+AK E+DS VKI+ GV HGWT+RYD  ++ A K A+EAH+D+L W IKH+
Sbjct  181  LVKQFEEVLKAKPEIDSFVKIYPGVAHGWTIRYDVRNEAACKRADEAHRDLLAWLIKHV  239



>ref|XP_007034580.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY05506.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=239

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L    G G V++L GL  Y +G LDSKLA+LLVSDVFGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPGSGVGHVEELAGLKTYFTGSLDSKLAVLLVSDVFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+GDP+V E   +P+ VWLKDH  D   +DAK+VI+ LK+ G+S 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVAERSDRPLAVWLKDHGPDKGLEDAKLVIDALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV LAK   + A VLLHP+FVT+DDI+ VKVPI +LGAE D+ +PP +
Sbjct  121  IGAAGICWGAKVVVGLAKEALIPAAVLLHPSFVTVDDIKSVKVPIAILGAEIDQLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQF+  L+AK EV S VKIF    HGWTVRY+ +D  AV  A+EAHQDML WF K++
Sbjct  181  VKQFDEILKAKPEVGSFVKIFPKCAHGWTVRYNVNDATAVSYADEAHQDMLNWFTKYV  238



>ref|XP_010532701.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=238

 Score =   288 bits (738),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G+V++LGGL+ YV G  DS  AILLVSDVFGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLNPKSGSGRVEKLGGLDAYVIGSPDSTRAILLVSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDPY  +N  +PI VW+KDH  D   + +K V+E LK+ GI+ 
Sbjct  61   DKVAESGFYVVVPDYFYGDPYDPKNQDRPIAVWIKDHGADKGFEQSKPVVEALKSKGITS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+LAK   ++A V LHP+FVT+DD++GVKVP+ VLGAE D  +PP++
Sbjct  121  IGAAGMCWGAKVVVELAKDALIQAGVFLHPSFVTVDDVKGVKVPLAVLGAEIDHMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV S VKIF   THGWTVRY  DD  AVK AEEAH+DML WF+ HL
Sbjct  181  LKQFEEVLASKPEVKSCVKIFPKTTHGWTVRYSTDDPSAVKAAEEAHKDMLDWFVTHL  238



>ref|XP_010695307.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Beta vulgaris subsp. 
vulgaris]
Length=241

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 174/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C  NPP L  S G G VQ++GG+  YV G  D+KLA+L +SDV+GYEA NLRKLA
Sbjct  1    MAGAQCCDNPPTLNPSSGVGLVQEIGGIQSYVVGSSDTKLAVLFISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+Y VVPDF HG+PY  EN  +PI VW+KDH  D   ++AK+VIE LK  GISK
Sbjct  61   DKVAAAGYYAVVPDFLHGEPYDAENTERPIQVWIKDHGPDKGCEEAKLVIEALKQKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            +G  G C G K VV LA+    V+A  LLHP+FVT+DDI+GVKVP+ VLGAE D  +PP+
Sbjct  121  IGAVGFCWGAKVVVQLAQSQEYVQAGALLHPSFVTVDDIKGVKVPLAVLGAEIDHLSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE AL AK EVD  VKIF GV HGWTVRY+ +D  AVK AEEAHQDML WF KH+
Sbjct  181  LVKQFEEALNAKAEVDGFVKIFPGVAHGWTVRYNTEDAAAVKCAEEAHQDMLGWFQKHI  239



>gb|KDP40090.1| hypothetical protein JCGZ_02088 [Jatropha curcas]
Length=239

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    GAG+V+Q+GG N Y++GP DSKLAILLVSD++GYEA  LRKLA
Sbjct  1    MSGPQCCANPPTLNPESGAGRVEQVGGFNSYLTGPSDSKLAILLVSDIYGYEAPILRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            D I  AGFYVVVPDFF+G+PY  +N  + I VW KDH +D   +DAK V++ +K+ G+S 
Sbjct  61   DMIAAAGFYVVVPDFFYGEPYSPDNAERHIQVWFKDHGLDKGFEDAKPVVQAIKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV LAK   ++A VLLHP+ VT+DDI+ V+VPI VLGAE D  +PP +
Sbjct  121  IGAAGFCWGAKVVVQLAKSEFIQAAVLLHPSLVTVDDIKAVEVPIAVLGAEIDHISPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK E+D  VKIF  V HGWTVRYDE D+ AVK AEEAH D L WF KH+
Sbjct  181  VKQFEEVLTAKPEIDCHVKIFPKVEHGWTVRYDERDETAVKNAEEAHGDTLDWFTKHV  238



>ref|XP_007034579.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05505.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=248

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 173/236 (73%), Gaps = 1/236 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L    G G V++L GL  Y +G LDSKLA+LLVSDVFGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPGSGVGHVEELAGLKTYFTGSLDSKLAVLLVSDVFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+GDP+V E   +P+ VWLKDH  D   +DAK+VI+ LK+ G+S 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVAERSDRPLAVWLKDHGPDKGLEDAKLVIDALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV LAK   + A VLLHP+FVT+DDI+ VKVPI +LGAE D+ +PP +
Sbjct  121  IGAAGICWGAKVVVGLAKEALIPAAVLLHPSFVTVDDIKSVKVPIAILGAEIDQLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            VKQF+  L+AK EV S VKIF    HGWTVRY+ +D  AV  A+EAHQDML WF K
Sbjct  181  VKQFDEILKAKPEVGSFVKIFPKCAHGWTVRYNVNDATAVSYADEAHQDMLNWFTK  236



>ref|XP_010649854.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Vitis vinifera]
 emb|CBI26171.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  +PP L  + G+G V+QLGGL+CY++G   SKLAILLVSD++GYEA N RKLA
Sbjct  1    MSGPQCCEHPPSLNPNSGSGHVEQLGGLSCYIAGSPHSKLAILLVSDIYGYEAPNFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVV PDF +GD YV + A +P  VW+KDH +D   +D K VIE LK+ G+S 
Sbjct  61   DKVAAAGFYVVAPDFLYGDTYVPDKAERPFPVWIKDHGMDKGFEDTKPVIEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FV+LDDI+GVKVP  VLGAE D+ +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKSGYIQAAVLLHPSFVSLDDIKGVKVPTAVLGAEIDQMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK  VD  VKIF GV HGWTVRY+ +D  AVK AEEAHQDML WF K++
Sbjct  181  VKQFEEILTAKPGVDGFVKIFPGVAHGWTVRYNAEDAGAVKCAEEAHQDMLGWFSKYV  238



>ref|XP_009365790.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=244

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 181/243 (74%), Gaps = 2/243 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G G V++LGGL+ YV+G  DSKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGPDKAFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VL HP+FVT+DDI+ VKVPI +LGAE D  +PP++
Sbjct  121  IGAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH*  781
            VKQFE  L A  EV S VKIF  V+HGWTVRY+ +DK A K AEEAHQD+L+WF+KH+  
Sbjct  181  VKQFEEVLTA-NEVKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLEWFLKHVKG  239

Query  782  VPL  790
            V L
Sbjct  240  VTL  242



>gb|EYU38138.1| hypothetical protein MIMGU_mgv1a012798mg [Erythranthe guttata]
Length=239

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  S G G V + GGL  YVSGP DSKLA++L +DV+GYEA NLRK+A
Sbjct  1    MSGPQCCANPPTLSPSSGVGSVIEFGGLKSYVSGPSDSKLAVILAADVYGYEAPNLRKIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGFYVVVPDFF+GDPY   N  KP+ VW   H      +DAK VIE L++ GIS 
Sbjct  61   DKIAAAGFYVVVPDFFYGDPYDPANPEKPLLVWKALHEPAKAFEDAKPVIEALRSKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   +EA V LHP+FVTLDDI+ VK P+ +LGAETD  +PP++
Sbjct  121  IGAAGFCYGAKVVVELAKSKLIEAGVFLHPSFVTLDDIKEVKAPLAILGAETDHLSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L   +EV+S VKIF GV HGW VRY  DD++AVK AEEA+QD L WFIK +
Sbjct  181  VKQFEEILSTNSEVESFVKIFPGVAHGWAVRYKFDDEMAVKSAEEAYQDTLNWFIKFV  238



>ref|XP_004165841.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cucumis sativus]
Length=239

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 178/238 (75%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S GAG ++QLGGL  YVSG  DSKLA+L ++DV+G+EA  LRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKLAVLFITDVYGFEAPLLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VV PDFFHGDP+V + A +PI VWL+DH  +    DAK V+E LK  GI+ 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRPIRVWLQDHETEKGFDDAKPVVEALKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VVDLAK+  ++A VLLHP+FVT+DDI+GVK PI +LGAE D  +PP++
Sbjct  121  IGAVGICWGAKVVVDLAKVELIQAAVLLHPSFVTVDDIKGVKAPISILGAEIDHMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +K+FE  L AK EVD  VKIF  V+HGWTVRY  +D+ AVK A+EAH+D+L WF K++
Sbjct  181  LKEFEEILSAKPEVDGFVKIFPKVSHGWTVRYKVEDEEAVKCADEAHEDLLAWFTKYV  238



>ref|XP_007154155.1| hypothetical protein PHAVU_003G095100g [Phaseolus vulgaris]
 gb|ESW26149.1| hypothetical protein PHAVU_003G095100g [Phaseolus vulgaris]
Length=239

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V++L GL+ Y++G  +S LA+LL+SDVFGYEA NLR +A
Sbjct  1    MSGPECCSNPPLLNPNAGAGHVEKLAGLDSYIAGSPNSNLAVLLISDVFGYEAPNLRNIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFF GDPY  EN  + I VWLKDH  D  S+ AK ++E LK+ G+S 
Sbjct  61   DKVAAAGYYVVVPDFFFGDPYNPENANRAIHVWLKDHGTDKGSEAAKSIVEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VLLHP+FV++DDI+GV +P  VLGAE D+ +PP++
Sbjct  121  IGAVGFCWGAKVVVELSKSRLIQAAVLLHPSFVSVDDIKGVDIPTAVLGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK  +D  VKIF  V+HGW+VRY  DD IAVK AEEAHQD+L WF +HL
Sbjct  181  VKQFEQVLTAKPGIDCFVKIFPQVSHGWSVRYRNDDAIAVKAAEEAHQDLLNWFARHL  238



>ref|XP_010103443.1| hypothetical protein L484_010045 [Morus notabilis]
 gb|EXB95846.1| hypothetical protein L484_010045 [Morus notabilis]
Length=239

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 177/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C +NPP L  S GAG V++LGGL+ YV+G  +SKLA+LL+SD++G+EA NLRKLA
Sbjct  1    MSGCQCCSNPPTLNPSSGAGHVEKLGGLDSYVTGSPNSKLAVLLISDIYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGF+V VPDF HGDPYV      +G+WL+DH  D   ++AK VIEDLK+ G S +
Sbjct  61   DKLAAAGFFVAVPDFLHGDPYVSEDFSGLGIWLQDHGTDKGFEEAKPVIEDLKSKGFSAI  120

Query  425  GIGGVCSGGKTVVDLAKIP-CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            G  G C G K VV++AK    ++A VLLHP+FVTLDDI+ VKVPI +LGAE D+ +PP++
Sbjct  121  GAAGFCWGAKVVVEVAKFTNFIQAAVLLHPSFVTLDDIKEVKVPIAILGAEIDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK E+DS VKIF GV HGWTVRYD  D+ A K AEEAH+D+L+ F KH+
Sbjct  181  VKQFEEVLSAKAEIDSFVKIFPGVAHGWTVRYDVQDEAANKRAEEAHKDLLEIFTKHV  238



>ref|XP_006358424.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum tuberosum]
Length=239

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C  NPP L  S G G + +LGGL  YVSG  +SK AILL+SDV+GYEA NLRKLA
Sbjct  1    MAGPQCCENPPALSSSSGHGSILELGGLKTYVSGSSNSKHAILLISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G+YVVVPDF +GDPY  EN  KPI VW++ H  D   +DAK VI  LK  GIS 
Sbjct  61   DKVAAGGYYVVVPDFLYGDPYNPENKEKPIQVWIQSHGTDKGFEDAKQVIAALKDKGISP  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK VV+LAK   +++ VLLHP+FV++DDI+ VK PI +LG E D+ +PP++
Sbjct  121  IGAAGFCWGGKVVVELAKSDNIQSAVLLHPSFVSVDDIKEVKAPIAILGGEIDQLSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EVD  VKI+ GV+HGWTVRY+ +DK AV+ AEEAHQDML WF KH+
Sbjct  181  VKQFEEILSSKPEVDRFVKIYPGVSHGWTVRYNVEDKKAVQSAEEAHQDMLDWFTKHV  238



>ref|XP_004134157.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cucumis sativus]
 gb|KGN57031.1| hypothetical protein Csa_3G150110 [Cucumis sativus]
Length=239

 Score =   286 bits (731),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 178/238 (75%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S GAG ++QLGGL  YVSG  DSKLA+L ++DV+G+EA  LRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKLAVLFITDVYGFEAPLLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VV PDFFHGDP+V + A +PI VWL+DH  +    DAK V+E LK  GI+ 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRPIRVWLQDHETEKGFDDAKPVVEALKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+LAK+  ++A VLLHP+FVT+DDI+GVK PI +LGAE D  +PP++
Sbjct  121  IGAVGICWGAKVVVELAKVELIQAAVLLHPSFVTVDDIKGVKAPISILGAEIDHMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +K+FE  L AK EVD  VKIF  V+HGWTVRY  +D+ AVK A+EAH+D+L WF K++
Sbjct  181  LKEFEEILSAKPEVDGFVKIFPKVSHGWTVRYKVEDEEAVKCADEAHEDLLAWFTKYV  238



>ref|XP_007223756.1| hypothetical protein PRUPE_ppa010552mg [Prunus persica]
 gb|EMJ24955.1| hypothetical protein PRUPE_ppa010552mg [Prunus persica]
Length=245

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 178/239 (74%), Gaps = 1/239 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP +  S G+G V++LGGL+ YV+G  DSKLAILLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTINPSSGSGHVEKLGGLDSYVTGSPDSKLAILLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF +GDPY  E+  +P+ VW+KDH   N  +DAK V+  L+  G S 
Sbjct  61   DKVAAAGFFVVVPDFLYGDPYAPEDANRPLPVWIKDHGPANGFEDAKPVLGALRRKGFSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C GGK VV+LAK   ++A VL HP+FV +DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  VGAAGFCWGGKVVVELAKHDFIQAAVLCHPSFVIVDDIKAVKVPISILGAEIDHMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            VKQFE  L AK+EV S VKIF  V HGWTVRY+ +D+ AVK AEEAHQ++L+WF+ H+ 
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVAHGWTVRYNVEDEAAVKCAEEAHQNLLEWFLNHVR  239



>ref|XP_004247494.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Solanum 
lycopersicum]
Length=239

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C  NPP L  S G G V +LGGL  YVS   +SK AILL+SDV+GYEA NLRKLA
Sbjct  1    MAGPQCCENPPALSSSSGHGSVLELGGLKTYVSDSSNSKYAILLISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G+YVVVPDF +GDPY  EN  KPI VW++ H  D   +DAK VI  LK  GIS 
Sbjct  61   DKVAAGGYYVVVPDFLYGDPYNPENKEKPIQVWIQSHGTDKGFEDAKQVIAALKDKGISP  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK VV+LAK   V+A VLLHP+FV++DDI+ VK PI +LGAE D+ +PP++
Sbjct  121  IGAAGFCWGGKVVVELAKSDNVQAAVLLHPSFVSVDDIKEVKAPIAILGAEIDQLSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EVD  VKI+ GV+HGWTVRY+ +D+ AV+ AEEAHQDML WF KH+
Sbjct  181  VKQFEEILSSKPEVDCFVKIYPGVSHGWTVRYNVEDEKAVQSAEEAHQDMLDWFTKHV  238



>ref|XP_009102600.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Brassica rapa]
Length=239

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG LDSKL ++L+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVSGSGHVEKLGGLDAYVSGSLDSKLCVILISDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDP+   N  +PI +WLKDH  D   +D K VIE +K+ GI+ 
Sbjct  61   DKVAASGFYVVVPDYFYGDPFDASNQERPISLWLKDHGADKGFEDTKPVIEAMKSKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K   V+A VLLHP+FVT+DDI+G KVPI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKQELVQAAVLLHPSFVTVDDIKGGKVPIAILGAEIDQLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI   VTHGWTVRY  DD  AVK AEEAH++ML WF+ ++
Sbjct  181  LKQFEEILASKPEVNSYVKIHPKVTHGWTVRYKTDDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_008438729.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Cucumis 
melo]
Length=239

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 178/238 (75%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S GAG ++QLGGL  YVSG  DSK+A+L ++DV+G+EA  LRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKIAVLFITDVYGFEAPLLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VV PDFFHGDP+V + A +PI VWL+DH  D    DAK V+E LK  GIS 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRPIRVWLQDHGPDKGFDDAKPVVEALKNKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+LAK+  ++A VLLHP+FVT+DDI+GVK  I +LGAE D  +PP++
Sbjct  121  IGAVGICWGAKVVVELAKVELIQAAVLLHPSFVTVDDIKGVKAHISILGAEIDHMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK EVD  VKIF  V+HGWTVRY+ +D+ AVK A+EAH+D+L WF K++
Sbjct  181  LKQFEEILSAKPEVDGFVKIFPKVSHGWTVRYNVEDEEAVKCADEAHEDLLAWFTKYV  238



>ref|XP_006419793.1| hypothetical protein CICLE_v10005752mg [Citrus clementina]
 gb|ESR33033.1| hypothetical protein CICLE_v10005752mg [Citrus clementina]
Length=239

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 173/239 (72%), Gaps = 1/239 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + G G V+ LGGLN YV+G   SKLA+LLVSDV+ YEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTAGGGHVENLGGLNAYVNGSPHSKLAVLLVSDVYVYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D   ++AK VI  +K+ GI+ +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEEAKPVIHAIKSKGITAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+ V+VP  VLGAE D+ +PP ++
Sbjct  121  GAAGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKAVEVPTAVLGAEFDQISPPDLL  180

Query  605  KQFEIALQAKTE-VDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            KQFE  L AK+E VD  VKIF  V+HGWTVRY+ +DK AVK AEEAHQDML+WF K+++
Sbjct  181  KQFEEVLTAKSEQVDGYVKIFPKVSHGWTVRYNVEDKSAVKCAEEAHQDMLEWFAKYVN  239



>ref|XP_009352129.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=244

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 178/238 (75%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C +NPP L  S G G V++LGGL+ YV+G  DSKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGAQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGPDKAFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VL HP+FVT+DDI+ VKVPI +LGAE D  +PP++
Sbjct  121  IGAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L A  EV S VKIF  V+HGWTVRY+ +DK A K AEEAHQD+L+WF+KH+
Sbjct  181  VKQFEEVLTA-NEVKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLEWFLKHV  237



>ref|XP_008340903.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Malus 
domestica]
Length=245

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C +NPP L  S G G V+ LGGL+ YV+G   SKLA+LLVSDVFG+EA NLRKLA
Sbjct  1    MSSSECCSNPPTLNPSSGTGHVENLGGLDSYVTGSPHSKLALLLVSDVFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDFF+ DPY  E+  +P+ VW+KDH  +   +DAK+V+E LK  G+S 
Sbjct  61   DKVAAAGFFVVVPDFFNKDPYAPEDANRPLPVWIKDHRPBKGFEDAKLVLEALKRKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VL HP FVT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  IGAAGFCWGAKVVVELAKRALIQAAVLCHPTFVTVDDIKEVKVPISILGAEFDRISPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+EV S VKIF  V+HGWTVRY+ +D+ A K AEEAHQD+L+W + H+
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVSHGWTVRYNVEDEAACKSAEEAHQDLLEWLLNHV  238



>emb|CDX85115.1| BnaC07g07910D [Brassica napus]
Length=239

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG LDSKL ++L+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVSGSGHVEKLGGLDAYVSGSLDSKLCVILISDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+G +GFYVVVPD+F+GDP+   N  +PI +W+KDH  D   +D K VIE +K  GI+ 
Sbjct  61   DKVGASGFYVVVPDYFYGDPFDASNQERPISLWIKDHGADKGFEDTKPVIEAIKTKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K   V+A VLLHP+FVT+DDI+G KVPI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKQELVQADVLLHPSFVTVDDIKGGKVPIAILGAEIDQVSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI+  V HGWTVRY  DD  AVK AEEAH++ML WF+ ++
Sbjct  181  LKQFEEILASKPEVNSYVKIYPKVAHGWTVRYKTDDPDAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_004296954.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=241

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 176/240 (73%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + G+G V++LGGL+ Y++G  DSKLAI+LVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPTSGSGHVEKLGGLDSYLTGSPDSKLAIVLVSDIFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DKI  AGF+ VVPDFF+GDPYV   +     +  WLK H  D   +D KVVIE LK+ G+
Sbjct  61   DKIAAAGFFAVVPDFFYGDPYVPAADGSLDSLPAWLKGHGADKGFEDVKVVIEALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
              +G  G C G K VV+LAK   ++A VL HP+FVTLDDI+ VKVPI +LGAE D  +PP
Sbjct  121  CAIGAVGFCWGAKVVVELAKGDFIQAAVLAHPSFVTLDDIKAVKVPISILGAEIDRMSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++VKQFE AL AK+E+ S VKIF  V+HGWTVRYD  DK AVK AEEAH+DML WF+ H+
Sbjct  181  ELVKQFEEALTAKSEIKSHVKIFPKVSHGWTVRYDVSDKEAVKPAEEAHKDMLDWFVNHV  240



>emb|CDX77495.1| BnaA07g06330D [Brassica napus]
Length=239

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG LDSKL ++L+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVCGSGHVEKLGGLDAYVSGSLDSKLCVILISDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDP+   N  +PI +WLKDH  D   +D K VIE +K+ GI+ 
Sbjct  61   DKVAASGFYVVVPDYFYGDPFDASNQERPISLWLKDHGADKGFEDTKPVIEAIKSKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L K   V+A VLLHP+FVT+DDI+G KVPI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWGAKVVVELCKQELVQAAVLLHPSFVTVDDIKGGKVPIAILGAEIDQLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI   VTHGWTVRY  DD  AVK AEEAH++ML WF+ ++
Sbjct  181  LKQFEEILASKPEVNSYVKIHPKVTHGWTVRYKTDDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_009621645.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=228

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 171/240 (71%), Gaps = 16/240 (7%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYG---AGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS P C  NPPKL        AG VQQLGG +CYVSG + S LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGNSGGEAGHVQQLGGFSCYVSGSVHSTLALLLVSDVFGYEAPKLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            KLADK+  AGFYVVVPDF  GDP++ N  +P+ +W+KDH  D   +DAK VIE LK    
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHIANDVRPLELWIKDHGPDQGFEDAKPVIEALK----  116

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
                     S  K VV+LAK   ++A VLLHP+FV +DD+  VKVPI +LGAE D+ +PP
Sbjct  117  ---------SKAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  167

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++VKQFE+AL AK EVD+ VKIF GV HGW+VRY ++D++AVK AEEAHQDML WF KHL
Sbjct  168  ELVKQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  227



>ref|XP_010527418.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=240

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 173/235 (74%), Gaps = 1/235 (0%)
 Frame = +2

Query  74   PHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKI  253
            P C  N P L  S G+G+V++LGGL+ YVSG  DSKL I+L SDVFGYEA NLR LADKI
Sbjct  5    PQCCENRPTLNPSSGSGRVEKLGGLDAYVSGSPDSKLGIVLFSDVFGYEAPNLRNLADKI  64

Query  254  GGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGI  430
              AGF VVVPDF  GDPY  EN  +P+ VWLKDH  D   +D+K +IE LK+ GIS VG 
Sbjct  65   AAAGFLVVVPDFLKGDPYEPENQDRPLHVWLKDHEPDKGFEDSKPLIEALKSKGISAVGA  124

Query  431  GGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQ  610
             G C GGK VV++AK   ++A VLLHP+FVT+DDI+ VK PI VLGAE D T+PP+++KQ
Sbjct  125  AGACFGGKVVVEMAKNELIQAAVLLHPSFVTVDDIKEVKAPIAVLGAENDRTSPPELLKQ  184

Query  611  FEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            FE  L +K EV S VKI+  V+HGW +RYD DD+ AVK AEEAH+DML+W + H+
Sbjct  185  FEQVLASKPEVKSHVKIYENVSHGWGIRYDPDDESAVKAAEEAHKDMLEWSLIHV  239



>ref|XP_008390813.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=244

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 179/243 (74%), Gaps = 2/243 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G G V++LGGL+ YV+G  DSKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH +D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGLDKAFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +   G C G K VV+LAK   ++A VL HP+FVT+DDI+ VKVPI +LGAE D  +PP++
Sbjct  121  IXAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH*  781
            VKQFE  L A   V S VKIF  V+HGWTVRY+ +DK A K AEEAHQD+L WF+KH+  
Sbjct  181  VKQFEEVLTANG-VKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLDWFLKHVKG  239

Query  782  VPL  790
            V L
Sbjct  240  VTL  242



>ref|XP_002312740.1| dienelactone hydrolase family protein [Populus trichocarpa]
 gb|EEE90107.1| dienelactone hydrolase family protein [Populus trichocarpa]
Length=240

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 178/239 (74%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C A+PP L  S GAG V+++GGL+ YVSG  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MAGPQCCAHPPTLNPSVGAGHVEKVGGLDTYVSGSPDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGFY VVPDFF+GDP+  +N  +PI VWLKDH +    +DAK VIE L + G+S 
Sbjct  61   DKIAAAGFYAVVPDFFYGDPFAPDNAERPIKVWLKDHGMHKGFEDAKPVIEALNSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPC-VEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            +G  G C G K VV+L K    ++A VL HP+FVT+DD +  KVPI +LGAETD+ +PP 
Sbjct  121  IGAVGFCWGAKVVVELGKSSAFIKAAVLCHPSFVTVDDFKEFKVPISILGAETDQLSPPA  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L +K+EVDS VKIF  V HGWTVRYD +D+ AVK AEEAH ++L+WF K++
Sbjct  181  LLKQFEELLASKSEVDSFVKIFPKVAHGWTVRYDVEDEAAVKSAEEAHGNLLEWFAKYV  239



>ref|XP_010326630.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
lycopersicum]
Length=240

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 173/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C  NPP L  S G G V +LGGL  YVS   +SK AILL+SDV+GYEA NLRKLA
Sbjct  1    MAGPQCCENPPALSSSSGHGSVLELGGLKTYVSDSSNSKYAILLISDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G+YVVVPDF +GDPY  EN  KPI VW++ H  D   +DAK VI  LK  GIS 
Sbjct  61   DKVAAGGYYVVVPDFLYGDPYNPENKEKPIQVWIQSHGTDKGFEDAKQVIAALKDKGISP  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQG-VKVPILVLGAETDETTPPK  598
            +G  G C GGK VV+LAK   V+A VLLHP+FV++DDI+  VK PI +LGAE D+ +PP+
Sbjct  121  IGAAGFCWGGKVVVELAKSDNVQAAVLLHPSFVSVDDIKAEVKAPIAILGAEIDQLSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L +K EVD  VKI+ GV+HGWTVRY+ +D+ AV+ AEEAHQDML WF KH+
Sbjct  181  LVKQFEEILSSKPEVDCFVKIYPGVSHGWTVRYNVEDEKAVQSAEEAHQDMLDWFTKHV  239



>emb|CDP20217.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   281 bits (720),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 170/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  N P L  S GAG V+++GGL  YV+GP DSK+A+LLVSDVFGYEA  LRKLA
Sbjct  1    MSGPQCCENAPSLSSSSGAGHVEEIGGLQSYVTGPADSKIAVLLVSDVFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+ GAG +VVVPDFF GDP V      +  WLK+H  D   + AK VIE LK  GI+KV
Sbjct  61   DKVAGAGIFVVVPDFFFGDPLVLEKTT-VDDWLKNHGPDQGFEHAKPVIEALKGKGITKV  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV+LAK   + A VLLHP+FVTLDDIQGVKVPI +LGAE D+  PP+++
Sbjct  120  GAAGFCWGAKVVVELAKYAYIHAAVLLHPSFVTLDDIQGVKVPISILGAEKDQKWPPELL  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            K+F  AL AK EVD  VKIF G THGWTVRY ++D+  VK A EAHQD L WF+K+L
Sbjct  180  KKFGEALDAKPEVDGFVKIFPGATHGWTVRYKDEDEKEVKAAAEAHQDTLDWFVKYL  236



>ref|XP_008368976.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=244

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 179/243 (74%), Gaps = 2/243 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G G V++LGGL+ YV+G  DSKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH +D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGLDKAFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +   G C G K VV+LAK   ++A VL HP+FVT+DDI+ VKVPI +LGAE D  +PP++
Sbjct  121  ICAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH*  781
            VKQFE  L A   V S VKIF  V+HGWTVRY+ +DK A K AEEAHQD+L WF+KH+  
Sbjct  181  VKQFEEVLTANG-VKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLDWFLKHVKG  239

Query  782  VPL  790
            V L
Sbjct  240  VTL  242



>ref|XP_008340902.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Malus 
domestica]
Length=245

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS LA+LL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDVYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAXRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VL HP FVT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  IGAAGFCWGAKVVVELAKRALIQAAVLCHPTFVTVDDIKEVKVPISILGAEFDRISPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+EV S VKIF  V+HGWTVRY+ +D+ A K AEEAHQD+L+W + H+
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVSHGWTVRYNVEDEAACKSAEEAHQDLLEWLLNHV  238



>ref|XP_009784376.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Nicotiana 
sylvestris]
Length=228

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 170/240 (71%), Gaps = 16/240 (7%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYG---AGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS P C  NPPKL        AG VQQLGG +CY+SGP  S LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGSSGGEAGHVQQLGGFSCYISGPPHSTLALLLVSDVFGYEAPKLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            KLADK+  AGFYVVVPDF  GDP+V N  +P+ +W+KDH  D   +DAK VIE LK    
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHVANDVRPLELWIKDHGPDQGFEDAKPVIEALK----  116

