BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24450_g1_i1 len=1005 path=[1387:0-67 1168:68-103 785:104-192
874:193-364 1351:365-369 1356:370-395 1265:396-413 1283:414-440
1819:441-477 1856:478-518 1896:519-592 1096:593-630 2007:631-666
2043:667-708 322:709-1004]

Length=1005
                                                                      Score     E

ref|XP_009621644.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    285   1e-91   
ref|XP_009784375.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    284   3e-91   
ref|XP_006489249.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      276   3e-88   
ref|XP_010103447.1|  hypothetical protein L484_010049                   276   5e-88   
ref|XP_006489248.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    276   5e-88   
gb|ABR92334.1|  putative dienelactone hydrolase family protein          276   5e-88   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010035817.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      275   2e-87   
ref|XP_006339416.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      275   2e-87   
gb|KDO74854.1|  hypothetical protein CISIN_1g026476mg                   274   2e-87   
ref|XP_010103445.1|  hypothetical protein L484_010047                   274   3e-87   
ref|XP_006419784.1|  hypothetical protein CICLE_v10005759mg             273   7e-87   
ref|XP_006489247.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    271   5e-86   
gb|KDP40089.1|  hypothetical protein JCGZ_02087                         270   9e-86   
ref|XP_004165841.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      270   9e-86   
ref|XP_008340903.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    270   2e-85   
gb|KCW84305.1|  hypothetical protein EUGRSUZ_B01156                     269   2e-85   
ref|XP_006489278.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      269   3e-85   
ref|XP_004134157.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      269   3e-85   
ref|XP_010035827.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      268   4e-85   
ref|XP_004247494.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    268   4e-85   
gb|KCW84306.1|  hypothetical protein EUGRSUZ_B01156                     270   4e-85   
ref|XP_010262559.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      268   5e-85   
ref|XP_004229456.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      268   6e-85   
ref|XP_006358424.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      268   7e-85   
emb|CDP20217.1|  unnamed protein product                                268   7e-85   
ref|XP_002516793.1|  endo-1,3-1,4-beta-d-glucanase, putative            268   1e-84   Ricinus communis
ref|XP_010041171.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      267   1e-84   
ref|XP_010103443.1|  hypothetical protein L484_010045                   267   1e-84   
ref|XP_006406017.1|  hypothetical protein EUTSA_v10021426mg             266   4e-84   
ref|XP_006419786.1|  hypothetical protein CICLE_v10005765mg             266   5e-84   
ref|XP_007034580.1|  Alpha/beta-Hydrolases superfamily protein is...    265   6e-84   
ref|XP_009365790.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      265   1e-83   
ref|XP_010649854.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      265   1e-83   
ref|XP_008368364.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      265   1e-83   
ref|XP_010326630.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    264   2e-83   
ref|XP_008438729.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    264   2e-83   
ref|XP_007034579.1|  Alpha/beta-Hydrolases superfamily protein is...    264   2e-83   
ref|XP_006419793.1|  hypothetical protein CICLE_v10005752mg             264   2e-83   
ref|XP_006419787.1|  hypothetical protein CICLE_v10005761mg             263   3e-83   
ref|XP_008353246.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   3e-83   
ref|XP_008368374.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   4e-83   
ref|XP_009621645.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    263   5e-83   
ref|XP_003529605.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   6e-83   
emb|CBI32343.3|  unnamed protein product                                262   1e-82   
ref|XP_008234913.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      262   1e-82   
gb|KCW84309.1|  hypothetical protein EUGRSUZ_B01156                     262   1e-82   
ref|XP_009784376.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    261   2e-82   
ref|XP_008340902.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    262   2e-82   
ref|XP_002275697.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      263   2e-82   Vitis vinifera
ref|XP_010695307.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           261   2e-82   
ref|XP_009352129.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      261   3e-82   
ref|XP_011071518.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      262   3e-82   
ref|XP_009339925.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    261   4e-82   
ref|XP_010103440.1|  hypothetical protein L484_010042                   261   4e-82   
emb|CDX85111.1|  BnaC07g07950D                                          261   4e-82   
ref|XP_010466703.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    261   5e-82   
ref|XP_010532701.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      261   5e-82   
ref|XP_007200368.1|  hypothetical protein PRUPE_ppa010677mg             260   5e-82   
gb|AFK34617.1|  unknown                                                 260   5e-82   
ref|XP_009102607.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           260   6e-82   
gb|EYU38138.1|  hypothetical protein MIMGU_mgv1a012798mg                259   1e-81   
emb|CDX77499.1|  BnaA07g06370D                                          259   1e-81   
ref|XP_004247139.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      259   1e-81   
gb|AFJ92670.1|  GLU protein                                             260   2e-81   
ref|XP_002885571.1|  dienelactone hydrolase family protein              259   2e-81   
ref|XP_010035807.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    259   2e-81   
ref|XP_008390813.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      259   2e-81   
ref|XP_010035799.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    259   3e-81   
gb|KDP40090.1|  hypothetical protein JCGZ_02088                         259   3e-81   
emb|CAN78076.1|  hypothetical protein VITISV_041962                     258   3e-81   Vitis vinifera
ref|XP_002275763.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           258   4e-81   Vitis vinifera
ref|XP_008368976.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      258   4e-81   
ref|XP_010488428.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    258   5e-81   
gb|KCW84310.1|  hypothetical protein EUGRSUZ_B01156                     257   6e-81   
ref|XP_010527412.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           258   6e-81   
ref|XP_004290676.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      258   6e-81   
gb|KCW84301.1|  hypothetical protein EUGRSUZ_B01152                     259   8e-81   
ref|XP_007223756.1|  hypothetical protein PRUPE_ppa010552mg             258   8e-81   
ref|XP_007154155.1|  hypothetical protein PHAVU_003G095100g             257   1e-80   
ref|XP_010035787.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      257   1e-80   
gb|KHG15388.1|  Endo-1,3(4)-beta-D-glucanase                            257   1e-80   
ref|XP_010512613.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      257   1e-80   
gb|KFK39652.1|  hypothetical protein AALP_AA3G271900                    256   2e-80   
gb|KEH32209.1|  endo-1,3-1,4-beta-D-glucanase-like protein              256   2e-80   
ref|XP_010527418.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   3e-80   
ref|NP_566731.1|  alpha/beta-Hydrolases superfamily protein             256   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353277.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   3e-80   
ref|XP_004296954.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      256   3e-80   
gb|AAN65058.1|  Unknown protein                                         256   4e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524812.1|  endo-1,3-1,4-beta-d-glucanase, putative            256   4e-80   Ricinus communis
ref|XP_009102600.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           255   5e-80   
gb|AFK33996.1|  unknown                                                 255   5e-80   
ref|XP_004508363.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      255   6e-80   
ref|XP_002312740.1|  dienelactone hydrolase family protein              255   8e-80   Populus trichocarpa [western balsam poplar]
ref|XP_007223790.1|  hypothetical protein PRUPE_ppa010646mg             255   9e-80   
ref|XP_003550071.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           254   1e-79   
emb|CDX85115.1|  BnaC07g07910D                                          254   1e-79   
ref|XP_008438728.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      254   1e-79   
ref|XP_008802649.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    254   2e-79   
ref|XP_008352794.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    254   2e-79   
ref|XP_009362383.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    254   2e-79   
gb|KCW60882.1|  hypothetical protein EUGRSUZ_H03614                     254   2e-79   
ref|XP_002275597.2|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           254   2e-79   Vitis vinifera
ref|XP_010527420.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      254   3e-79   
ref|XP_010512630.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    253   3e-79   
emb|CBI32342.3|  unnamed protein product                                253   3e-79   
gb|ACJ85031.1|  unknown                                                 253   3e-79   Medicago truncatula
emb|CDX77495.1|  BnaA07g06330D                                          253   5e-79   
ref|XP_010466702.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    253   5e-79   
ref|XP_010035774.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      253   5e-79   
ref|XP_008223023.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      253   6e-79   
ref|XP_010466706.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      253   6e-79   
gb|EPS69745.1|  hypothetical protein M569_05020                         253   7e-79   
ref|XP_011010276.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      252   1e-78   
ref|XP_008223022.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    252   1e-78   
ref|XP_010527419.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      252   1e-78   
ref|XP_010488433.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      252   1e-78   
gb|KFK39658.1|  hypothetical protein AALP_AA3G272500                    251   3e-78   
emb|CAN80740.1|  hypothetical protein VITISV_016685                     251   3e-78   Vitis vinifera
ref|XP_010909270.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      251   3e-78   
gb|KCW84308.1|  hypothetical protein EUGRSUZ_B01156                     250   3e-78   
ref|XP_006361507.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    251   4e-78   
ref|XP_006361509.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    250   4e-78   
ref|XP_006361508.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    251   4e-78   
ref|XP_002275501.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           250   6e-78   Vitis vinifera
ref|XP_008367180.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      250   6e-78   
ref|XP_010532702.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      250   6e-78   
gb|KHN03434.1|  Endo-1,3(4)-beta-D-glucanase                            250   8e-78   
gb|AFK41285.1|  unknown                                                 250   8e-78   
ref|XP_008340899.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   9e-78   
ref|XP_010938744.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   1e-77   
ref|XP_011071533.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   1e-77   
ref|XP_006361504.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    251   1e-77   
ref|XP_006361506.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    251   1e-77   
emb|CBI32341.3|  unnamed protein product                                249   2e-77   
ref|XP_008219062.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   2e-77   
ref|XP_009365787.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      249   2e-77   
gb|EYU38136.1|  hypothetical protein MIMGU_mgv1a012773mg                248   3e-77   
ref|XP_009339923.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      248   3e-77   
ref|XP_009352128.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      248   4e-77   
ref|XP_008223021.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    248   6e-77   
gb|KFK39657.1|  hypothetical protein AALP_AA3G272500                    248   6e-77   
ref|XP_008802648.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      247   8e-77   
ref|XP_010038123.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      247   1e-76   
gb|AFK40311.1|  unknown                                                 247   1e-76   
ref|XP_008390811.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      246   2e-76   
ref|XP_010905246.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      246   2e-76   
ref|XP_006361505.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    248   3e-76   
ref|NP_566732.1|  alpha/beta-Hydrolases superfamily protein             246   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290675.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      246   5e-76   
ref|XP_010695954.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    246   7e-76   
emb|CDY09037.1|  BnaC01g30540D                                          244   8e-76   
ref|XP_011071517.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      245   1e-75   
ref|XP_010532693.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      245   1e-75   
gb|ACU19417.1|  unknown                                                 244   2e-75   Glycine max [soybeans]
emb|CDO98981.1|  unnamed protein product                                243   2e-75   
ref|XP_002309880.2|  dienelactone hydrolase family protein              243   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_009417917.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    244   2e-75   
ref|XP_010532707.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      243   3e-75   
ref|XP_010038125.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      243   3e-75   
ref|XP_009352126.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      243   3e-75   
ref|XP_008223025.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      243   3e-75   