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
                     S  K VV+LAK   ++A VLLHP+FV +DD+  VKVPI +LGAE D+ +PP
Sbjct  117  ---------SKAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  167

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++V QFE+AL AK EVD+ VKIF GV HGW+VRY ++D++AVK AEEAHQDML WF KHL
Sbjct  168  ELVMQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  227



>gb|KCW84308.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=230

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 171/236 (72%), Gaps = 10/236 (4%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    G+G V+QLGGL  YV G  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D   ++ K +I+ LK+ GISK
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FVT+DDI+         GAE D+ +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIK---------GAEIDQMSPPAL  171

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            +KQFE  L AK+EVD  VKIF  V+HGWT+RY  +D+ AVK AEEAH DM++WF+K
Sbjct  172  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVK  227



>ref|XP_008438728.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cucumis melo]
Length=239

 Score =   281 bits (719),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 173/234 (74%), Gaps = 1/234 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S GAG ++QLGGL  YVSG  DSK AIL ++DV+G+EA  +RKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKRAILFITDVYGFEAPLVRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VV PDFFHGDP+V + A + I VWL+DH  D    DAK V+E LK  GIS 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRTISVWLQDHGPDKGFDDAKPVVEALKNKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  GVC G K VV+LAK+  ++A VLLHP+ VT+DDI+GVK  IL+LGAE D+ +PP++
Sbjct  121  IGAAGVCWGAKVVVELAKVELIQAAVLLHPSLVTVDDIKGVKAHILILGAEIDQISPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
            +KQFE  L AK EVD  VKIF  V+HGWTVRY+ +D  A+K A+EAH+D+L WF
Sbjct  181  LKQFEEILSAKPEVDGFVKIFSKVSHGWTVRYNVEDAEAIKCADEAHEDLLAWF  234



>ref|XP_008223022.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Prunus 
mume]
Length=245

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 177/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C +NPP +  S G+G V++LGGL+ YV+G  DSKLAILLVSD+FG+EA NLRKLA
Sbjct  1    MSGLQCCSNPPTINPSSGSGHVEKLGGLDSYVTGFPDSKLAILLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF +GDPY  E+  +P+ VW+KDH      +DAK V+  L+  G S 
Sbjct  61   DKVAAAGFFVVVPDFLYGDPYAPEDANRPLPVWIKDHGPAKGFEDAKPVLGALRRKGFSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C GGK VV+LAK   ++A VL HP+FVT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  VGAAGFCWGGKVVVELAKHNFIQAAVLCHPSFVTVDDIKAVKVPISILGAEIDHMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+EV S VKIF  V HGWTVRY+ +D+ AVK AEEAHQ++L+WF+ H+
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVAHGWTVRYNVEDEAAVKCAEEAHQNLLEWFLNHV  238



>gb|KCW60882.1| hypothetical protein EUGRSUZ_H03614 [Eucalyptus grandis]
Length=237

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  + G G V++LGGL  YVSG  DS LAI+LVSDVFGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLNPASGQGHVEELGGLKSYVSGSSDSNLAIVLVSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF GDP+V EN  +PI  WLKDH    + +DAK ++E +K  G S 
Sbjct  61   DKVAAAGFYVVVPDFFGGDPFVRENAERPIMEWLKDHGTVGI-EDAKRIVEAVKGKGASA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A+ LLHP+FV++DDI+ VK PI +LGAE D  +PP++
Sbjct  120  IGAAGFCWGAKVVVELAKTGAIKASALLHPSFVSVDDIK-VKAPIAILGAEIDRMSPPEL  178

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK+EVD+ VKIF  V+HGWTVRYD  D+ AVK AEEAH DML+WF K +
Sbjct  179  LKQFEEILAAKSEVDAQVKIFPKVSHGWTVRYDVADEEAVKCAEEAHSDMLEWFAKFV  236



>ref|XP_010527420.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=240

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 175/235 (74%), Gaps = 1/235 (0%)
 Frame = +2

Query  74   PHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKI  253
            P C  N P L  S G+G+V+++GGL+ YVSG LDSKL I+L SDVFGYEA NLR LADKI
Sbjct  5    PQCCENRPTLNPSSGSGRVEKIGGLDAYVSGSLDSKLGIVLFSDVFGYEAPNLRNLADKI  64

Query  254  GGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGI  430
              +GF VVVPDF  GDPY  EN  +P+ VW++DH  D   +D+K ++E LK+ GI+ VG 
Sbjct  65   AASGFLVVVPDFLKGDPYEPENQDRPLHVWMRDHEPDRGFEDSKPLVEALKSKGITAVGA  124

Query  431  GGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQ  610
             G+C GGK VV++AK   ++A VLLHP+FVT+DDI+ VK PI VLGAE D T+PP+++KQ
Sbjct  125  AGLCFGGKVVVEMAKNELIQAAVLLHPSFVTVDDIKEVKTPIAVLGAENDRTSPPELLKQ  184

Query  611  FEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            FE  L +K EV S VKI+  V+HGW +RYD DD+ AVK AEEAH+DML+W + H+
Sbjct  185  FEQVLASKPEVKSHVKIYENVSHGWGIRYDPDDESAVKAAEEAHKDMLEWSLIHV  239



>ref|XP_002275763.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Vitis vinifera]
 emb|CBI32344.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  Y +GP DSKL ILLVSD+ GYEA NLRKLA
Sbjct  1    MSGPQCCENPPVLSSSCGAGSVAEIGGLKAYFTGPPDSKLVILLVSDILGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFYVVVPDFFHGDP+V    K + VW+K H  D   +D K +I  L++ GI+ +
Sbjct  61   DKVAAAGFYVVVPDFFHGDPFVPE-TKTLPVWIKSHGPDKGFEDVKPIIAALRSKGINSI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV+LAK   ++A VLLHP+F T+DDI+ +K PI +LGAETD  +PP++V
Sbjct  120  GAAGFCWGAKVVVELAKAGDIQAAVLLHPSFTTVDDIKEIKAPISILGAETDHVSPPELV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L  K E+ S VKIF GV HGW VRY  DD+ AVK AEEA Q+M+ WFI+H+
Sbjct  180  KQFEEVLATKPEIKSFVKIFPGVAHGWAVRYKVDDEEAVKRAEEAQQNMMDWFIEHV  236



>emb|CAN78076.1| hypothetical protein VITISV_041962 [Vitis vinifera]
Length=237

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  Y +GP DSKL ILLVSD+ GYEA NLRKLA
Sbjct  1    MSGPQCCENPPVLSSSCGAGSVAEIGGLKAYFTGPPDSKLVILLVSDILGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFYVVVPDFFHGDP+V    K + VW+K H  D   +D K +I  L++ GI+ +
Sbjct  61   DKVAAAGFYVVVPDFFHGDPFVPE-TKTLPVWIKSHGPDKGFEDVKPIIAALRSKGINSI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV+LAK   ++A VLLHP+F T+DDI+ +K PI +LGAETD  +PP++V
Sbjct  120  GAAGFCWGAKVVVELAKAGDIQAAVLLHPSFTTVDDIKEIKAPISILGAETDHVSPPELV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L  K E+ S VKIF GV HGW VRY  D++ AVK AEEA Q+M+ WFI+H+
Sbjct  180  KQFEEVLATKPEIKSFVKIFPGVAHGWAVRYKVDBEEAVKRAEEAQQNMMDWFIEHV  236



>ref|XP_004247139.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum lycopersicum]
Length=239

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 167/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C  NPP L  S G G V +LGGL  YVSG  DSK AILL+SD+FGYEA NLRKLA
Sbjct  1    MAGTQCCENPPALSSSSGYGSVFELGGLKTYVSGSSDSKKAILLISDIFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G+YVVVPDFF+GDPY  EN  + I VWL+ H  D   +DAK VI  LK  GIS 
Sbjct  61   DKVAAEGYYVVVPDFFNGDPYNSENKERTIQVWLESHGTDKGFEDAKQVIAALKDKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK VV LA    ++A VLLHP+FV++DD   VK PI +LGAE D  TPP++
Sbjct  121  IGAAGFCWGGKVVVQLATSANIQAAVLLHPSFVSVDDFTEVKAPIAILGAELDRPTPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            + QF+  L +K EVDS V+++ GV HGWTVRY+ +DK AV+ AEEAHQDML WF KH+
Sbjct  181  IMQFKEILSSKPEVDSFVRMYPGVAHGWTVRYNVEDKKAVQSAEEAHQDMLNWFAKHV  238



>ref|XP_008353246.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS LA+LL+SD +G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDXYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAKRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VL HP+ VT+DDI+ VKVPI VLGAE D+ +PP+V
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKEVKVPISVLGAEIDQMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EV S VKIF  V+HGWTVRY  +D+ A K AEEAHQD+LKWF+ H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYSVEDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_010041171.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=236

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 175/238 (74%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  S GAG+V+QLGGL+ YV G  DSKLA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLDPSSGAGRVEQLGGLDAYVVGSQDSKLAMLLLSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPD+F+GDPY  EN  +P+ VW+KDH  D   +  K +I+ LK+ GISK
Sbjct  61   DKVAAAGFYVVVPDYFYGDPYAPENPERPLVVWIKDHGTDKGFEATKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   ++A VLLHPAFVTLDDI+ VKVPI VLGAE D  +P ++
Sbjct  121  IGAAGFCWGAKVGVELAKCELIQAAVLLHPAFVTLDDIKDVKVPIAVLGAEIDRFSPLEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK+EVD  VKI+   +HGWT+RY  +D+ A   A EAH DM++WF+K +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIYPKTSHGWTIRYKVEDEAA---AMEAHSDMIQWFVKFV  235



>ref|XP_004290676.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 172/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP LC + GAG V ++GGL  YV+GP DSKLA+LLVSD+FG+EA N RKLA
Sbjct  1    MSGPQCCENPPSLCSTCGAGSVTEIGGLKAYVTGPSDSKLAVLLVSDIFGFEAPNFRKLA  60

Query  245  DKIGG-AGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK     GF+VVVPDFF+GDP++    + + VWL+ H  D   +DAKVVI  L+  GIS 
Sbjct  61   DKTARVGGFHVVVPDFFYGDPFIPEKTERL-VWLQSHGTDKGFEDAKVVIAALRNKGIST  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK VV+L+K  C++A VLLHP+ VT+DDI+ VK PI VLGAE D+ +PP++
Sbjct  120  IGAAGFCWGGKVVVELSKSDCIQAAVLLHPSRVTVDDIKEVKAPIAVLGAEFDKISPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +KQFE  L  K +V   VKIF GV HGW VRY +DD+ AVK+A EAHQDML WF K++ 
Sbjct  180  LKQFEEVLSTKPDVSGYVKIFPGVPHGWAVRYKDDDETAVKLANEAHQDMLDWFTKYVQ  238



>gb|KHG15388.1| Endo-1,3(4)-beta-D-glucanase [Gossypium arboreum]
Length=238

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 171/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V+ L GLN YVSG L SKLA+ L+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCSNPPTLDSASGAGHVENLAGLNTYVSGSLQSKLAVFLISDIFGYEAPNFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVV PDFF+G+PY  N   +P+ VW+KDH  D   +DAK+VI+ LK+ G+S 
Sbjct  61   DKVAASGFYVVAPDFFYGEPYDPNNPDRPLSVWIKDHGADKGYEDAKLVIDALKSKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K V  LAK P ++A V+LHP+FV +DDI+ VKVPI +LGAE D  + P++
Sbjct  121  IGAAGFCWGAKVVARLAKDPLIQAAVMLHPSFVNVDDIKSVKVPIAILGAEQDHISTPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQF+  L+A +EVDS VKIF  V HGW+VRYD +D  AV  A EA QDML WF K++
Sbjct  181  LKQFDEILKA-SEVDSFVKIFPKVGHGWSVRYDVNDPTAVSSANEAQQDMLAWFAKYV  237



>gb|KFK39652.1| hypothetical protein AALP_AA3G271900 [Arabis alpina]
Length=239

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPPKL  + G+  V++L GL+ YVSG L S LA+LLVS VFGYE  +LRKLA
Sbjct  1    MSDHQCTENPPKLDPNSGSCHVEKLAGLDSYVSGSLHSNLAVLLVSHVFGYETPHLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY  EN  +P+ VW+KDH  D   +++K V++ LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENHDRPLPVWIKDHGQDKAFEESKPVVDALKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G+ G C G K  V+LAK   VEATVLLHP+ VT+DDI+GVKVPI VLGAE D+ +PP++
Sbjct  121  IGVAGFCWGAKIAVELAKQELVEATVLLHPSRVTVDDIKGVKVPIAVLGAEFDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L  KTEV S VKIF  V HGWTVRY+ +D   V+ AEEAH+DML W I H+
Sbjct  181  VKQFEDILATKTEVKSFVKIFPRVKHGWTVRYNVNDPFEVEAAEEAHKDMLTWLIDHV  238



>ref|XP_011010276.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Populus euphratica]
Length=240

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 174/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C ANPP L  S GAG V+++GGL+ YVSG  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MAGPQCCANPPILNPSSGAGYVEKVGGLDSYVSGSPDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AGFY VVPDFF+GDP+  +N  +PI VWLKDH      +DAK VIE L + G+S 
Sbjct  61   DKIAAAGFYAVVPDFFYGDPFAPDNAERPIKVWLKDHGTHKGLEDAKPVIEALNSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPC-VEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            +G  G C G K VV+L K    ++A VL HP+FVT DD +  KVPI +LGAETD  +PP 
Sbjct  121  IGAVGFCWGAKVVVELGKSSAFIKAAVLCHPSFVTADDFKEFKVPISILGAETDHLSPPA  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L +K+EVDS VKIF  V HGWTVRYD +D+ AVK AEEAH ++L+W  K++
Sbjct  181  LLKQFEEVLASKSEVDSFVKIFPKVAHGWTVRYDVEDEAAVKSAEEAHGNLLEWLAKYV  239



>ref|XP_008368364.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS LA+LL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDVYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDANRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VL HP+ VT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  IGAAGFCWGAKVVVELSKHAXIQAAVLCHPSLVTVDDIKEVKVPISILGAEIDRMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EV S VKIF  V+HGWTVRY   D+ A K AEEAHQD+LKWF+ H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYSVXDEAACKSAEEAHQDLLKWFLNHV  238



>emb|CBI32343.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YVSGP DSKLAILL+SDV+GYEA NLR LA
Sbjct  1    MSGPQCCENPPTLSSSSGAGCVTEIGGLKAYVSGPSDSKLAILLISDVYGYEAPNLRNLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+ GAGFYVVVPDFF+GDP++     P  VW+K H  D   +DAK +I +L++ GI+ +
Sbjct  61   DKVAGAGFYVVVPDFFYGDPFLPETNIP--VWIKAHGTDKGFEDAKPIIAELRSKGINAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V+L+K   ++A VLLHP+FVT+DDI+ VK PI +LGAE D+ +PPK++
Sbjct  119  GAAGFCWGAKVAVELSKAGHIQAAVLLHPSFVTVDDIKEVKAPIAILGAEIDQYSPPKLL  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L  K EV+  VKIF GV HGW+VRY  +D+ AVK A EAHQ+M+ WF +++
Sbjct  179  KQFEEVLSTKPEVNGYVKIFPGVDHGWSVRYKVEDEEAVKQANEAHQNMMDWFTQYV  235



>ref|XP_003550071.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Glycine max]
Length=239

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 173/239 (72%), Gaps = 3/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V++L GLN Y+SG  +S +AILL+SD++GYEA NLR +A
Sbjct  1    MSGPECCSNPPVLNPNAGAGHVEKLAGLNSYLSGSPNS-IAILLISDIYGYEAPNLRNIA  59

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFFHGDPY  EN ++ I VWLKDH  D  S+ AK +IE LK+ G+  
Sbjct  60   DKVAAAGYYVVVPDFFHGDPYNPENASRSIPVWLKDHGTDKGSEAAKSIIEALKSKGVMA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FV++DDI+GV  P  VLGAE D+ +PP++
Sbjct  120  IGAAGFCWGAKVVVELAKSRLIQAAVLLHPSFVSVDDIKGVDTPTAVLGAEIDKMSPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVK-VAEEAHQDMLKWFIKHL  775
            VKQFE  L AK  VD  VKIF  V+HGWTVR++  D   VK  AEEAHQDML WF KHL
Sbjct  180  VKQFEQVLTAKPGVDCFVKIFPKVSHGWTVRFNPKDAETVKAAAEEAHQDMLNWFAKHL  238



>ref|XP_002275697.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Vitis vinifera]
Length=275

 Score =   280 bits (716),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YVSGP DSKLAILL+SDV+GYEA NLR LA
Sbjct  40   MSGPQCCENPPTLSSSSGAGCVTEIGGLKAYVSGPSDSKLAILLISDVYGYEAPNLRNLA  99

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+ GAGFYVVVPDFF+GDP++     P  VW+K H  D   +DAK +I +L++ GI+ +
Sbjct  100  DKVAGAGFYVVVPDFFYGDPFLPETNIP--VWIKAHGTDKGFEDAKPIIAELRSKGINAI  157

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  V+L+K   ++A VLLHP+FVT+DDI+ VK PI +LGAE D+ +PPK++
Sbjct  158  GAAGFCWGAKVAVELSKAGHIQAAVLLHPSFVTVDDIKEVKAPIAILGAEIDQYSPPKLL  217

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L  K EV+  VKIF GV HGW+VRY  +D+ AVK A EAHQ+M+ WF +++
Sbjct  218  KQFEEVLSTKPEVNGYVKIFPGVDHGWSVRYKVEDEEAVKQANEAHQNMMDWFTQYV  274



>ref|XP_008802649.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Phoenix 
dactylifera]
Length=238

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 174/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G G  V  LGGL  Y +GP DSKLAILL++DVFGYEA NLRKL
Sbjct  1    MASSQCCENPPTLNPASGQGCVVDDLGGLKAYTAGPSDSKLAILLIADVFGYEAPNLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADK+  AGF+VVVPDFF+GDPYV +  KPI  W++ H  D   +DAK+VIE LK  G+S 
Sbjct  61   ADKVAAAGFFVVVPDFFYGDPYVPD-QKPIMTWIEGHGTDKGFEDAKLVIEALKNKGVSA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K V +LAK   ++A V+LHP+FVT+DDI+ VK  I +LGAE D+ +PP++
Sbjct  120  IGAAGFCWGAKVVAELAKFNYIKAAVMLHPSFVTVDDIKEVKCHIAILGAEIDKMSPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +KQFE  L  K+EV+S VKIF GV HGWTVRYD  D+ AVK AEEAH+DM +WF KHL+
Sbjct  180  LKQFEEILSVKSEVNSYVKIFPGVVHGWTVRYDTSDEPAVKKAEEAHRDMFEWFTKHLN  238



>ref|XP_006406009.1| hypothetical protein EUTSA_v10021427mg [Eutrema salsugineum]
 dbj|BAJ33610.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47462.1| hypothetical protein EUTSA_v10021427mg [Eutrema salsugineum]
Length=239

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG LDSKL ILL+SD+FGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVSGSGHVEKLGGLDAYVSGSLDSKLCILLISDIFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDPY   N  + + VW+KDH  D   +D K V+E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYNPSNQERQVPVWIKDHGPDKGFQDTKPVLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K   ++A VLLHP+FV++DDI+G KVPI +LGAE D  +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKQELIQAAVLLHPSFVSVDDIKGGKVPIAILGAEFDNLSPPSL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K+EV+S VKI+  V HGWTVRY+ DD  AVK AEEAH++ML WF+ ++
Sbjct  181  LKQFEEILASKSEVNSCVKIYPKVAHGWTVRYNTDDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_008368374.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   278 bits (711),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS LA+LL+SD +G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDXYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAXRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VL HP+ VT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  IGAAGFCWGAKVVVELSKHAXIQAAVLCHPSLVTVDDIKEVKVPISILGAEIDRMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EV S VKIF  V+HGWTVRY   D+ A K AEEAHQD+LKWF+ H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYSVKDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_008234913.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=240

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 174/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YV+GP DSK AILL+SDV+G+EA NLRKLA
Sbjct  1    MSGPQCCENPPTLSSSSGAGSVTEIGGLKAYVTGPSDSKQAILLISDVYGFEAPNLRKLA  60

Query  245  DKIG-GAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI   AGF+VVVPDFF+GDPYV +N  +P+ VW++ H      +DAK +I  L+  G+S
Sbjct  61   DKIASAAGFHVVVPDFFYGDPYVPDNAERPVSVWIQSHGTGKGFEDAKPIIAALRNKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            K+G  G C G K VV+LAK   ++A VLLHP+ VT+DDI+ +K PI +LGAE D+ +PP+
Sbjct  121  KIGAAGFCWGAKVVVELAKSDYIQAAVLLHPSLVTVDDIKEIKAPIAILGAEFDKISPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++K++E  L  K EV+  VKIF GV HGWTVRY E+D+ AVK A EAHQD+L WF +H+
Sbjct  181  LLKKYEEVLSTKPEVNGYVKIFPGVPHGWTVRYKEEDEAAVKHAGEAHQDLLAWFTQHV  239



>gb|AFJ92670.1| GLU protein [Vitis amurensis]
Length=275

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YVSGP DSKLAILL+SDV+GYEA NLR LA
Sbjct  40   MSGPQCCENPPTLSSSSGAGCVTEIGGLKAYVSGPSDSKLAILLISDVYGYEAPNLRNLA  99

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+ GAGFYVVVPDFF+GDP++     P  VW+K H  D   +DAK +I +L++ GI+ +
Sbjct  100  DKVAGAGFYVVVPDFFYGDPFLPETNIP--VWIKAHGTDKGFEDAKPIIAELRSKGINAI  157

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K  ++L+K   ++A VLLHP+FV +DDI+ VK PI +LGAE D+ +PPK++
Sbjct  158  GAAGFCWGAKVAIELSKAGHIQAAVLLHPSFVNVDDIKEVKAPIAILGAEIDQYSPPKLL  217

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L  K EV+  VKIF GV HGW+VRY  +D+ AVK AEEAHQ+M+ WF +++
Sbjct  218  KQFEEVLSTKPEVNGYVKIFPGVDHGWSVRYKVEDEEAVKQAEEAHQNMMDWFAQYV  274



>ref|XP_008219062.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=238

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 171/237 (72%), Gaps = 0/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C +NPP L  SYG    ++LGGLN Y +G  DSKLAI+LVSDVFGY A NLRKLA
Sbjct  1    MAGPQCCSNPPILNPSYGVDCAEKLGGLNVYAAGSPDSKLAIVLVSDVFGYRAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            +K+  AGF+VVVP+FF+ DP+V +  +P+ VWL+DH  D   +DAK +I  LK  G S +
Sbjct  61   EKVAAAGFFVVVPNFFYDDPFVYDNNRPLAVWLEDHGTDKGFEDAKSIINALKEKGYSAI  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C GGK V +LAK   V+A VLLHP+FV LDDI+GVKVP+ VLGAE DE +P +++
Sbjct  121  GAAGFCWGGKVVTELAKSDFVQAAVLLHPSFVALDDIEGVKVPMAVLGAEIDEYSPLELL  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK+ +DS VKIF    H WTVRY+ +D+ AVK AEEAH +M+ WF KH+
Sbjct  181  KQFEEILAAKSGIDSYVKIFPKAEHSWTVRYNVEDEEAVKRAEEAHNNMIDWFSKHV  237



>ref|XP_006406017.1| hypothetical protein EUTSA_v10021426mg [Eutrema salsugineum]
 dbj|BAJ34546.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47470.1| hypothetical protein EUTSA_v10021426mg [Eutrema salsugineum]
Length=239

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  + G+G+V++LGGL+ YVSG   SKLA++LVS VFGYE   LRKLA
Sbjct  1    MSDHQCTENPPNLDPNSGSGQVEKLGGLDTYVSGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY  EN  +P+ VW+KDH  D   +D+K V+E LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENHDRPLPVWIKDHGQDKGFEDSKPVVEALKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LA+   VEA VLLHP+ VT+DDI+ VKVPI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKIAVELARQELVEAAVLLHPSRVTVDDIKEVKVPIAVLGAEFDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE     K EV S VKIF  V HGWTVRY+E+D   VK AEEAH+DML W I H+
Sbjct  181  VKQFEDIFATKPEVKSFVKIFPRVKHGWTVRYNENDPSEVKAAEEAHKDMLAWLIDHV  238



>ref|XP_010035807.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW84303.1| hypothetical protein EUGRSUZ_B01154 [Eucalyptus grandis]
Length=236

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S G G ++QLGGLN YV G  DSKLAILL+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCDNPPTLNPSSGDGFMEQLGGLNAYVIGSQDSKLAILLISDIFGYEAPNFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYV VPD+F+GDP+  EN  +P  VWLKDH  D   +  K +I+ LK+ GISK
Sbjct  61   DKVAAAGFYVAVPDYFNGDPFSPENPERPFTVWLKDHGTDKGFEATKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   ++A VLLHP FVTLDDI+ VKVPI VLGAE D  +PP++
Sbjct  121  IGAAGFCWGSKVAVELAKCELIQAAVLLHPVFVTLDDIKEVKVPIAVLGAEIDRFSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK+EVD  VKI+   +HGWT+RY  +D+ A   A EAH DM++WF+K +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIYPKTSHGWTIRYKVEDEAA---AMEAHSDMIQWFVKFV  235



>ref|XP_010035799.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Eucalyptus 
grandis]
Length=237

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S G G ++QLGGLN YV G  DSKLAILL+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCDNPPTLNPSSGDGFMEQLGGLNAYVIGSQDSKLAILLISDIFGYEAPNFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYV VPD+F+GDP+  EN  +P  VWLKDH  D   +  K +I+ LK+ GISK
Sbjct  61   DKVAAAGFYVAVPDYFNGDPFSPENPERPFTVWLKDHGTDKGFEATKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   ++A VLLHP FVTLDDI+ VKVPI VLGAE D  +PP++
Sbjct  121  IGAAGFCWGSKVAVELAKCELIQAAVLLHPVFVTLDDIKEVKVPIAVLGAEIDRFSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK+EVD  VKI+   +HGWT+RY  +D+ A   A EAH DM++WF+K +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIYPKTSHGWTIRYKVEDEAA---AMEAHSDMIQWFVKFV  235



>ref|XP_007200368.1| hypothetical protein PRUPE_ppa010677mg [Prunus persica]
 gb|EMJ01567.1| hypothetical protein PRUPE_ppa010677mg [Prunus persica]
Length=240

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 174/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YV+GP DSK AILLVSDV+G+EA NLRKLA
Sbjct  1    MSGPQCCENPPTLSSSSGAGSVTEIGGLKAYVAGPSDSKQAILLVSDVYGFEAPNLRKLA  60

Query  245  DKIG-GAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI   AGF+VVVPDFF+GDPYV +N  +P+ VW++ H      +DAK +I  L+  G+S
Sbjct  61   DKIASAAGFHVVVPDFFYGDPYVPDNAERPVSVWIQSHGTGKGFEDAKPIIAALRNKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            K+G  G C G K VV+LAK   ++A VLLHP+ VT+DDI+ +K PI +LGAE D+ +PP+
Sbjct  121  KIGAAGFCWGAKVVVELAKSDYIQAAVLLHPSLVTVDDIKEIKAPIAILGAEFDKISPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++K++E  L +K EV+  VKIF GV HGWTVRY E+D+ AVK A EAH D+L WF +H+
Sbjct  181  LLKKYEEVLSSKPEVNGYVKIFPGVPHGWTVRYKEEDEAAVKHAGEAHHDLLAWFTQHV  239



>gb|EPS69745.1| hypothetical protein M569_05020 [Genlisea aurea]
Length=238

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 173/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYS-YGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M+   C  NPP+L      AG V++ GGL+ YVSGP DS  A+LLVSDVFGYEA NLRKL
Sbjct  1    MAGAQCCENPPELIAGGSAAGSVEEFGGLSSYVSGPADSGFAVLLVSDVFGYEAPNLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADKIG AGF+ VVPD F GDP+    +  +G W+K H  D   +DAK V+E LKA G++K
Sbjct  61   ADKIGDAGFFAVVPDLFRGDPFAPEKSG-LGDWIKGHGTDKGFEDAKPVVEALKAKGVAK  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VLLHP+FVTL+DI GVKVPI +LGAE D+ +PP++
Sbjct  120  IGAAGFCWGAKVVVELSKEAHIQAAVLLHPSFVTLEDIHGVKVPISILGAEIDKASPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            + QFE AL++K EVDS VKIF GV HGW++RYD  D  AVK AEEAH D+L+W  KHL+
Sbjct  180  LIQFEAALKSKAEVDSFVKIFPGVGHGWSIRYDVSDAEAVKRAEEAHADLLQWLHKHLN  238



>ref|XP_009339925.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Pyrus 
x bretschneideri]
Length=239

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS  A+LL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNFAVLLISDVYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  +P+ VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDANRPVSVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VL HP+ VT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKEVKVPISILGAEIDRMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V+QFE  L  K EV S VKIF  V+HGWTVRY  +D+ A K AEEAHQD+LKWF+ H+
Sbjct  181  VRQFEEVLTTKPEVKSHVKIFPKVSHGWTVRYSVEDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_010527419.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=240

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 170/234 (73%), Gaps = 1/234 (0%)
 Frame = +2

Query  77   HCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIG  256
             C  N P L  S G+G+V++LGGL+ YVSG  DSKL I+L SDVFGYEA NLR LADKI 
Sbjct  6    QCCENRPTLNPSSGSGRVEKLGGLDAYVSGSPDSKLGIVLFSDVFGYEAPNLRNLADKIA  65

Query  257  GAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIG  433
             AGF VVVPDF  GDPY  EN  +P+ VWLKDH  D   +D+K +IE LK+ GI+ VG  
Sbjct  66   AAGFLVVVPDFLKGDPYEPENQDRPLHVWLKDHEPDKGFEDSKPLIEALKSKGITAVGAA  125

Query  434  GVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQF  613
            G C GGK VV++AK   ++A VLLHP+FVT+DDI+  K PI VLGAE D T+PP+++KQF
Sbjct  126  GACFGGKVVVEMAKNELIQAAVLLHPSFVTVDDIKEFKAPIAVLGAENDRTSPPELLKQF  185

Query  614  EIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            E  L  K EV S VKI+  V+HGW +RYD DD+ AVK AEEAH+DML+W + H+
Sbjct  186  EQVLAFKPEVKSHVKIYENVSHGWGIRYDPDDESAVKAAEEAHKDMLEWSLIHV  239



>ref|XP_008223021.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Prunus 
mume]
Length=246

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 177/239 (74%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C +NPP +  S G+G V++LGGL+ YV+G  DSKLAILLVSD+FG+EA NLRKLA
Sbjct  1    MSGLQCCSNPPTINPSSGSGHVEKLGGLDSYVTGFPDSKLAILLVSDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF +GDPY  E+  +P+ VW+KDH      +DAK V+  L+  G S 
Sbjct  61   DKVAAAGFFVVVPDFLYGDPYAPEDANRPLPVWIKDHGPAKGFEDAKPVLGALRRKGFSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C GGK VV+LAK   ++A VL HP+FVT+DDI+ VKVPI +LGAE D  +PP+V
Sbjct  121  VGAAGFCWGGKVVVELAKHNFIQAAVLCHPSFVTVDDIKAVKVPISILGAEIDHMSPPEV  180

Query  602  VKQFEIALQAKTE-VDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+E V S VKIF  V HGWTVRY+ +D+ AVK AEEAHQ++L+WF+ H+
Sbjct  181  VKQFEEVLTAKSEVVKSHVKIFPKVAHGWTVRYNVEDEAAVKCAEEAHQNLLEWFLNHV  239



>ref|XP_009102607.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Brassica rapa]
Length=239

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPPKL  + G+G V++LGGL+ YVSG   SKLA++LVS VFGYE   LRKLA
Sbjct  1    MSGHQCTENPPKLDPNSGSGHVEKLGGLDSYVSGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY   N  +P+ +W+KDH  D   +D+K V++ LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPANEDRPLPIWIKDHPQDKAFEDSKPVVDALKNKGITT  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K  V+LAK   V+A VLLHP+ VT+DDI+GVKVPI VLGAE D+ TPPK+
Sbjct  121  VGAAGFCWGAKVAVELAKQELVKAVVLLHPSRVTVDDIKGVKVPISVLGAEYDQVTPPKL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V+QF+  L  K EV S VKIF  V HGWTVRYD +D   V+ A+EAH+DML W I H+
Sbjct  181  VQQFQNVLATKPEVKSFVKIFPRVKHGWTVRYDPNDPSEVEAAKEAHKDMLVWLINHV  238



>ref|XP_002524812.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF37655.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 170/239 (71%), Gaps = 1/239 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L    G G V ++GGL  Y +GP D K +I+L+SD+FG+EA NLRKLA
Sbjct  1    MSGSQCCENPPTLSSGSGIGSVTEIGGLKVYATGPSDCKRSIVLISDIFGWEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+GDPYV EN  +P+ +W+K H  D   +DAK +I  LK+ G+S 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPYVPENADRPLPIWIKSHGTDKGFEDAKPIIAALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FVT+DDI+ +K PI +LGAE D  +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKSDPIQAAVLLHPSFVTVDDIKEIKEPIAILGAEIDHLSPPTL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +KQFE  L A+ E++  VKIF GV HGWTVRY  +D+ AV+ AEEAH+DML WF +++ 
Sbjct  181  LKQFEEVLSARPEINGYVKIFPGVAHGWTVRYKTEDEKAVECAEEAHKDMLDWFAEYVQ  239



>ref|XP_011071517.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=253

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 171/237 (72%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            +S+  C  NPP      GAGK+Q+LGGL+CYVSG  DS  +++L+SD+FGYE  +LR LA
Sbjct  18   VSSHQCTDNPPTQSPYRGAGKIQKLGGLDCYVSGSADSNFSVILISDIFGYEVPHLRMLA  77

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AGFY VVPDFF GDP+ +  +  + +W K H  D   KDAK +++ ++  GISK+
Sbjct  78   DKVAAAGFYTVVPDFFRGDPFKDGDS--LQIWFKHHGYDQGFKDAKAIVKAIERNGISKI  135

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G+ G C GGK  V+L +   +EA VLLHP+ VT+ DI+GV+VPI +LGA  DE TPP++V
Sbjct  136  GVAGFCWGGKVNVELMERAYIEAGVLLHPSNVTVPDIRGVRVPISILGAGIDEVTPPELV  195

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++FE  L+ K EVDS VKIF GV HGWT RY++DDK+AVK AEEAH  ML WFIKHL
Sbjct  196  RKFEAVLKKKPEVDSFVKIFPGVQHGWTTRYNDDDKLAVKRAEEAHNAMLHWFIKHL  252



>ref|XP_010466703.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Camelina 
sativa]
Length=241

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPH--CIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS  H  C  NPP L  + G+G V++LG L+ YVSG   SKLA+LLVS VFGYE  NLRK
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            LADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +   +++K ++E LK  GI
Sbjct  61   LADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPIVEALKNKGI  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            + +G  G C G K  V+LAK   V+ATVLLHP+ VT+DDI+GV +PI VLGAE D+ +PP
Sbjct  121  TSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVNIPIAVLGAELDQVSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++V+QFE  L +K EV S VKIF  V HGWTVRY+E+D   V+ AEEAH+DML W   H+
Sbjct  181  ELVRQFEDVLASKPEVKSFVKIFPSVKHGWTVRYNENDPSEVEAAEEAHKDMLAWLTNHV  240



>gb|EYU38136.1| hypothetical protein MIMGU_mgv1a012773mg [Erythranthe guttata]
Length=240

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 172/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  + G G V + GGL  YVSGP DSKLA+LL SDVFGYEA  LRK+A
Sbjct  1    MSGPQCCANPPTLSPNSGVGSVIEFGGLKSYVSGPSDSKLAVLLASDVFGYEAPELRKIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AG+YVVVPDFF+GDP   +N  K + VWL  H      ++AK+VI+ LK+ GI+ 
Sbjct  61   DKIAAAGYYVVVPDFFNGDPLDPDNVEKLLPVWLSLHEPAKAYEEAKLVIDALKSKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIP-CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            +G  G C G K VV+LAK    ++A VLLHP+FVTLDD++ VK P+ +LGAE D+ TPP+
Sbjct  121  IGAAGFCYGAKVVVELAKSSDLIQAGVLLHPSFVTLDDVKEVKAPLAILGAEMDQYTPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L + +EV+S VKIF GV HGWTVRYD DD++AVK AEEA QD L W +K +
Sbjct  181  LVKQFEEILSSNSEVESFVKIFPGVAHGWTVRYDLDDEMAVKSAEEAQQDTLDWIMKFV  239



>ref|XP_010909270.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Elaeis guineensis]
Length=238

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 171/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G G  V  LGGL  Y +GP DSKLAILL +D FGYEA NLRKL
Sbjct  1    MASSQCYENPPTLNPASGQGCVVDDLGGLKAYTAGPSDSKLAILLAADAFGYEAPNLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADK+  AGF+VVVPDFFHGDPYV +  KP+  W++ H  D   +DAK+VIE LK  G+S 
Sbjct  61   ADKVAAAGFFVVVPDFFHGDPYVPD-QKPVKTWIESHEKDKGFEDAKLVIEALKNKGVSA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G + V +LAK   +++ V+LHP+FVT+DDI+ VK  I + GAE D+T+PP++
Sbjct  120  IGAAGFCWGAQVVAELAKSGYIKSAVMLHPSFVTVDDIKEVKCHIAIFGAEIDKTSPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L  K+EV+S VKIF GV HGWT+RYD  D+ AVK AEEAHQ ML+WF KHL
Sbjct  180  LKQFEEILSLKSEVNSYVKIFPGVAHGWTMRYDTSDETAVKKAEEAHQGMLEWFAKHL  237



>ref|XP_010512613.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Camelina sativa]
Length=241

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 173/240 (72%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPH--CIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS  H  C  NPP L  + G+G V++LG L+ YVSG   SKLA+LLVS VFGYE  NLRK
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            LADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +   +++K ++E LK  GI
Sbjct  61   LADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPIVEALKNKGI  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            + +G  G C G K  V+LAK   V+ATVLLHP+ VT+DDI+GV +PI VLGA+ D+ +PP
Sbjct  121  TSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVNIPIAVLGAKFDQVSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++V+QFE  L +K+EV S+VKIF  V HGWTVRY+E+D   V+ AEEAH+DML W   H+
Sbjct  181  ELVRQFEYVLASKSEVKSVVKIFPSVKHGWTVRYNENDPSEVEAAEEAHKDMLAWLTNHV  240



>emb|CDX85111.1| BnaC07g07950D [Brassica napus]
Length=239

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPPKL  + G+G V++LGGL+ YVSG   SKLA++LVS VFGYE   LRKLA
Sbjct  1    MSGHQCTENPPKLDPNSGSGHVEKLGGLDSYVSGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY   N  +P+ +W+KDH  D   +D+K V++ LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPANEDRPLPIWIKDHPQDKGFEDSKPVVDALKNEGITT  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K  V+LAK   V+A VLLHP+ VT+DDI+GVKVPI VLGAE D+ TPP++
Sbjct  121  VGAAGFCWGAKVAVELAKQELVKAVVLLHPSRVTVDDIKGVKVPISVLGAEYDQVTPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQF+  L  K EV S VKIF  V HGWTVRYD +D   VK AEEAH+DML W   H+
Sbjct  181  VKQFQHVLATKPEVKSFVKIFPRVRHGWTVRYDPNDPSEVKAAEEAHKDMLVWLTNHV  238



>ref|XP_010103440.1| hypothetical protein L484_010042 [Morus notabilis]
 gb|EXB95843.1| hypothetical protein L484_010042 [Morus notabilis]
Length=237

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 170/238 (71%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G G V++LGGL+ YV+G  +SKLA+LL+SD++GYEA N RKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGEGHVEKLGGLDSYVTGSPNSKLAVLLISDIYGYEAPNFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF+V VPDF HGDPY       IG+WL DH  DN  ++AK VIEDLK+ G S +
Sbjct  61   DKIAAAGFFVAVPDFVHGDPYDSEDFSRIGIWLNDHGTDNAFEEAKPVIEDLKSQGFSAI  120

Query  425  GIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            G  G+C G K V +LAK    ++A  LLHP+ VTLDDI+ VKV I +LGAE D+ +PP++
Sbjct  121  GAAGLCWGAKVVTELAKFNNFIQAGALLHPSLVTLDDIKEVKVSIAILGAEFDQASPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK E+DS VKI+ GV HGWT+R    D+ A K AEE+H D+L++F KH+
Sbjct  181  VKQFEKILSAKPEIDSFVKIYPGVEHGWTIR--PSDEAARKTAEESHNDLLEFFTKHV  236



>emb|CAN80740.1| hypothetical protein VITISV_016685 [Vitis vinifera]
Length=251

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 174/250 (70%), Gaps = 13/250 (5%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNL----  232
            MS P C  +PP L  + G+G V+QLGGL+CY++G   SKLAILLVSD++GY         
Sbjct  1    MSGPQCCEHPPSLNPNSGSGHVEQLGGLSCYIAGSPHSKLAILLVSDIYGYNTNCFSCMA  60

Query  233  --------RKLADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKV  385
                    +KLADK+  AGFYVV PDF +GDPYV + A +P+ VW+KDH +D   +D K 
Sbjct  61   SKPDIMKNKKLADKVAAAGFYVVAPDFLYGDPYVPDKAERPLPVWIKDHGMDKGFEDTKP  120

Query  386  VIEDLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVL  565
            VIE LK+ G+S +G  G C G K VV+LAK   ++A VLLHP+FV+LDDI+GVKVP  VL
Sbjct  121  VIEALKSKGVSAIGAAGFCWGAKVVVELAKSGYIQAAVLLHPSFVSLDDIKGVKVPTAVL  180

Query  566  GAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQ  745
            GAE D+ +PP +VKQFE  L AK  VD  VKIF GV HGWTVRY+ +D  AVK AEEAHQ
Sbjct  181  GAEIDQMSPPALVKQFEEILTAKPGVDGFVKIFPGVAHGWTVRYNAEDAGAVKCAEEAHQ  240

Query  746  DMLKWFIKHL  775
            DML WF K++
Sbjct  241  DMLGWFSKYV  250



>gb|KCW84310.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=218

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L    G+G V+QLGGL  YV G  DSKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D   ++ K +I+ LK+ GISK
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FVT+DDI+GVKVPI VLGAE D+ +PP +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDK  712
            +KQFE  L AK+EVD  VKIF  V+HGWT+RY  +D+
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDE  217



>ref|XP_011071533.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=240

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 1/234 (0%)
 Frame = +2

Query  77   HCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIG  256
             C +NPP L    GAG+VQ+LGGL CY+SG  DSK++I+L+SD+FGYEA  LRKLADK+ 
Sbjct  6    QCCSNPPTLIPDCGAGEVQELGGLTCYISGSADSKISIILISDIFGYEAPKLRKLADKVA  65

Query  257  GAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIG  433
             AGFY VVPD+F GDP   E   +    W+K+H     SKD K +IE LK+ GI+K+G  
Sbjct  66   AAGFYTVVPDYFRGDPCDAERFHQVFPGWIKNHCPTQGSKDTKPLIEALKSKGITKIGAA  125

Query  434  GVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQF  613
            G C G K VV+LAK   ++A VL+HP+ V+L+DIQGVKVPI +LGAE D  +PP++VKQF
Sbjct  126  GFCWGAKVVVELAKEGYIQAGVLIHPSLVSLEDIQGVKVPISILGAEHDHASPPELVKQF  185

Query  614  EIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            E AL AK EVD+ VKIF GV+HGW +R  +DD  AV  AEEAH DML WF+K+L
Sbjct  186  ETALNAKPEVDAFVKIFPGVSHGWAIRCSDDDDHAVNSAEEAHGDMLDWFVKYL  239



>gb|KHN03434.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=240

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 173/240 (72%), Gaps = 4/240 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V++L GLN Y+SG  +S +AILL+SD++GYEA NLR +A
Sbjct  1    MSGPECCSNPPVLNPNAGAGHVEKLAGLNSYLSGSPNS-IAILLISDIYGYEAPNLRNIA  59

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFFHGDPY  EN ++ I VWLKDH  D  S+ AK +IE LK+ G+  
Sbjct  60   DKVAAAGYYVVVPDFFHGDPYNPENASRSIPVWLKDHGTDKGSEAAKSIIEALKSKGVMA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FV++DDI+GV  P  VLGAE D+ +PP++
Sbjct  120  IGAAGFCWGAKVVVELAKSRLIQAAVLLHPSFVSVDDIKGVDTPTAVLGAEIDKMSPPEL  179

Query  602  VKQFEIALQAKTE-VDSLVKIFGGVTHGWTVRYDEDDKIAVK-VAEEAHQDMLKWFIKHL  775
            VKQFE  L AK   VD  VKIF  V+HGWTVR++  D   VK  AEEAHQDML WF KHL
Sbjct  180  VKQFEQVLTAKPGVVDCFVKIFPKVSHGWTVRFNPKDAETVKAAAEEAHQDMLNWFAKHL  239



>ref|XP_008353277.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=245

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS LA+LL+SD +G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDXYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  + I VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAXRXISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VL HP+ VT+DDI+ VKVPI VLGAE D+ +PP+V
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKEVKVPISVLGAEIDQMSPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EV S VKIF  V+HGWTVRY+ +D+ A K AEEAHQD+L+W + H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYNVEDEAACKSAEEAHQDLLEWLLNHV  238



>ref|XP_010488428.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=241

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 170/240 (71%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPH--CIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS  H  C  NPP L  + G+G V++LG L+ YVSG   SKLA+LLVS VFGYE  NLRK
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            LADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +   +++K ++E LK  GI
Sbjct  61   LADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPIVEALKNKGI  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            + +G  G C G K  V+LAK   V+ATVLLHP+ VT+DDI+GV +PI VLGAE D+ +PP
Sbjct  121  TSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVSIPIAVLGAEFDQVSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++V+QFE  L +K EV   VKIF  V HGWTVRY+E+D   V+ AEEAH+DML W   H+
Sbjct  181  ELVRQFEDVLASKPEVKIFVKIFPSVKHGWTVRYNENDPFEVEAAEEAHKDMLSWLTNHV  240



>ref|XP_010938744.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Elaeis guineensis]
Length=238

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 170/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G G  V  LGGL  Y  GP   K A+LLVSDVFGYEA NLRKL
Sbjct  1    MASSQCCENPPTLNPASGQGCVVDDLGGLKAYTVGPPACKTAVLLVSDVFGYEAPNLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADK+  AGF+VVVPDFF GDPYV +  KP+ +WL  H  D   +DAK+VIE LK  G+S 
Sbjct  61   ADKVAAAGFFVVVPDFFRGDPYVPD-KKPLDIWLASHGTDKGFEDAKLVIEALKNKGVST  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K V DLAK   ++A V+LHP+FVT+DDI+ VK  + +LGAE D+ +PP++
Sbjct  120  VGAAGFCWGAKVVADLAKYDYIKAAVMLHPSFVTVDDIKLVKCHLAILGAEIDKMSPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +KQFE  L  K+EV+S VKIF GV HGWTVRYD  D+ AVK AEE+HQDML+WF KHL+
Sbjct  180  LKQFEEILSLKSEVNSYVKIFPGVVHGWTVRYDTGDETAVKKAEESHQDMLEWFAKHLN  238



>ref|XP_010466706.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Camelina sativa]
Length=241

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  DSKL ++LVSDV+GYEA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGNVEKLGGLDAYVSGSPDSKLCVILVSDVYGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D   ++ K ++E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFCGDPYDPSNQERPIQVWIKDHGCDKGFEETKPLLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K+  ++A VLLHP+FVT+DDI+ VK PI +LGAE D  +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKVELIQAAVLLHPSFVTVDDIKVVKAPIAILGAEFDNLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE +L +K EV S VKIF  V+HGWTVRY  D+  AVK A+EAH++ML WF+ +L
Sbjct  181  VKQFEESLASKPEVYSYVKIFPKVSHGWTVRYKIDEPEAVKAADEAHKEMLDWFVTYL  238



>ref|XP_009362383.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Pyrus 
x bretschneideri]
Length=240

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKL-CYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS P C +NPP L   SYG     ++LGGLN YV G  +SKLAILLVS+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNSDEKLGGLNVYVVGSPNSKLAILLVSNVFGYRVPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D   +DAK +I  LK  G+S
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVHDNDRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K V++LAK   ++A +LLHP+FV LDDIQ VKVPI + GAE D+ +PP+
Sbjct  121  AIGAAGFCWGAKVVIELAKSDFIQAALLLHPSFVALDDIQEVKVPIAIQGAEIDDYSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L AK EVDS VKIF    HGWT+ Y+ +D+ AVK AEEAH++ L WF+KH+
Sbjct  181  LVKQFEQILAAKPEVDSFVKIFPKAEHGWTMSYNAEDEEAVKRAEEAHRNTLAWFVKHV  239



>ref|XP_008352794.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Malus 
domestica]
Length=240

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKL-CYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS P C +NPP L   SYG     ++LGGLN YV+G  +SKLAILL+S+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNCXEKLGGLNVYVAGSPNSKLAILLISNVFGYRVPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D   +DAK +I  LK  G+S
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVYDNNRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K V +LAK   ++A VLLHP+FVTLDDIQ VKVPI + GAE D+ +PP+
Sbjct  121  AIGAAGFCWGAKVVTELAKSDFIQAAVLLHPSFVTLDDIQEVKVPIAIQGAEIDDYSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L AK EVDS VKIF    H WT+ Y+ +D+ AVK AEEAH++ L WF+KH+
Sbjct  181  LVKQFEQILAAKPEVDSFVKIFPKAEHXWTMSYNVEDEEAVKRAEEAHRNTLAWFVKHV  239



>emb|CDX77499.1| BnaA07g06370D [Brassica napus]
Length=239

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 167/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPPKL  + G+G V++LGGL+ Y+SG   SKLA++LVS VFGYE   LRKLA
Sbjct  1    MSGHQCTENPPKLDPNSGSGHVEKLGGLDSYISGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY   N  +P+ +W+KDH  D   +D+K V+E LK  G++ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPANEDRPLPIWIKDHPQDKGFEDSKPVVEALKNKGLTT  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K  V+LAK   V+A VLLHP+ VT+DDI GVKVPI VLGAE D+ TPP++
Sbjct  121  VGAVGFCWGAKVAVELAKQELVKAVVLLHPSRVTVDDINGVKVPISVLGAEYDQVTPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQF+  L  K EV S VKIF  V HGWTVRYD +D   V+ AEEAH+DML W   H+
Sbjct  181  VKQFQNVLATKPEVKSFVKIFPRVKHGWTVRYDPNDPSEVEAAEEAHKDMLVWLTNHV  238



>ref|XP_010532702.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=239

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  + G G+V++ GGL+ Y++G  +S   ILLVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCENPPTLDPNSGLGRVEKFGGLDTYITGSPNSNRGILLVSDIFGYQAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAK---PIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGFYVVVPDFF+GDPY  NG +   PI VWLK+H      +D+K VIE LK  GI
Sbjct  61   DKVAAAGFYVVVPDFFYGDPY--NGVEDYGPIAVWLKNHGPLKGFEDSKPVIEALKCKGI  118

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            + +G  G+C G K VV+L K   ++A V LHP+FVT+DDI+ VKVP+ +LGAE D  +PP
Sbjct  119  TAIGAAGMCWGAKVVVELDKTELIQAGVFLHPSFVTVDDIKDVKVPLAILGAELDHVSPP  178

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             ++KQFE  L +K EV S VKIF GV+HGW+VRYD +D  AVK AEE+H++ML WFI ++
Sbjct  179  ALLKQFEEVLASKPEVKSYVKIFPGVSHGWSVRYDTNDPAAVKAAEESHKEMLDWFITYV  238



>ref|XP_008802648.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Phoenix dactylifera]
Length=238

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G G  V  LGGL  Y +GP DSKLAILL+SDVFGYEA NLRKL
Sbjct  1    MASSQCCENPPTLNPAGGQGCVVDDLGGLKAYTAGPSDSKLAILLISDVFGYEAPNLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADK+  AGF+VVVPDFF+GDPYV +  KPI  W+  H  D   +DAK+VIE LK  G+S 
Sbjct  61   ADKVAAAGFFVVVPDFFYGDPYVPD-QKPITTWIGSHGTDKGFEDAKLVIEALKNKGVSA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K V +L K   ++A V+LHP+ VT+DDI+ VK  I +LGAE D+ +PP++
Sbjct  120  IGAAGFCWGAKVVAELGKSDYIKAAVMLHPSLVTVDDIKEVKCHIAILGAEIDKISPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +KQFE  L  K+EV+S VKIF GV HGWTVRYD  D+ AVK AEEAHQ ML+WF K+L+
Sbjct  180  LKQFEEILSVKSEVNSYVKIFPGVAHGWTVRYDTSDEPAVKKAEEAHQGMLEWFTKYLN  238



>ref|XP_010512630.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=239

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  DSKL  +LVSDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGNVEKLGGLDAYVSGSPDSKLCAILVSDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D   ++ K ++E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFCGDPYDPSNQERPIQVWIKDHGCDKGFEETKPLLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K+  ++A VLLHP+FVT+DDI+ VK PI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKVELIQAAVLLHPSFVTVDDIKDVKAPIAILGAEIDKLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV S VKIF  V+HGWTVRY+ D+  AVK A+E+H++ML WF+ ++
Sbjct  181  VKQFEEILASKPEVYSYVKIFPKVSHGWTVRYNIDEPEAVKAADESHKEMLDWFVTYV  238



>ref|XP_002275597.2| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Vitis vinifera]
Length=245

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 171/239 (72%), Gaps = 3/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YVSGP DSKL ILLVSD+FGYEA NLRKLA
Sbjct  7    MSGPQCCENPPTLTSSSGAGCVAEIGGLKAYVSGPSDSKLVILLVSDLFGYEAPNLRKLA  66

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHA--VDNVSKDAKVVIEDLKAAGIS  418
            DK+  AGFYVVVPDFF+GDP+V      I VW+K H    D   +DAK V+ +L++ GI+
Sbjct  67   DKVAAAGFYVVVPDFFYGDPFVPETMT-IPVWIKKHMEWFDKGFEDAKPVVAELRSKGIN  125

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K VV+L+K+  ++A VL HPA VT+DDI+ +K P  +LGAETD  +PP+
Sbjct  126  AIGAAGFCWGAKVVVELSKVDQIQAAVLFHPARVTVDDIKEIKAPTAILGAETDHVSPPE  185

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L  K EV+  VKIF GV HGW+VRY  +D+ AVK A+E+HQ+M+ WF +++
Sbjct  186  LLKQFEEVLSTKPEVNGYVKIFPGVAHGWSVRYKVEDEEAVKRADESHQNMMDWFAQYV  244



>ref|XP_002275501.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Vitis vinifera]
 emb|CAN67688.1| hypothetical protein VITISV_036609 [Vitis vinifera]
Length=239

 Score =   271 bits (692),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L    G G V ++GGL  YV+GP DSK AILLVSD+FGYEA   RKLA
Sbjct  1    MSDSQCCENPPNLTSICGGGSVIEVGGLKAYVAGPSDSKHAILLVSDIFGYEAPKFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVEN-GAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+GDP+V +   KPI VW + H  D   +DAK VI  LK+ GIS 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVFDIPEKPIEVWRESHGTDKGFEDAKPVIAALKSKGIST  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   +++ VLLHP+ VT+DDI+ VK PI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVVVELAKSDYIQSAVLLHPSRVTVDDIKEVKAPIAVLGAEIDKASPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L  K EV+S VKIF GV HGW+VRY ++++I VK AEEAHQ+M+ WF +++
Sbjct  181  LKQFEEVLSTKPEVNSYVKIFPGVVHGWSVRYKDENEIEVKSAEEAHQNMVDWFTRYV  238



>emb|CBI32342.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 171/239 (72%), Gaps = 3/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V ++GGL  YVSGP DSKL ILLVSD+FGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLTSSSGAGCVAEIGGLKAYVSGPSDSKLVILLVSDLFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHA--VDNVSKDAKVVIEDLKAAGIS  418
            DK+  AGFYVVVPDFF+GDP+V      I VW+K H    D   +DAK V+ +L++ GI+
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVPETMT-IPVWIKKHMEWFDKGFEDAKPVVAELRSKGIN  119

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K VV+L+K+  ++A VL HPA VT+DDI+ +K P  +LGAETD  +PP+
Sbjct  120  AIGAAGFCWGAKVVVELSKVDQIQAAVLFHPARVTVDDIKEIKAPTAILGAETDHVSPPE  179

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L  K EV+  VKIF GV HGW+VRY  +D+ AVK A+E+HQ+M+ WF +++
Sbjct  180  LLKQFEEVLSTKPEVNGYVKIFPGVAHGWSVRYKVEDEEAVKRADESHQNMMDWFAQYV  238



>emb|CBI32341.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L    G G V ++GGL  YV+GP DSK AILLVSD+FGYEA   RKLA
Sbjct  19   MSDSQCCENPPNLTSICGGGSVIEVGGLKAYVAGPSDSKHAILLVSDIFGYEAPKFRKLA  78

Query  245  DKIGGAGFYVVVPDFFHGDPYVEN-GAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+GDP+V +   KPI VW + H  D   +DAK VI  LK+ GIS 
Sbjct  79   DKVAAAGFYVVVPDFFYGDPFVFDIPEKPIEVWRESHGTDKGFEDAKPVIAALKSKGIST  138

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   +++ VLLHP+ VT+DDI+ VK PI VLGAE D+ +PP++
Sbjct  139  IGAAGFCWGAKVVVELAKSDYIQSAVLLHPSRVTVDDIKEVKAPIAVLGAEIDKASPPEL  198

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L  K EV+S VKIF GV HGW+VRY ++++I VK AEEAHQ+M+ WF +++
Sbjct  199  LKQFEEVLSTKPEVNSYVKIFPGVVHGWSVRYKDENEIEVKSAEEAHQNMVDWFTRYV  256



>ref|XP_009339923.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=237

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G+G V++LGG + YV+G  +SKLA+LLV D FGYEA   R LA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPESKLAVLLVHDAFGYEAPKARMLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF VV+PDFF+ DP+  + A  + VW+K HA D   +DAK+VIE LK+ G+S V
Sbjct  61   DKIAAAGFIVVLPDFFNRDPFNGDLAS-LPVWIKAHAPDKTIEDAKLVIEALKSKGVSAV  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C GGK VV+LAK   ++A VL HP+FVTLDDI+ VKVPI VLGAE D+ TPP+VV
Sbjct  120  GAVGFCWGGKGVVELAKHDFIQAAVLCHPSFVTLDDIKAVKVPISVLGAEIDQLTPPEVV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK E+ S VKIF  + HGWT+RY+++D+ AVKVAEEAHQD+L WF++++
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKLVHGWTLRYNDEDEAAVKVAEEAHQDLLGWFLENI  236



>ref|XP_010905246.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Elaeis guineensis]
Length=240