ref|XP_009106630.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      243   3e-75   
ref|XP_011023033.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      243   4e-75   
gb|KHN03435.1|  Endo-1,3(4)-beta-D-glucanase                            243   4e-75   
ref|XP_008352792.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    243   4e-75   
ref|XP_009362382.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    243   5e-75   
ref|XP_009365788.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      242   6e-75   
ref|XP_006406009.1|  hypothetical protein EUTSA_v10021427mg             242   8e-75   
ref|XP_009599203.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    242   9e-75   
ref|XP_009339924.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    243   1e-74   
ref|XP_006419788.1|  hypothetical protein CICLE_v10006994mg             242   1e-74   
ref|XP_007224824.1|  hypothetical protein PRUPE_ppa023469mg             242   1e-74   
ref|XP_009599202.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    242   1e-74   
gb|EEC79184.1|  hypothetical protein OsI_19879                          241   2e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_008360320.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      241   2e-74   
ref|XP_010322752.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      240   4e-74   
ref|NP_001242164.1|  uncharacterized protein LOC100801095               240   5e-74   
ref|XP_009417919.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      240   5e-74   
ref|XP_006339415.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      240   6e-74   
ref|XP_007034581.1|  Alpha/beta-Hydrolases superfamily protein is...    239   8e-74   
ref|XP_010327302.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    239   1e-73   
ref|XP_010551668.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      239   1e-73   
ref|XP_008808248.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    239   1e-73   
ref|NP_001030749.1|  alpha/beta-Hydrolases superfamily protein          239   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883437.1|  hydrolase                                          239   2e-73   
emb|CDY09036.1|  BnaC01g30550D                                          238   2e-73   
ref|XP_003529606.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    238   2e-73   
ref|XP_010327300.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    239   3e-73   
ref|XP_009352130.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      238   3e-73   
ref|XP_003568483.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      238   4e-73   
ref|XP_007224354.1|  hypothetical protein PRUPE_ppa020844mg             238   5e-73   
ref|XP_002516792.1|  endo-1,3-1,4-beta-d-glucanase, putative            237   5e-73   Ricinus communis
ref|XP_009788741.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      237   6e-73   
ref|XP_006654368.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      237   6e-73   
ref|XP_010488431.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    237   6e-73   
gb|ACU23923.1|  unknown                                                 237   8e-73   Glycine max [soybeans]
gb|EYU45607.1|  hypothetical protein MIMGU_mgv1a012169mg                238   9e-73   
ref|XP_009588353.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      236   1e-72   
ref|XP_009365791.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      236   2e-72   
ref|XP_002439762.1|  hypothetical protein SORBIDRAFT_09g019630          236   3e-72   Sorghum bicolor [broomcorn]
gb|KDP40091.1|  hypothetical protein JCGZ_02089                         235   3e-72   
ref|XP_011090811.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      235   4e-72   
gb|EYU45606.1|  hypothetical protein MIMGU_mgv1a012169mg                236   4e-72   
ref|XP_010103444.1|  hypothetical protein L484_010046                   244   5e-72   
ref|XP_006850805.1|  hypothetical protein AMTR_s00025p00112220          235   6e-72   
gb|EYU45608.1|  hypothetical protein MIMGU_mgv1a012169mg                234   1e-71   
ref|XP_004962159.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      233   2e-71   
ref|XP_004296955.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      233   5e-71   
gb|KEH32215.1|  endo-1,3-1,4-beta-D-glucanase-like protein              231   9e-71   
gb|AAU10802.1|  putative endo-1,3;1,4-beta-D-glucanase                  231   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008367178.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      231   2e-70   
ref|XP_010101277.1|  hypothetical protein L484_011641                   232   2e-70   
ref|NP_001055474.1|  Os05g0399100                                       232   2e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010024433.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      230   3e-70   
gb|KEH32211.1|  endo-1,3-1,4-beta-D-glucanase-like protein              232   4e-70   
ref|XP_010024431.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      230   5e-70   
ref|XP_008340900.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      230   5e-70   
ref|XP_010024432.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      229   7e-70   
ref|XP_007150409.1|  hypothetical protein PHAVU_005G151000g             229   8e-70   
gb|EAY97963.1|  hypothetical protein OsI_19880                          229   8e-70   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98176.1|  predicted protein                                      229   9e-70   
ref|XP_006654369.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      229   1e-69   
ref|XP_010024428.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      229   1e-69   
gb|AFK37956.1|  unknown                                                 229   1e-69   
ref|XP_007226805.1|  hypothetical protein PRUPE_ppa024774mg             232   1e-69   
ref|XP_010024435.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      228   2e-69   
ref|XP_002516791.1|  endo-1,3-1,4-beta-d-glucanase, putative            228   2e-69   Ricinus communis
ref|XP_007150406.1|  hypothetical protein PHAVU_005G150700g             228   3e-69   
gb|AGV54685.1|  endo-13;14-beta-D-glucanase-like protein                228   3e-69   
ref|XP_008223020.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      228   4e-69   
ref|XP_010024430.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      227   6e-69   
ref|XP_010024439.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      226   1e-68   
ref|XP_003542895.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      226   1e-68   
ref|XP_010024440.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      226   1e-68   
ref|XP_009417916.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    227   1e-68   
gb|KHN37559.1|  Endo-1,3(4)-beta-D-glucanase                            226   1e-68   
gb|KCW60876.1|  hypothetical protein EUGRSUZ_H03609                     225   3e-68   
ref|XP_010650032.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      225   3e-68   
ref|NP_001148765.1|  endo-1,3;1,4-beta-D-glucanase                      225   3e-68   Zea mays [maize]
gb|KCW60874.1|  hypothetical protein EUGRSUZ_H03607                     227   4e-68   
ref|XP_002439763.1|  hypothetical protein SORBIDRAFT_09g019650          224   5e-68   Sorghum bicolor [broomcorn]
ref|XP_007147786.1|  hypothetical protein PHAVU_006G155000g             224   8e-68   
gb|KCW60872.1|  hypothetical protein EUGRSUZ_H03606                     224   8e-68   
ref|XP_006601393.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      224   2e-67   
ref|XP_007154161.1|  hypothetical protein PHAVU_003G095400g             223   2e-67   
ref|NP_001148665.1|  LOC100282281                                       223   2e-67   Zea mays [maize]
gb|KCW60880.1|  hypothetical protein EUGRSUZ_H03611                     226   2e-67   
gb|KEH32213.1|  endo-1,3-1,4-beta-D-glucanase-like protein              223   3e-67   
ref|NP_001140497.1|  hypothetical protein                               223   3e-67   Zea mays [maize]
gb|ACN40022.1|  unknown                                                 222   6e-67   Picea sitchensis
ref|XP_010488429.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    220   7e-67   
ref|XP_006419795.1|  hypothetical protein CICLE_v10005738mg             221   8e-67   
gb|EAY97964.1|  hypothetical protein OsI_19881                          221   1e-66   Oryza sativa Indica Group [Indian rice]
gb|KDO74852.1|  hypothetical protein CISIN_1g0265102mg                  219   2e-66   
ref|XP_007150410.1|  hypothetical protein PHAVU_005G151100g             221   2e-66   
emb|CBI26172.3|  unnamed protein product                                221   2e-66   
gb|KDO38826.1|  hypothetical protein CISIN_1g025027mg                   221   3e-66   
ref|XP_009352125.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      220   3e-66   
ref|XP_006489279.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      221   3e-66   
ref|XP_003529603.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase           220   3e-66   
ref|XP_009365792.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      219   5e-66   
ref|XP_008351228.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      219   6e-66   
ref|XP_006419796.1|  hypothetical protein CICLE_v10005724mg             218   2e-65   
gb|ABK24087.1|  unknown                                                 218   2e-65   Picea sitchensis
emb|CDY18109.1|  BnaA01g23700D                                          217   2e-65   
ref|NP_001055475.1|  Os05g0399200                                       218   3e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010103439.1|  hypothetical protein L484_010041                   218   3e-65   
gb|KDO74846.1|  hypothetical protein CISIN_1g024721mg                   218   3e-65   
gb|ABK22216.1|  unknown                                                 217   4e-65   Picea sitchensis
emb|CDP16397.1|  unnamed protein product                                216   7e-65   
ref|XP_010512634.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    215   8e-65   
gb|ABR16847.1|  unknown                                                 216   8e-65   Picea sitchensis
ref|XP_003568487.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      216   1e-64   
ref|XP_004962158.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      216   1e-64   
ref|XP_003529604.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      215   3e-64   
gb|EMS62534.1|  Endo-1,3;1,4-beta-D-glucanase                           214   4e-64   
ref|XP_007154163.1|  hypothetical protein PHAVU_003G095600g             214   6e-64   
ref|XP_007154156.1|  hypothetical protein PHAVU_003G095100g             211   2e-63   
gb|AES64349.2|  endo-1,3-1,4-beta-D-glucanase-like protein              213   2e-63   
ref|XP_003594098.1|  Carboxymethylenebutenolidase-like protein          213   5e-63   
ref|XP_007150408.1|  hypothetical protein PHAVU_005G150900g             211   7e-63   
ref|XP_010103442.1|  hypothetical protein L484_010044                   211   1e-62   
gb|ACU23709.1|  unknown                                                 209   3e-62   
ref|XP_008802650.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    207   9e-62   
ref|XP_010041172.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      207   1e-61   
dbj|BAD05237.1|  putative Endo-1,3;1,4-beta-D-glucanase precursor       207   4e-61   
ref|NP_001061323.1|  Os08g0238200                                       208   4e-61   
ref|XP_002441061.1|  hypothetical protein SORBIDRAFT_09g019640          205   2e-60   
ref|XP_006406008.1|  hypothetical protein EUTSA_v10021427mg             204   2e-60   
ref|XP_010938801.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      205   2e-60   
ref|XP_003568485.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    204   3e-60   
gb|KEH32210.1|  endo-1,3-1,4-beta-D-glucanase-like protein              204   4e-60   
ref|XP_008370576.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      205   2e-59   
ref|XP_010695962.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    201   5e-59   
emb|CDO98982.1|  unnamed protein product                                201   5e-59   
ref|NP_001132740.1|  uncharacterized protein LOC100194227               199   3e-58   
ref|XP_003566261.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      201   4e-58   
gb|ABK24067.1|  unknown                                                 199   5e-58   
ref|XP_006584060.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    197   6e-58   
dbj|BAB02775.1|  unnamed protein product                                197   1e-57   
ref|NP_001067684.1|  Os11g0275500                                       199   1e-57   
gb|ABA92618.2|  Endo-1,3;1,4-beta-D-glucanase precursor, putative...    199   1e-57   
gb|EAZ25219.1|  hypothetical protein OsJ_09019                          199   1e-57   
ref|XP_008808249.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    196   2e-57   
ref|XP_009599216.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      193   1e-56   
gb|KEH36746.1|  endo-1,3-1,4-beta-D-glucanase-like protein              195   2e-56   
gb|ADE76752.1|  unknown                                                 194   3e-56   
dbj|BAK05899.1|  predicted protein                                      195   5e-56   
ref|XP_004972493.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      194   7e-56   
gb|EAY97970.1|  hypothetical protein OsI_19888                          194   1e-55   
ref|XP_010488432.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    192   1e-55   
ref|XP_006850804.1|  hypothetical protein AMTR_s00025p00111790          191   1e-55   
ref|XP_009799861.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      191   6e-55   
ref|XP_008438730.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    189   1e-54   
gb|EMS61726.1|  Endo-1,3;1,4-beta-D-glucanase                           189   1e-54   
gb|EYU38137.1|  hypothetical protein MIMGU_mgv1a012773mg                189   1e-54   
ref|XP_003573585.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      190   2e-54   
ref|XP_004305461.1|  PREDICTED: carboxymethylenebutenolidase homolog    188   3e-54   
gb|EMT08698.1|  Endo-1,3;1,4-beta-D-glucanase                           190   6e-54   
gb|AAU10811.1|  putative endo-1,3;1,4-beta-D-glucanase                  189   7e-54   
gb|KCW49939.1|  hypothetical protein EUGRSUZ_K03401                     186   7e-54   
ref|XP_002447789.1|  hypothetical protein SORBIDRAFT_06g015650          188   2e-53   
emb|CAN78075.1|  hypothetical protein VITISV_041961                     184   3e-53   
ref|NP_001061329.1|  Os08g0239300                                       187   3e-53   
ref|XP_008390954.1|  PREDICTED: uncharacterized protein LOC103453179    191   4e-53   
gb|EEC83150.1|  hypothetical protein OsI_28358                          186   6e-53   