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 167/240 (70%), Gaps = 2/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C ANPP L    G G  V  LGGL  Y +G  DSK+AI+L SDV+G+EA NLRK+
Sbjct  1    MASSQCCANPPTLSPGSGQGCVVDDLGGLKAYTAGSPDSKIAIILASDVYGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADKI G+GF+VVVPDFF+G+PY  N A +P+ +W++ H      +DAK VI  LK+ GIS
Sbjct  61   ADKIAGSGFFVVVPDFFYGEPYAPNNAERPLPIWIQSHTTAKGFEDAKSVIAALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K  V+LAK   ++A VLLHP+FV++DDI+ VK PI +LGAE+D  +PP+
Sbjct  121  AVGAAGFCWGAKVAVELAKADEIQAAVLLHPSFVSVDDIKEVKCPIAILGAESDHLSPPQ  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +VKQFE  L AK  V   VKIF GV HGW+VRY  DD  AV+ AEEAHQD L WF KH+ 
Sbjct  181  LVKQFEQILSAKKRVSYFVKIFPGVAHGWSVRYKTDDASAVRSAEEAHQDTLDWFAKHVR  240



>ref|NP_566732.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAB02778.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36041.1| AT3g23600/MDB19_9 [Arabidopsis thaliana]
 gb|AAM19921.1| AT3g23600/MDB19_9 [Arabidopsis thaliana]
 gb|AAM61180.1| contains similarity to endo-1,3-1,4-beta-D-glucanase [Arabidopsis 
thaliana]
 gb|AEE76781.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=239

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  +SKL +LL+SD+FG+EA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSAESKLCVLLISDIFGFEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D   ++ K V+E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFGGDPYNPSNQDRPIPVWIKDHGCDKGFENTKPVLETIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K   ++A VLLHP+FV +DDI+G K PI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKEELIQAAVLLHPSFVNVDDIKGGKAPIAILGAEIDQMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI   V+HGWTVRY+ D+  AVK AEEAH++ML WF+ ++
Sbjct  181  LKQFEEILSSKPEVNSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYI  238



>ref|XP_010038123.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW49940.1| hypothetical protein EUGRSUZ_K03402 [Eucalyptus grandis]
Length=240

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPK-LCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            MS   C  NPP     S G G V ++GGL  Y++GP D++L++LLVSDVFGYEA  LRKL
Sbjct  1    MSETQCCENPPTPSTMSVGIGCVAEIGGLKAYITGPPDAELSVLLVSDVFGYEAPKLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+   GFYVVVPDFF+GDPYV +N  +PI VW + H  D   +DA  V+  L++ G+S
Sbjct  61   ADKVAACGFYVVVPDFFYGDPYVPDNPERPIAVWRQSHGTDKGFEDAIRVVSALRSEGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K VV+L K   V+A VLLHP+ VT++DI+ VK PI VLGAE D+ +PP+
Sbjct  121  AIGAAGFCWGAKVVVELGKSDHVQAAVLLHPSRVTVEDIKEVKAPIAVLGAEHDKMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L AK EVD  VKIF GV HGWTVRY ++D++ VK AEEAH+DML W  KHL
Sbjct  181  LLKQFEEILSAKPEVDGYVKIFAGVEHGWTVRYKDEDEVVVKSAEEAHKDMLDWLTKHL  239



>ref|XP_003529605.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Glycine max]
Length=238

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 177/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +N P L  + GAG V++L  L+ Y+SG  +S +AILLVSDVFGYEA NLR +A
Sbjct  1    MSGPECCSNSPVLNPNAGAGHVEKLAALDSYLSGSPNS-IAILLVSDVFGYEAPNLRNIA  59

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFF+GDPY  EN ++P+ VWLKDH  D  S+ AK +IE LK+ G++ 
Sbjct  60   DKVAAAGYYVVVPDFFYGDPYNPENASRPLSVWLKDHGTDKGSEAAKSIIEALKSKGVTA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK VV+LAK   ++A VLLHPAFV++DDI+GV +P  VLGAE D+ +PP++
Sbjct  120  IGAAGFCWGGKVVVELAKSRLIQADVLLHPAFVSVDDIKGVDIPTAVLGAEIDKMSPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK  VD  VKIF  V+HGWTVRY+ +D  AVK AEEAHQDML WF KHL
Sbjct  180  VKQFEQVLTAKPGVDCFVKIFPKVSHGWTVRYNPEDAEAVKAAEEAHQDMLNWFAKHL  237



>ref|XP_010488433.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Camelina sativa]
Length=239

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  DSKL ++LVSDV+GYEA NLR LA
Sbjct  1    MSGPQCCENPPTLDPVSGSGNVEKLGGLDAYVSGSPDSKLCVILVSDVYGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F GDP+   N  +PI VW+KDH  D   ++ K ++E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFCGDPFDPSNQERPIQVWIKDHGCDKGFEETKPLLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K+  ++A VLLHP+FVT+DDI+ VK PI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKVELIQAAVLLHPSFVTVDDIKDVKAPIAILGAEIDKLSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV S VKIF  V+HGWTVRY+ ++  AVK A+EAH++ML WF+ ++
Sbjct  181  VKQFEEILASKPEVYSYVKIFPKVSHGWTVRYNINEPEAVKAADEAHKEMLDWFVTYV  238



>ref|XP_002885571.1| dienelactone hydrolase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61830.1| dienelactone hydrolase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 167/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  + G+G V++LG L+ YVSG   SKLA+LLVS VFGYE  NLRKLA
Sbjct  1    MSGHQCTENPPHLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFF+GDPY  EN  +P+  W KDH  +   +D+K ++E LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFYGDPYNPENKDRPLLTWAKDHGQEKGFEDSKPIVEALKNKGITS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   V+ATVLLHP+ VT+DDI+ V +PI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKDVNIPIAVLGAELDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V+QFE  L +K EV S VKIF  V HGWTVRY+E+D   V+ AEEAH DML W I ++
Sbjct  181  VRQFEDILASKPEVKSFVKIFPRVKHGWTVRYNENDPSEVEAAEEAHMDMLAWLIDYV  238



>ref|XP_010695954.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 gb|AFM94017.1| dienelactone hydrolase-1 [Beta vulgaris]
Length=262

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 3/237 (1%)
 Frame = +2

Query  74   PHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKI  253
            P C  NPP L  + G G V+ +GGL  YVSG   S  AILL+SD FGYEA NLRKLADK+
Sbjct  25   PQCCKNPPILKPNSGTGHVEVIGGLKSYVSGSPHSNFAILLISDFFGYEAPNLRKLADKV  84

Query  254  GGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGI  430
              AG+YVVVPDFFHGDP+  N   +P+ VWL+DH  D   ++AK VIE LK  GI K+G 
Sbjct  85   AAAGYYVVVPDFFHGDPFNPNNTDRPVQVWLQDHGTDQGYEEAKPVIESLKRKGICKIGA  144

Query  431  GGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVK  607
             G C GG+ V  LA+    ++A VLLHPA VT++DI+GVKVPI VLGAE D+ +PP+++K
Sbjct  145  AGFCWGGRVVALLAQSDEYIQAGVLLHPAGVTVNDIKGVKVPIAVLGAEFDQVSPPELLK  204

Query  608  QF-EIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +F E+ +  + EVDS VKIF GV HGWT+RYD +D  AVK AEEAHQDML WF +++
Sbjct  205  EFQEVLIAKRPEVDSYVKIFPGVAHGWTMRYDPEDASAVKSAEEAHQDMLSWFQRYI  261



>gb|AFK41285.1| unknown [Lotus japonicus]
Length=239

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V ++ G+N Y SG   S LA+LL+SDVFGYEA NLR LA
Sbjct  1    MSGPECCSNPPTLNPTGGAGHVDKIAGVNAYFSGSSHSNLAVLLLSDVFGYEAPNLRNLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD   G+P  + N  +P   W+KDH  D   +D K +IE LK+ G+S 
Sbjct  61   DKVAAAGYYVVVPDLLKGEPLDLGNPDRPFPAWIKDHGPDKGFEDTKPIIEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP+FV+LDDI+GV +PI VL AE D  +PP++
Sbjct  121  IGAVGFCWGAKVVVELAKSRLIQAAVLLHPSFVSLDDIKGVDIPISVLAAEIDTISPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK++V S VKIF  V+HGW+VRY+ +D  AVK AEEAHQD+L WF KHL
Sbjct  181  VKQFEQVLAAKSQVASFVKIFPKVSHGWSVRYNLEDTEAVKEAEEAHQDLLDWFAKHL  238



>ref|XP_008390811.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=237

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G+G V++LGG + YV+G  DS+L++LLV D FGYEA   RKLA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGYEAPKARKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF VV+PDFF+GDP+  + A  I VW K HA +   +DAK+VIE L++ G+S +
Sbjct  61   DKIAAAGFIVVLPDFFNGDPFNGDRAS-IPVWRKTHAPEKTIEDAKLVIEALRSKGVSAI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V+DLAK   ++A VL HP+ VTLDDI+ VKVPI VLGAE D+  PP+V+
Sbjct  120  GAAGFCWGXKGVIDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDQMYPPEVI  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK E+ S VKIF  V HGWT+RYD++D+ AVK A EAHQD+L WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKVAHGWTLRYDDEDEAAVKAAGEAHQDLLGWFLEHV  236



>gb|EEC79184.1| hypothetical protein OsI_19879 [Oryza sativa Indica Group]
Length=240

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G GKV    GG+  YVSG  +SK A++LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVDSFGGIKAYVSGAAESKAAVVLVSDVFGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPDF HGDP+V EN  +PI VW+KDH  D   ++AK VI  LK  G+S
Sbjct  61   ADKVASSGYFVVVPDFLHGDPFVRENTERPIEVWIKDHGADKGFEEAKPVIAALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+LAK   + A V+ HP+ VT+DD++ VK PI +LGAE D  +PP+
Sbjct  121  SVGAAGYCWGAKVVVELAKAHEIHAAVMCHPSLVTVDDMKEVKCPIAILGAEIDHVSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE  L +K+E+   VKIF GV HGWTVRY +DD  AVK AEEA  DM+ WF K+L
Sbjct  181  VVKQFEQVLSSKSEIGHFVKIFPGVEHGWTVRYKDDDAAAVKSAEEALADMIDWFNKNL  239



>ref|XP_010466702.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=250

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 171/249 (69%), Gaps = 12/249 (5%)
 Frame = +2

Query  65   MSAPH--CIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR-  235
            MS  H  C  NPP L  + G+G V++LG L+ YVSG   SKLA+LLVS VFGYE  NLR 
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRF  60

Query  236  --------KLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVV  388
                    KLADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +   +++K +
Sbjct  61   QNLYLISLKLADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPI  120

Query  389  IEDLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLG  568
            +E LK  GI+ +G  G C G K  V+LAK   V+ATVLLHP+ VT+DDI+GV +PI VLG
Sbjct  121  VEALKNKGITSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVNIPIAVLG  180

Query  569  AETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQD  748
            AE D+ +PP++V+QFE  L +K EV S VKIF  V HGWTVRY+E+D   V+ AEEAH+D
Sbjct  181  AELDQVSPPELVRQFEDVLASKPEVKSFVKIFPSVKHGWTVRYNENDPSEVEAAEEAHKD  240

Query  749  MLKWFIKHL  775
            ML W   H+
Sbjct  241  MLAWLTNHV  249



>ref|XP_008808248.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Phoenix 
dactylifera]
Length=240

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C ANPP L    G G  V  LGGL  Y +G  DSKLAI+LVSDV+G+EA NLRK+
Sbjct  1    MASSQCCANPPTLSPGSGQGCVVDDLGGLKAYTAGSPDSKLAIILVSDVYGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK   +GF+VVVPDF +GDPY  N A +P+ +W++ H      +DAK VI  LK+ GIS
Sbjct  61   ADKAAASGFFVVVPDFLYGDPYSPNNAERPLPIWIQSHTTAKGFEDAKPVIAALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+LAK   ++A V LHP+FV++DDI+ VK PI +LGAE D  +PP+
Sbjct  121  AVGAAGFCWGAKVVVELAKAAEIQAAVFLHPSFVSVDDIKEVKCPIAILGAEFDHLSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VKQFE  L AKT V   VKIF GV HGW+VRY  DD  AVK AEEAHQDML WF KH+
Sbjct  181  LVKQFEQILSAKTGVSYFVKIFPGVAHGWSVRYKVDDASAVKSAEEAHQDMLDWFAKHV  239



>gb|ACU19417.1| unknown [Glycine max]
Length=239

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 169/239 (71%), Gaps = 3/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V++L GLN Y+SG  +S +AILL+SD++ YEA NLR +A
Sbjct  1    MSGPECCSNPPVLNPNAGAGHVEKLAGLNSYLSGSPNS-IAILLISDIYDYEAPNLRNIA  59

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFFHGDPY  EN ++   VWLKDH  D  S+ AK +IE LK+ G+  
Sbjct  60   DKVAAAGYYVVVPDFFHGDPYNPENASRSTPVWLKDHGTDKGSEAAKSIIEALKSKGVMA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A VLLHP FV++DDI+GV  P  +LGAE D+ +PP++
Sbjct  120  IGAAGFCWGAKVVVELAKSRLIQAAVLLHPWFVSVDDIKGVDTPTAMLGAEIDKMSPPEL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVK-VAEEAHQDMLKWFIKHL  775
            VKQFE  L AK  VD  VKIF  V+HGWTVR++  D   VK  AEEAHQDM+ W  KHL
Sbjct  180  VKQFEQVLTAKPGVDCFVKIFPKVSHGWTVRFNPKDAETVKAAAEEAHQDMVNWSAKHL  238



>ref|XP_010035774.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW84300.1| hypothetical protein EUGRSUZ_B01151 [Eucalyptus grandis]
Length=236

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 171/238 (72%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ANPP L  S GAG V+Q+GGL+ YV G LDSKLAI+L+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCANPPTLDPSNGAGHVEQVGGLDAYVVGSLDSKLAIILLSDIFGYEAPNFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVV PD+F+GD Y  EN  +PI VW+KDH V++   D   VIE LK+ GISK
Sbjct  61   DKVASAGFYVVAPDYFYGDAYDPENAERPILVWVKDHGVESGYDDTLPVIEALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK VV+L K   ++A V+LHPA VT DDI+GVKVPI VLGAE DE   P++
Sbjct  121  IGAAGFCWGGKGVVELNKRELIQAGVILHPALVTTDDIKGVKVPIAVLGAEVDENASPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK EVD  VK++   THGWTVRY +        AEEAH DM++WF+K++
Sbjct  181  LKQFEEVLAAKPEVDGFVKVYPRTTHGWTVRYKD---EEKAAAEEAHVDMVQWFVKYV  235



>gb|KHN03435.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=239

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 167/237 (70%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G G V ++GG++ Y SG   SKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPSGGGGHVNKVGGVDSYFSGSSHSKLALLMLSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD   G+P+  +N  +P+ VWLKDH  D  S+  K +IE LK+ G+S 
Sbjct  61   DKVAAAGYYVVVPDLLDGEPFNYQNSNRPLPVWLKDHGPDKGSEATKPIIEALKSKGVSV  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +   G C G K VV+L K   ++  VL+HP+FV+LDDI+ V +PI +LGAE D+ +PP++
Sbjct  121  IAAVGFCWGAKVVVELVKSKLIQTAVLMHPSFVSLDDIKAVDIPIAILGAEIDQYSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            VKQFE  L AK  V S VKIF  ++HGW VRY+ +D  AVKVAEEAH+DML W  KH
Sbjct  181  VKQFEQVLAAKAGVASFVKIFPKISHGWAVRYNAEDAEAVKVAEEAHRDMLDWLAKH  237



>ref|XP_010527412.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Tarenaya hassleriana]
Length=239

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  + G+G V++LGGL+ YV G  DSKL ILLVS VFGYE  NLRKLA
Sbjct  1    MSHPQCCENPPTLDPNSGSGHVEKLGGLDSYVVGSPDSKLGILLVSHVFGYETPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPDFFHGDPY  EN  +P+ VW+KDH  D   +++K VIE LK+ GI+ 
Sbjct  61   DKVANSGFYVVVPDFFHGDPYNPENQDRPLLVWIKDHEPDKGFEESKPVIEALKSKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   V+A VLLHP+ VT+DDI+GV+VPI +LGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVAVELAKQELVQAVVLLHPSRVTVDDIKGVEVPISILGAEFDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV   VKIF  V HGWTVRY+  D    + AEEAH+DML+W I ++
Sbjct  181  VKQFEEILASKPEVKRFVKIFPRVKHGWTVRYNPSDPSEAEAAEEAHEDMLEWLIHYV  238



>ref|XP_002309880.2| dienelactone hydrolase family protein [Populus trichocarpa]
 gb|EEE90330.2| dienelactone hydrolase family protein [Populus trichocarpa]
Length=239

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+P C  NPPKL   YGAG VQ+LGGL  YV+G  DSKLAILL++D FGYEA NLRKLA
Sbjct  1    MSSPQCFENPPKLTPDYGAGTVQELGGLKTYVTGASDSKLAILLIADAFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKP---IGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGF+VVVPDFF+GDP   + ++P   I  W K H  D   ++AK+VI  LK+ G+
Sbjct  61   DKVAAAGFFVVVPDFFYGDPV--DLSRPGFDIEAWKKLHNTDKGHENAKLVIATLKSKGV  118

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            + +G  G C GG   V LA    ++A V+LHP  +T+D+I+ VK+PI VLGAE D  +PP
Sbjct  119  NSIGAAGFCWGGNVAVKLASSNDIQAAVILHPGPLTIDEIREVKIPIAVLGAEIDHYSPP  178

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            + +K+F   L AK+++ SL+KIF GV+HGWTVRY+ +D+ AVK AEEAH+DML WF K
Sbjct  179  EQLKEFGEILSAKSQLASLLKIFPGVSHGWTVRYNVEDEPAVKSAEEAHRDMLHWFTK  236



>ref|XP_007224354.1| hypothetical protein PRUPE_ppa020844mg [Prunus persica]
 gb|EMJ25553.1| hypothetical protein PRUPE_ppa020844mg [Prunus persica]
Length=263

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/262 (52%), Positives = 171/262 (65%), Gaps = 25/262 (10%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVF-----------  211
            M+ P C +NPP L  SYG    ++LGGLN Y +G  +SKLAI+LVSDVF           
Sbjct  1    MAGPQCCSNPPILSPSYGVDCAEKLGGLNVYAAGSPNSKLAIVLVSDVFEEPITYNQLGF  60

Query  212  --------------GYEATNLRKLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKD  349
                          GY A NLRKL +K+  AGF+VVVP+FF+ DP+V +  +P+ VWL+D
Sbjct  61   VKQFTELTYLICPAGYRAPNLRKLGEKVAAAGFFVVVPNFFYDDPFVYDNNRPLAVWLED  120

Query  350  HAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLD  529
            H  D   +DAK +I  LK  G S +G  G C GGK V +LAK   V+A VLLHP+FV LD
Sbjct  121  HGTDKGFEDAKSIINALKEKGYSAIGAAGFCWGGKVVTELAKSDFVQAAVLLHPSFVALD  180

Query  530  DIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDD  709
            DI+GVKVP+ VLGAE DE +P +++KQFE  L AKTE+DS VKIF    H WTVRY+ +D
Sbjct  181  DIEGVKVPMAVLGAEIDEYSPLELLKQFEEILAAKTEIDSYVKIFPKAEHSWTVRYNVED  240

Query  710  KIAVKVAEEAHQDMLKWFIKHL  775
            + AVK AEEAH +M+ WF KH+
Sbjct  241  EEAVKRAEEAHNNMIDWFSKHV  262



>ref|XP_010038125.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=241

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 169/240 (70%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPP-KLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            MS   C  NPP +   S G G V ++GGL  Y++GP D+KL++LLVSDVFGYEA  LRKL
Sbjct  1    MSETQCCENPPTRSTMSVGIGCVAEIGGLKAYITGPPDAKLSVLLVSDVFGYEAPKLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDH-AVDNVSKDAKVVIEDLKAAGI  415
            ADK+   GFYVVVPDFF+GDPYV +N  +PI VW + H  V    +DA  V+  L++ G+
Sbjct  61   ADKVASCGFYVVVPDFFYGDPYVPDNPERPIAVWRQSHGTVRKGFEDAIRVVSALRSEGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            S +G  G C G K VV+L K   ++A VLLHP+ VT++DI+ VK PI VLGAE D+ +PP
Sbjct  121  SAIGAAGFCWGAKVVVELGKSDYIQAVVLLHPSRVTVEDIKEVKAPIAVLGAEYDKLSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +++KQFE  L AK EVD  VKIF GV HGWTVRY ++D   VK AEEAH+DML WF KHL
Sbjct  181  ELLKQFEEILSAKPEVDGCVKIFAGVEHGWTVRYKDEDAAEVKSAEEAHKDMLDWFNKHL  240



>ref|XP_011023033.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Populus euphratica]
 ref|XP_011012726.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Populus euphratica]
Length=239

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPPKL   YGAG VQ+LGGL  YV+G  DSKLAILL++D FGYEA NLRKLA
Sbjct  1    MSNPQCFENPPKLTPGYGAGTVQELGGLKTYVTGASDSKLAILLIADAFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKP---IGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGF+VVVPDFF+GDP   + ++P   +  W K H  D   +DAK+VI  LK+ G+
Sbjct  61   DKVAAAGFFVVVPDFFYGDPI--DLSRPGFDVEAWKKLHNTDKGHEDAKLVIATLKSKGV  118

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            + +G+ G C GG   V LA    ++A V+LHP  +T+D+I+ VK+PI VLGAE D  +PP
Sbjct  119  NSIGVAGFCWGGNVAVKLASSNDIQAAVILHPGPLTVDEIREVKIPIAVLGAEIDLYSPP  178

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            + +K+F   L AK+++ SL+KIF GV+HGWTVRY+ +D+ AVK AEEAH+DML WF K
Sbjct  179  EQLKEFGEILSAKSQLPSLLKIFPGVSHGWTVRYNVEDEPAVKSAEEAHRDMLHWFTK  236



>ref|XP_007034581.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY05507.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=215

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 163/217 (75%), Gaps = 4/217 (2%)
 Frame = +2

Query  128  VQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGDPY  307
            V++L GL  Y +G LDSKLA+LLVSDVFGY+A NLRKLADK+  AGFYVVVPDFF+GDP+
Sbjct  1    VEELAGLKTYFTGSLDSKLAVLLVSDVFGYDAPNLRKLADKVAAAGFYVVVPDFFYGDPF  60

Query  308  V-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIPC  484
            V E   +P+ VWLKDH      +DAK+VI+ LK+ G+S +G  G+C G K VV LAK   
Sbjct  61   VAERSDRPLAVWLKDH---GPVEDAKLVIDALKSKGVSAIGAAGICWGAKVVVGLAKEAL  117

Query  485  VEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIF  664
            + A VLLHP+FVT+DDI+ VKVPI +LGAE D+ +PP +VKQF+  L+AK EV S VKIF
Sbjct  118  IPAAVLLHPSFVTVDDIKSVKVPIAILGAEIDQLSPPALVKQFDEILKAKPEVGSFVKIF  177

Query  665  GGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
                HGWTVRY+ +D  AV  A+EAHQDML WF K++
Sbjct  178  PKCAHGWTVRYNVNDATAVSYADEAHQDMLNWFTKYV  214



>gb|AFK34617.1| unknown [Lotus japonicus]
Length=239

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 173/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP +  + G G V++  GL+ Y++G   SKLAILLVSD++GYEA NLR LA
Sbjct  1    MSGPQCCSNPPTINPTAGVGHVEKFAGLDSYLTGSPHSKLAILLVSDIYGYEAPNLRNLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFF+GDPY  EN  +P+ VWLKDH  D   + AK ++E LK+ G+S 
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYNPENANRPLPVWLKDHGTDKGFEVAKPIVEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A V LHP+FV+LDDI GV +PI +LGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVVVELAKSRLIQAAVQLHPSFVSLDDINGVDIPIAILGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            +KQFE  L AK  VDS VKIF  V+HGW+VRY+ +D  AVK AEEAHQDML WF KH
Sbjct  181  LKQFEQVLTAKPGVDSYVKIFPKVSHGWSVRYNIEDAEAVKAAEEAHQDMLDWFAKH  237



>ref|XP_009417917.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G G  V  LGG+  Y +G  +SK+A+LL+SDV+G+EA NLRK+
Sbjct  1    MASPQCCANPPTLSPACGDGIVVDDLGGVRAYTAGSPNSKIAVLLISDVYGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADKI  +GF+VVVPD  + DPY  +N  +PI +W++ H+ D   +DAK +I  LK  GIS
Sbjct  61   ADKIATSGFFVVVPDLLYDDPYSADNPERPISIWIQSHSPDKGCQDAKPIIAALKNKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C GGK V +LAK   +EA VL HP+FV +DD++GVK PI +LGAE D  +PP+
Sbjct  121  AVGAAGFCWGGKVVFELAKSSEIEAAVLCHPSFVNVDDVKGVKCPISILGAENDHISPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE AL   +E   +VKIF GV HGWTVR+  DD  AVK A+EAHQDML WFI+H+
Sbjct  181  LLKQFERALSLTSEERHIVKIFPGVAHGWTVRHKADDAAAVKRAQEAHQDMLNWFIQHV  239



>emb|CDY09037.1| BnaC01g30540D [Brassica napus]
Length=239

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C  NPP L    G+G V++LGGL+ YVSG  DS   +LLVSD++GYEA NLR LA
Sbjct  1    MLGPQCCENPPVLNPLSGSGHVEKLGGLDVYVSGSPDSNKCVLLVSDIYGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPDFF+GDPY   +  +P+ VW+KDH  D   +D K V+E +K  GI  
Sbjct  61   DKVAASGFYVVVPDFFYGDPYDPSHQDRPVPVWIKDHGPDKGFEDTKPVLEAIKNKGIIA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C GGK VV+L++   ++A VLLHP +VT+DDI+ VKVPI +LGAE D  TPP +
Sbjct  121  IGAAGMCWGGKVVVELSEEELIQAAVLLHPTYVTVDDIKDVKVPIAILGAEDDFLTPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV S VKIF  V+HGWT RYD +D  AVK AEEAH++ML WF+ ++
Sbjct  181  VKQFEEILASKPEVGSYVKIFPNVSHGWTTRYDINDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_003568483.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Brachypodium distachyon]
Length=240

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 170/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G GKV    GG+  YV+G  +SK A++LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVDSFGGIRAYVAGAQESKAAVILVSDVFGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPDF HGDPYV E+  KPI VW+K+HA +   ++AK VI  LK  G S
Sbjct  61   ADKVALSGYFVVVPDFIHGDPYVPESVDKPIAVWIKEHAPEKAFEEAKPVIAALKKQGAS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+LAK   ++A V+LHP+FVT+DDI+ VK PI +LGAE D+ +PP+
Sbjct  121  SVGAAGYCWGAKVVVELAKANEIQAAVMLHPSFVTVDDIKEVKCPIAILGAEIDKMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE  L + + V   VKIF GV HGWTVRY+ DD  AVK AEEA  DM  WF ++L
Sbjct  181  VVKQFEQVLSSNSGVGHFVKIFPGVAHGWTVRYNSDDASAVKSAEEALADMTSWFDQNL  239



>ref|XP_007223790.1| hypothetical protein PRUPE_ppa010646mg [Prunus persica]
 gb|EMJ24989.1| hypothetical protein PRUPE_ppa010646mg [Prunus persica]
Length=241

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 179/240 (75%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G+G V++ GGL+ YV+G  DSKLAILL SD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLDPSGGSGHVEKFGGLDTYVTGSPDSKLAILLASDIFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGF+VVVPDFF+GDP+V   +     +  WLKDH  D   +++K V+E LK+ G+
Sbjct  61   DKVAAAGFFVVVPDFFYGDPFVPGDDGSYANLPTWLKDHGPDKAFEESKPVLEVLKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            S VG  G C G K VV+L+K   ++A VL HP+FVTLDDI+ VKVPI +LGAE D+ +PP
Sbjct  121  SAVGAAGFCYGAKVVVELSKHDFIQAAVLCHPSFVTLDDIKAVKVPISILGAEIDKMSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VVKQFE AL AK+E++  VKIF  V HGWTVRY+ +D+ AVK AEEAHQD+L+WF+ H+
Sbjct  181  EVVKQFEEALTAKSEIECHVKIFPKVAHGWTVRYNVEDEAAVKAAEEAHQDLLEWFLNHV  240



>gb|AAN65058.1| Unknown protein [Arabidopsis thaliana]
Length=239

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  + G+G V++LG L+ YV G   SKLA+LLV  VFGYE  NLRKLA
Sbjct  1    MSVHQCTENPPDLDPTSGSGHVEKLGNLDTYVCGSTHSKLAVLLVPHVFGYETPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY  EN  +P  +W+KDH ++   +++K ++E LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENQDRPFPIWMKDHELEKGFEESKPIVEALKNKGITS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   V+ATVLLHPA VT+DDI+ V +PI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVAVELAKEKLVDATVLLHPARVTVDDIKEVNLPIAVLGAEIDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V+QFE  L +K +V S VKIF    HGWTVRY+E+D   V+ A EAH+DML W I +L
Sbjct  181  VRQFEDILASKPQVKSFVKIFPRCKHGWTVRYNENDPSEVEAAMEAHKDMLAWLIDYL  238



>ref|NP_566731.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAK48958.1|AF370531_1 Unknown protein [Arabidopsis thaliana]
 gb|AEE76778.1| dienelactone hydrolase-like protein [Arabidopsis thaliana]
Length=239

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  + G+G V++LG L+ YV G   SKLA+LLV  VFGYE  NLRKLA
Sbjct  1    MSGHQCTENPPDLDPTSGSGHVEKLGNLDTYVCGSTHSKLAVLLVPHVFGYETPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFY VVPDFFHGDPY  EN  +P  +W+KDH ++   +++K ++E LK  GI+ 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENQDRPFPIWMKDHELEKGFEESKPIVEALKNKGITS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K  V+LAK   V+ATVLLHPA VT+DDI+ V +PI VLGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVAVELAKEKLVDATVLLHPARVTVDDIKEVNLPIAVLGAEIDQVSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V+QFE  L +K +V S VKIF    HGWTVRY+E+D   V+ A EAH+DML W I +L
Sbjct  181  VRQFEDILASKPQVKSFVKIFPRCKHGWTVRYNENDPSEVEAAMEAHKDMLAWLIDYL  238



>ref|NP_001242164.1| uncharacterized protein LOC100801095 [Glycine max]
 gb|ACU22986.1| unknown [Glycine max]
Length=239

 Score =   264 bits (674),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 166/237 (70%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  S G G V ++GG++ Y SG   SKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPSGGGGHVNKVGGVDSYFSGSSHSKLALLMLSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD   G+P+  +N  +P+ VWLKD   D  S+  K +IE LK+ G+S 
Sbjct  61   DKVAAAGYYVVVPDLLDGEPFNYQNSNRPLPVWLKDRGPDKGSEATKPIIEALKSKGVSV  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +   G C G K VV+L K   ++  VL+HP+FV+LDDI+ V +PI +LGAE D+ +PP++
Sbjct  121  IAAVGFCWGAKVVVELVKSKLIQTAVLMHPSFVSLDDIKAVDIPIAILGAEIDQYSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            VKQFE  L AK  V S VKIF  ++HGW VRY+ +D  AVKVAEEAH+DML W  KH
Sbjct  181  VKQFEQVLAAKAGVASFVKIFPKISHGWAVRYNAEDAEAVKVAEEAHRDMLDWLAKH  237



>ref|XP_002883437.1| hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59696.1| hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=236

 Score =   264 bits (674),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 170/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  DSKL +LL+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSPDSKLCVLLISDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F GDP+   N  +PI VW+KDH  D    + K V+E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFGGDPFDPSNQDRPIAVWIKDHGWDKGFDNTKPVLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G   VV+L+K   ++A VLLHP+FVT+DDI+G K PI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWG---VVELSKEELIQAAVLLHPSFVTVDDIKGGKAPIAILGAEIDQMSPPAL  177

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI+  V+HGWTVRY  DD  AVK AEEAH++ML WF  ++
Sbjct  178  LKQFEEILASKPEVNSYVKIYLKVSHGWTVRYSIDDPEAVKAAEEAHKEMLDWFATYV  235



>ref|XP_006361507.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X4 [Solanum 
tuberosum]
Length=254

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 163/237 (69%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V QLG  N YVSGP  SKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H      +DAK V+  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +L+K   ++A VLLHP+ V +DD + VKVPI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L +K EVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+DML W  K++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_004508363.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cicer arietinum]
Length=237

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 172/238 (72%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C +NPP L  S G+G V +L  LN Y++G  +S LA+LLVSD+FGYEA NLRKLA
Sbjct  1    MSGAECCSNPPTLNPSAGSGHVDKLASLNAYITGSPNSNLAVLLVSDIFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DKI  AG+YVVVPDFF+GDPY  EN  +P+ VWLKDH  D   +DAK +IE +K+ G+S 
Sbjct  61   DKIAAAGYYVVVPDFFNGDPYNPENPDRPLLVWLKDHGADKGFEDAKSIIEAIKSKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K VV LAK   + A VLLHP+FVT+DDI+ V +PI +LGAE D+ +PP++
Sbjct  121  VGAAGFCWGAKVVVGLAKSRLIPAAVLLHPSFVTVDDIKSVDIPISILGAEIDQISPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+ V S VKIF    HGWTVRY+ DD  AVK AEEAH+D+L WF KHL
Sbjct  181  VKQFEEVLSAKS-VASFVKIFPK-AHGWTVRYNPDDAEAVKAAEEAHKDLLDWFAKHL  236



>ref|XP_006361508.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X5 [Solanum 
tuberosum]
Length=251

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 162/236 (69%), Gaps = 2/236 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V QLG  N YVSGP  SKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H      +DAK V+  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +L+K   ++A VLLHP+ V +DD + VKVPI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            KQFE  L +K EVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+DML W  K+
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKY  234



>ref|XP_006361509.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X6 [Solanum 
tuberosum]
Length=236

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 163/237 (69%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V QLG  N YVSGP  SKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H      +DAK V+  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +L+K   ++A VLLHP+ V +DD + VKVPI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L +K EVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+DML W  K++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_010488431.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=239

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V+++GGL+ YVSG  DSKL ILL+S+VFGYEA  LR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKVGGLDAYVSGSPDSKLCILLISEVFGYEAPKLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDPY   +  +P+ VW+KDH  D   +D   V+E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYNPADQDRPVLVWIKDHGCDKGFEDTIPVLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K+  ++A VLLHP FVT+DDI+G K PI +LGAE D  T P +
Sbjct  121  IGAAGMCWGAKVVVELSKMELIQAAVLLHPTFVTVDDIKGGKAPIAILGAELDHWTSPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV S VKI   V+HGWTVRY+ D+  AVK AEEAH++ML WF+ +L
Sbjct  181  VKQFEETLASKPEVPSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYL  238



>ref|XP_008223023.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=241

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 178/240 (74%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +N P L  S G+G V++ GGL+ YV+G  DSKLAILL SD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSNAPTLNPSSGSGHVEKFGGLDTYVTGSPDSKLAILLASDIFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGF+VVVPDFF+GDP+V   +     +  WLKDH  D   +++K V+E LK+ G+
Sbjct  61   DKVAAAGFFVVVPDFFYGDPFVPGDDGSYANLPTWLKDHGPDKAFEESKPVLEVLKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            S VG  G C G K VV+L+K   ++A VL HP+FVTLDDI+ VKVPI +LGAE D+ +PP
Sbjct  121  SAVGAAGFCYGAKVVVELSKHDFIQAAVLCHPSFVTLDDIKAVKVPISILGAEIDKMSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VVKQFE AL AK+E++  VKIF  V HGWTVRY+ +D+ AVK AEEAHQD+L+WF+ H+
Sbjct  181  EVVKQFEEALTAKSEIECHVKIFPKVAHGWTVRYNVEDEAAVKAAEEAHQDLLEWFLNHV  240



>ref|XP_006654368.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Oryza brachyantha]
Length=240

 Score =   263 bits (672),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G G+V    GG+  YVSG  DSK A++LVSDV+G+EA NLRK+
Sbjct  1    MASPQCCANPPTLDPAGGEGQVVDSFGGIKAYVSGAADSKAAVVLVSDVYGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++V+VPDF HGDP+V EN  +PI VW+K+H  D   ++AK VI  LK  G+S
Sbjct  61   ADKVASSGYFVMVPDFLHGDPFVRENTERPIQVWIKEHGADKGFEEAKPVIAALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K VV+LAK   ++A V+ HP+FVT+DDI+ VK PI +LGAETD  +PP+
Sbjct  121  SIGAVGYCWGAKVVVELAKAHEIQAAVMCHPSFVTVDDIKEVKCPIAILGAETDIMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L +K+ +   VKIF GV HGWTVRY  DD  AVK AEEA  DM  WF K+L
Sbjct  181  LIKQFEQVLSSKSRIAHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMTDWFNKNL  239



>ref|XP_006361506.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X3 [Solanum 
tuberosum]
Length=295

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 164/238 (69%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V QLG  N YVSGP  SKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H      +DAK V+  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +L+K   ++A VLLHP+ V +DD + VKVPI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            KQFE  L +K EVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+DML W  K+++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYVN  236



>ref|XP_009106630.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Brassica rapa]
Length=239

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C  NPP L    G+G V++L GL+ YVSG  DS   +LLVSD++GYEA NLR LA
Sbjct  1    MLGPQCCENPPVLNPLSGSGHVEKLAGLDVYVSGSPDSNKCVLLVSDIYGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDPY   +  + + VW+KDH  D   +D K V+E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYDPSHQDRSVPVWIKDHGPDKGFEDTKPVLEAIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C GGK VV+L+K   ++A VLLHP +VT+DDI+ VKVPI +LGAE D  TPP +
Sbjct  121  IGAAGMCWGGKVVVELSKEELIQAAVLLHPTYVTVDDIKDVKVPIAILGAEDDFLTPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV S VKIF  V+HGWT RYD +D  AVK AEEAH++ML WF+ ++
Sbjct  181  VKQFEEILASKPEVSSYVKIFPNVSHGWTTRYDINDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_006361504.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
tuberosum]
Length=300

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 164/238 (69%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V QLG  N YVSGP  SKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H      +DAK V+  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +L+K   ++A VLLHP+ V +DD + VKVPI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            KQFE  L +K EVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+DML W  K+++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYVN  236



>ref|XP_006419788.1| hypothetical protein CICLE_v10006994mg, partial [Citrus clementina]
 gb|ESR33028.1| hypothetical protein CICLE_v10006994mg, partial [Citrus clementina]
Length=246

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = +2

Query  116  GAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFH  295
            G G V+ LGGLN YV+G   SKLA+LLVSDV  Y+A NLRKLADKI  AGFYV VPDF H
Sbjct  28   GGGHVENLGGLNTYVNGSPHSKLAVLLVSDV--YDALNLRKLADKIAAAGFYVAVPDFLH  85

Query  296  GDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAK  475
            GDPYV N  + +  W+KDH  D   +DAK VI+ +K+ GI+ +G  G C G K  V LAK
Sbjct  86   GDPYVPNAGRTLQDWIKDHGTDKAFEDAKPVIQAIKSKGITAIGAAGFCWGAKIAVQLAK  145

Query  476  IPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLV  655
               ++A VLLHP+FVT+DDI+ V+VP  VLGAE D+ +PP ++K+FE  L AK+EVD  V
Sbjct  146  REFIQAAVLLHPSFVTVDDIKTVEVPTAVLGAEFDQISPPALLKRFEEVLTAKSEVDGYV  205

Query  656  KIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KIF  V+HGWTVRY  +DK AVK AEEAHQ+ML+WF K++
Sbjct  206  KIFPKVSHGWTVRYKVEDKSAVKCAEEAHQNMLEWFAKYV  245



>ref|NP_001030749.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE76782.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=236

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 171/238 (72%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  +SKL +LL+SD+FG+EA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSAESKLCVLLISDIFGFEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D   ++ K V+E +K  GI+ 
Sbjct  61   DKVAASGFYVVVPDYFGGDPYNPSNQDRPIPVWIKDHGCDKGFENTKPVLETIKNKGITA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G   VV+L+K   ++A VLLHP+FV +DDI+G K PI +LGAE D+ +PP +
Sbjct  121  IGAAGMCWG---VVELSKEELIQAAVLLHPSFVNVDDIKGGKAPIAILGAEIDQMSPPAL  177

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI   V+HGWTVRY+ D+  AVK AEEAH++ML WF+ ++
Sbjct  178  LKQFEEILSSKPEVNSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYI  235



>ref|XP_009362382.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Pyrus 
x bretschneideri]
Length=261

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 172/260 (66%), Gaps = 23/260 (9%)
 Frame = +2

Query  65   MSAPHCIANPPKL-CYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS P C +NPP L   SYG     ++LGGLN YV G  +SKLAILLVS+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNSDEKLGGLNVYVVGSPNSKLAILLVSNVFGYRVPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D   +DAK +I  LK  G+S
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVHDNDRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  419  KVGIGGVCSGG---------------------KTVVDLAKIPCVEATVLLHPAFVTLDDI  535
             +G  G C GG                     K V++LAK   ++A +LLHP+FV LDDI
Sbjct  121  AIGAAGFCWGGEWLLSHTTFSTGCLISSIAQAKVVIELAKSDFIQAALLLHPSFVALDDI  180

Query  536  QGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKI  715
            Q VKVPI + GAE D+ +PP++VKQFE  L AK EVDS VKIF    HGWT+ Y+ +D+ 
Sbjct  181  QEVKVPIAIQGAEIDDYSPPELVKQFEQILAAKPEVDSFVKIFPKAEHGWTMSYNAEDEE  240

Query  716  AVKVAEEAHQDMLKWFIKHL  775
            AVK AEEAH++ L WF+KH+
Sbjct  241  AVKRAEEAHRNTLAWFVKHV  260



>ref|XP_002439762.1| hypothetical protein SORBIDRAFT_09g019630 [Sorghum bicolor]
 gb|EES18192.1| hypothetical protein SORBIDRAFT_09g019630 [Sorghum bicolor]
Length=239

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 164/238 (69%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G GKV    GGL  YV+GP DSK A++LV+DVFG+EA  LRK+
Sbjct  1    MASSQCCDNPPALNPACGEGKVVDSFGGLKAYVAGPEDSKAAVVLVADVFGFEAPILRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADK+  +G++VVVPDFFHGDPYV    KPI  WLK H  +   ++AK VI  LK  G+S 
Sbjct  61   ADKVASSGYFVVVPDFFHGDPYVPENGKPIPEWLKSHTPEKGFEEAKPVIATLKEKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K VV+LAK   ++A VLLHP+FVT+DDI+ VK PI +LGAE D+ +PP++
Sbjct  121  VGAAGYCWGAKVVVELAKAHEIQAAVLLHPSFVTIDDIKEVKCPISILGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L   + V   VKIF GV HGW+VRY  DD  AVK AEEA  DML WF K+L
Sbjct  181  VKQFEQVLSVNSGVGHFVKIFPGVAHGWSVRYSHDDAAAVKSAEEAFADMLDWFNKNL  238



>gb|KDP40091.1| hypothetical protein JCGZ_02089 [Jatropha curcas]
Length=240

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 161/239 (67%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+ HC  NPP L  +YGAG VQ+LGGL  YV+GP DSKLAILLV D FGYE  NLRKLA
Sbjct  1    MSSSHCFENPPTLNPNYGAGTVQELGGLKTYVTGPPDSKLAILLVCDAFGYETPNLRKLA  60

Query  245  DKIGGA-GFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+  A GF VVVPDF +GDP  V N      VWLK+H      KDAK VI  LK+ GIS
Sbjct  61   DKVAAAAGFLVVVPDFLYGDPADVNNPQFDRHVWLKNHDTTEGCKDAKAVIAGLKSRGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C GG  VV LA    ++A V+LHP  +T D+I  VKVP  +LGAE D+  PP+
Sbjct  121  SIGAAGFCWGGMVVVKLASCNDIQAAVILHPGLITADEINAVKVPTAILGAEKDKICPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +KQ    L  K+E++S VKIF GV HGWT+RY ++D  AVK+AEEAH D+L WF  H+
Sbjct  181  QLKQLGELLAVKSEIESYVKIFPGVAHGWTLRYSDEDDSAVKIAEEAHSDLLNWFTTHV  239



>gb|KFK39658.1| hypothetical protein AALP_AA3G272500 [Arabis alpina]
Length=239

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  DSKL +LL+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNSGSGSGHVEKLGGLDAYVSGSPDSKLCVLLISDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDPY   N  + I VW+KDH  D   +D K V+E +K+ GI+ 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYDPSNQERSITVWIKDHGADKGFEDTKPVLEAIKSKGITG  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C G K VV+L+K   ++A VL+HP+FVT+DDI+  KVPI +LGAE D  +PP +
Sbjct  121  IGAAGMCWGAKVVVELSKQELIQAAVLMHPSFVTVDDIKSGKVPIAILGAEIDNMSPPAL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EV+S VKI   V+HGWTVRY  DD  AVK AEEAH++ML WF+ ++
Sbjct  181  LKQFEEILASKPEVNSYVKIHPKVSHGWTVRYSTDDAEAVKAAEEAHKEMLDWFVTYV  238



>emb|CDO98981.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 171/237 (72%), Gaps = 0/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  N P L    GAG V++LGGL  YV+G  DS++A+LLVSDVFGYEA  LRKLA
Sbjct  1    MSGPQCCENAPSLSSGSGAGHVEELGGLQSYVTGSADSEIAVLLVSDVFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+ GAGF+VVVPDFF GDP +      +  WLK H  D   + AK VIE LK  GI+KV
Sbjct  61   DKVAGAGFFVVVPDFFFGDPVLVLEGTDLDAWLKKHGPDQGFEHAKSVIEALKGKGITKV  120

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VV+LA   C++A V+LHPAFVTL+DIQGVKVP+ +LGAETD T PP+++
Sbjct  121  GAAGFCWGAKVVVELATYACIQAAVILHPAFVTLEDIQGVKVPMSILGAETDHTGPPELL  180

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++F  AL AK EVD  VKIF GV HGW+VRY ++D+  VK AEEAHQD+L W +K+L
Sbjct  181  RKFGQALDAKPEVDGFVKIFPGVAHGWSVRYKDEDEKEVKAAEEAHQDLLGWLVKYL  237



>ref|XP_004290675.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=261

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            +S P C+ +PP L  + GAG+V Q+GGL  YV+GP  SKLAI+L SDV+GYEA NLRK+A
Sbjct  21   LSGPQCLEHPPNLNGTSGAGRVIQVGGLKAYVTGPPHSKLAIILASDVYGYEAPNLRKIA  80

Query  245  DKIGG-AGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+   AGF+VVVPDFF+G+PY  N   + + VWLKDH  D   +DAK +I  LK  G S
Sbjct  81   DKVASTAGFHVVVPDFFYGEPYNPNNTQRNMTVWLKDHGTDKGFEDAKRLIAALKKKGAS  140

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            K+G  G C GGK V +LAK    +A VLLHP+ VTLDDI+ VK PI +L A+ D  TPP+
Sbjct  141  KIGAAGFCWGGKVVAELAKGYYTKAAVLLHPSRVTLDDIKEVKTPISILVAQFDNGTPPE  200

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            ++KQF+  L +  +VD+ VKIF GV+HGWTVRY +D+  AVK A EAHQDML WF K++ 
Sbjct  201  LMKQFKEVL-STNKVDNFVKIFPGVSHGWTVRYQQDNVTAVKSANEAHQDMLDWFTKYVQ  259



>ref|XP_008352792.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Malus 
domestica]
Length=261

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 172/260 (66%), Gaps = 23/260 (9%)
 Frame = +2

Query  65   MSAPHCIANPPKL-CYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            MS P C +NPP L   SYG     ++LGGLN YV+G  +SKLAILL+S+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNCXEKLGGLNVYVAGSPNSKLAILLISNVFGYRVPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D   +DAK +I  LK  G+S
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVYDNNRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  419  KVGIGGVCSGG---------------------KTVVDLAKIPCVEATVLLHPAFVTLDDI  535
             +G  G C GG                     K V +LAK   ++A VLLHP+FVTLDDI
Sbjct  121  AIGAAGFCWGGEWFLSQTTFSTGCLISSIAQAKVVTELAKSDFIQAAVLLHPSFVTLDDI  180

Query  536  QGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKI  715
            Q VKVPI + GAE D+ +PP++VKQFE  L AK EVDS VKIF    H WT+ Y+ +D+ 
Sbjct  181  QEVKVPIAIQGAEIDDYSPPELVKQFEQILAAKPEVDSFVKIFPKAEHXWTMSYNVEDEE  240

Query  716  AVKVAEEAHQDMLKWFIKHL  775
            AVK AEEAH++ L WF+KH+
Sbjct  241  AVKRAEEAHRNTLAWFVKHV  260



>gb|ACU23923.1| unknown [Glycine max]
Length=240

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L    G G V ++GG++ Y +G   SKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPGGGVGHVDKVGGVDSYFTGSPHSKLAVLMLSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHA-VDNVSKDAKVVIEDLKAAGIS  418
            DK+G AG+YVVVPD   G+P+  +N  +P   W+KDH  V+  ++  K +IE LK+ G+S
Sbjct  61   DKVGAAGYYVVVPDLLDGEPFNPQNSDRPFPAWIKDHGPVEKGAEATKPIIEALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +   G C G K VV+LAK   ++  VLLHP+FV+LDDI+GV +PI +LGAE D+  PP+
Sbjct  121  AIAAVGFCWGAKVVVELAKSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVFPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            +VKQFE  L AK+ V S VKIF  V+HGW VRY+ +D  AVKVAEEAHQD+L W  KH
Sbjct  181  LVKQFEQVLAAKSGVASFVKIFPKVSHGWAVRYNTEDAEAVKVAEEAHQDLLDWLAKH  238



>ref|XP_009417919.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   261 bits (666),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 168/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C ANPP L  + G G  V  LGG+  Y +G  +SKLA+LL+SD+FG+EA NLRK+
Sbjct  3    MASSQCCANPPTLSPACGDGIVVDDLGGVRAYTAGSPNSKLAVLLISDIFGFEAPNLRKI  62

Query  242  ADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADKI  +GF+VVVP+  + DPY  +N  +PI +W++ H+ D   +DAK +I  LK  GIS
Sbjct  63   ADKIATSGFFVVVPNLLYDDPYSADNPERPISIWIQSHSPDKGCQDAKPIIAALKNKGIS  122

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C GGK VV+LAK   +EA VL HP+FV +DD++GVK PI +LGAE D  +PP+
Sbjct  123  AVGAAGFCWGGKVVVELAKSSEIEAAVLCHPSFVNIDDMKGVKCPISILGAENDHISPPE  182

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE AL   +E   +VKIF GV HGWTV++  DD  AVK A+EAHQDML WF +H+
Sbjct  183  LLKQFEQALSLTSEERHIVKIFPGVAHGWTVKHKADDAAAVKRAQEAHQDMLNWFTQHV  241



>ref|XP_003529606.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Glycine 
max]
 gb|KHN03037.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=240

 Score =   261 bits (666),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L    G G V ++GG++ Y +G   SKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPGGGVGHVDKVGGVDSYFTGSPHSKLAVLMLSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHA-VDNVSKDAKVVIEDLKAAGIS  418
            DK+G AG+YVVVPD   G+P+  +N  +P   W+KDH  V+  ++  K +IE LK+ G+S
Sbjct  61   DKVGAAGYYVVVPDLLDGEPFNPQNSDRPFPAWIKDHGPVEKGAEATKPIIEALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +   G C G K VV+LAK   ++  VLLHP+FV+LDDI+GV +PI +LGAE D+ +PP+
Sbjct  121  AIAAVGFCWGAKVVVELAKSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            +VKQFE  L AK+ V S VKIF  V+HGW VRY+ +D   VKVAEEAHQD+L W  KH
Sbjct  181  LVKQFEQVLAAKSGVASFVKIFPKVSHGWAVRYNTEDAETVKVAEEAHQDLLDWLAKH  238



>ref|XP_009339924.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Pyrus 
x bretschneideri]
Length=273

 Score =   261 bits (668),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 173/272 (64%), Gaps = 35/272 (13%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G G V+ LGGL+ YV+G  DS  A+LL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNFAVLLISDVYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VVVPDF + DPY  E+  +P+ VW+KDH  D   +DAK V+E LK+ G+S 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDANRPVSVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQG--------------------  541
            +G  G C G K VV+L+K   ++A VL HP+ VT+DDI+G                    
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKGKIPVLIFRKYLHHYWNKKLV  180

Query  542  --------------VKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTH  679
                          VKVPI +LGAE D  +PP+VV+QFE  L  K EV S VKIF  V+H
Sbjct  181  SHSLYDLFLDLLSEVKVPISILGAEIDRMSPPEVVRQFEEVLTTKPEVKSHVKIFPKVSH  240

Query  680  GWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            GWTVRY  +D+ A K AEEAHQD+LKWF+ H+
Sbjct  241  GWTVRYSVEDEAACKSAEEAHQDLLKWFLNHV  272



>ref|XP_009599203.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009599204.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X3 [Nicotiana 
tomentosiformis]
Length=239

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 164/238 (69%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C  NPP L  S G G V ++GG   YVSGP  SKLAILL SDV+GYEA NLRKLA
Sbjct  1    MAGAQCCENPPTLSSSSGVGSVLEIGGFKAYVSGPSSSKLAILLASDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDF +GDPY  EN  KP+ +W++ H  D   +DAK V+  LK  GIS 
Sbjct  61   DKVAAAGYYVVVPDFLYGDPYNPENTEKPLSIWVQSHGTDKGFEDAKKVVAALKDKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K V DLAK   ++A V LHP+ V +DDI+ VK PI +L AE D  +PP++
Sbjct  121  IGAAGFCWGAKVVTDLAKSDYIQAAVQLHPSLVKVDDIKEVKAPIAILAAEIDRISPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EVDS VKIF  V HGWTVRY+ +D+ AV+ AEEAH+ ML WF K++
Sbjct  181  IKQFEEILSSKPEVDSFVKIFPSVKHGWTVRYNVEDQEAVQSAEEAHRHMLDWFTKYV  238



>ref|XP_004962159.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Setaria italica]
Length=239

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + GAGKV    GGL  YV+G  DSK A++L++DVFG+EA NLRK+
Sbjct  1    MASSQCCENPPALDPAGGAGKVVDSFGGLKAYVAGAEDSKAAVVLIADVFGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            ADK+  +G++VVVPDFFHGD Y+    KPI  WLK HA +   +DAK VI  LK  G+S 
Sbjct  61   ADKVALSGYFVVVPDFFHGDAYIPENEKPIHEWLKSHAPEKGFEDAKPVIAALKEQGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VLLHP+FV++DD++ VK PI +LGAE D+ +PP++
Sbjct  121  IGAAGYCWGAKVVVELSKAQEIQAAVLLHPSFVSVDDMKEVKCPISILGAEVDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+ V   VK+F GV+HGW+VRY  DD  AVK AEEA  DM+ WF K+L
Sbjct  181  VKQFEQVLSAKSGVGHFVKVFPGVSHGWSVRYSHDDAAAVKSAEEALADMIDWFNKNL  238



>ref|XP_009599202.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=250

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 164/238 (69%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C  NPP L  S G G V ++GG   YVSGP  SKLAILL SDV+GYEA NLRKLA
Sbjct  1    MAGAQCCENPPTLSSSSGVGSVLEIGGFKAYVSGPSSSKLAILLASDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDF +GDPY  EN  KP+ +W++ H  D   +DAK V+  LK  GIS 
Sbjct  61   DKVAAAGYYVVVPDFLYGDPYNPENTEKPLSIWVQSHGTDKGFEDAKKVVAALKDKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K V DLAK   ++A V LHP+ V +DDI+ VK PI +L AE D  +PP++
Sbjct  121  IGAAGFCWGAKVVTDLAKSDYIQAAVQLHPSLVKVDDIKEVKAPIAILAAEIDRISPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EVDS VKIF  V HGWTVRY+ +D+ AV+ AEEAH+ ML WF K++
Sbjct  181  IKQFEEILSSKPEVDSFVKIFPSVKHGWTVRYNVEDQEAVQSAEEAHRHMLDWFTKYV  238



>ref|XP_006361505.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Solanum 
tuberosum]
Length=297

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 160/233 (69%), Gaps = 2/233 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V QLG  N YVSGP  SKLAILLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H      +DAK V+  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +L+K   ++A VLLHP+ V +DD + VKVPI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
            KQFE  L +K EVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+DML W 
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWL  231



>ref|XP_006850805.1| hypothetical protein AMTR_s00025p00112220 [Amborella trichopoda]
 gb|ERN12386.1| hypothetical protein AMTR_s00025p00112220 [Amborella trichopoda]
Length=239

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 166/240 (69%), Gaps = 5/240 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C  NPP L  S G G V++LGGL  YV+G  DSK AI+LVSD+FG+EA NLR+LA
Sbjct  1    MAGPQCCENPPTLRSSSGEGHVEELGGLKAYVTGSSDSKRAIVLVSDIFGFEAPNLRRLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV---WLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AG+YVVV D+F+GDP+  +  +P      WL+ H  +   + +K +IE LK+ GI
Sbjct  61   DKVASAGYYVVVTDYFYGDPFAPD--QPFDAFPNWLQSHKPEKAFEVSKPIIEALKSKGI  118

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            S +G GG C G K VV+LAK   ++A VLLHP+ V  +DI  VK PI +LGAE D+ +PP
Sbjct  119  SAIGAGGFCWGAKVVVELAKSGSIQAAVLLHPSLVKPEDISEVKCPIAILGAEIDKASPP  178

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++VKQFE  L  + +VD+ VKIF GV HGWTVRY  DD+  VK AEEAH DML WF K++
Sbjct  179  ELVKQFEEILSTRNKVDNFVKIFPGVAHGWTVRYSLDDETVVKNAEEAHTDMLNWFNKYV  238



>ref|XP_009588353.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Nicotiana tomentosiformis]
Length=238

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C+ NPP L  + GAG +Q +GGLN YV+G +DSKLAILL+SDVFGYEA  LRK+A
Sbjct  1    MSRPQCLKNPPTLNSASGAGDLQDIGGLNSYVTGSVDSKLAILLISDVFGYEAPLLRKIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+ VVVPDFF+G+P ++     +  WLKDH  D   +DAK V+E LK+ G+S +
Sbjct  61   DKVAAAGYLVVVPDFFYGEP-LDREKHNVQTWLKDHGADKGCEDAKAVVESLKSKGVSSI  119

Query  425  GIGGVCSGGKTVVDLAKIP-CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            G  G C GG  V  LAK    + A V+LHP  +T+D+I  VKVP  +L AE D   PP  
Sbjct  120  GAAGFCWGGMVVSKLAKHENSIGAAVILHPGPITVDEINEVKVPTAILAAEHDHIFPPDQ  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
             KQ   AL AK+E++S VKIF GV HGWTVRY+ +D+ AVK AEEAH DML WF K ++
Sbjct  180  AKQLTDALSAKSEIESCVKIFPGVEHGWTVRYNVEDESAVKAAEEAHSDMLNWFTKFIN  238



>ref|XP_010035787.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=236

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V+QL GLN Y+ G  DSKLAILL+SD+FGYEA N RK+A
Sbjct  1    MSGPQCCENPPTLDPSCGAGHVEQLCGLNTYIVGSQDSKLAILLLSDIFGYEAPNFRKIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPD+F+GD +V +N  +P+ VW+KDH  D   +D K +I+ LK+ GISK
Sbjct  61   DKVAAAGFYVVVPDYFNGDTFVLDNPERPLMVWMKDHGTDKGFEDTKPIIQALKSKGISK  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K   +LAK   ++A V+LHPAFVTLDDI+GVKVP  VL AE D  TP ++
Sbjct  121  IGAAGFCWGAKVATELAKCELIQAAVMLHPAFVTLDDIKGVKVPTAVLAAENDHLTPLEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EVD  VKI+   +HGWT RY          A EAH DM++W +K++
Sbjct  181  VKQFEEELAAKPEVDGFVKIYPKTSHGWTTRY---KAEDEAAAMEAHSDMIQWVVKYV  235