ref|XP_004972492.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      186   1e-52   
ref|XP_010938802.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      183   4e-52   
gb|AFW77924.1|  hypothetical protein ZEAMMB73_089561                    182   6e-52   
ref|XP_003573587.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      183   1e-51   
ref|XP_002447791.1|  hypothetical protein SORBIDRAFT_06g015660          183   1e-51   
ref|XP_006655299.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      183   1e-51   
gb|KEH32214.1|  endo-1,3-1,4-beta-D-glucanase-like protein              180   2e-51   
ref|XP_002973848.1|  hypothetical protein SELMODRAFT_173745             181   2e-51   
ref|XP_007154157.1|  hypothetical protein PHAVU_003G095100g             178   4e-51   
ref|XP_006659958.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      180   6e-51   
ref|NP_001055479.1|  Os05g0400100                                       181   2e-50   
ref|XP_008340904.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    176   3e-50   
ref|XP_002447792.1|  hypothetical protein SORBIDRAFT_06g015670          179   5e-50   
ref|XP_006659959.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      178   1e-49   
ref|NP_001067682.1|  Os11g0275200                                       177   2e-49   
ref|XP_010231396.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    174   2e-48   
gb|EMT26818.1|  Endo-1,3;1,4-beta-D-glucanase                           173   2e-48   
ref|NP_001061324.1|  Os08g0238500                                       174   7e-48   
ref|XP_007034582.1|  Alpha/beta-Hydrolases superfamily protein, p...    172   7e-48   
ref|XP_004972505.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    172   1e-47   
dbj|BAK00071.1|  predicted protein                                      172   2e-47   
gb|EAZ06121.1|  hypothetical protein OsI_28357                          172   2e-47   
ref|XP_009352313.1|  PREDICTED: uncharacterized AIM2 family prote...    174   3e-47   
gb|AAX92852.1|  Dienelactone hydrolase family, putative                 171   8e-47   
gb|EMT10879.1|  hypothetical protein F775_52638                         170   2e-46   
ref|XP_008678529.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      166   4e-45   
gb|KCW60878.1|  hypothetical protein EUGRSUZ_H03609                     162   7e-45   
ref|XP_008678528.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      166   2e-44   
gb|KCW84311.1|  hypothetical protein EUGRSUZ_B01156                     159   6e-44   
ref|NP_001067681.2|  Os11g0275000                                       165   1e-43   
ref|XP_004972504.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      162   1e-43   
gb|EMT30982.1|  Endo-1,3;1,4-beta-D-glucanase                           161   3e-43   
ref|XP_002983153.1|  hypothetical protein SELMODRAFT_179981             160   3e-43   
gb|ABK21331.1|  unknown                                                 157   6e-43   
ref|NP_001288380.1|  endo-1,3;1,4-beta-D-glucanase-like precursor       159   1e-42   
ref|XP_002439764.1|  hypothetical protein SORBIDRAFT_09g019670          160   2e-42   
gb|KHN03436.1|  Endo-1,3(4)-beta-D-glucanase                            155   2e-42   
ref|XP_002965911.1|  hypothetical protein SELMODRAFT_266933             156   8e-42   
gb|KDO74845.1|  hypothetical protein CISIN_1g025842mg                   152   9e-41   
gb|KCW44571.1|  hypothetical protein EUGRSUZ_L01916                     149   2e-40   
ref|XP_004508356.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    150   4e-40   
gb|ACJ85204.1|  unknown                                                 145   4e-39   
ref|XP_010532694.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      151   4e-39   
ref|XP_008390955.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      142   3e-37   
gb|AAX92849.1|  Dienelactone hydrolase family                           144   3e-37   
ref|XP_008779366.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      141   6e-37   
gb|EEE68290.1|  hypothetical protein OsJ_26538                          143   8e-37   
gb|EMT26819.1|  Endo-1,3;1,4-beta-D-glucanase                           142   2e-36   
ref|XP_010231398.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-lik...    140   6e-36   
gb|EMS50557.1|  Endo-1,3;1,4-beta-D-glucanase                           139   1e-35   
ref|XP_004974306.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      137   3e-35   
ref|NP_001175458.1|  Os08g0239100                                       138   3e-35   
ref|XP_006419792.1|  hypothetical protein CICLE_v10006579mg             135   5e-35   
ref|XP_010024438.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      134   5e-35   
ref|NP_001104915.1|  endo-1,3;1,4-beta-D-glucanase precursor            140   5e-35   
ref|XP_001762960.1|  predicted protein                                  135   2e-34   
gb|EEE63655.1|  hypothetical protein OsJ_18472                          132   5e-33   
gb|EMS54749.1|  Endo-1,3;1,4-beta-D-glucanase                           129   7e-32   
ref|XP_006589951.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      125   2e-31   
ref|XP_009788743.1|  PREDICTED: LOW QUALITY PROTEIN: carboxymethy...    126   5e-31   
ref|NP_001061325.1|  Os08g0238600                                       125   6e-31   
gb|AFK48155.1|  unknown                                                 124   9e-31   
gb|AHA61360.1|  hypothetical protein Lr546b_ref                         122   2e-30   
ref|XP_001778568.1|  predicted protein                                  123   1e-29   
gb|EMT07197.1|  Endo-1,3;1,4-beta-D-glucanase                           124   2e-29   
gb|KHN03432.1|  Endo-1,3(4)-beta-D-glucanase                            120   3e-29   
ref|XP_006355882.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      118   9e-29   
ref|XP_009417960.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      117   2e-28   
ref|XP_001780729.1|  predicted protein                                  118   7e-28   
gb|KHN29750.1|  Endo-1,3(4)-beta-D-glucanase                            115   1e-27   
gb|KDO74851.1|  hypothetical protein CISIN_1g0314641mg                  113   5e-27   
ref|XP_002558981.1|  Pc13g05470                                         116   7e-27   
gb|EPS29102.1|  hypothetical protein PDE_04051                          116   1e-26   
gb|ACN36517.1|  unknown                                                 109   1e-25   
gb|EME45097.1|  hypothetical protein DOTSEDRAFT_52470                   113   1e-25   
gb|KCW49936.1|  hypothetical protein EUGRSUZ_K03398                     108   2e-25   
ref|XP_008777225.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      107   4e-25   
gb|EMT08699.1|  Endo-1,3;1,4-beta-D-glucanase                           108   5e-25   
ref|XP_010039262.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      107   1e-24   
gb|EKG21151.1|  Dienelactone hydrolase                                  110   1e-24   
gb|AFW62026.1|  hypothetical protein ZEAMMB73_756786                    109   1e-24   
gb|ABA92619.2|  Endo-1,3;1,4-beta-D-glucanase precursor, putative...    108   2e-24   
gb|AAX92845.1|  Dienelactone hydrolase family, putative                 108   2e-24   
ref|XP_010026993.1|  PREDICTED: endo-1,3;1,4-beta-D-glucanase-like      100   5e-23   
dbj|BAD05244.1|  Endo-1,3;1,4-beta-D-glucanase precursor-like pro...    103   6e-23   
ref|XP_007805356.1|  hypothetical protein EPUS_06695                    105   8e-23   
ref|XP_008296773.1|  PREDICTED: carboxymethylenebutenolidase homolog    104   1e-22   
ref|XP_005809917.1|  PREDICTED: carboxymethylenebutenolidase homolog    103   2e-22   
gb|EKG17503.1|  Dienelactone hydrolase                                  103   2e-22   
ref|XP_007783199.1|  hypothetical protein W97_07379                     103   3e-22   
gb|EEE61614.1|  hypothetical protein OsJ_16031                          103   4e-22   
ref|XP_007547897.1|  PREDICTED: carboxymethylenebutenolidase homolog    102   6e-22   
ref|XP_007586365.1|  putative dienelactone hydrolase family protein     102   6e-22   
ref|XP_008436851.1|  PREDICTED: carboxymethylenebutenolidase homolog    102   7e-22   
ref|XP_007582340.1|  putative dienelactone hydrolase family protein     102   8e-22   
gb|EPT00991.1|  hypothetical protein FOMPIDRAFT_1023529                 102   1e-21   
gb|EAY97969.1|  hypothetical protein OsI_19887                          102   1e-21   
ref|XP_007865398.1|  dienelactone hydrolase endo-1,3,1,4-beta-D-g...    101   1e-21   
gb|ETE71655.1|  Carboxymethylenebutenolidase-like protein               103   2e-21   
ref|XP_007924324.1|  hypothetical protein MYCFIDRAFT_61202              101   2e-21   
emb|CAF97999.1|  unnamed protein product                                101   2e-21   
ref|XP_010866643.1|  PREDICTED: carboxymethylenebutenolidase homolog    100   3e-21   
gb|AGW24452.1|  hypothetical protein                                  96.3    3e-21   
ref|XP_003443530.1|  PREDICTED: carboxymethylenebutenolidase homo...    100   3e-21   
ref|XP_010867879.1|  PREDICTED: carboxymethylenebutenolidase homolog    100   4e-21   
ref|XP_007677009.1|  hypothetical protein BAUCODRAFT_71902              100   5e-21   
ref|XP_009552054.1|  hypothetical protein HETIRDRAFT_390196             100   5e-21   
gb|KGO48026.1|  Dienelactone hydrolase                                99.8    6e-21   
ref|XP_009882052.1|  PREDICTED: carboxymethylenebutenolidase homolog  99.8    7e-21   
ref|XP_003071965.1|  Dienelactone hydrolase family protein            99.4    8e-21   
ref|XP_005026153.1|  PREDICTED: carboxymethylenebutenolidase homo...  99.4    8e-21   
ref|XP_005386170.1|  PREDICTED: carboxymethylenebutenolidase homo...  99.4    9e-21   
gb|KGO72034.1|  Dienelactone hydrolase                                99.0    1e-20   
ref|XP_007770741.1|  alpha beta-hydrolase                             99.0    1e-20   
ref|XP_005026152.1|  PREDICTED: carboxymethylenebutenolidase homo...  99.4    1e-20   
dbj|GAD93040.1|  dienelactone hydrolase family protein                99.0    1e-20   
ref|XP_007730070.1|  esterase/lipase                                  98.6    2e-20   
ref|XP_006634660.1|  PREDICTED: carboxymethylenebutenolidase homolog  98.6    2e-20   
gb|KGO39775.1|  Sterol O-acyltransferase, ACAT/DAG/ARE types            102   2e-20   
gb|KGO62752.1|  Sterol O-acyltransferase, ACAT/DAG/ARE types            102   2e-20   
ref|XP_010133699.1|  PREDICTED: carboxymethylenebutenolidase homolog  98.6    2e-20   
ref|XP_001364031.1|  PREDICTED: carboxymethylenebutenolidase homo...  98.6    2e-20   
ref|XP_008305807.1|  PREDICTED: carboxymethylenebutenolidase homolog  98.2    2e-20   
ref|XP_451148.1|  hypothetical protein                                98.2    2e-20   
ref|XP_004761276.1|  PREDICTED: carboxymethylenebutenolidase homo...  98.2    2e-20   
gb|KGQ86435.1|  hypothetical protein MEO_03377                        97.8    2e-20   
gb|EMF10538.1|  dienelactone hydrolase family protein                 98.2    3e-20   
ref|XP_010763374.1|  hypothetical protein PADG_08034                  97.8    3e-20   
ref|XP_419013.1|  PREDICTED: carboxymethylenebutenolidase homolog...  97.8    3e-20   
ref|XP_001547677.1|  hypothetical protein BC1G_13839                  97.8    3e-20   
gb|KDO38803.1|  hypothetical protein CISIN_1g0401631mg                93.6    3e-20   
gb|EKV06996.1|  Dienelactone hydrolase family protein                 97.4    3e-20   
ref|XP_003854503.1|  hypothetical protein MYCGRDRAFT_99487            97.8    3e-20   
ref|XP_002714112.1|  PREDICTED: carboxymethylenebutenolidase homolog  97.4    4e-20   
ref|XP_005722593.1|  PREDICTED: carboxymethylenebutenolidase homo...  97.4    4e-20   
emb|CDR43330.1|  CYFA0S11e04192g1_1                                   97.1    5e-20   
gb|EEH16486.1|  hypothetical protein PABG_06573                       97.1    6e-20   
gb|KGU07644.1|  hypothetical protein MEQ_03398                        96.7    6e-20   
ref|XP_004546641.1|  PREDICTED: carboxymethylenebutenolidase homo...  96.7    6e-20   
gb|KGU26037.1|  hypothetical protein MG7_03412                        96.7    7e-20   
gb|KHC63084.1|  hypothetical protein MGE_03406                        96.7    7e-20   
ref|XP_007341011.1|  alpha/beta-hydrolase                             97.1    7e-20   
ref|XP_009470325.1|  PREDICTED: carboxymethylenebutenolidase homolog  96.7    8e-20   
gb|KDQ50688.1|  hypothetical protein JAAARDRAFT_211518                96.7    8e-20   
ref|XP_002419835.1|  dienelactone hydrolase, putative                 96.3    9e-20   
gb|KGU29962.1|  hypothetical protein MGK_03426                        96.3    1e-19   
emb|CBN81887.1|  Carboxymethylenebutenolidase homolog                 96.3    1e-19   
ref|XP_005356731.1|  PREDICTED: carboxymethylenebutenolidase homolog  95.9    1e-19   
ref|XP_004625254.1|  PREDICTED: carboxymethylenebutenolidase homolog  95.9    1e-19   
ref|XP_009160375.1|  esterase/lipase                                  96.3    1e-19   
ref|XP_005871109.1|  PREDICTED: carboxymethylenebutenolidase homo...  96.3    1e-19   
ref|XP_002791818.1|  dienelactone hydrolase family protein            95.9    1e-19   
ref|XP_007372839.1|  hypothetical protein SPAPADRAFT_48422            95.9    1e-19   
ref|XP_006769521.1|  PREDICTED: carboxymethylenebutenolidase homo...  95.9    1e-19   
ref|XP_008718327.1|  hypothetical protein HMPREF1541_05768            96.3    1e-19   
emb|CDO69655.1|  hypothetical protein BN946_scf184851.g43             95.9    1e-19   
ref|XP_006019034.1|  PREDICTED: carboxymethylenebutenolidase homo...  95.9    1e-19   
gb|KDQ11033.1|  hypothetical protein BOTBODRAFT_136319                96.3    1e-19   
gb|KGQ97135.1|  hypothetical protein MG1_03430                        95.5    1e-19   
ref|XP_010209857.1|  PREDICTED: carboxymethylenebutenolidase homolog  95.9    1e-19   
ref|XP_722830.1|  hypothetical protein CaO19.12082                    95.5    2e-19   
gb|KGQ90131.1|  hypothetical protein MEU_03418                        95.5    2e-19   
gb|KHC35054.1|  hypothetical protein MGO_03398                        95.5    2e-19   
ref|XP_006019033.1|  PREDICTED: carboxymethylenebutenolidase homo...  95.9    2e-19   
gb|EEQ45297.1|  conserved hypothetical protein                        95.5    2e-19   
ref|XP_010706811.1|  PREDICTED: carboxymethylenebutenolidase homolog  95.5    2e-19   
gb|EJT99783.1|  dienelactone hydrolase                                95.5    2e-19   
ref|XP_010610339.1|  PREDICTED: carboxymethylenebutenolidase homo...  95.1    2e-19   
ref|XP_009486064.1|  PREDICTED: carboxymethylenebutenolidase homolog  95.1    2e-19   
ref|XP_008938340.1|  PREDICTED: carboxymethylenebutenolidase homolog  95.1    2e-19   
ref|NP_001103302.1|  carboxymethylenebutenolidase homolog             95.1    3e-19   
ref|XP_005531772.1|  PREDICTED: carboxymethylenebutenolidase homo...  95.1    3e-19   
ref|XP_003686937.1|  hypothetical protein TPHA_0H03000                94.7    3e-19   