>ref|XP_009788741.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Nicotiana sylvestris]
Length=239

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S G G V + GGL  YVS   +SK AILLVSD+FGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLSSSSGVGSVLEFGGLKTYVSASSNSKHAILLVSDIFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G+YVVVPDF +GDPY  E   KP+ +WL+ H VD   +DAK V+  LK  GIS 
Sbjct  61   DKVAAVGYYVVVPDFLYGDPYNPETMEKPLSIWLQSHGVDKGFEDAKQVVAALKDKGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV LAK   ++A VLLHP+FVT+DDI+ VK PI +LGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVVVQLAKSDDIQAAVLLHPSFVTVDDIKEVKAPIAILGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L +K EVD+ VKI+ GV HGWTVRYD +DK AV+ AEEAH+DML+WF KH+
Sbjct  181  IKQFEEILSSKPEVDNFVKIYPGVAHGWTVRYDVEDKKAVESAEEAHRDMLEWFTKHV  238



>ref|XP_010532693.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=259

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 165/243 (68%), Gaps = 2/243 (1%)
 Frame = +2

Query  56   NNIMSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
               +S P C+ NPP L  + G+G V ++GGL  YVSG   SK  I+LVSDV+GYEA NLR
Sbjct  17   RRTISNPQCLENPPNLDPNSGSGHVTKIGGLKAYVSGSSHSKRGIILVSDVYGYEAPNLR  76

Query  236  KLADKIGGAGFYVVVPDFFHGDPY-VENGAK-PIGVWLKDHAVDNVSKDAKVVIEDLKAA  409
            K+ADK+  AGFY VVPD+F GDPY +E   K P+ VW+KDH       D+K VIE LK  
Sbjct  77   KIADKVAAAGFYAVVPDYFFGDPYKIEYKEKRPVPVWIKDHPPAKGFNDSKPVIEALKRK  136

Query  410  GISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETT  589
            GI+ +G  G+C G K VV+LAK   ++A V  HP++VT+DDI+ VK P+ + GAE D  +
Sbjct  137  GITTIGATGICWGAKVVVELAKTDLIQAAVFFHPSYVTVDDIKEVKAPLAIFGAEFDGGS  196

Query  590  PPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            PP ++KQFE  L AK++V S VKIF  V HGWTVRY+  D +AVK AEEAH DML+WF  
Sbjct  197  PPALLKQFEQILAAKSDVKSCVKIFPNVKHGWTVRYNVTDPVAVKAAEEAHNDMLQWFAT  256

Query  770  HLH  778
             L 
Sbjct  257  LLQ  259



>ref|XP_008367180.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=240

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G V++LGGL+ Y+ G  DSK+A+LLVSDVFGY+A NLRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKLGGLDTYLVGSPDSKVAVLLVSDVFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+   GF+VV+PDFF+GDP+V  E G      W+K H  D   +DAK ++E LK+ GIS
Sbjct  61   DKLAAGGFFVVIPDFFYGDPFVLGEEGFAAFPGWIKHHGTDKALEDAKPILEALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+L+K   ++A  + HP+FVTLDDI+ VKVP  +LGAE D  +PP+
Sbjct  121  AVGAVGFCYGAKVVVELSKHDFIQAAAMCHPSFVTLDDIKAVKVPTQILGAEIDNMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE AL AK E+ S VKIF  V HGWT RY+++D+ A K AEEAHQD+L+WF+ H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWFLNHV  239



>gb|KCW84301.1| hypothetical protein EUGRSUZ_B01152 [Eucalyptus grandis]
Length=293

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  S GAG V+QL GLN Y+ G  DSKLAILL+SD+FGYEA N RK+A
Sbjct  58   MSGPQCCENPPTLDPSCGAGHVEQLCGLNTYIVGSQDSKLAILLLSDIFGYEAPNFRKIA  117

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPD+F+GD +V +N  +P+ VW+KDH  D   +D K +I+ LK+ GISK
Sbjct  118  DKVAAAGFYVVVPDYFNGDTFVLDNPERPLMVWMKDHGTDKGFEDTKPIIQALKSKGISK  177

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K   +LAK   ++A V+LHPAFVTLDDI+GVKVP  VL AE D  TP ++
Sbjct  178  IGAAGFCWGAKVATELAKCELIQAAVMLHPAFVTLDDIKGVKVPTAVLAAENDHLTPLEL  237

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK EVD  VKI+   +HGWT RY          A EAH DM++W +K++
Sbjct  238  VKQFEEELAAKPEVDGFVKIYPKTSHGWTTRY---KAEDEAAAMEAHSDMIQWVVKYV  292



>gb|KFK39657.1| hypothetical protein AALP_AA3G272500 [Arabis alpina]
Length=240

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L    G+G V++LGGL+ YVSG  DSKL +LL+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNSGSGSGHVEKLGGLDAYVSGSPDSKLCVLLISDVFGYEAPNLRALA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDH-AVDNVSKDAKVVIEDLKAAGIS  418
            DK+  +GFYVVVPD+F+GDPY   N  + I VW+KDH A D   +D K V+E +K+ GI+
Sbjct  61   DKVAASGFYVVVPDYFYGDPYDPSNQERSITVWIKDHGAQDKGFEDTKPVLEAIKSKGIT  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G+C G K VV+L+K   ++A VL+HP+FVT+DDI+  KVPI +LGAE D  +PP 
Sbjct  121  GIGAAGMCWGAKVVVELSKQELIQAAVLMHPSFVTVDDIKSGKVPIAILGAEIDNMSPPA  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L +K EV+S VKI   V+HGWTVRY  DD  AVK AEEAH++ML WF+ ++
Sbjct  181  LLKQFEEILASKPEVNSYVKIHPKVSHGWTVRYSTDDAEAVKAAEEAHKEMLDWFVTYV  239



>gb|KEH32209.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=238

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 173/238 (73%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + G+G V++LG LN Y++G  +SK ++LLVSDVFGYEA NLRKLA
Sbjct  1    MSGPECCSNPPILNPNAGSGHVEKLGALNAYIAGSPNSKSSVLLVSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG++VVVPDF +G+PY  EN  +P+ +W+KDH  D   +DAK +IE +K+ G+S 
Sbjct  61   DKVAAAGYFVVVPDFLNGEPYNPENPDRPLPIWIKDHGTDKGFEDAKPIIEAIKSKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K V +LAK   ++A VLLHP+FV++DDI+ V +P  +LGAE D  +PP++
Sbjct  121  VGAAGFCWGAKVVTELAKSRLIQAAVLLHPSFVSVDDIKAVDIPYSILGAEIDRLSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+   S VKIF  V+HGWTVRY  +D  AVK AEEAHQD+L WF KHL
Sbjct  181  VKQFEEILSAKS-APSFVKIFPKVSHGWTVRYSPEDAEAVKAAEEAHQDLLDWFAKHL  237



>ref|NP_001055474.1| Os05g0399100 [Oryza sativa Japonica Group]
 dbj|BAF17388.1| Os05g0399100, partial [Oryza sativa Japonica Group]
Length=284

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 174/259 (67%), Gaps = 3/259 (1%)
 Frame = +2

Query  8    LACLRT*SHF-SKAY*HNNIMSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSK  181
            L+ LR   H   + +     M++P C ANPP L  + G GKV +  GG+  YV+G  +SK
Sbjct  25   LSSLRLEKHRDQEKFQQEQAMASPQCCANPPTLNPAGGEGKVVESFGGIKAYVAGAAESK  84

Query  182  LAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAV  358
             A++L+SDVFG+EA NLRK+ADK+  +G++VVVPDF HGDP V E+  KP  +W+K+H  
Sbjct  85   AAVVLISDVFGFEAPNLRKIADKVASSGYFVVVPDFLHGDPLVPESTEKPFQMWIKEHGP  144

Query  359  DNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQ  538
            D   ++AK +I  LK  G+S +G  G C G K VV+L K   ++A V+ HP+FVT+DD++
Sbjct  145  DKAFEEAKPIIAALKEKGVSSIGAVGYCWGAKVVVELVKAHEIQAAVMCHPSFVTVDDMK  204

Query  539  GVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIA  718
             VK PI +LGAE D  +PP+VVKQFE  L +K+ +   VKIF GV HGWTVRY  DD  A
Sbjct  205  EVKCPIAILGAEIDRMSPPEVVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAA  264

Query  719  VKVAEEAHQDMLKWFIKHL  775
            VK AEEA  DM+ WF K+L
Sbjct  265  VKSAEEALADMIDWFNKNL  283



>ref|XP_004296955.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=244

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 169/244 (69%), Gaps = 8/244 (3%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + G+G V++L GL+ YV+G  DSKLAILL++D+FGYEA  LRKLA
Sbjct  1    MSGPACCSNPPALNPASGSGHVEKLAGLDSYVTGSPDSKLAILLIADIFGYEAPLLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG------VWLKDHAVDNVSKDAKVVIEDLKA  406
            DKI   G++VVVPDFF+GD +    A P+G      +WLK H      + AK ++E LK+
Sbjct  61   DKIAAVGYFVVVPDFFYGDAF-PGDAGPVGNSSALPIWLKTHIPIKACEAAKPLVEALKS  119

Query  407  AGISKVGIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDE  583
             G+S +G  G C G K VV+LAK    + A VL HP+FVT+DD + VKVPI +LGAE D 
Sbjct  120  RGVSAIGAVGFCWGAKAVVELAKYDNFLHAAVLCHPSFVTVDDCKAVKVPISILGAEIDP  179

Query  584  TTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
             +PP VVKQFE  L AKTE+ S VKIF  V HGWTVRY+ +D+ AVK AEEAHQD+L WF
Sbjct  180  ISPPDVVKQFEEVLTAKTEIKSHVKIFPKVQHGWTVRYNAEDEAAVKCAEEAHQDILDWF  239

Query  764  IKHL  775
              HL
Sbjct  240  FSHL  243



>ref|XP_008223025.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=243

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 170/242 (70%), Gaps = 5/242 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G  +  GGL+ YV+G   SKLA+L +SD+FG++A  LRK A
Sbjct  1    MSGPQCCSHPPVLNPSSGSGHAETFGGLDSYVTGSPHSKLAVLFLSDIFGFQAPKLRKFA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AG++VVVPDFF+GDP+V   +     + VWLKDH+ +   +DAK+VIE LK+ G+
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVVADDGSFDRLPVWLKDHSPEKGLEDAKLVIEALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIP--CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETT  589
            S +G  G C G K  V+L K     + A VLLHPAF T+DDI+ VKVPI VLGAE D  T
Sbjct  121  SAIGAAGFCWGAKVAVELGKHDHDFIHAGVLLHPAFTTVDDIKEVKVPIAVLGAEFDHIT  180

Query  590  PPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            PP+V+KQ+E  L AKTE+ S VKIF  V HGWT RY+ +D+ +VK AEEAHQD+L+WF  
Sbjct  181  PPEVLKQWEEVLIAKTEIKSYVKIFPEVEHGWTTRYNVEDEKSVKSAEEAHQDLLEWFSN  240

Query  770  HL  775
            H+
Sbjct  241  HV  242



>ref|XP_009365787.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 172/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G V++L GL+ Y+ G  DSK+A+LLVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKLSGLDTYLVGSPDSKVAVLLVSDIFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+   GF+VVVPDFF+GDP+V  E G      W+K H  D   +DAK V+E LK+ GIS
Sbjct  61   DKLAAGGFFVVVPDFFYGDPFVLGEEGFAAFPGWIKHHGTDKALEDAKPVLEALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+L+K   ++A  + HP+FVTLDDI+ VKVP  +LGAE D  +PP+
Sbjct  121  AVGAVGFCYGAKVVVELSKHDFIQAAAMCHPSFVTLDDIKAVKVPTQILGAEIDHMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE AL AK E+ S VKIF  V HGWT RY+++D+ A K AEEAHQD+L+WF+ H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWFLNHV  239



>ref|XP_010532707.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=241

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C  NPP    + G+G V++LGGL+ YV+G  DSK AILL SD FG+EA NLRKLA
Sbjct  3    MMGPQCCQNPPVKIPNAGSGHVEKLGGLDAYVTGSPDSKFAILLASDAFGFEAPNLRKLA  62

Query  245  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFFHGD Y  EN  +P+ VW+KDH  +   + +K VIE LK+ GI  
Sbjct  63   DKVAAAGFYVVVPDFFHGDSYTPENQDRPLPVWIKDHGPEKGFEYSKPVIEALKSKGIDA  122

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  GVC G K VV+LAK   +++ VLLHP+ V++DDI+ VK PI VLGAE D TTPP++
Sbjct  123  IGATGVCFGAKVVVELAKRQLIQSAVLLHPSLVSVDDIKEVKTPIAVLGAEIDGTTPPEL  182

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VK+F  AL +K +V S VKI+  V HGW+VRY+E D  AVK AEEAH+DML+W + H+
Sbjct  183  VKKFSEALASKPDVKSYVKIYPNVEHGWSVRYEESDAEAVKAAEEAHKDMLEWSLIHV  240



>ref|XP_007224824.1| hypothetical protein PRUPE_ppa023469mg [Prunus persica]
 gb|EMJ26023.1| hypothetical protein PRUPE_ppa023469mg [Prunus persica]
Length=243

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 172/242 (71%), Gaps = 5/242 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+A  C ++PP L  S G+G V++ GGL+ YV+G   SKLAIL +SD+FG++A  LRK A
Sbjct  1    MAASKCCSHPPVLNPSSGSGHVEKFGGLDSYVTGSPHSKLAILFLSDIFGFQAPKLRKFA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AG++VVVPDFF+GDP+V   +     + VWLKDH+ +   +DAK+VIE LK+ G+
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVLADDGSFDRLPVWLKDHSPEKGFEDAKLVIEALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIP--CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETT  589
            S +G  G C G K  V+L K     + A VLLHPAF T+DDI+ VKVPI +LGAE D  T
Sbjct  121  SAIGAAGFCWGAKVAVELGKHDHDFIHAGVLLHPAFTTVDDIKEVKVPIAILGAEFDHIT  180

Query  590  PPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            PP+V+KQ+E  L AKTE+ S VKIF  V HGWT RY+ +D+ +VK AEEAHQD+L+WF  
Sbjct  181  PPEVLKQWEEVLIAKTEIKSYVKIFPEVEHGWTTRYNVEDEKSVKSAEEAHQDLLEWFSN  240

Query  770  HL  775
            H+
Sbjct  241  HV  242



>emb|CDY09036.1| BnaC01g30550D [Brassica napus]
Length=238

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C  NPP L    G+G V++LGG + YVSG  DS   +LLVSD++GY+A NLR LA
Sbjct  1    MLGPQCCENPPVLNPLSGSGHVEKLGG-DVYVSGSPDSNKCVLLVSDIYGYKAPNLRALA  59

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  +GFYVVVPD+F+GDPY   +  +P+ VW+KDH  D   +D   V+E +K  GI+ 
Sbjct  60   DKVAASGFYVVVPDYFYGDPYDPSHQDRPVPVWIKDHGHDKGFEDTNPVLEAIKNKGITA  119

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G+C GGK V +L+K   +EA VLLHP +VT+DDI+ VKVPI +LGAE D  TPP +
Sbjct  120  IGAAGMCWGGKVVAELSKEELIEAAVLLHPTYVTVDDIKDVKVPIAILGAENDFLTPPAL  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L +K EV S VKIF  V+HGWT RYD +D  AVK AEEAH++ML WF+ ++
Sbjct  180  VKQFEEILPSKPEVGSYVKIFPNVSHGWTTRYDINDPEAVKAAEEAHKEMLDWFVTYV  237



>gb|AAU10802.1| putative endo-1,3;1,4-beta-D-glucanase [Oryza sativa Japonica 
Group]
 dbj|BAG87591.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63648.1| hypothetical protein OsJ_18465 [Oryza sativa Japonica Group]
Length=240

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 167/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G GKV +  GG+  YV+G  +SK A++L+SDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVESFGGIKAYVAGAAESKAAVVLISDVFGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPDF HGDP V E+  KP  +W+K+H  D   ++AK +I  LK  G+S
Sbjct  61   ADKVASSGYFVVVPDFLHGDPLVPESTEKPFQMWIKEHGPDKAFEEAKPIIAALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K VV+L K   ++A V+ HP+FVT+DD++ VK PI +LGAE D  +PP+
Sbjct  121  SIGAVGYCWGAKVVVELVKAHEIQAAVMCHPSFVTVDDMKEVKCPIAILGAEIDRMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE  L +K+ +   VKIF GV HGWTVRY  DD  AVK AEEA  DM+ WF K+L
Sbjct  181  VVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMIDWFNKNL  239



>ref|XP_010024431.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60873.1| hypothetical protein EUGRSUZ_H03606 [Eucalyptus grandis]
Length=240

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 165/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG +++L GL  YV+GP DSK A+LL++D FGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHIEELAGLKTYVTGPSDSKRAVLLIADAFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV--WLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI  AGF VVVPDFF+GDP ++  +    +  W K+H  D   +DAK VI  LK+ G+S
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNLEAWFKNHGTDKGYEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C GG  +V LA    ++A V+LHP  +T D+I+ VK+P  +LGAE D ++PP+
Sbjct  121  AIGAAGFCWGGMVLVKLAGTEDIQAAVILHPGPMTEDEIKAVKIPTAILGAEIDHSSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +K+F   + AKTE +S VKIF GV+HGW+VRYD+D++  VK AEEA +D L WF+KH+
Sbjct  181  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNEFVVKSAEEAQEDTLNWFLKHV  239



>ref|XP_010024435.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60875.1| hypothetical protein EUGRSUZ_H03608 [Eucalyptus grandis]
Length=240

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 165/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG V++L GL  YV+GP DSK A+LL++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHVEELAGLKTYVTGPSDSKRAVLLIADVFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG--VWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI  AGF VVVPDFF+GDP ++  +       W K+H  D   +DAK VI  LK+ G+S
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNFEAWFKNHGTDKGHEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C GG  +V LA    ++A V+LHP  +T D I+ VK+P  +LGAE D ++PP+
Sbjct  121  AIGAAGFCWGGVVLVKLAGTEDIQAAVILHPGPMTEDAIKAVKIPTAILGAEIDHSSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +K+F   + AKTE +S VKIF GV+HGW+VRYD+D+++ VK AEEA +D L WF+KH+
Sbjct  181  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNELVVKSAEEAQEDTLNWFLKHV  239



>ref|XP_009352128.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 173/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G V++L GL+ Y+ G  DSK+A+LLVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKLSGLDTYLVGSPDSKVAVLLVSDIFGYDAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+   GF+VVVPDFF+GDP+V  E G   +  W+K H  D   +DAK V+E +K+ GIS
Sbjct  61   DKLAAGGFFVVVPDFFYGDPFVLGEEGFAALPGWIKHHGTDKALEDAKQVLEAVKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+L+K   ++A  + HP+FVTLDDI+ VKVP  +LGAE D  +PP+
Sbjct  121  AVGAVGFCYGAKVVVELSKHDFIQAAAMCHPSFVTLDDIKAVKVPTQILGAEIDNMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE AL AK E+ S VKIF  V HGWT RY+++D+ A K AEEAHQD+L+WF+ H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWFLNHV  239



>gb|KEH32215.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=239

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 163/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C +NPP L    GAG V +LGG++ Y++G       ILLVSD+FGY+A  LR  A
Sbjct  1    MLGPACCSNPPILNSFSGAGHVAKLGGVDAYLTGSPLCTFVILLVSDIFGYKAPILRMFA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G+YVVVPDFF+GDPY   N  +PI VW+KDH  +   + ++ +IE LK+ GIS 
Sbjct  61   DKVAATGYYVVVPDFFNGDPYDPRNVDRPIDVWVKDHLPETGFEVSQPIIEALKSKGIST  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G KTV +L K   ++A VL HP+++T+DDI GV +PI +LGAE D+ TPP+V
Sbjct  121  IGAAGFCWGAKTVCELGKSKLIQAAVLAHPSYITVDDINGVNIPIAILGAENDQVTPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L A +EVDS VKIF  V+HGWT+RYD  D  AVK +EEA Q +L WF KHL
Sbjct  181  IKQFEQVLAANSEVDSFVKIFPNVSHGWTIRYDTKDPEAVKASEEARQILLDWFDKHL  238



>gb|AFK33996.1| unknown [Medicago truncatula]
Length=238

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 172/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + G+G V++LG LN Y++G  +SK ++LLVSDVFGYEA NLRKLA
Sbjct  1    MSGPECCSNPPILNPNAGSGHVEKLGALNAYIAGSPNSKSSVLLVSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG++VVVPDF +G+PY  EN  +P+ +W+KDH  D   +DAK +IE +K+ G+S 
Sbjct  61   DKVAAAGYFVVVPDFLNGEPYNPENPDRPLPIWIKDHGTDKGFEDAKPIIEAIKSKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K V +LAK   ++A VLLHP+FV++DDI+ V +P  +LGAE D  +PP++
Sbjct  121  VGAAGFCWGAKVVTELAKSRLIQAAVLLHPSFVSVDDIKAVDIPYSILGAEIDRLSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK    S VKIF  V+HGWTVRY  +D  AVK AEEAHQD+L WF KHL
Sbjct  181  VKQFEEILSAKF-APSFVKIFPKVSHGWTVRYSPEDAEAVKAAEEAHQDLLDWFAKHL  237



>gb|KCW60874.1| hypothetical protein EUGRSUZ_H03607 [Eucalyptus grandis]
Length=310

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 168/251 (67%), Gaps = 2/251 (1%)
 Frame = +2

Query  29   SHFSKAY*HNNIMSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDV  208
            SHF +       MS+  C  NPP L  + GAG V++L GL  YV+GP DSK A+LL++DV
Sbjct  59   SHFHQISEEERKMSSSQCFENPPNLSSTCGAGHVEELAGLKTYVTGPSDSKRAVLLIADV  118

Query  209  FGYEATNLRKLADKIGGAGFYVVVPDFFHGDPYVENGAKPIG--VWLKDHAVDNVSKDAK  382
            FGYEA  LRKLADKI  AGF V VPDFF+GDP ++  +       W K+H  D   +DAK
Sbjct  119  FGYEAPKLRKLADKIASAGFLVAVPDFFYGDPIIDFTSPNFNFEAWFKNHGTDKGHEDAK  178

Query  383  VVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILV  562
             VI  LK+ G+S +G  G C GG  +V LA    ++A V+LHP  +T D I+ VK+P  +
Sbjct  179  PVIAALKSKGVSTIGAAGFCWGGVVLVKLAGTEDIQAAVILHPGPMTEDAIKAVKIPTAI  238

Query  563  LGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAH  742
            LGAE D ++PP+ +K+F   + AKTE +S VKIF GV+HGW+VRYD+D+++ VK AEEA 
Sbjct  239  LGAEIDHSSPPEQLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNELVVKSAEEAQ  298

Query  743  QDMLKWFIKHL  775
            +D L WF+KH+
Sbjct  299  EDTLNWFLKHV  309



>ref|XP_010024432.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60879.1| hypothetical protein EUGRSUZ_H03610 [Eucalyptus grandis]
Length=240

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG +++L GL  YV+GP DSK A+LL++D FGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHIEELAGLKTYVTGPSDSKRAVLLIADAFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV--WLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI  AGF VVVPDFF+GDP ++  +    +  W K+H  D   +D K VI  LK+ G+S
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNLEAWFKNHGTDKGYEDVKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C GG  +V LA    ++A V+LHP   T D+I+ VK+P  +LGAE D+ +PP+
Sbjct  121  AIGAAGFCWGGMVLVKLAGTEDIQAAVILHPGPTTEDEIKAVKIPTAILGAEIDQHSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +K+F   + AKTE +S VKIF GV+HGW+VRYD+D++  VK AEEAH+D L WF+KH+
Sbjct  181  KLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNEFVVKSAEEAHEDALNWFLKHV  239



>ref|XP_010024440.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=241

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 163/240 (68%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG+V++L GL  YV+GP DSK AI+L++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPDLSSTCGAGRVEELAGLKTYVTGPSDSKRAIILIADVFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY---VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGF VVVPDF +GDPY     N       W K H+ D   +D K VI  L++ G+
Sbjct  61   DKVTSAGFLVVVPDFLYGDPYPLDYSNRNFDREAWKKIHSTDKGYEDVKPVISALRSKGL  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            S +G  G C GGK +V LA    ++A V+LHP  +T D+IQ VK+P  +LGAE D  +PP
Sbjct  121  SAIGAAGFCWGGKVLVKLAGTEDIQAAVILHPGHMTEDEIQAVKIPTAILGAEIDHASPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            + +K+F   + AKTE +S VKIF  V+HGW+VRYD+++  AVK AEEA +DML WF+KH+
Sbjct  181  EELKKFGEIMSAKTEFESYVKIFPSVSHGWSVRYDDNNDFAVKSAEEAQEDMLNWFLKHV  240



>ref|XP_010024439.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60881.1| hypothetical protein EUGRSUZ_H03613 [Eucalyptus grandis]
Length=239

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 165/238 (69%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG+V++L GL  YV+GP DSK A++L++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPDLSSTCGAGRVEELAGLKTYVTGPSDSKRAVILIADVFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF VVVPDF +GDP  + N       W K H+ D   +D K VI  L++ G+S 
Sbjct  61   DKVASAGFLVVVPDFLYGDPIDLSNPNFDREAWKKIHSTDKGYEDVKPVISALRSKGLSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GGK +V LA I  ++A V+LHP  +T D+IQ VK+P  +LGAE D  +PP+ 
Sbjct  121  IGAAGFCWGGKVLVKLAGIEDIQAAVILHPGHMTEDEIQAVKIPTAILGAEIDHASPPEE  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +K+F   + AKTE +S VKIF  V+HGW+VRYD++++ AVK AEEA +DML WF+KH+
Sbjct  181  LKKFGEIMSAKTEFESYVKIFPSVSHGWSVRYDDNNEFAVKSAEEAQKDMLNWFLKHV  238



>ref|XP_010101277.1| hypothetical protein L484_011641 [Morus notabilis]
 gb|EXB88212.1| hypothetical protein L484_011641 [Morus notabilis]
Length=270

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 170/270 (63%), Gaps = 32/270 (12%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C +NPP +    G G V++LGGL  Y SG   SK+A++L+SDVFGYEA N+R +A
Sbjct  1    MAGNQCCSNPPVMDPGSGEGSVEELGGLKVYTSGSPSSKMAVILISDVFGYEAPNIRMVA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  +GF+VVVPDFFHGDP+  +  KP+ VWLKDH  D   ++ K V+E LK+ G S +
Sbjct  61   DKVAASGFFVVVPDFFHGDPFAYSNNKPLAVWLKDHGTDKGFEEVKPVVEALKSKGFSSL  120

Query  425  GIGGVCSGGKTVVDLAKIPCV--------------------------------EATVLLH  508
            G  G C G K V +++K   +                                +A VLLH
Sbjct  121  GAAGFCWGAKVVTEISKSKSIIQAAVLLHPSFVTLDDITAKVVTEISKSKSIIQAAVLLH  180

Query  509  PAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWT  688
            P+FVTLDDI GV VPI +LGAE D+ +PP ++KQFE  L AK EVDS V+IF  V HGWT
Sbjct  181  PSFVTLDDITGVNVPIAILGAEIDDYSPPALLKQFEAILIAKPEVDSHVEIFPNVKHGWT  240

Query  689  VRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +RY+ +D+ AV  AEEAH+ ML+WF K+++
Sbjct  241  LRYNVNDEAAVNSAEEAHRKMLEWFSKYVN  270



>ref|XP_002516791.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF45405.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 162/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C+ NPP L  +YG G VQ+LGGL  Y++GP DSKLAILL  D FG+EA NLRKLA
Sbjct  1    MSSSQCLENPPILNPNYGLGTVQELGGLKAYITGPPDSKLAILLACDAFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF  VVPDF +GDP+ +++       WLK H      +DAKVVI  LK  GIS 
Sbjct  61   DKVAAAGFLAVVPDFLYGDPFQLDSPQFNREAWLKIHDTAKGCEDAKVVIAALKNRGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C GG  VV LA    + A V+LHP ++T D+I+ VKVP  +LGAE D+ +PP+ 
Sbjct  121  VGAAGFCWGGMVVVKLASCDDIHAAVILHPGWITADEIKAVKVPTAILGAEIDQISPPEQ  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +K+F   L  K+E +S VKIF GV HGWT+RY+++D  AVK AEEAH DML WF KH+
Sbjct  181  MKEFGEILAEKSEFESYVKIFPGVVHGWTLRYNDEDDSAVKFAEEAHLDMLNWFTKHV  238



>ref|XP_010024430.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=240

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG V++L GL  YV+GP DSK A+LL++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHVEELAGLKTYVTGPSDSKRAVLLIADVFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG--VWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI  AGF V VPDFF+GDP ++  +       W K+H  D   +DAK VI  LK+ G+S
Sbjct  61   DKIASAGFLVAVPDFFYGDPIIDFTSPNFNFEAWFKNHGTDKGHEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C GG  +V LA    ++A V+LHP  +T D I+ VK+P  +LGAE D ++PP+
Sbjct  121  TIGAAGFCWGGVVLVKLAGTEDIQAAVILHPGPMTEDAIKAVKIPTAILGAEIDHSSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +K+F   + AKTE +S VKIF GV+HGW+VRYD+D+++ VK AEEA +D L WF+KH+
Sbjct  181  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNELVVKSAEEAQEDTLNWFLKHV  239



>ref|XP_002516792.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF45406.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 161/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG VQ+ GGL  YV+GP  S LAI+L+SD+FG+EA NLRKLA
Sbjct  1    MSSSQCFENPPSLTSTCGAGTVQEFGGLKIYVTGPPHSTLAIILISDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+V+VPDFF+GDP  + N       W K H  D   +DAK VI  LK  G+S 
Sbjct  61   DKVAAAGFFVLVPDFFYGDPVDLNNPEFDRESWRKVHNADKGYEDAKQVIAALKCKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +   G C GG+ VV LA    ++A V+LHP  +T+DDI  VKVPI  LGAE D  +PP+ 
Sbjct  121  ISAAGFCWGGRVVVKLASSDDIKAAVVLHPGRLTVDDINEVKVPIAFLGAEFDHASPPEQ  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQF   L AK+E DS VKIF GV+HGW+VRY+ +D+ AV+ AEEA  DML WF K++
Sbjct  181  LKQFGEVLSAKSEFDSFVKIFPGVSHGWSVRYNVEDESAVRSAEEAQSDMLNWFTKYV  238



>dbj|BAJ98176.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G GKV    GG+  YV+G  +SK A++L+SDVFG+ A NLRK+
Sbjct  1    MASPQCCANPPTLNPAAGEGKVVDSFGGIKAYVAGAQESKAAVVLISDVFGFGAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPDF HGDPYV E+  +PI VW+K+H      ++AK VI  LK  G S
Sbjct  61   ADKVAASGYFVVVPDFLHGDPYVPEDADRPIAVWIKEHTAGKAFEEAKPVIAALKEQGAS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K V +LAK   ++  V+ HP+FVT+DDI+ VK PI VLGAETD  +PP+
Sbjct  121  SVGAAGYCWGAKVVAELAKANEIQTAVMSHPSFVTVDDIKEVKCPIAVLGAETDVMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +VK+FE  L + + +   VKIF GV+HGWTVRY+ +D  AVK AEEA  DM+ WF K+L
Sbjct  181  LVKEFEQVLSSNSGIAHFVKIFPGVSHGWTVRYNGEDAAAVKSAEEALTDMIDWFNKNL  239



>gb|ACJ85031.1| unknown [Medicago truncatula]
Length=238

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 172/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + G+G V++LG LN Y++G  +SK ++LLVSDVFGYEA NLRKLA
Sbjct  1    MSGPECCSNPPILNPNAGSGHVEKLGALNAYIAGSPNSKSSVLLVSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG++VVVPDF +G+PY  EN  +P+ +W+KDH  D   +DAK +IE +K+ G+S 
Sbjct  61   DKVAAAGYFVVVPDFLNGEPYNPENPDRPLPIWIKDHGTDKGFEDAKPIIEAIKSKGVSS  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG  G C G K V +LAK   ++A VLLHP+FV++DDI+ V +P  +LGAE D  +PP++
Sbjct  121  VGAAGFCWGAKVVTELAKSRLIQAAVLLHPSFVSVDDIKAVDIPYSILGAEIDRLSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VKQFE  L AK+   S VKIF  V+HGWTVRY  +D  AVK AEEAHQD+L W  KHL
Sbjct  181  VKQFEEILSAKS-APSFVKIFPKVSHGWTVRYSPEDAEAVKAAEEAHQDLLDWVAKHL  237



>gb|KEH32211.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=293

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 172/239 (72%), Gaps = 3/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSG-PLDSKLAILLVSDVFGYEATNLRKL  241
            MS   C +NPP L    GAG V+++GGL+ Y++G PL +K AIL VSD++GYE+  +R L
Sbjct  55   MSGHACCSNPPILNPFSGAGHVEKIGGLDAYLTGSPLSTK-AILFVSDIYGYESPIIRNL  113

Query  242  ADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  AG+YVVVPD+F+GDPY ++   +P+ +W++DH  D   + ++ +IE LK+ G+S
Sbjct  114  ADKVAAAGYYVVVPDYFYGDPYDDDRVDRPLPIWMEDHEPDKGFEASQPIIEALKSKGVS  173

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G KTV +L K   ++A VL HP+ +T++DI GV +PI +LGAE D  TPP+
Sbjct  174  AIGAAGYCWGAKTVCELGKSKLIQAVVLAHPSLITVEDINGVNIPIAILGAELDPITPPE  233

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            V+KQFE  L AK EVDS VKIF  V+HGWT+RYD +D  AVK AEEAHQ +L WF+K++
Sbjct  234  VIKQFEQVLAAKPEVDSFVKIFPNVSHGWTIRYDTEDPEAVKAAEEAHQILLDWFVKYV  292



>ref|XP_008340899.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
 ref|XP_008361979.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=237

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 175/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G+G V++LGG + YV+G  DSKLA+LLV D FGYEA   R LA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSKLAVLLVHDAFGYEAPKARMLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF VV+PDFF+ DP+  + A  I VW+K HA D   +DAK+VIE LK+ G+S +
Sbjct  61   DKIAAAGFIVVLPDFFNRDPFNGDLAS-IPVWIKAHAPDKTIEDAKLVIEALKSXGVSAI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C GGK VV+LAK   ++A VL HP+FVTLDDI+ VKVPI VLGAE D+ TPP+VV
Sbjct  120  GAVGFCWGGKGVVELAKHDFIQAAVLCHPSFVTLDDIKAVKVPISVLGAEIDQLTPPEVV  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK E+ S VKIF  + HGWT+RY+++D+ AVK AEEAHQD+L WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKIAHGWTLRYNDEDEAAVKAAEEAHQDLLGWFLEHI  236



>ref|XP_007150409.1| hypothetical protein PHAVU_005G151000g [Phaseolus vulgaris]
 gb|ESW22403.1| hypothetical protein PHAVU_005G151000g [Phaseolus vulgaris]
Length=239

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 165/233 (71%), Gaps = 1/233 (0%)
 Frame = +2

Query  80   CIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGG  259
            C++NPP L  S G G V  + G+N YV+G   + LAI+L+SDV+G++   LRK+ADK+  
Sbjct  5    CLSNPPILNASTGVGYVTNIAGVNSYVTGSPLAILAIVLISDVYGFKPPLLRKIADKVAN  64

Query  260  AGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGG  436
             G++VVVPDFFHG+PY  EN ++P   WLKDH      + AK +IE LK  G S VG+ G
Sbjct  65   HGYFVVVPDFFHGEPYNKENASRPFDPWLKDHDPAKGIETAKPIIEALKRKGASAVGVAG  124

Query  437  VCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFE  616
             C G +TV  L K   V+A+VLLHP+++T+DDI+GV+VPI +LGAE D  +PPK++KQF+
Sbjct  125  FCWGARTVTKLGKAKLVQASVLLHPSYITVDDIRGVEVPIAILGAEHDSLSPPKLLKQFK  184

Query  617  IALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
              L AK E+DS VKIF  V+HGWTVRYD +D  AVK A +AH+ M+ WF KHL
Sbjct  185  QVLDAKPEIDSYVKIFANVSHGWTVRYDPNDPKAVKAAGKAHKIMINWFDKHL  237



>ref|XP_006654369.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Oryza brachyantha]
Length=240

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP    + G GKV    GG+  YVSG  +SK A++LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTPDPAGGEGKVVDSFGGIKAYVSGAAESKAAVILVSDVFGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADKI  +GF+VVVPDF HGDP V E+  KP  VW+K+H  D   ++AK VI  LK  G+S
Sbjct  61   ADKIALSGFFVVVPDFLHGDPLVPESTEKPFPVWIKEHGPDKAFEEAKPVIAALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K V +LAK   ++  V+ HP+FVT+DDI+ VK  I +LGAE D  +PP+
Sbjct  121  TVGAAGYCWGAKVVAELAKAHEIQTAVMCHPSFVTVDDIKEVKCSIAILGAEIDRMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE  L +K+ +   VKIF GV HGWTVRY  DD  AVK AEEA  DM+ WF K+L
Sbjct  181  VVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMIDWFNKNL  239



>gb|EAY97963.1| hypothetical protein OsI_19880 [Oryza sativa Indica Group]
Length=240

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G GKV    GG+  YV+G  +SK A++LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVDSFGGIKAYVAGAAESKAAVVLVSDVFGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPDF  GDP V E+  KP  +W+K+H  D   ++AK +I  LK  G+S
Sbjct  61   ADKVASSGYFVVVPDFLDGDPLVPESTEKPFQMWIKEHGPDKAFEEAKPIIAALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C G K VV+LAK   ++A V+ HP+FVT+DD++ VK PI +LGAE D  +PP+
Sbjct  121  SIGAVGYCWGAKVVVELAKAHEIQAAVMCHPSFVTVDDMKEVKCPIAILGAEIDRMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE  L +K+ +   VKIF GV HGWTVRY  DD  AVK AEEA  DM+ WF K+L
Sbjct  181  VVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMIDWFNKNL  239



>gb|KCW60880.1| hypothetical protein EUGRSUZ_H03611 [Eucalyptus grandis]
Length=339

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 163/240 (68%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG+V++L GL  YV+GP DSK AI+L++DVFGYEA  LRKLA
Sbjct  99   MSSSQCFENPPDLSSTCGAGRVEELAGLKTYVTGPSDSKRAIILIADVFGYEAPKLRKLA  158

Query  245  DKIGGAGFYVVVPDFFHGDPY---VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            DK+  AGF VVVPDF +GDPY     N       W K H+ D   +D K VI  L++ G+
Sbjct  159  DKVTSAGFLVVVPDFLYGDPYPLDYSNRNFDREAWKKIHSTDKGYEDVKPVISALRSKGL  218

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
            S +G  G C GGK +V LA    ++A V+LHP  +T D+IQ VK+P  +LGAE D  +PP
Sbjct  219  SAIGAAGFCWGGKVLVKLAGTEDIQAAVILHPGHMTEDEIQAVKIPTAILGAEIDHASPP  278

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            + +K+F   + AKTE +S VKIF  V+HGW+VRYD+++  AVK AEEA +DML WF+KH+
Sbjct  279  EELKKFGEIMSAKTEFESYVKIFPSVSHGWSVRYDDNNDFAVKSAEEAQEDMLNWFLKHV  338



>ref|XP_006339415.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum tuberosum]
Length=238

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 161/238 (68%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C+ NPP L  + G G +Q++GGL+ YVSG + SKLAILL+SDVFGYEA  LRKLA
Sbjct  1    MSGAECMKNPPTLNSASGIGNLQEIGGLSSYVSGSIHSKLAILLISDVFGYEAPLLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  +G+ VVVPDFF+G+P ++     +  W KDH +D   +DAKVV+E LK+ G+S +
Sbjct  61   DKVAASGYLVVVPDFFYGEP-LDREKHDLQTWFKDHGIDKGCEDAKVVVESLKSKGVSAI  119

Query  425  GIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            G  G C GG  V  LAK    ++A V+LHP  +T+DDI  VKVP  +L AE D   PP  
Sbjct  120  GAAGFCWGGMVVSKLAKYESTIDAAVILHPGPITVDDINEVKVPTAILAAEHDHIFPPDQ  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             K    AL AK E++S VKIF GV HGWTVRY+ +D+ AVK AEEAH DML WF K +
Sbjct  180  AKLLANALSAKPEIESFVKIFPGVEHGWTVRYNVEDESAVKAAEEAHSDMLNWFTKFI  237



>gb|AFK37956.1| unknown [Medicago truncatula]
Length=239

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C +NPP L    GAG V+++GGL+ Y++G   S  AIL VSD++GYE+  +R LA
Sbjct  1    MSGHACCSNPPILNPFSGAGHVEKIGGLDAYLTGSPLSTKAILFVSDIYGYESPIIRNLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPD+F+GDPY ++   +P+ +W++DH  D   + ++ +IE LK+ G+  
Sbjct  61   DKVAAAGYYVVVPDYFYGDPYDDDRVDRPLPIWMEDHEPDKGFEASQPIIEALKSKGVFA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G KTV +L K   ++A VL HP+ +T++DI GV +PI +LGAE D  TPP+V
Sbjct  121  IGAAGYCWGAKTVCELGKSKLIQAVVLAHPSLITVEDINGVNIPIAILGAELDPITPPEV  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK EVDS VK+F  V+HGWT+RYD +D  AVK AEEAHQ +L WF+K++
Sbjct  181  IKQFEQVLAAKPEVDSFVKVFPNVSHGWTIRYDTEDPEAVKAAEEAHQILLDWFVKYV  238



>ref|XP_010327302.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Solanum 
lycopersicum]
Length=236

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 159/237 (67%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V ++G  N YVSGP  SKLAILLVSDV+GYEA NLR + 
Sbjct  1    MSGRECCENPPALSSSSGNGCVLKVGSFNAYVSGPSTSKLAILLVSDVYGYEAPNLRNIV  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF GDPY     K + +W++ H      +DAK +I  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFCGDPYTIE--KTLSIWIQSHGTAKGFEDAKQIIAVLKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +LAK   ++A VLLHP+ V +DD + VK PI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELAKSDYIQAAVLLHPSLVKVDDFKEVKAPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             QFE  L +K EVD  VKIF GV HGWTVRY+ ++K AV+ AEEAH+DML W  K++
Sbjct  179  IQFEEVLSSKPEVDKFVKIFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_010322752.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum lycopersicum]
Length=238

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 163/238 (68%), Gaps = 2/238 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+   C+ NPP L  + G G +Q++GGL+ YVSG + SKLAILL+SDVFGYEA  LRKLA
Sbjct  1    MAGAQCMKNPPTLNSASGVGDLQEIGGLSSYVSGSIHSKLAILLISDVFGYEAPLLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  +G+ VVVPDFF+G+P ++     +  WLKDH +D   +DAKVV+E LK+ G+S +
Sbjct  61   DKVAASGYLVVVPDFFYGEP-LDREKHDVQTWLKDHGIDKGCEDAKVVVESLKSKGVSAI  119

Query  425  GIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            G  G C GG  V  LAK    ++A V+LHP  +T+DDI  VKVPI +L AE D   PP  
Sbjct  120  GAAGFCWGGMVVSKLAKYESTIDAAVILHPGPITVDDINEVKVPIAILAAEHDHIFPPDQ  179

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             K    AL AK E++S VKIF GV HGWTVRY+ +D+ AVK AEE+H DML WF K +
Sbjct  180  AKLLGNALSAKPEIESFVKIFPGVEHGWTVRYNVEDEPAVKAAEESHTDMLNWFTKFI  237



>ref|XP_008367178.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=236

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 167/237 (70%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C  NPP L  S  +G V++LGG + YV+G  DS+L++LLV D FG   T   KLA
Sbjct  1    MASSECCLNPPALNPSSSSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGTLPTT-PKLA  59

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF VV+PDFF+GDP+  + A  I VW K HA +   +DAK+VIE L++ G+S +
Sbjct  60   DKIAAAGFIVVLPDFFNGDPFNGDRAS-IPVWRKTHAPEKTIEDAKLVIEALRSKGVSAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V+DLAK   ++A VL HP+ VTLDDI+ VKVPI VLGAE D+  PP+V+
Sbjct  119  GAAGFCWGAKGVIDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDQMYPPEVI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK E+ S VKIF  V HGWT+RYD++D+ AVK A EAHQD+L WF++H+
Sbjct  179  KQFEEVLTAKPEIKSHVKIFPKVAHGWTLRYDDEDEAAVKAAGEAHQDLLGWFLEHV  235



>ref|XP_010327300.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327301.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
lycopersicum]
Length=254

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 159/237 (67%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS   C  NPP L  S G G V ++G  N YVSGP  SKLAILLVSDV+GYEA NLR + 
Sbjct  1    MSGRECCENPPALSSSSGNGCVLKVGSFNAYVSGPSTSKLAILLVSDVYGYEAPNLRNIV  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  AG+YVVVPDFF GDPY     K + +W++ H      +DAK +I  LK  GIS +
Sbjct  61   DKVAAAGYYVVVPDFFCGDPYTIE--KTLSIWIQSHGTAKGFEDAKQIIAVLKDKGISAI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K V +LAK   ++A VLLHP+ V +DD + VK PI +L AE D+ +PP+++
Sbjct  119  GAAGFCWGAKVVTELAKSDYIQAAVLLHPSLVKVDDFKEVKAPIAILAAEIDKISPPELI  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             QFE  L +K EVD  VKIF GV HGWTVRY+ ++K AV+ AEEAH+DML W  K++
Sbjct  179  IQFEEVLSSKPEVDKFVKIFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_008223020.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=239

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 164/239 (69%), Gaps = 1/239 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG + +LGGL  Y +GP +SK AILLVSDVFGYE  NLRKLA
Sbjct  1    MSSAECFKNPPVLGPTSGAGTLLELGGLKTYFTGPSESKHAILLVSDVFGYENLNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDP-YVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGF+VV+PDFF+GDP  ++N       W K H+ +   +DAK+VI  LK+ GIS 
Sbjct  61   DKVAAAGFFVVIPDFFYGDPVNLDNPQFDRESWHKAHSREKGYEDAKLVIAALKSQGISA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C GG  VV LAK   ++A V+LHP  +T ++I  VKVP  +LGAE D+T+PP+ 
Sbjct  121  IGAAGFCWGGNVVVKLAKTNDIQAAVILHPGRLTDEEIVEVKVPTAILGAEIDKTSPPEQ  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            +K F   L  K+E +S VKIF GV HGWT RY+ +D+ AVK AEEAH DML WF K+++
Sbjct  181  MKHFGEILSTKSEFNSFVKIFPGVAHGWTTRYNAEDESAVKSAEEAHLDMLNWFTKYVN  239



>ref|NP_001148765.1| endo-1,3;1,4-beta-D-glucanase [Zea mays]
 gb|ACG32824.1| endo-1,3;1,4-beta-D-glucanase precursor [Zea mays]
Length=241

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G GKV    GGL  YV+GP DSK A++LV+DVFG+EA  LR +
Sbjct  1    MASSQCCDNPPALNPACGKGKVVDSFGGLKAYVAGPEDSKAAVVLVADVFGFEAPILRNI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPDFFHGDPYV EN  K I VWLK H  +   ++AK VI  LK  G+S
Sbjct  61   ADKVASSGYFVVVPDFFHGDPYVPENAEKLIPVWLKSHTPEKGFEEAKPVIAALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKI-PCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
             VG  G C G K VV+LAK    ++A VLLHP+FVT+DDI+ VK  I +LGAE D  +PP
Sbjct  121  AVGAAGYCWGAKVVVELAKANELLQAAVLLHPSFVTVDDIKEVKCSIAILGAEMDVRSPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++VKQFE AL   + V   VKIF GV HGW+VRY  DD  AVK AEEA  DML WF K+L
Sbjct  181  ELVKQFEQALSVNSGVGHFVKIFPGVAHGWSVRYSLDDAAAVKSAEEAFADMLDWFNKNL  240



>gb|AFK40311.1| unknown [Lotus japonicus]
Length=239

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP +  + GAG V++  GL+ Y++G   SKLAILLVSD++GYEA NLR LA
Sbjct  1    MSGPQCCSNPPTINPTAGAGHVEKFAGLDSYLTGSPHSKLAILLVSDIYGYEAPNLRNLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFF+GDPY  EN  +P+ VWLKDH  D   + AK ++E LK+ G+S 
Sbjct  61   DKVVAAGYYVVVPDFFYGDPYNPENANRPLPVWLKDHGTDKGFEVAKPIVEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+LAK   ++A V LHP+FV+LDDI GV +PI +LGAE D+ +PP++
Sbjct  121  IGAAGFCWGAKVVVELAKSRLIQAAVQLHPSFVSLDDINGVDIPIAILGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQFE  L AK  VDS VKIF  V+HGW+VRY+ +D  AVK AEEAHQDML WF KHL
Sbjct  181  LKQFEQVLTAKPGVDSYVKIFPKVSHGWSVRYNIEDAEAVKAAEEAHQDMLDWFAKHL  238



>ref|XP_010650032.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Vitis vinifera]
Length=244

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 159/241 (66%), Gaps = 4/241 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGG---LNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS   C  NPP      GAG VQ++GG   L  YV+GPLDSKLAIL VSDVFGYEA NLR
Sbjct  1    MSISRCYENPPSFSPGSGAGTVQEVGGGGRLKAYVTGPLDSKLAILFVSDVFGYEAPNLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAG  412
            KLADK+  AGF VV PDFF+GDP  + N      VW+  H  D   +DAK VI  L++ G
Sbjct  61   KLADKVAAAGFLVVAPDFFYGDPVDLSNPNFDRQVWIAAHGTDKGCEDAKAVIAALRSKG  120

Query  413  ISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTP  592
            +S +G  G C GGK VV+LA    ++A V+LHP  +T D+I  VK PI +LGAE D+ +P
Sbjct  121  VSAIGAAGFCWGGKVVVNLASSDHIQAAVVLHPGRITDDEINEVKTPIAILGAEIDDASP  180

Query  593  PKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            P+ ++ F   L AK+ +D  VKIF GV HGWTVRY  +D+  VK AEEAH DML WF K+
Sbjct  181  PEQLEHFGEILSAKSGIDCFVKIFPGVAHGWTVRYSVEDEWGVKSAEEAHGDMLNWFSKY  240

Query  773  L  775
            +
Sbjct  241  M  241



>ref|XP_007150406.1| hypothetical protein PHAVU_005G150700g [Phaseolus vulgaris]
 gb|ESW22400.1| hypothetical protein PHAVU_005G150700g [Phaseolus vulgaris]
Length=240

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 162/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M    C+ANPP L  S G G +  + G+N YVSG   + L I+L+SD+FG+E   LRK+A
Sbjct  1    MVGSECLANPPILNASTGVGYLTNIAGVNSYVSGSPLAILTIVLISDIFGFEPPLLRKIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+   G++VVVPDFFHG+PY  EN ++P+  WLKDH      + AK +IE LK  G S 
Sbjct  61   DKVANHGYFVVVPDFFHGEPYNAENASRPLNSWLKDHNSTKGIETAKPIIEALKRKGASA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG+ G C G +T   L     VEA+V+LHP+ VT+D+I+GV+VPI +L AE D  +PPK+
Sbjct  121  VGVAGFCWGARTATKLGITKLVEASVILHPSSVTVDEIRGVEVPIAILAAEHDSFSPPKL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +K+F+  L AK E+DS VKIF  V+HGWTVRYD +D  AVK A +AH+ M+ WF +HL
Sbjct  181  IKKFKQVLDAKPEIDSYVKIFANVSHGWTVRYDPNDPKAVKDARKAHKIMINWFDRHL  238



>gb|KCW60872.1| hypothetical protein EUGRSUZ_H03606 [Eucalyptus grandis]
Length=245

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 165/244 (68%), Gaps = 7/244 (3%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS+  C  NPP L  + GAG +++L GL  YV+GP DSK A+LL++D FGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHIEELAGLKTYVTGPSDSKRAVLLIADAFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV--WLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DKI  AGF VVVPDFF+GDP ++  +    +  W K+H  D   +DAK VI  LK+ G+S
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNLEAWFKNHGTDKGYEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G  G C GG  +V LA    ++A V+LHP  +T D+I+ VK+P  +LGAE D ++PP+
Sbjct  121  AIGAAGFCWGGMVLVKLAGTEDIQAAVILHPGPMTEDEIKAVKIPTAILGAEIDHSSPPE  180

Query  599  VVKQFEIALQAKTEV-----DSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
             +K+F   + AKTE      +S VKIF GV+HGW+VRYD+D++  VK AEEA +D L WF
Sbjct  181  QLKKFGEIMSAKTETPVLQFESYVKIFPGVSHGWSVRYDDDNEFVVKSAEEAQEDTLNWF  240

Query  764  IKHL  775
            +KH+
Sbjct  241  LKHV  244



>ref|XP_010024433.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60877.1| hypothetical protein EUGRSUZ_H03609 [Eucalyptus grandis]
Length=240

 Score =   250 bits (638),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M +  C  NPP L  + GAG+V++L GL  YV+GP DSK A+L + D FGYEA  LRKLA
Sbjct  1    MLSSQCFENPPNLSSTCGAGRVEELAGLKTYVTGPSDSKRALLFIPDAFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+  AGF+VVVPDF++GDP ++  +    I VWLK+H+ D   +DAK VI  LK+ G+S
Sbjct  61   DKVASAGFFVVVPDFYYGDPVIDVNDPNFNIEVWLKNHSPDKGYEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G+ G C GG  +V LA    ++A V+LHP  +T D+I+ VK+P  +LGAE D   P  
Sbjct  121  AIGVAGFCWGGMVLVKLAGTEDIQAAVILHPGRITEDEIRAVKIPTAILGAENDHIFPAD  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +K+    + AKTE +S VKIF GV HGW+VRY++DD+ AVK A+EA +DML WF+KH+
Sbjct  181  ELKKLGEIMSAKTEFESYVKIFPGVRHGWSVRYNDDDESAVKSAKEAQEDMLNWFLKHV  239



>ref|XP_010551668.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=241

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = +2

Query  74   PHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKI  253
            P C  N P    + G+G V++LGGL+ YV+G  +SK AILL SD FG+EA NLRKLADK+
Sbjct  6    PQCCQNAPTRIPNAGSGHVEKLGGLDAYVTGSPESKFAILLASDAFGFEAPNLRKLADKV  65

Query  254  GGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGI  430
              +GFYVV+PDFF GD Y  EN  +P+ VW+KDH  +   + +K VIE LK+ GI  +G 
Sbjct  66   AASGFYVVIPDFFRGDSYSPENQDRPLPVWIKDHGPEKGFEYSKPVIEALKSRGIDAIGA  125

Query  431  GGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQ  610
             G+C G K VV+LAK   +++ VLLHP+ V+LDDI+ VK PI V GAE D TTPP++V+Q
Sbjct  126  TGICFGAKVVVELAKRELIQSAVLLHPSLVSLDDIKEVKAPIAVFGAEIDSTTPPELVQQ  185

Query  611  FEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            F  AL +K EV S VKI+  V HGW+VRY+ DD  AVK AEEAH+DML+W + H+
Sbjct  186  FAEALASKPEVKSYVKIYNNVEHGWSVRYNVDDAEAVKAAEEAHKDMLEWSLIHV  240



>ref|NP_001140497.1| hypothetical protein [Zea mays]
 gb|ACF83943.1| unknown [Zea mays]
 gb|AFW77922.1| hypothetical protein ZEAMMB73_089561 [Zea mays]
 gb|AFW77923.1| hypothetical protein ZEAMMB73_089561 [Zea mays]
Length=240

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++  C  NPP L  + G GKV    GGL  YV+GP DSK A++LV+DVFG+EA  +RK+
Sbjct  1    MASSQCCDNPPALNPACGEGKVVDSFGGLKAYVAGPEDSKAAVVLVADVFGFEAPIMRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADK+  +G++VVVPD FHGDPY  EN  KP  VW+K H  +   ++ K VI  LK  G+S
Sbjct  61   ADKVASSGYFVVVPDLFHGDPYAPENVEKPFPVWIKSHTPEKGFEETKQVIGALKEKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+LAK   ++A VLLHP+FVT+DDI+ VK  I +LGAE D+ +PP+
Sbjct  121  AVGAAGYCWGAKVVVELAKAHEIQAAVLLHPSFVTVDDIKEVKCAISILGAEIDKMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQFE  L   + V   VKIF GV HGW+VRY+ DD  AVK AEEA  DML WF K+L
Sbjct  181  LIKQFEQVLSLNSGVGHFVKIFPGVAHGWSVRYNHDDAAAVKSAEEAFADMLDWFNKNL  239



>ref|XP_008360320.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=240

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G+V++ GGL+ Y+ G  DSKLA+LL+SD+FGY+A NLRK+A
Sbjct  1    MSGPQCCSHPPTLNPSSGSGRVEKFGGLDTYLVGSPDSKLAVLLLSDIFGYDAPNLRKMA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+  AGF+VVVPDFF+GDP+   E G   +  W+K H  D   +D K ++E LK+ GIS
Sbjct  61   DKLAAAGFFVVVPDFFYGDPFELGEXGFAALPGWIKHHEPDKAFEDTKPLLEALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G C G K VV+L+K   ++A  + HPAFVTLDDI+ VKVP  +LGAE D  +PP+
Sbjct  121  AVGAVGFCYGAKVVVELSKHDLIQAAAMCHPAFVTLDDIKAVKVPTQILGAEIDHLSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE AL AK E+ S VKIF  V HGWT RY+++D+ A K AEEA+QD+L+W   H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAYQDLLEWLQNHV  239



>ref|XP_009352126.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
 ref|XP_009352127.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=237

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G+G V++LGG + YV+G  DS+L++LLV D FGYEA   RKLA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGYEAPKARKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF VV+PDF +GDP+  + +  I VW K HA +   +DAK+VIE L++ G+S +
Sbjct  61   DKIAAAGFIVVLPDFLNGDPFNWDRSS-IPVWKKAHAPEKTIEDAKLVIEALRSKGVSAI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VVDLAK   ++A VL HP+ VTLDDI+ VKVPI VLGAE DE  PP+V+
Sbjct  120  GAAGFCWGAKGVVDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDEMYPPEVI  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK E+ S VKIF  V HGWT+RYD++D+ AVK AEEAHQD+L WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKVAHGWTLRYDDEDEAAVKAAEEAHQDLLGWFLEHV  236



>gb|ACN40022.1| unknown [Picea sitchensis]
Length=242

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 168/242 (69%), Gaps = 4/242 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+ P C  + P+L    G G+V+    L+ YV+   D+K A++L+SD+FG+EA NLRKLA
Sbjct  1    MAGPQCCESAPQLHPGVGIGRVETFEHLSVYVTASPDAKAAVILISDIFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV----ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAG  412
            DK+  AG++VVVPDFF+GDP+V    EN       W+K H       D+  VIE LK+ G
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVPGSAENPLAGFQDWIKSHGPAKGFDDSTKVIEVLKSRG  120