>ref|XP_009621644.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=241

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 179/240 (75%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYG---AGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            MS P C  NPPKL S      AG VQQLG  +CYVSG  HS LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGNSGGEAGHVQQLGGFSCYVSGSVHSTLALLLVSDVFGYEAPKLR  60

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            KLADK+  AGFYVVVPDF  GDP++ N  +P+ +W+KDH  D    DAK VIE LK+ GV
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHIANDVRPLELWIKDHGPDQGFEDAKPVIEALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            TK+G  G C G K  V+LAK   ++A VLLHP+FV +DD+  VKVPISI+GAE D+ +P 
Sbjct  121  TKIGAVGFCWGAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+VKQFE+AL AKPEVD+ VKIF GV HGW+VRY ++D+ AVK+AEEAHQD+L WF KHL
Sbjct  181  ELVKQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  240



>ref|XP_009784375.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Nicotiana 
sylvestris]
Length=241

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 179/240 (75%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYG---AGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            MS P C  NPPKL S      AG VQQLG  +CY+SGP HS LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGSSGGEAGHVQQLGGFSCYISGPPHSTLALLLVSDVFGYEAPKLR  60

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            KLADK+  AGFYVVVPDF  GDP+V N  +P+ +W+KDH  D    DAK VIE LK+ GV
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHVANDVRPLELWIKDHGPDQGFEDAKPVIEALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            TK+G  G C G K  V+LAK   ++A VLLHP+FV +DD+  VKVPISI+GAE D+ +P 
Sbjct  121  TKIGAVGFCWGAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+V QFE+AL AKPEVD+ VKIF GV HGW+VRY ++D+ AVK+AEEAHQD+L WF KHL
Sbjct  181  ELVMQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  240



>ref|XP_006489249.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Citrus sinensis]
Length=238

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 178/237 (75%), Gaps = 0/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + GAG V++LG LN YV+G   SKLAVLL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFYV VPDFFHGDPYV +G KP+  W+KDH VD    +AK VI+ LK+ G+T +
Sbjct  61   DKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V L K   ++A VLLHP+FVT+DDI+ V+VP+SI+GAE D  +P  +V
Sbjct  121  GAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALV  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+FE AL A  EVDS VKIF  V HGWTVRY+ +D++AVKAAEEAHQ+LL+WF K++
Sbjct  181  KEFEEALNAISEVDSFVKIFPKVAHGWTVRYNVEDESAVKAAEEAHQNLLEWFAKYV  237



>ref|XP_010103447.1| hypothetical protein L484_010049 [Morus notabilis]
 gb|EXB95850.1| hypothetical protein L484_010049 [Morus notabilis]
Length=240

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 182/239 (76%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S GAG V +LG +N YV+G S+S+LAVLL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGNVNKLGGINSYVTGASNSRLAVLLISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVE-NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGF+V +PDF HGDP+V  + ++PI VW+KDH  D  C +AK VIEDLK+ G + 
Sbjct  61   DKIAEAGFFVAIPDFLHGDPFVPGDASRPISVWIKDHGTDKGCEEAKPVIEDLKSKGFSA  120

Query  419  VGIGGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            +G  G+C G K  V+LAK+   ++A  LLHP+FVT+DDI++V V I+I+GAE+D  +P  
Sbjct  121  IGAAGLCWGAKVVVELAKLDNLIQAAALLHPSFVTVDDIKEVNVSIAILGAEHDNLSPPP  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE  L+AK E+DS VKI+ GV+HGWTVRYD  D+AA K A+EAH+DLL WF+KH+
Sbjct  181  LVKQFEEVLKAKSEIDSFVKIYPGVSHGWTVRYDVHDEAASKRADEAHKDLLAWFIKHV  239



>ref|XP_006489248.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Citrus 
sinensis]
Length=238

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 175/237 (74%), Gaps = 0/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + G G V+ LG LN YV+G  HSKLAVLLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTTGVGHVENLGGLNTYVNGSPHSKLAVLLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D    DAK VI+ +K+ G+T +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEDAKPVIQAIKSKGITAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K AV LAK   ++A VLLHP+FVT+DDI+ V+VPIS++GAE D+ +P  +V
Sbjct  121  GAAGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKGVEVPISVLGAEIDQFSPPALV  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+FE AL AK EVDS VKIF  V HGW+VRY+ +D+ AVKAAEEAHQ+LL+W  K++
Sbjct  181  KEFEEALTAKSEVDSFVKIFPKVAHGWSVRYNAEDEFAVKAAEEAHQNLLEWLTKYV  237



>gb|ABR92334.1| putative dienelactone hydrolase family protein [Salvia miltiorrhiza]
Length=237

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 179/237 (76%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C  NPP L S  G+G+V+++G ++ YVSGP+ SK A++L+SDVFGYEA NLRKLA
Sbjct  1    MAGAQCCENPPTLSSGSGSGKVEEIGGISSYVSGPADSKAAIILISDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+G AGF  VVPDFF GDPYV +  KPI  WLKDH  D    DAK +IE LK+ G+TK+
Sbjct  61   DKVGAAGFSAVVPDFFRGDPYVPD-QKPITDWLKDHGPDQGFEDAKPIIEALKSKGITKI  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V+L+K P V+A VL+HP+ V+++DIQ VKVPISI+GAE D  +P E+V
Sbjct  120  GAVGFCWGAKVVVELSKYPYVQAGVLIHPSLVSVEDIQGVKVPISILGAETDHISPPELV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE AL AKPEVDS VKIF   +HGW+VRY ++D+ AVK+A EAH+D+L WF+KHL
Sbjct  180  KQFEAALNAKPEVDSFVKIFARCSHGWSVRYKDEDEGAVKSAGEAHKDMLDWFIKHL  236



>ref|XP_010035817.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW84304.1| hypothetical protein EUGRSUZ_B01155 [Eucalyptus grandis]
Length=246

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 181/245 (74%), Gaps = 1/245 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  S GAG+V+QLG L+ YV G   SKLA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPNLDPSSGAGRVEQLGGLDAYVVGSQDSKLAMLLLSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPD+F GDP+  EN  +P  VW+KDH  D    D K  I+ LK+ G++ 
Sbjct  61   DKVAAAGFYVVVPDYFCGDPFAPENHERPFMVWIKDHGTDKGFEDTKPAIQALKSKGIST  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK AV+LAK   V+A VLLHP+FVTLDDI+  KVPI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGGKVAVELAKCELVQAAVLLHPSFVTLDDIKGAKVPIAVLGAEIDQMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH*  778
            +KQFE  L AK E+D+ VKIF  V+HGWTVRY  +D+AAVK+AEEAH D+++WFVK +  
Sbjct  181  LKQFEEVLSAKSEIDAFVKIFPKVSHGWTVRYKVEDEAAVKSAEEAHSDMIQWFVKFVKE  240

Query  779  LVSLH  793
              +LH
Sbjct  241  ETTLH  245



>ref|XP_006339416.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum tuberosum]
Length=241

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 173/240 (72%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG---QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            MS P C  NPP   S  G G    VQQ G  NCY+SGP  S  AV+LVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPNYLSGGGGGGAGHVQQFGGFNCYLSGPVDSTQAVILVSDVFGYEAPKLR  60

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            KLADK+  AGFYVVVPDF  GDP + N  KP+ VW+ DH  D    DAK VIE LK+ GV
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPRIPNDEKPLEVWIIDHGPDQGFEDAKPVIEALKSNGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            TK+G  G C G K  V+LAK   ++A VLLHP+FV +DD+  VKVPISI+GAE D  +P 
Sbjct  121  TKIGAAGFCWGAKVVVELAKYAYIQAAVLLHPSFVVVDDMHAVKVPISILGAEIDRRSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+VKQFE+AL AKPEVD+ VKIF GVTHGW+VRY+++D+  VK+AEE+HQD+L WF KHL
Sbjct  181  ELVKQFEMALNAKPEVDAFVKIFPGVTHGWSVRYNDEDELDVKSAEESHQDMLGWFEKHL  240



>gb|KDO74854.1| hypothetical protein CISIN_1g026476mg [Citrus sinensis]
Length=238

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 176/237 (74%), Gaps = 0/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + GAG V++LG LN YV+G   SKLAVLL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFYV VPDFFHGDPYV +G KP+  W+KDH VD    +AK VI+ LK+ G+T +
Sbjct  61   DKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V L K   ++A VLLHP+FVT+DDI+ V+VP+SI+GAE D  +P  +V
Sbjct  121  GAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALV  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+FE AL AK  VDS VKIF  V HGWTVRY+ +D+ AVKAAEEAH +LL+WF K++
Sbjct  181  KEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHHNLLEWFAKYV  237



>ref|XP_010103445.1| hypothetical protein L484_010047 [Morus notabilis]
 gb|EXB95848.1| hypothetical protein L484_010047 [Morus notabilis]
Length=240

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 178/239 (74%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S GAG VQ+LG L+ YV+G   SKLAVLLVSDV+GYEA NLRKLA
Sbjct  1    MSGPECCSNPPTLNPSSGAGHVQKLGGLDSYVTGTPSSKLAVLLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVE-NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGF+V VPDFFHGDP+V  + ++P+ VWLKDH  D    +AK V EDLK+ G + 
Sbjct  61   DKIAAAGFFVAVPDFFHGDPFVAGDASRPLPVWLKDHGTDKGFEEAKPVTEDLKSKGFSA  120

Query  419  VGIGGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            +G  G C GGK  V+L+K    ++A  LLHP+FV +DDI++VKVPI+I+G E D+ +P  
Sbjct  121  IGAAGFCWGGKVVVELSKFTNFIQAAALLHPSFVAVDDIKEVKVPIAILGGERDQISPPP  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE  L+AKPE+DS VKI+ GV HGWT+RYD  ++AA K A+EAH+DLL W +KH+
Sbjct  181  LVKQFEEVLKAKPEIDSFVKIYPGVAHGWTIRYDVRNEAACKRADEAHRDLLAWLIKHV  239



>ref|XP_006419784.1| hypothetical protein CICLE_v10005759mg [Citrus clementina]
 gb|ESR33024.1| hypothetical protein CICLE_v10005759mg [Citrus clementina]
Length=238

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 177/237 (75%), Gaps = 0/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + GAG V++LG LN YV+G   SKLAVLL+SD+ GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNGGAGHVEKLGGLNAYVTGSPDSKLAVLLISDIHGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFYV VPDFFHGDPYV +G KP+  W+KDH VD    +AK VI+ LK+ G+T +
Sbjct  61   DKVAAAGFYVGVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITSI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+ V+VP+SI+GAE D  +P  +V
Sbjct  121  GAAGFCWGAKVVVQLAKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPVLV  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+FE AL AK  VDS VKIF  V HGWTVRY+ +D+ AVKAAEEAHQ+LL+WF K++
Sbjct  181  KEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHQNLLEWFAKYV  237



>ref|XP_006489247.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Citrus 
sinensis]
Length=238

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 174/238 (73%), Gaps = 0/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + G G V+ LG LN YV+G  HSKLAVLLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTTGVGHVENLGGLNTYVNGSPHSKLAVLLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D    DAK VI+ +K+ G+T +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEDAKPVIQAIKSKGITAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+ V+VP +++GAE D+ +P  ++
Sbjct  121  GAAGFCWGAKVGVQLAKREFIQAAVLLHPSFVTVDDIKTVEVPTAVLGAEFDQISPPALL  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            KQFE  L AK EVD  VKIF  V+HGWTVRY+ +DK+AVK AEEAHQ++L+WF K+++
Sbjct  181  KQFEEVLTAKSEVDGYVKIFPKVSHGWTVRYNVEDKSAVKCAEEAHQNMLEWFAKYVN  238



>gb|KDP40089.1| hypothetical protein JCGZ_02087 [Jatropha curcas]
Length=239

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + GAG V+++G  N YV+G   SKLA+LL+SD++GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPASGAGHVEKVGGFNSYVTGSPDSKLAILLISDIYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGFYVVVPDFF+GDPY  +N  +PI VWLKDH  D    DAK V++ LK+ GVT 
Sbjct  61   DKIAAAGFYVVVPDFFYGDPYSPDNAERPIQVWLKDHEADKGFEDAKPVVQALKSKGVTA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V LAK   ++A VLLHP+F+T+DDI+ V+VPI+I+GAE D  +P  +
Sbjct  121  IGAAGFCWGAKVVVQLAKREFIQAAVLLHPSFITVDDIKGVEVPIAILGAEIDHLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEVD  VKIF  V HGWTVRY+ +D  AVKAAEEAH +LL WF KH+
Sbjct  181  VKQFEEVLTAKPEVDCHVKIFPKVAHGWTVRYNVEDANAVKAAEEAHGNLLDWFTKHV  238



>ref|XP_004165841.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cucumis sativus]
Length=239

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S GAG ++QLG L  YVSG   SKLAVL ++DV+G+EA  LRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKLAVLFITDVYGFEAPLLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VV PDFFHGDP+V + A +PI VWL+DH  +   +DAK V+E LK  G+T 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRPIRVWLQDHETEKGFDDAKPVVEALKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  VDLAK+  ++A VLLHP+FVT+DDI+ VK PISI+GAE D  +P E+
Sbjct  121  IGAVGICWGAKVVVDLAKVELIQAAVLLHPSFVTVDDIKGVKAPISILGAEIDHMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +K+FE  L AKPEVD  VKIF  V+HGWTVRY  +D+ AVK A+EAH+DLL WF K++
Sbjct  181  LKEFEEILSAKPEVDGFVKIFPKVSHGWTVRYKVEDEEAVKCADEAHEDLLAWFTKYV  238



>ref|XP_008340903.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Malus 
domestica]
Length=245

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C +NPP L  S G G V+ LG L+ YV+G  HSKLA+LLVSDVFG+EA NLRKLA
Sbjct  1    MSSSECCSNPPTLNPSSGTGHVENLGGLDSYVTGSPHSKLALLLVSDVFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDFF+ DPY  E+  +P+ VW+KDH  +    DAK+V+E LK  GV+ 
Sbjct  61   DKVAAAGFFVVVPDFFNKDPYAPEDANRPLPVWIKDHRPBKGFEDAKLVLEALKRKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VL HP FVT+DDI++VKVPISI+GAE D  +P EV
Sbjct  121  IGAAGFCWGAKVVVELAKRALIQAAVLCHPTFVTVDDIKEVKVPISILGAEFDRISPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK EV S VKIF  V+HGWTVRY+ +D+AA K+AEEAHQDLL+W + H+
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVSHGWTVRYNVEDEAACKSAEEAHQDLLEWLLNHV  238



>gb|KCW84305.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=247

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 176/239 (74%), Gaps = 1/239 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    G+G V+QLG L  YV G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D    + K +I+ LK+ G++K
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FVT+DDI+ VKVPI+++GAE D+ +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L AK EVD  VKIF  V+HGWT+RY  +D+AAVK AEEAH D+++WFVK ++
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFVN  239



>ref|XP_006489278.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Citrus sinensis]
Length=238

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 174/238 (73%), Gaps = 0/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + G G V+ LG LN YV+G  HSKLAVLLVSDV+ YEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTAGGGHVENLGGLNAYVNGSPHSKLAVLLVSDVYVYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D    +AK VI  +K+ G+T +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEEAKPVIHAIKSKGITAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K AV LAK   ++A VLLHP+FVT+DDI+ V+VP +++GAE D+ +P +++
Sbjct  121  GAAGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKAVEVPTAVLGAEFDQISPPDLL  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            KQFE  L AK EVD  VKIF  V+HGWTVRY+ +DK+AVK AEEAHQD+L+WF K+++
Sbjct  181  KQFEEVLTAKSEVDGYVKIFPKVSHGWTVRYNVEDKSAVKCAEEAHQDMLEWFAKYVN  238



>ref|XP_004134157.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cucumis sativus]
 gb|KGN57031.1| hypothetical protein Csa_3G150110 [Cucumis sativus]
Length=239

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S GAG ++QLG L  YVSG   SKLAVL ++DV+G+EA  LRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKLAVLFITDVYGFEAPLLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VV PDFFHGDP+V + A +PI VWL+DH  +   +DAK V+E LK  G+T 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRPIRVWLQDHETEKGFDDAKPVVEALKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+LAK+  ++A VLLHP+FVT+DDI+ VK PISI+GAE D  +P E+
Sbjct  121  IGAVGICWGAKVVVELAKVELIQAAVLLHPSFVTVDDIKGVKAPISILGAEIDHMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +K+FE  L AKPEVD  VKIF  V+HGWTVRY  +D+ AVK A+EAH+DLL WF K++
Sbjct  181  LKEFEEILSAKPEVDGFVKIFPKVSHGWTVRYKVEDEEAVKCADEAHEDLLAWFTKYV  238



>ref|XP_010035827.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW84307.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=239

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    G+G V+QLG L  YV G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D    + K +I+ LK+ G++K
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FVT+DDI+ VKVPI+++GAE D+ +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD  VKIF  V+HGWT+RY  +D+AAVK AEEAH D+++WFVK +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFV  238



>ref|XP_004247494.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Solanum 
lycopersicum]
Length=239

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C  NPP L SS G G V +LG L  YVS  S+SK A+LL+SDV+GYEA NLRKLA
Sbjct  1    MAGPQCCENPPALSSSSGHGSVLELGGLKTYVSDSSNSKYAILLISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G+YVVVPDF +GDPY  EN  KPI VW++ H  D    DAK VI  LK  G++ 
Sbjct  61   DKVAAGGYYVVVPDFLYGDPYNPENKEKPIQVWIQSHGTDKGFEDAKQVIAALKDKGISP  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V+LAK   V+A VLLHP+FV++DDI++VK PI+I+GAE D+ +P E+
Sbjct  121  IGAAGFCWGGKVVVELAKSDNVQAAVLLHPSFVSVDDIKEVKAPIAILGAEIDQLSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEVD  VKI+ GV+HGWTVRY+ +D+ AV++AEEAHQD+L WF KH+
Sbjct  181  VKQFEEILSSKPEVDCFVKIYPGVSHGWTVRYNVEDEKAVQSAEEAHQDMLDWFTKHV  238



>gb|KCW84306.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=269

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 176/239 (74%), Gaps = 1/239 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    G+G V+QLG L  YV G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D    + K +I+ LK+ G++K
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FVT+DDI+ VKVPI+++GAE D+ +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L AK EVD  VKIF  V+HGWT+RY  +D+AAVK AEEAH D+++WFVK ++
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFVN  239



>ref|XP_010262559.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Nelumbo nucifera]
Length=238

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP LCSS G G V +LG L  YV+G   SK  +LLVSD+FGYEA NLRKLA
Sbjct  1    MSGPQCCDNPPTLCSSCGEGSVLELGGLKAYVAGSQDSKRGILLVSDIFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGFYVVVPDF +GDPYV +N  +P+ VW+K H  D    DAK VI+ LK  G+T 
Sbjct  61   DKIAAAGFYVVVPDFLYGDPYVPDNAERPLPVWIKSHGPDKAFEDAKPVIDALKVKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V LA+   ++A VLLH +FVT+DDI++VKVPI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVVVQLARFDQIQAAVLLHASFVTVDDIKEVKVPIAVLGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            +KQFE  L +K EVD  VKIF GV HGWTVRY  +DKA VK+AEEAH+D+L+WF K+
Sbjct  181  LKQFEEVLSSKSEVDGFVKIFPGVAHGWTVRYSAEDKAVVKSAEEAHRDMLEWFTKY  237



>ref|XP_004229456.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum lycopersicum]
Length=248

 Score =   268 bits (686),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 173/242 (71%), Gaps = 4/242 (2%)
 Frame = +2

Query  59   IMSSPHCIANPPKLCSSYGAG----QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATN  226
            +MS P C  NPP   S  G G     VQQLG  NCY+SGP  S  A++LVSDVFGYEA  
Sbjct  6    VMSGPECCENPPNYLSGGGGGGGAGHVQQLGGFNCYLSGPLDSAQAIILVSDVFGYEAPK  65

Query  227  LRKLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAG  406
            LRKLADK+  AGFYVVVPDF  GDP + N  KP+ VW+ DH  D     AK VIE LK+ 
Sbjct  66   LRKLADKVAAAGFYVVVPDFLRGDPRIPNDEKPLEVWIVDHGPDQGFEYAKPVIEALKSK  125

Query  407  GVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETT  586
            GVTK+G  G C G K  V+LAK   ++A VLLHP+FV +DD+  VK+PISI+GAE D  +
Sbjct  126  GVTKIGAAGFCWGAKVVVELAKYAYIQAAVLLHPSFVVIDDMHAVKIPISILGAEIDRYS  185

Query  587  PAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
              E+VKQFE+AL AKPEVD+ VKIF GVTHGW VRY+++D+ AVK+AEE+HQD+L WF K
Sbjct  186  SPELVKQFEMALNAKPEVDAFVKIFPGVTHGWAVRYNDEDELAVKSAEESHQDMLGWFEK  245

Query  767  HL  772
            HL
Sbjct  246  HL  247



>ref|XP_006358424.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum tuberosum]
Length=239

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 175/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C  NPP L SS G G + +LG L  YVSG S+SK A+LL+SDV+GYEA NLRKLA
Sbjct  1    MAGPQCCENPPALSSSSGHGSILELGGLKTYVSGSSNSKHAILLISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G+YVVVPDF +GDPY  EN  KPI VW++ H  D    DAK VI  LK  G++ 
Sbjct  61   DKVAAGGYYVVVPDFLYGDPYNPENKEKPIQVWIQSHGTDKGFEDAKQVIAALKDKGISP  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V+LAK   +++ VLLHP+FV++DDI++VK PI+I+G E D+ +P E+
Sbjct  121  IGAAGFCWGGKVVVELAKSDNIQSAVLLHPSFVSVDDIKEVKAPIAILGGEIDQLSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEVD  VKI+ GV+HGWTVRY+ +DK AV++AEEAHQD+L WF KH+
Sbjct  181  VKQFEEILSSKPEVDRFVKIYPGVSHGWTVRYNVEDKKAVQSAEEAHQDMLDWFTKHV  238