Query  413  ISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTP  592
            IS +G  G C G K VV+L K   ++A VLLHP+FVT+DDI+ VK P+ +LGAE D+++P
Sbjct  121  ISAIGAAGFCWGAKVVVELTKGEVLKAGVLLHPSFVTVDDIKVVKAPLAILGAEIDKSSP  180

Query  593  PKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            P++V+QF   L AK EVDS VKI+ GV HGWTVRYDE+D++AVK AEEAH  ML+W  K+
Sbjct  181  PELVEQFGAILSAKPEVDSFVKIYPGVAHGWTVRYDENDEVAVKNAEEAHVKMLEWLNKY  240

Query  773  LH  778
            L+
Sbjct  241  LN  242



>gb|ABK24087.1| unknown [Picea sitchensis]
Length=242

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 165/242 (68%), Gaps = 4/242 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C  + P      G G+V+    L  YV+   D+K A++L+SDVFG+EA NLRKLA
Sbjct  1    MLGPQCCESAPHPHPGVGIGRVETFQHLPAYVTASPDAKAAVILISDVFGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV----ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAG  412
            DK+  AG++VVVPDFF+GDP+V    EN       WLK H  D   +D+  VIE LK+ G
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVLGSAENPFAGAQEWLKSHGTDKGFEDSTKVIEVLKSRG  120

Query  413  ISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTP  592
            IS +G  G C G K VV+L K   ++A VLLHP+ VTLDDI+ VK P+ +LGAE D+T+P
Sbjct  121  ISAIGAAGFCWGAKVVVELTKGEVLKAGVLLHPSRVTLDDIKAVKAPLAILGAEIDKTSP  180

Query  593  PKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            P++V+QF   L AK EVDS VKI+ GV HGWTVRY+E+D++AVK AEEAH  ML+W  K+
Sbjct  181  PELVQQFGAILSAKQEVDSFVKIYPGVAHGWTVRYNENDEVAVKNAEEAHVKMLEWLNKY  240

Query  773  LH  778
            L+
Sbjct  241  LN  242



>ref|XP_009365788.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
 ref|XP_009365789.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=237

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M++  C +NPP L  S G+G V++LGG + YV+G  DS+L++LLV D FGYEA   RKLA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGYEAPKARKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DKI  AGF VV+PDF +GDP+  + +  I VW K HA +   +DAK+VIE L++ G+S +
Sbjct  61   DKIAAAGFIVVLPDFLNGDPFNWDRSS-IPVWKKAHAPEKTIEDAKLVIEALRSKGVSAI  119

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C G K VVDLAK   ++A VL HP+ VTLDDI+ VKVPI VLGAE DE  PP+V+
Sbjct  120  GAAGFCWGAKGVVDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDEMYPPEVI  179

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQFE  L AK E+ S VKIF  V HGWT RYD++D+ AVK AEEAHQD+L WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKVAHGWTSRYDDEDEAAVKAAEEAHQDLLGWFLEHV  236



>ref|XP_010024428.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 ref|XP_010024429.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60871.1| hypothetical protein EUGRSUZ_H03605 [Eucalyptus grandis]
Length=240

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M +  C  NPP L  + GAG+V++L GL  YV+GP DSK A+L + D FGYEA  LRKLA
Sbjct  1    MLSSQCFENPPNLSSTCGAGRVEELAGLKTYVTGPSDSKRALLFIPDAFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+  A F+VVVPDF++GDP ++  +    I VWLK+H+ D   +DAK VI  LK+ G+S
Sbjct  61   DKVASAEFFVVVPDFYYGDPVIDVNDPNFNIEVWLKNHSPDKGYEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G+ G C GG  +V LA    ++A V+LHP  +T D+I+ VK+P  +LGAE D   P  
Sbjct  121  AIGVAGFCWGGMVLVKLAGTEDIQAAVILHPGHITEDEIRAVKIPTAILGAENDHIFPAD  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
             +K+    + AKTE++S VKIF GV HGW+VRY++DD+ AVK A+EA +DML WF+KH+
Sbjct  181  ELKKLGEIMSAKTEIESYVKIFPGVRHGWSVRYNDDDESAVKSAKEAQEDMLNWFLKHV  239



>ref|XP_007154161.1| hypothetical protein PHAVU_003G095400g [Phaseolus vulgaris]
 gb|ESW26155.1| hypothetical protein PHAVU_003G095400g [Phaseolus vulgaris]
Length=241

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 165/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M+     +N P L  S GAG V  +GGLN YV+    + LAILLVSDVFGY+A   RKLA
Sbjct  1    MAGNQGHSNSPVLNASSGAGHVTNIGGLNSYVTASPLAILAILLVSDVFGYKAPLFRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AGFYVVVPDFF+ DP+  +N  +P+ VWL+DH  +   + AK VIE LK+ G S 
Sbjct  61   DKVAAAGFYVVVPDFFYDDPFDPDNVNRPLPVWLQDHEPEEGFEAAKPVIEALKSKGFSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            VG+ G C GGKTV DL K   VEA VLLHPA+V ++DI+G+K PI +LG + D  TPP +
Sbjct  121  VGVAGFCWGGKTVTDLGKSKHVEAAVLLHPAYVEVNDIRGIKTPIAILGGQNDTITPPNL  180

Query  602  VKQFEIALQ-AKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            +KQF+  LQ AK +V S VKIF  V HGWTVRYD +D  AVK AE+AH+ M+ WF K+L
Sbjct  181  IKQFKQILQDAKPKVRSEVKIFPNVGHGWTVRYDPNDPKAVKAAEKAHRIMIDWFDKYL  239



>gb|EYU45608.1| hypothetical protein MIMGU_mgv1a012169mg [Erythranthe guttata]
Length=259

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = +2

Query  122  GKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGD  301
            GKV+Q GGL+CY+SGP  SK AI+L++DVFG+  ++ R++ADK+  AG+Y V+PDFF GD
Sbjct  43   GKVKQFGGLDCYISGPSYSKTAIILITDVFGFAPSHSREIADKVAAAGYYTVLPDFFRGD  102

Query  302  PYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIP  481
            PYV    KP   W+K HA +   KDA  +I+ LKA GI+K+G+ G C GGK   DL+K P
Sbjct  103  PYVR--GKPFAPWIKKHAPEKGIKDAIPIIKALKARGITKIGVAGFCWGGKVAADLSKHP  160

Query  482  CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKI  661
             VEATVLLHP   T +DI+G KVPI +LG E D+   P++VK+FE  L++K EVDS VKI
Sbjct  161  YVEATVLLHPTSTTTEDIRGDKVPISILGGELDDLCKPELVKEFENILKSKPEVDSFVKI  220

Query  662  FGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
            F GV HGWT+RY+ + + A+K AEE+H DML WF  HL 
Sbjct  221  FPGVAHGWTLRYN-NTEFAIKKAEESHSDMLHWFDMHLR  258



>ref|XP_011090811.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=236

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 157/237 (66%), Gaps = 2/237 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C  NPP L  + GAG VQQ+GG N YV+G  DSKLAI+ ++D FG+E   LRKLA
Sbjct  1    MSGPQCAHNPPTLDPASGAGHVQQIGGFNTYVTGDQDSKLAIIFLADAFGWEVPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKV  424
            DK+  +GF VVVPDF++GD +    A     W+  H  D    DA+ +I  LK+ G+SK+
Sbjct  61   DKVAESGFLVVVPDFYYGDKFTLEKAGQ--GWVDTHPPDRGCDDARTIIAALKSKGVSKI  118

Query  425  GIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVV  604
            G  G C GG   V LAK  C+EA V+LHP  +T+++I  VK PI +LGAE D   PP++V
Sbjct  119  GAAGFCWGGMVAVRLAKYDCIEAAVVLHPGPITVEEINEVKTPIAILGAEIDHIGPPEMV  178

Query  605  KQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            KQ E  L +K EVDS VKIF GV HGWTVRY++DD+  VK A E+H DML W  K++
Sbjct  179  KQLEDVLSSKPEVDSFVKIFPGVGHGWTVRYNDDDEFEVKSALESHSDMLNWLTKYV  235



>ref|XP_009417916.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 169/270 (63%), Gaps = 33/270 (12%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAG-KVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            M++P C ANPP L  + G G  V  LGG+  Y +G  +SK+A+LL+SDV+G+EA NLRK+
Sbjct  1    MASPQCCANPPTLSPACGDGIVVDDLGGVRAYTAGSPNSKIAVLLISDVYGFEAPNLRKI  60

Query  242  ADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            ADKI  +GF+VVVPD  + DPY  +N  +PI +W++ H+ D   +DAK +I  LK  GIS
Sbjct  61   ADKIATSGFFVVVPDLLYDDPYSADNPERPISIWIQSHSPDKGCQDAKPIIAALKNKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQG-------------------  541
             VG  G C GGK V +LAK   +EA VL HP+FV +DD++G                   
Sbjct  121  AVGAAGFCWGGKVVFELAKSSEIEAAVLCHPSFVNVDDVKGIPSFKNWSNSCFLNMFLLL  180

Query  542  ------------VKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGW  685
                        VK PI +LGAE D  +PP+++KQFE AL   +E   +VKIF GV HGW
Sbjct  181  RVETICFHHLPGVKCPISILGAENDHISPPELLKQFERALSLTSEERHIVKIFPGVAHGW  240

Query  686  TVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            TVR+  DD  AVK A+EAHQDML WFI+H+
Sbjct  241  TVRHKADDAAAVKRAQEAHQDMLNWFIQHV  270



>gb|KEH32213.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=250

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 163/249 (65%), Gaps = 12/249 (5%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVF-----------  211
            M  P C +NPP L    GAG V +LGG++ Y++G       ILLVSD+F           
Sbjct  1    MLGPACCSNPPILNSFSGAGHVAKLGGVDAYLTGSPLCTFVILLVSDIFVFVFTCLICFV  60

Query  212  GYEATNLRKLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVV  388
            GY+A  LR  ADK+   G+YVVVPDFF+GDPY   N  +PI VW+KDH  +   + ++ +
Sbjct  61   GYKAPILRMFADKVAATGYYVVVPDFFNGDPYDPRNVDRPIDVWVKDHLPETGFEVSQPI  120

Query  389  IEDLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLG  568
            IE LK+ GIS +G  G C G KTV +L K   ++A VL HP+++T+DDI GV +PI +LG
Sbjct  121  IEALKSKGISTIGAAGFCWGAKTVCELGKSKLIQAAVLAHPSYITVDDINGVNIPIAILG  180

Query  569  AETDETTPPKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQD  748
            AE D+ TPP+V+KQFE  L A +EVDS VKIF  V+HGWT+RYD  D  AVK +EEA Q 
Sbjct  181  AENDQVTPPEVIKQFEQVLAANSEVDSFVKIFPNVSHGWTIRYDTKDPEAVKASEEARQI  240

Query  749  MLKWFIKHL  775
            +L WF KHL
Sbjct  241  LLDWFDKHL  249



>emb|CBI26172.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 156/237 (66%), Gaps = 4/237 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGG---LNCYVSGPLDSKLAILLVSDVFGYEATNLR  235
            MS   C  NPP      GAG VQ++GG   L  YV+GPLDSKLAIL VSDVFGYEA NLR
Sbjct  1    MSISRCYENPPSFSPGSGAGTVQEVGGGGRLKAYVTGPLDSKLAILFVSDVFGYEAPNLR  60

Query  236  KLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAG  412
            KLADK+  AGF VV PDFF+GDP  + N      VW+  H  D   +DAK VI  L++ G
Sbjct  61   KLADKVAAAGFLVVAPDFFYGDPVDLSNPNFDRQVWIAAHGTDKGCEDAKAVIAALRSKG  120

Query  413  ISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTP  592
            +S +G  G C GGK VV+LA    ++A V+LHP  +T D+I  VK PI +LGAE D+ +P
Sbjct  121  VSAIGAAGFCWGGKVVVNLASSDHIQAAVVLHPGRITDDEINEVKTPIAILGAEIDDASP  180

Query  593  PKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
            P+ ++ F   L AK+ V+  VKIF GV HGWTVRY  +D+  VK AEEAH DML WF
Sbjct  181  PEQLEHFGEILSAKSGVNCFVKIFPGVAHGWTVRYSVEDEWGVKSAEEAHGDMLNWF  237



>ref|XP_006601393.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Glycine max]
Length=258

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 168/256 (66%), Gaps = 20/256 (8%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + G G V ++GG++ Y +G   SKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPTGGGGHVDKVGGIDSYFTGSPHSKLAVLMLSDVFGYEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAV---------DNVSKDAKVVIE  394
            DK+G AG+YVVVPD   G+P+  +N  +P   W+KD A          +  ++  K +IE
Sbjct  61   DKVGAAGYYVVVPDLLDGEPFNPQNSDRPFPAWIKDCATGLPHLLAVSEKGAEPTKPIIE  120

Query  395  DLKAAGISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAE  574
             LK+ G+S +   G C G K V++LAK   ++  VLLHP+F++LDDI+GV  PI +LGAE
Sbjct  121  ALKSKGVSAIAAVGFCWGAKVVIELAKSKLIQTAVLLHPSFISLDDIKGVDTPIAILGAE  180

Query  575  TDETTPPKVVKQFEIALQAKTEVD----------SLVKIFGGVTHGWTVRYDEDDKIAVK  724
             D+ +PP++VKQFE  L AK+ +           S VKIF  V+HGW VRY+ +D  AVK
Sbjct  181  IDQVSPPELVKQFEQVLAAKSGISFMSIFFVLVASFVKIFPKVSHGWAVRYNTEDAEAVK  240

Query  725  VAEEAHQDMLKWFIKH  772
            VAEEAHQD+L W  KH
Sbjct  241  VAEEAHQDLLDWLAKH  256



>gb|EYU45607.1| hypothetical protein MIMGU_mgv1a012169mg [Erythranthe guttata]
Length=259

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 155/219 (71%), Gaps = 3/219 (1%)
 Frame = +2

Query  122  GKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGD  301
            GKV+Q GGL+CY+SGP  SK AI+L++DVFG+  ++ R++ADK+  AG+Y V+PDFF GD
Sbjct  43   GKVKQFGGLDCYISGPSYSKTAIILITDVFGFAPSHSREIADKVAAAGYYTVLPDFFRGD  102

Query  302  PYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIP  481
            PYV    KP   W+K HA +   KDA  +I+ LKA GI+K+G+ G C GGK   DL+K P
Sbjct  103  PYVR--GKPFAPWIKKHAPEKGIKDAIPIIKALKARGITKIGVAGFCWGGKVAADLSKYP  160

Query  482  CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKI  661
             VEATVLLHP + T +DIQG KVPI +LG E D    P++VK+FE  L++K EVDS VKI
Sbjct  161  YVEATVLLHPTYTTTEDIQGDKVPISILGGEKDTYCKPELVKEFENILKSKPEVDSFVKI  220

Query  662  FGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
              GV HGWT+RY+  +  A+K A E+H DML WF  HL 
Sbjct  221  VPGVDHGWTLRYNSSE-FALKKAAESHNDMLDWFEMHLR  258



>ref|XP_009352130.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 168/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G V++ GGL+ Y+ G  DSKLA+LL+SD+FGY+A  LRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKFGGLDTYLVGSPDSKLAVLLLSDIFGYDAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK   AGF+VVVPDFF+GDP+   E G   +  WLK H  D   +D K ++E LK+ GIS
Sbjct  61   DKFADAGFFVVVPDFFYGDPFELGEEGFDALPGWLKHHEPDKAFEDTKPLLEALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G+C G K VV+L+K   ++A  + HPAFVT+DD + VKVP  +LGAE D  +PP+
Sbjct  121  AVGAVGLCFGAKVVVELSKHDLIQAAAMCHPAFVTVDDFKAVKVPTQILGAEIDHLSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            VVKQFE AL AK E+ S VKIF  V HGWT RY+++D+ A K AEEAHQD+L+W   H+
Sbjct  181  VVKQFEEALAAKPEIKSHVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWLQNHV  239



>ref|XP_010103444.1| hypothetical protein L484_010046 [Morus notabilis]
 gb|EXB95847.1| hypothetical protein L484_010046 [Morus notabilis]
Length=527

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 171/236 (72%), Gaps = 3/236 (1%)
 Frame = +2

Query  74   PHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKI  253
            PHC +NPP L  S GAG V++LGGL+ YV+G   SK A++LVSDV+GY+A NLRKLADKI
Sbjct  31   PHCGSNPPTLNASSGAGHVEKLGGLDSYVTGFPISKHAVILVSDVYGYQAPNLRKLADKI  90

Query  254  GGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGI  430
              AGF+V VPDFFHG+PY   N ++P   WL DH  +   ++AK +I+DLK+ G S +G+
Sbjct  91   AAAGFFVAVPDFFHGEPYDPNNTSRPKDAWLNDHRPEKGFEEAKPLIKDLKSKGFSAIGV  150

Query  431  GGVCSGGKTVVDLAKIP-CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVK  607
             G C G K  ++LAK+   V+AT +LHP+FVTLDDI+ VKVP+ V GAE D+  P ++V 
Sbjct  151  AGFCWGAKVAIELAKLKNFVQATAILHPSFVTLDDIKEVKVPLGVFGAELDKQYPRELVN  210

Query  608  QFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            QFE  L+A  ++D  VKI+ GV HG+T+RYD  D +A K A+EAH+D+L WF K++
Sbjct  211  QFEEVLRA-NKIDHFVKIYQGVKHGFTLRYDVQDDLARKRAKEAHKDLLNWFTKNV  265


 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 164/233 (70%), Gaps = 11/233 (5%)
 Frame = +2

Query  110  SYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDF  289
            S GAG V++LGGL+ YV+G  +SKLA+LL+SDV+GYEA NLRKLADKI  AGF+V V DF
Sbjct  294  SSGAGHVEKLGGLDSYVTGSPNSKLAVLLISDVYGYEAPNLRKLADKIAAAGFFVAVSDF  353

Query  290  FHGDPYVENGA-KPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVD  466
             HGDPYV N A + + VW+KDH  D   ++AK VIE LK+ G S +   G C G K V++
Sbjct  354  LHGDPYVPNDASRSVSVWIKDHGTDKGFEEAKPVIEGLKSKGFSAIVAAGFCWGAKVVIE  413

Query  467  LAKIP-CVEATVLLHPAFVTLDDIQG---------VKVPILVLGAETDETTPPKVVKQFE  616
            LAK    ++A  LLHP+FV +DDI+G         VKV   +LGAE D  +PP +VKQFE
Sbjct  414  LAKFTNFIQAAALLHPSFVIVDDIKGMLETLNSKEVKVSTAILGAEHDNLSPPPLVKQFE  473

Query  617  IALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
              L AK E+++ VKI+ GV HGWTVRYD  D+ A K AEEAH+D+L++F KH+
Sbjct  474  KVLSAKPEINTFVKIYPGVAHGWTVRYDVKDEAASKRAEEAHKDLLEFFTKHV  526



>gb|KCW60876.1| hypothetical protein EUGRSUZ_H03609 [Eucalyptus grandis]
Length=245

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 165/244 (68%), Gaps = 7/244 (3%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M +  C  NPP L  + GAG+V++L GL  YV+GP DSK A+L + D FGYEA  LRKLA
Sbjct  1    MLSSQCFENPPNLSSTCGAGRVEELAGLKTYVTGPSDSKRALLFIPDAFGYEAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK+  AGF+VVVPDF++GDP ++  +    I VWLK+H+ D   +DAK VI  LK+ G+S
Sbjct  61   DKVASAGFFVVVPDFYYGDPVIDVNDPNFNIEVWLKNHSPDKGYEDAKPVIAALKSKGVS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             +G+ G C GG  +V LA    ++A V+LHP  +T D+I+ VK+P  +LGAE D   P  
Sbjct  121  AIGVAGFCWGGMVLVKLAGTEDIQAAVILHPGRITEDEIRAVKIPTAILGAENDHIFPAD  180

Query  599  VVKQFEIALQAKTEV-----DSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
             +K+    + AKTE+     +S VKIF GV HGW+VRY++DD+ AVK A+EA +DML WF
Sbjct  181  ELKKLGEIMSAKTEIPVLQFESYVKIFPGVRHGWSVRYNDDDESAVKSAKEAQEDMLNWF  240

Query  764  IKHL  775
            +KH+
Sbjct  241  LKHV  244



>ref|XP_003542895.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Glycine max]
Length=241

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 158/240 (66%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYS-YGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            MS+P C  NPP L    +GAG VQ+LGGLN YV+G  DSKLA++LVSDVFGYEA  LRKL
Sbjct  1    MSSPQCFENPPNLNSDIHGAGTVQELGGLNSYVTGSSDSKLALILVSDVFGYEAPKLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            ADK+  AGF VVVPD  +GD  V+  N       W K H  D   +D K +I  LK+ G+
Sbjct  61   ADKVAAAGFLVVVPDLLYGDYIVDLNNPQFDRESWRKAHGKDKACEDTKPLISALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
              VG  G C GG  VV LA    ++A V+LHP  +  ++   V++PI +LGAE D   PP
Sbjct  121  KSVGAAGFCWGGVVVVKLAISTDIQAAVILHPGLIADNEFNEVRIPIAILGAEIDHLFPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            + +KQ E  L  K E +S VK++ GV+HGWT+RY++DD+  VK A+EAHQDML WFIKH+
Sbjct  181  ERLKQIEEMLSVKAEFESFVKLYPGVSHGWTLRYNDDDEATVKSAKEAHQDMLNWFIKHV  240



>ref|XP_002439763.1| hypothetical protein SORBIDRAFT_09g019650 [Sorghum bicolor]
 gb|EES18193.1| hypothetical protein SORBIDRAFT_09g019650 [Sorghum bicolor]
Length=239

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   IMSAPHCIANPPKLCYSYGAGKV-QQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRK  238
            + ++ HC  NPP L  + G G+V    GG   Y++G   SK A++L+SD FG+EA NLRK
Sbjct  1    MATSSHCFENPPALEPASGGGEVVDDFGGQKAYITGSAGSKAAVVLISDAFGFEAPNLRK  60

Query  239  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            +AD++  +G++VVVPDF HGDPY  + + P G+W++ H   N  K+AK VI  +K  G+S
Sbjct  61   IADQVASSGYFVVVPDFLHGDPYDLSSSNP-GMWIQAHNPQNAFKEAKPVIAAIKEKGVS  119

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
            ++G  G C G K VV+LAK+  ++A VLLHP+ +T DDI+ VK PI +LGAE D ++PP+
Sbjct  120  RIGAAGYCWGAKVVVELAKVHEIQAAVLLHPSLLTDDDIKEVKCPISILGAEIDRSSPPE  179

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            ++KQF   L A +E+D  VKIF GV HGW VRY +DD  AV  A+EA QDM  WF K+L
Sbjct  180  LLKQFGQILSANSEIDHFVKIFPGVAHGWAVRYSDDDASAVASAKEALQDMSHWFNKYL  238



>gb|AGV54685.1| endo-13;14-beta-D-glucanase-like protein [Phaseolus vulgaris]
Length=255

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 163/236 (69%), Gaps = 1/236 (0%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C +NPP L  + GAG V++L GL+ Y++G  +S LA+LL+SDVFGYEA NLR +A
Sbjct  1    MSGPECCSNPPLLNPNAGAGHVEKLAGLDSYIAGSPNSNLAVLLISDVFGYEAPNLRNIA  60

Query  245  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISK  421
            DK+  AG+YVVVPDFF GDPY  EN  + I VWLKDH  D  S+ AK ++E LK+ G+S 
Sbjct  61   DKVAAAGYYVVVPDFFFGDPYNPENADRAIHVWLKDHGTDKGSEAAKSIVEALKSKGVSA  120

Query  422  VGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKV  601
            +G  G C G K VV+L+K   ++A VLLHP+FV++DDI+GV +P  VLGAE D+ +PP++
Sbjct  121  IGAVGFCWGAKVVVELSKSRLIQAAVLLHPSFVSVDDIKGVDIPTAVLGAEIDKMSPPEL  180

Query  602  VKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIK  769
            VKQFE  L AK  VD  VKIF  V  GW V   + D  AVK A  A   ++KWF +
Sbjct  181  VKQFEQVLNAKPGVDFFVKIFSPVFPGWGVGDRKGDAKAVKGAGGAPPGLVKWFSR  236



>gb|ABK22216.1| unknown [Picea sitchensis]
 gb|ABK26648.1| unknown [Picea sitchensis]
Length=242

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 163/242 (67%), Gaps = 4/242 (2%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            M  P C  + P      G G+V+    L  YV+   D+K A++L+SD++G+EA NLRKLA
Sbjct  1    MLGPQCCESAPHPHPGVGIGRVETFQHLPAYVTASPDAKAAVILISDIYGFEAPNLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV----ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAG  412
            DK+  AG++VVVPDFF+GDP+V    EN    +  W+K H  D   +D+  VIE LK+ G
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVRGSVENPLAGVQDWIKSHGTDKGFEDSTKVIEVLKSRG  120

Query  413  ISKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTP  592
            IS +G  G C G K VV+L K   ++A VLLHPA VTLDDI  VK P+ +LGAE D+ +P
Sbjct  121  ISAIGAAGFCWGAKVVVELTKGEVLKAGVLLHPAIVTLDDINAVKAPLAILGAEIDKISP  180

Query  593  PKVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKH  772
            P++V+QF   L AK EVDS VKI+ GV HGWT RY+E+D++AVK AEEAH  ML+W  K+
Sbjct  181  PELVQQFGAILSAKPEVDSFVKIYPGVAHGWTTRYNENDEVAVKNAEEAHVKMLEWLNKY  240

Query  773  LH  778
            L+
Sbjct  241  LN  242



>gb|KHN37559.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=241

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 158/240 (66%), Gaps = 3/240 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYS-YGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKL  241
            MS+P C  NPP L    +GAG VQ+LGGLN YV+G  DSKLA++LVSDVFGYEA  LRKL
Sbjct  1    MSSPQCFENPPNLNSDIHGAGTVQELGGLNSYVTGSSDSKLALILVSDVFGYEAPKLRKL  60

Query  242  ADKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGI  415
            ADK+  AGF VVVPD  +GD  V+  N       W K H  D   +D K +I  LK+ G+
Sbjct  61   ADKVAAAGFLVVVPDLLYGDYIVDLNNPQFDRESWRKAHGKDKACEDTKPLISALKSKGV  120

Query  416  SKVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPP  595
              +G  G C GG  VV LA    ++A V+LHP  +  ++   V++PI +LGAE D   PP
Sbjct  121  KSIGAAGFCWGGVVVVKLAISTDIQAAVILHPGLIADNEFNEVRIPIAILGAEIDHLFPP  180

Query  596  KVVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHL  775
            + +KQ E  L  K E +S VK++ GV+HGWT+RY++DD+  VK A+EAHQDML WFIKH+
Sbjct  181  ERLKQIEEMLSVKAEFESFVKLYPGVSHGWTLRYNDDDEATVKSAKEAHQDMLNWFIKHV  240



>ref|XP_009365791.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 166/235 (71%), Gaps = 2/235 (1%)
 Frame = +2

Query  65   MSAPHCIANPPKLCYSYGAGKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLA  244
            MS P C ++PP L  S G+G V++ GGL+ Y+ G  DSKLA+LL+SD+FGY+A  LRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKFGGLDTYLVGSPDSKLAVLLLSDIFGYDAPKLRKLA  60

Query  245  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGIS  418
            DK   AGF+VVVPDFF+GDP+   E G   +  WLK H  D   +D K ++E LK+ GIS
Sbjct  61   DKFADAGFFVVVPDFFYGDPFELGEEGFDALPGWLKHHEPDKAFEDTKPLLEALKSKGIS  120

Query  419  KVGIGGVCSGGKTVVDLAKIPCVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPK  598
             VG  G+C G K VV+L+K   ++A  + HPAFVT+DD + VKVP  +LGAE D  +PP+
Sbjct  121  AVGAVGLCFGAKVVVELSKHDLIQAAAMCHPAFVTVDDFKAVKVPTQILGAEIDHMSPPE  180

Query  599  VVKQFEIALQAKTEVDSLVKIFGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWF  763
            VVKQFE AL AK E+ S VKIF  V HGWT RY+++D+ A K AEEAHQD+L+W 
Sbjct  181  VVKQFEEALAAKPEIKSHVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWL  235



>gb|EYU45606.1| hypothetical protein MIMGU_mgv1a012169mg [Erythranthe guttata]
Length=259

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 157/219 (72%), Gaps = 3/219 (1%)
 Frame = +2

Query  122  GKVQQLGGLNCYVSGPLDSKLAILLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGD  301
            GKV+Q GGL+CY+SGP  S+ AI+L++DVFG+  ++ R++ADK+  AG+Y V+PDFF GD
Sbjct  43   GKVKQFGGLDCYISGPSHSETAIILITDVFGFAPSHSREIADKVAAAGYYTVLPDFFRGD  102

Query  302  PYVENGAKPIGVWLKDHAVDNVSKDAKVVIEDLKAAGISKVGIGGVCSGGKTVVDLAKIP  481
            PY ++GA P+  WLK HA +   KDA  +IE LK  GI+K+G+ G C GGK   DL+K P
Sbjct  103  PY-QHGA-PLTPWLKKHAPEEGIKDAIPIIEALKGRGITKIGVAGFCWGGKVAADLSKYP  160

Query  482  CVEATVLLHPAFVTLDDIQGVKVPILVLGAETDETTPPKVVKQFEIALQAKTEVDSLVKI  661
             VEATVLLHP + T +DIQG KVPI +LG E D    P++VK+FE  L++K EVDS VKI
Sbjct  161  YVEATVLLHPTYTTTEDIQGDKVPISILGGEKDTYCKPELVKEFENILKSKPEVDSFVKI  220

Query  662  FGGVTHGWTVRYDEDDKIAVKVAEEAHQDMLKWFIKHLH  778
              GV HGWT+RY+  +  A+K A E+H DML WF  HL 
Sbjct  221  VPGVDHGWTLRYNSSE-FALKKAAESHNDMLDWFEMHLR  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2376282946848