>emb|CDP20217.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   268 bits (684),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 169/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  N P L SS GAG V+++G L  YV+GP+ SK+AVLLVSDVFGYEA  LRKLA
Sbjct  1    MSGPQCCENAPSLSSSSGAGHVEEIGGLQSYVTGPADSKIAVLLVSDVFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+ GAG +VVVPDFF GDP V      +  WLK+H  D     AK VIE LK  G+TKV
Sbjct  61   DKVAGAGIFVVVPDFFFGDPLVLEKTT-VDDWLKNHGPDQGFEHAKPVIEALKGKGITKV  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V+LAK   + A VLLHP+FVTLDDIQ VKVPISI+GAE D+  P E++
Sbjct  120  GAAGFCWGAKVVVELAKYAYIHAAVLLHPSFVTLDDIQGVKVPISILGAEKDQKWPPELL  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+F  AL AKPEVD  VKIF G THGWTVRY ++D+  VKAA EAHQD L WFVK+L
Sbjct  180  KKFGEALDAKPEVDGFVKIFPGATHGWTVRYKDEDEKEVKAAAEAHQDTLDWFVKYL  236



>ref|XP_002516793.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF45407.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + G+G V++LG LN Y++GPS SK A+LL+SDV+G+EA NLRKLA
Sbjct  1    MSGPQCCANPPTLDPASGSGHVEKLGGLNSYITGPSDSKRAILLISDVYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+GDPY  +N  +PI VWLKDH  D    DAK +++ LK+ GV+ 
Sbjct  61   DKVATAGFYVVVPDFFYGDPYAPDNADRPIQVWLKDHGTDKGFEDAKPLVQTLKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V LAK   ++A V+LHP+FVT+DDI+ V+VPISI+GAE D  +P  +
Sbjct  121  IGAAGFCWGAKVVVQLAKPEFIQAAVMLHPSFVTVDDIKAVEVPISILGAETDHLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK EV S  KIF  V HGWTVRY+ +D+ A K A+EAH D+++WF KH+
Sbjct  181  VKQFEEVLNAKSEVGSRCKIFPKVAHGWTVRYNVEDENAAKCADEAHGDMIEWFTKHV  238



>ref|XP_010041171.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=236

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 170/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  S GAG+V+QLG L+ YV G   SKLA+LL+SDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLDPSSGAGRVEQLGGLDAYVVGSQDSKLAMLLLSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPD+F+GDPY  EN  +P+ VW+KDH  D      K +I+ LK+ G++K
Sbjct  61   DKVAAAGFYVVVPDYFYGDPYAPENPERPLVVWIKDHGTDKGFEATKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHPAFVTLDDI+DVKVPI+++GAE D  +P E+
Sbjct  121  IGAAGFCWGAKVGVELAKCELIQAAVLLHPAFVTLDDIKDVKVPIAVLGAEIDRFSPLEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD  VKI+   +HGWT+RY         AA EAH D+++WFVK +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIYPKTSHGWTIRY---KVEDEAAAMEAHSDMIQWFVKFV  235



>ref|XP_010103443.1| hypothetical protein L484_010045 [Morus notabilis]
 gb|EXB95846.1| hypothetical protein L484_010045 [Morus notabilis]
Length=239

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP L  S GAG V++LG L+ YV+G  +SKLAVLL+SD++G+EA NLRKLA
Sbjct  1    MSGCQCCSNPPTLNPSSGAGHVEKLGGLDSYVTGSPNSKLAVLLISDIYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGF+V VPDF HGDPYV      +G+WL+DH  D    +AK VIEDLK+ G + +
Sbjct  61   DKLAAAGFFVAVPDFLHGDPYVSEDFSGLGIWLQDHGTDKGFEEAKPVIEDLKSKGFSAI  120

Query  422  GIGGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            G  G C G K  V++AK    ++A VLLHP+FVTLDDI++VKVPI+I+GAE D+ +P E+
Sbjct  121  GAAGFCWGAKVVVEVAKFTNFIQAAVLLHPSFVTLDDIKEVKVPIAILGAEIDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK E+DS VKIF GV HGWTVRYD  D+AA K AEEAH+DLL+ F KH+
Sbjct  181  VKQFEEVLSAKAEIDSFVKIFPGVAHGWTVRYDVQDEAANKRAEEAHKDLLEIFTKHV  238



>ref|XP_006406017.1| hypothetical protein EUTSA_v10021426mg [Eutrema salsugineum]
 dbj|BAJ34546.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47470.1| hypothetical protein EUTSA_v10021426mg [Eutrema salsugineum]
Length=239

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L  + G+GQV++LG L+ YVSG +HSKLAV+LVS VFGYE   LRKLA
Sbjct  1    MSDHQCTENPPNLDPNSGSGQVEKLGGLDTYVSGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY  EN  +P+ VW+KDH  D    D+K V+E LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENHDRPLPVWIKDHGQDKGFEDSKPVVEALKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LA+   VEA VLLHP+ VT+DDI++VKVPI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKIAVELARQELVEAAVLLHPSRVTVDDIKEVKVPIAVLGAEFDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE     KPEV S VKIF  V HGWTVRY+E+D + VKAAEEAH+D+L W + H+
Sbjct  181  VKQFEDIFATKPEVKSFVKIFPRVKHGWTVRYNENDPSEVKAAEEAHKDMLAWLIDHV  238



>ref|XP_006419786.1| hypothetical protein CICLE_v10005765mg [Citrus clementina]
 gb|ESR33026.1| hypothetical protein CICLE_v10005765mg [Citrus clementina]
Length=237

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + GAG V++LG L+ YV+G   SKLA LL+SD+FGYEA NLRKLA
Sbjct  1    MSGPRCCANPPTLNPNSGAGHVEKLGGLDTYVTGSPDSKLAALLISDIFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            D++  AGFYV VPDFFHGDP+V +G +P+  W+ DH VD    +AK +I+ LK  G+T  
Sbjct  61   DRVAAAGFYVAVPDFFHGDPHV-DGGRPLQEWINDHGVDKGFEEAKPLIQALKCKGITAT  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K AV LAK   ++A VLLHP+FVT+DDI+ V+VPIS++GAE D+ +P  +V
Sbjct  120  GAVGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKGVEVPISVLGAEIDQVSPPALV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+FE AL AK EVDS VKIF  V HGW+VRY+ +D++AVKAAEEAHQ+LL+W  KH+
Sbjct  180  KEFEEALTAKSEVDSFVKIFPKVAHGWSVRYNVEDESAVKAAEEAHQNLLEWLAKHV  236



>ref|XP_007034580.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY05506.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=239

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L    G G V++L  L  Y +G   SKLAVLLVSDVFGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPGSGVGHVEELAGLKTYFTGSLDSKLAVLLVSDVFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+GDP+V E   +P+ VWLKDH  D    DAK+VI+ LK+ GV+ 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVAERSDRPLAVWLKDHGPDKGLEDAKLVIDALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V LAK   + A VLLHP+FVT+DDI+ VKVPI+I+GAE D+ +P  +
Sbjct  121  IGAAGICWGAKVVVGLAKEALIPAAVLLHPSFVTVDDIKSVKVPIAILGAEIDQLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQF+  L+AKPEV S VKIF    HGWTVRY+ +D  AV  A+EAHQD+L WF K++
Sbjct  181  VKQFDEILKAKPEVGSFVKIFPKCAHGWTVRYNVNDATAVSYADEAHQDMLNWFTKYV  238



>ref|XP_009365790.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=244

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 177/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G G V++LG L+ YV+G   SKLAVLLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGPDKAFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VL HP+FVT+DDI+ VKVPISI+GAE D  +P E+
Sbjct  121  IGAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L A  EV S VKIF  V+HGWTVRY+ +DKAA K+AEEAHQDLL+WF+KH+
Sbjct  181  VKQFEEVLTAN-EVKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLEWFLKHV  237



>ref|XP_010649854.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Vitis vinifera]
 emb|CBI26171.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  +PP L  + G+G V+QLG L+CY++G  HSKLA+LLVSD++GYEA N RKLA
Sbjct  1    MSGPQCCEHPPSLNPNSGSGHVEQLGGLSCYIAGSPHSKLAILLVSDIYGYEAPNFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVV PDF +GD YV + A +P  VW+KDH +D    D K VIE LK+ GV+ 
Sbjct  61   DKVAAAGFYVVAPDFLYGDTYVPDKAERPFPVWIKDHGMDKGFEDTKPVIEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FV+LDDI+ VKVP +++GAE D+ +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKSGYIQAAVLLHPSFVSLDDIKGVKVPTAVLGAEIDQMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKP VD  VKIF GV HGWTVRY+ +D  AVK AEEAHQD+L WF K++
Sbjct  181  VKQFEEILTAKPGVDGFVKIFPGVAHGWTVRYNAEDAGAVKCAEEAHQDMLGWFSKYV  238



>ref|XP_008368364.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S LAVLL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDVYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDANRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VL HP+ VT+DDI++VKVPISI+GAE D  +P EV
Sbjct  121  IGAAGFCWGAKVVVELSKHAXIQAAVLCHPSLVTVDDIKEVKVPISILGAEIDRMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEV S VKIF  V+HGWTVRY   D+AA K+AEEAHQDLLKWF+ H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYSVXDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_010326630.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
lycopersicum]
Length=240

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 175/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C  NPP L SS G G V +LG L  YVS  S+SK A+LL+SDV+GYEA NLRKLA
Sbjct  1    MAGPQCCENPPALSSSSGHGSVLELGGLKTYVSDSSNSKYAILLISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G+YVVVPDF +GDPY  EN  KPI VW++ H  D    DAK VI  LK  G++ 
Sbjct  61   DKVAAGGYYVVVPDFLYGDPYNPENKEKPIQVWIQSHGTDKGFEDAKQVIAALKDKGISP  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQ-DVKVPISIIGAENDETTPAE  595
            +G  G C GGK  V+LAK   V+A VLLHP+FV++DDI+ +VK PI+I+GAE D+ +P E
Sbjct  121  IGAAGFCWGGKVVVELAKSDNVQAAVLLHPSFVSVDDIKAEVKAPIAILGAEIDQLSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE  L +KPEVD  VKI+ GV+HGWTVRY+ +D+ AV++AEEAHQD+L WF KH+
Sbjct  181  LVKQFEEILSSKPEVDCFVKIYPGVSHGWTVRYNVEDEKAVQSAEEAHQDMLDWFTKHV  239



>ref|XP_008438729.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Cucumis 
melo]
Length=239

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S GAG ++QLG L  YVSG   SK+AVL ++DV+G+EA  LRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKIAVLFITDVYGFEAPLLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VV PDFFHGDP+V + A +PI VWL+DH  D   +DAK V+E LK  G++ 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRPIRVWLQDHGPDKGFDDAKPVVEALKNKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+LAK+  ++A VLLHP+FVT+DDI+ VK  ISI+GAE D  +P E+
Sbjct  121  IGAVGICWGAKVVVELAKVELIQAAVLLHPSFVTVDDIKGVKAHISILGAEIDHMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AKPEVD  VKIF  V+HGWTVRY+ +D+ AVK A+EAH+DLL WF K++
Sbjct  181  LKQFEEILSAKPEVDGFVKIFPKVSHGWTVRYNVEDEEAVKCADEAHEDLLAWFTKYV  238



>ref|XP_007034579.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05505.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=248

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 169/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L    G G V++L  L  Y +G   SKLAVLLVSDVFGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPGSGVGHVEELAGLKTYFTGSLDSKLAVLLVSDVFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+GDP+V E   +P+ VWLKDH  D    DAK+VI+ LK+ GV+ 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVAERSDRPLAVWLKDHGPDKGLEDAKLVIDALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V LAK   + A VLLHP+FVT+DDI+ VKVPI+I+GAE D+ +P  +
Sbjct  121  IGAAGICWGAKVVVGLAKEALIPAAVLLHPSFVTVDDIKSVKVPIAILGAEIDQLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
            VKQF+  L+AKPEV S VKIF    HGWTVRY+ +D  AV  A+EAHQD+L WF K
Sbjct  181  VKQFDEILKAKPEVGSFVKIFPKCAHGWTVRYNVNDATAVSYADEAHQDMLNWFTK  236



>ref|XP_006419793.1| hypothetical protein CICLE_v10005752mg [Citrus clementina]
 gb|ESR33033.1| hypothetical protein CICLE_v10005752mg [Citrus clementina]
Length=239

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 174/239 (73%), Gaps = 1/239 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + G G V+ LG LN YV+G  HSKLAVLLVSDV+ YEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPTAGGGHVENLGGLNAYVNGSPHSKLAVLLVSDVYVYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGFYV VPDF HGDPYV N  + +  W+KDH  D    +AK VI  +K+ G+T +
Sbjct  61   DKIAAAGFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEEAKPVIHAIKSKGITAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K AV LAK   ++A VLLHP+FVT+DDI+ V+VP +++GAE D+ +P +++
Sbjct  121  GAAGFCWGAKVAVQLAKREFIQAAVLLHPSFVTVDDIKAVEVPTAVLGAEFDQISPPDLL  180

Query  602  KQFEIALQAKPE-VDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            KQFE  L AK E VD  VKIF  V+HGWTVRY+ +DK+AVK AEEAHQD+L+WF K+++
Sbjct  181  KQFEEVLTAKSEQVDGYVKIFPKVSHGWTVRYNVEDKSAVKCAEEAHQDMLEWFAKYVN  239



>ref|XP_006419787.1| hypothetical protein CICLE_v10005761mg [Citrus clementina]
 gb|ESR33027.1| hypothetical protein CICLE_v10005761mg [Citrus clementina]
Length=237

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 175/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + GAG V++LG L+ YV+G   SKLA LL+SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLNPNSGAGHVEKLGGLSTYVTGSPDSKLATLLISDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFYV VPDFFHGDP V +G +P+  W+KDH VD    +AK VI+ LK  G+T  
Sbjct  61   DKVAAAGFYVAVPDFFHGDPKV-DGGRPLQEWIKDHGVDKGFEEAKPVIQALKCKGITAT  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V LAK   ++A VLLHP+FVT+DDI+ V+VPIS++GAE D+ +P  +V
Sbjct  120  GAVGFCWGAKVVVQLAKHEFIQAAVLLHPSFVTVDDIKGVEVPISVLGAEIDQFSPPALV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            K+FE AL AK EVDS VKIF  V HGW+VRY+ +D+ AVKAAEEAHQ+LL+W  K++
Sbjct  180  KEFEEALTAKSEVDSFVKIFPKVAHGWSVRYNAEDEFAVKAAEEAHQNLLEWLTKYV  236



>ref|XP_008353246.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S LAVLL+SD +G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDXYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAKRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VL HP+ VT+DDI++VKVPIS++GAE D+ +P EV
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKEVKVPISVLGAEIDQMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEV S VKIF  V+HGWTVRY  +D+AA K+AEEAHQDLLKWF+ H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYSVEDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_008368374.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S LAVLL+SD +G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDXYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAXRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VL HP+ VT+DDI++VKVPISI+GAE D  +P EV
Sbjct  121  IGAAGFCWGAKVVVELSKHAXIQAAVLCHPSLVTVDDIKEVKVPISILGAEIDRMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEV S VKIF  V+HGWTVRY   D+AA K+AEEAHQDLLKWF+ H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYSVKDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_009621645.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=228

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 170/240 (71%), Gaps = 16/240 (7%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYG---AGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            MS P C  NPPKL S      AG VQQLG  +CYVSG  HS LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGNSGGEAGHVQQLGGFSCYVSGSVHSTLALLLVSDVFGYEAPKLR  60

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            KLADK+  AGFYVVVPDF  GDP++ N  +P+ +W+KDH  D    DAK VIE LK    
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHIANDVRPLELWIKDHGPDQGFEDAKPVIEALK----  116

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
                     S  K  V+LAK   ++A VLLHP+FV +DD+  VKVPISI+GAE D+ +P 
Sbjct  117  ---------SKAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  167

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+VKQFE+AL AKPEVD+ VKIF GV HGW+VRY ++D+ AVK+AEEAHQD+L WF KHL
Sbjct  168  ELVKQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  227



>ref|XP_003529605.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Glycine max]
Length=238

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 176/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +N P L  + GAG V++L AL+ Y+SG S + +A+LLVSDVFGYEA NLR +A
Sbjct  1    MSGPECCSNSPVLNPNAGAGHVEKLAALDSYLSG-SPNSIAILLVSDVFGYEAPNLRNIA  59

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFF+GDPY  EN ++P+ VWLKDH  D     AK +IE LK+ GVT 
Sbjct  60   DKVAAAGYYVVVPDFFYGDPYNPENASRPLSVWLKDHGTDKGSEAAKSIIEALKSKGVTA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V+LAK   ++A VLLHPAFV++DDI+ V +P +++GAE D+ +P E+
Sbjct  120  IGAAGFCWGGKVVVELAKSRLIQADVLLHPAFVSVDDIKGVDIPTAVLGAEIDKMSPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKP VD  VKIF  V+HGWTVRY+ +D  AVKAAEEAHQD+L WF KHL
Sbjct  180  VKQFEQVLTAKPGVDCFVKIFPKVSHGWTVRYNPEDAEAVKAAEEAHQDMLNWFAKHL  237



>emb|CBI32343.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YVSGPS SKLA+LL+SDV+GYEA NLR LA
Sbjct  1    MSGPQCCENPPTLSSSSGAGCVTEIGGLKAYVSGPSDSKLAILLISDVYGYEAPNLRNLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+ GAGFYVVVPDFF+GDP++     P  VW+K H  D    DAK +I +L++ G+  +
Sbjct  61   DKVAGAGFYVVVPDFFYGDPFLPETNIP--VWIKAHGTDKGFEDAKPIIAELRSKGINAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K AV+L+K   ++A VLLHP+FVT+DDI++VK PI+I+GAE D+ +P +++
Sbjct  119  GAAGFCWGAKVAVELSKAGHIQAAVLLHPSFVTVDDIKEVKAPIAILGAEIDQYSPPKLL  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L  KPEV+  VKIF GV HGW+VRY  +D+ AVK A EAHQ+++ WF +++
Sbjct  179  KQFEEVLSTKPEVNGYVKIFPGVDHGWSVRYKVEDEEAVKQANEAHQNMMDWFTQYV  235



>ref|XP_008234913.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=240

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 175/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YV+GPS SK A+LL+SDV+G+EA NLRKLA
Sbjct  1    MSGPQCCENPPTLSSSSGAGSVTEIGGLKAYVTGPSDSKQAILLISDVYGFEAPNLRKLA  60

Query  242  DKIG-GAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI   AGF+VVVPDFF+GDPYV +N  +P+ VW++ H       DAK +I  L+  GV+
Sbjct  61   DKIASAAGFHVVVPDFFYGDPYVPDNAERPVSVWIQSHGTGKGFEDAKPIIAALRNKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            K+G  G C G K  V+LAK   ++A VLLHP+ VT+DDI+++K PI+I+GAE D+ +P E
Sbjct  121  KIGAAGFCWGAKVVVELAKSDYIQAAVLLHPSLVTVDDIKEIKAPIAILGAEFDKISPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++K++E  L  KPEV+  VKIF GV HGWTVRY E+D+AAVK A EAHQDLL WF +H+
Sbjct  181  LLKKYEEVLSTKPEVNGYVKIFPGVPHGWTVRYKEEDEAAVKHAGEAHQDLLAWFTQHV  239



>gb|KCW84309.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=238

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 174/238 (73%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    G+G V+QLG L  YV G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D    + K +I+ LK+ G++K
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C   K  V+LAK   ++A VLLHP+FVT+DDI+ VKVPI+++GAE D+ +P  +
Sbjct  121  IGAAGFC-WAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD  VKIF  V+HGWT+RY  +D+AAVK AEEAH D+++WFVK +
Sbjct  180  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFV  237



>ref|XP_009784376.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Nicotiana 
sylvestris]
Length=228

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 170/240 (71%), Gaps = 16/240 (7%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYG---AGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            MS P C  NPPKL S      AG VQQLG  +CY+SGP HS LA+LLVSDVFGYEA  LR
Sbjct  1    MSGPECCENPPKLSSGSSGGEAGHVQQLGGFSCYISGPPHSTLALLLVSDVFGYEAPKLR  60

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            KLADK+  AGFYVVVPDF  GDP+V N  +P+ +W+KDH  D    DAK VIE LK    
Sbjct  61   KLADKVAAAGFYVVVPDFLRGDPHVANDVRPLELWIKDHGPDQGFEDAKPVIEALK----  116

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
                     S  K  V+LAK   ++A VLLHP+FV +DD+  VKVPISI+GAE D+ +P 
Sbjct  117  ---------SKAKVVVELAKYAYIQAAVLLHPSFVAVDDMHAVKVPISILGAEIDKRSPP  167

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+V QFE+AL AKPEVD+ VKIF GV HGW+VRY ++D+ AVK+AEEAHQD+L WF KHL
Sbjct  168  ELVMQFEMALNAKPEVDAFVKIFPGVAHGWSVRYKDEDEVAVKSAEEAHQDMLGWFEKHL  227



>ref|XP_008340902.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Malus 
domestica]
Length=245

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S LAVLL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDVYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  +PI VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAXRPISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VL HP FVT+DDI++VKVPISI+GAE D  +P EV
Sbjct  121  IGAAGFCWGAKVVVELAKRALIQAAVLCHPTFVTVDDIKEVKVPISILGAEFDRISPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK EV S VKIF  V+HGWTVRY+ +D+AA K+AEEAHQDLL+W + H+
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVSHGWTVRYNVEDEAACKSAEEAHQDLLEWLLNHV  238



>ref|XP_002275697.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Vitis vinifera]
Length=275

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YVSGPS SKLA+LL+SDV+GYEA NLR LA
Sbjct  40   MSGPQCCENPPTLSSSSGAGCVTEIGGLKAYVSGPSDSKLAILLISDVYGYEAPNLRNLA  99

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+ GAGFYVVVPDFF+GDP++     P  VW+K H  D    DAK +I +L++ G+  +
Sbjct  100  DKVAGAGFYVVVPDFFYGDPFLPETNIP--VWIKAHGTDKGFEDAKPIIAELRSKGINAI  157

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K AV+L+K   ++A VLLHP+FVT+DDI++VK PI+I+GAE D+ +P +++
Sbjct  158  GAAGFCWGAKVAVELSKAGHIQAAVLLHPSFVTVDDIKEVKAPIAILGAEIDQYSPPKLL  217

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L  KPEV+  VKIF GV HGW+VRY  +D+ AVK A EAHQ+++ WF +++
Sbjct  218  KQFEEVLSTKPEVNGYVKIFPGVDHGWSVRYKVEDEEAVKQANEAHQNMMDWFTQYV  274



>ref|XP_010695307.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Beta vulgaris subsp. 
vulgaris]
Length=241

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 172/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C  NPP L  S G G VQ++G +  YV G S +KLAVL +SDV+GYEA NLRKLA
Sbjct  1    MAGAQCCDNPPTLNPSSGVGLVQEIGGIQSYVVGSSDTKLAVLFISDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+Y VVPDF HG+PY  EN  +PI VW+KDH  D  C +AK+VIE LK  G++K
Sbjct  61   DKVAAAGYYAVVPDFLHGEPYDAENTERPIQVWIKDHGPDKGCEEAKLVIEALKQKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKI-PCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            +G  G C G K  V LA+    V+A  LLHP+FVT+DDI+ VKVP++++GAE D  +P E
Sbjct  121  IGAVGFCWGAKVVVQLAQSQEYVQAGALLHPSFVTVDDIKGVKVPLAVLGAEIDHLSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE AL AK EVD  VKIF GV HGWTVRY+ +D AAVK AEEAHQD+L WF KH+
Sbjct  181  LVKQFEEALNAKAEVDGFVKIFPGVAHGWTVRYNTEDAAAVKCAEEAHQDMLGWFQKHI  239



>ref|XP_009352129.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=244

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 176/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP L  S G G V++LG L+ YV+G   SKLAVLLVSD+FG+EA NLRKLA
Sbjct  1    MSGAQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGPDKAFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VL HP+FVT+DDI+ VKVPISI+GAE D  +P E+
Sbjct  121  IGAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L A  EV S VKIF  V+HGWTVRY+ +DKAA K+AEEAHQDLL+WF+KH+
Sbjct  181  VKQFEEVLTAN-EVKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLEWFLKHV  237



>ref|XP_011071518.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=256

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            +SS  C  NPP L ++ GAG+VQ+LG LNCYVSG + S  +V+L+SDV+GYEA +LR LA
Sbjct  18   VSSHQCTDNPPTLSATRGAGKVQELGGLNCYVSGSADSNFSVILISDVYGYEAPHLRMLA  77

Query  242  DKIGGAGFYVVVPDFFHGDPYVE-NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFF GDP+V  N  KP  +W K H  D    DAK +++ +K  G+++
Sbjct  78   DKVAAAGFYTVVPDFFRGDPFVNGNPHKPFHIWFKHHGYDQGFEDAKAIVKAIKRNGISR  137

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G+ G C GGK  V+L K   +EA VLLHP+ V++ DI+ VKVPISI+GAE D+ +P ++
Sbjct  138  IGVAGFCWGGKVNVELTKHAYIEAGVLLHPSNVSIQDIRGVKVPISILGAEIDQFSPPKL  197

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            V++FE  L+ KPEVDS VKIF GV HGWT+RY++DDK AVK+AEEAH  +L WF+KHL
Sbjct  198  VRKFEAVLKKKPEVDSFVKIFPGVQHGWTIRYNDDDKLAVKSAEEAHNAMLHWFIKHL  255



>ref|XP_009339925.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Pyrus 
x bretschneideri]
Length=239

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S  AVLL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNFAVLLISDVYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  +P+ VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDANRPVSVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VL HP+ VT+DDI++VKVPISI+GAE D  +P EV
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKEVKVPISILGAEIDRMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            V+QFE  L  KPEV S VKIF  V+HGWTVRY  +D+AA K+AEEAHQDLLKWF+ H+
Sbjct  181  VRQFEEVLTTKPEVKSHVKIFPKVSHGWTVRYSVEDEAACKSAEEAHQDLLKWFLNHV  238



>ref|XP_010103440.1| hypothetical protein L484_010042 [Morus notabilis]
 gb|EXB95843.1| hypothetical protein L484_010042 [Morus notabilis]
Length=237

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 170/238 (71%), Gaps = 3/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G G V++LG L+ YV+G  +SKLAVLL+SD++GYEA N RKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGEGHVEKLGGLDSYVTGSPNSKLAVLLISDIYGYEAPNFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGF+V VPDF HGDPY       IG+WL DH  DN   +AK VIEDLK+ G + +
Sbjct  61   DKIAAAGFFVAVPDFVHGDPYDSEDFSRIGIWLNDHGTDNAFEEAKPVIEDLKSQGFSAI  120

Query  422  GIGGVCSGGKAAVDLAKI-PCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            G  G+C G K   +LAK    ++A  LLHP+ VTLDDI++VKV I+I+GAE D+ +P E+
Sbjct  121  GAAGLCWGAKVVTELAKFNNFIQAGALLHPSLVTLDDIKEVKVSIAILGAEFDQASPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPE+DS VKI+ GV HGWT+R    D+AA K AEE+H DLL++F KH+
Sbjct  181  VKQFEKILSAKPEIDSFVKIYPGVEHGWTIR--PSDEAARKTAEESHNDLLEFFTKHV  236



>emb|CDX85111.1| BnaC07g07950D [Brassica napus]
Length=239

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPPKL  + G+G V++LG L+ YVSG +HSKLAV+LVS VFGYE   LRKLA
Sbjct  1    MSGHQCTENPPKLDPNSGSGHVEKLGGLDSYVSGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY   N  +P+ +W+KDH  D    D+K V++ LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPANEDRPLPIWIKDHPQDKGFEDSKPVVDALKNEGITT  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K AV+LAK   V+A VLLHP+ VT+DDI+ VKVPIS++GAE D+ TP E+
Sbjct  121  VGAAGFCWGAKVAVELAKQELVKAVVLLHPSRVTVDDIKGVKVPISVLGAEYDQVTPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQF+  L  KPEV S VKIF  V HGWTVRYD +D + VKAAEEAH+D+L W   H+
Sbjct  181  VKQFQHVLATKPEVKSFVKIFPRVRHGWTVRYDPNDPSEVKAAEEAHKDMLVWLTNHV  238



>ref|XP_010466703.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Camelina 
sativa]
Length=241

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 175/240 (73%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPH--CIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS  H  C  NPP L  + G+G V++LG L+ YVSG +HSKLAVLLVS VFGYE  NLRK
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            LADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +    ++K ++E LK  G+
Sbjct  61   LADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPIVEALKNKGI  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            T +G  G C G K AV+LAK   V+ATVLLHP+ VT+DDI+ V +PI+++GAE D+ +P 
Sbjct  121  TSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVNIPIAVLGAELDQVSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+V+QFE  L +KPEV S VKIF  V HGWTVRY+E+D + V+AAEEAH+D+L W   H+
Sbjct  181  ELVRQFEDVLASKPEVKSFVKIFPSVKHGWTVRYNENDPSEVEAAEEAHKDMLAWLTNHV  240



>ref|XP_010532701.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=238

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G+V++LG L+ YV G   S  A+LLVSDVFGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLNPKSGSGRVEKLGGLDAYVIGSPDSTRAILLVSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDPY  +N  +PI VW+KDH  D     +K V+E LK+ G+T 
Sbjct  61   DKVAESGFYVVVPDYFYGDPYDPKNQDRPIAVWIKDHGADKGFEQSKPVVEALKSKGITS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+LAK   ++A V LHP+FVT+DD++ VKVP++++GAE D  +P E+
Sbjct  121  IGAAGMCWGAKVVVELAKDALIQAGVFLHPSFVTVDDVKGVKVPLAVLGAEIDHMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV S VKIF   THGWTVRY  DD +AVKAAEEAH+D+L WFV HL
Sbjct  181  LKQFEEVLASKPEVKSCVKIFPKTTHGWTVRYSTDDPSAVKAAEEAHKDMLDWFVTHL  238



>ref|XP_007200368.1| hypothetical protein PRUPE_ppa010677mg [Prunus persica]
 gb|EMJ01567.1| hypothetical protein PRUPE_ppa010677mg [Prunus persica]
Length=240

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 175/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YV+GPS SK A+LLVSDV+G+EA NLRKLA
Sbjct  1    MSGPQCCENPPTLSSSSGAGSVTEIGGLKAYVAGPSDSKQAILLVSDVYGFEAPNLRKLA  60

Query  242  DKIG-GAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI   AGF+VVVPDFF+GDPYV +N  +P+ VW++ H       DAK +I  L+  GV+
Sbjct  61   DKIASAAGFHVVVPDFFYGDPYVPDNAERPVSVWIQSHGTGKGFEDAKPIIAALRNKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            K+G  G C G K  V+LAK   ++A VLLHP+ VT+DDI+++K PI+I+GAE D+ +P E
Sbjct  121  KIGAAGFCWGAKVVVELAKSDYIQAAVLLHPSLVTVDDIKEIKAPIAILGAEFDKISPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++K++E  L +KPEV+  VKIF GV HGWTVRY E+D+AAVK A EAH DLL WF +H+
Sbjct  181  LLKKYEEVLSSKPEVNGYVKIFPGVPHGWTVRYKEEDEAAVKHAGEAHHDLLAWFTQHV  239



>gb|AFK34617.1| unknown [Lotus japonicus]
Length=239

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP +  + G G V++   L+ Y++G  HSKLA+LLVSD++GYEA NLR LA
Sbjct  1    MSGPQCCSNPPTINPTAGVGHVEKFAGLDSYLTGSPHSKLAILLVSDIYGYEAPNLRNLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFF+GDPY  EN  +P+ VWLKDH  D     AK ++E LK+ GV+ 
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYNPENANRPLPVWLKDHGTDKGFEVAKPIVEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A V LHP+FV+LDDI  V +PI+I+GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVVVELAKSRLIQAAVQLHPSFVSLDDINGVDIPIAILGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            +KQFE  L AKP VDS VKIF  V+HGW+VRY+ +D  AVKAAEEAHQD+L WF KH
Sbjct  181  LKQFEQVLTAKPGVDSYVKIFPKVSHGWSVRYNIEDAEAVKAAEEAHQDMLDWFAKH  237



>ref|XP_009102607.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Brassica rapa]
Length=239

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPPKL  + G+G V++LG L+ YVSG +HSKLAV+LVS VFGYE   LRKLA
Sbjct  1    MSGHQCTENPPKLDPNSGSGHVEKLGGLDSYVSGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY   N  +P+ +W+KDH  D    D+K V++ LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPANEDRPLPIWIKDHPQDKAFEDSKPVVDALKNKGITT  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K AV+LAK   V+A VLLHP+ VT+DDI+ VKVPIS++GAE D+ TP ++
Sbjct  121  VGAAGFCWGAKVAVELAKQELVKAVVLLHPSRVTVDDIKGVKVPISVLGAEYDQVTPPKL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            V+QF+  L  KPEV S VKIF  V HGWTVRYD +D + V+AA+EAH+D+L W + H+
Sbjct  181  VQQFQNVLATKPEVKSFVKIFPRVKHGWTVRYDPNDPSEVEAAKEAHKDMLVWLINHV  238



>gb|EYU38138.1| hypothetical protein MIMGU_mgv1a012798mg [Erythranthe guttata]
Length=239

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  S G G V + G L  YVSGPS SKLAV+L +DV+GYEA NLRK+A
Sbjct  1    MSGPQCCANPPTLSPSSGVGSVIEFGGLKSYVSGPSDSKLAVILAADVYGYEAPNLRKIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGFYVVVPDFF+GDPY   N  KP+ VW   H       DAK VIE L++ G++ 
Sbjct  61   DKIAAAGFYVVVPDFFYGDPYDPANPEKPLLVWKALHEPAKAFEDAKPVIEALRSKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   +EA V LHP+FVTLDDI++VK P++I+GAE D  +P E+
Sbjct  121  IGAAGFCYGAKVVVELAKSKLIEAGVFLHPSFVTLDDIKEVKAPLAILGAETDHLSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L    EV+S VKIF GV HGW VRY  DD+ AVK+AEEA+QD L WF+K +
Sbjct  181  VKQFEEILSTNSEVESFVKIFPGVAHGWAVRYKFDDEMAVKSAEEAYQDTLNWFIKFV  238



>emb|CDX77499.1| BnaA07g06370D [Brassica napus]
Length=239

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPPKL  + G+G V++LG L+ Y+SG +HSKLAV+LVS VFGYE   LRKLA
Sbjct  1    MSGHQCTENPPKLDPNSGSGHVEKLGGLDSYISGSTHSKLAVVLVSHVFGYETPQLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY   N  +P+ +W+KDH  D    D+K V+E LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPANEDRPLPIWIKDHPQDKGFEDSKPVVEALKNKGLTT  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K AV+LAK   V+A VLLHP+ VT+DDI  VKVPIS++GAE D+ TP E+
Sbjct  121  VGAVGFCWGAKVAVELAKQELVKAVVLLHPSRVTVDDINGVKVPISVLGAEYDQVTPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQF+  L  KPEV S VKIF  V HGWTVRYD +D + V+AAEEAH+D+L W   H+
Sbjct  181  VKQFQNVLATKPEVKSFVKIFPRVKHGWTVRYDPNDPSEVEAAEEAHKDMLVWLTNHV  238



>ref|XP_004247139.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum lycopersicum]
Length=239

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C  NPP L SS G G V +LG L  YVSG S SK A+LL+SD+FGYEA NLRKLA
Sbjct  1    MAGTQCCENPPALSSSSGYGSVFELGGLKTYVSGSSDSKKAILLISDIFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G+YVVVPDFF+GDPY  EN  + I VWL+ H  D    DAK VI  LK  G++ 
Sbjct  61   DKVAAEGYYVVVPDFFNGDPYNSENKERTIQVWLESHGTDKGFEDAKQVIAALKDKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V LA    ++A VLLHP+FV++DD  +VK PI+I+GAE D  TP E+
Sbjct  121  IGAAGFCWGGKVVVQLATSANIQAAVLLHPSFVSVDDFTEVKAPIAILGAELDRPTPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            + QF+  L +KPEVDS V+++ GV HGWTVRY+ +DK AV++AEEAHQD+L WF KH+
Sbjct  181  IMQFKEILSSKPEVDSFVRMYPGVAHGWTVRYNVEDKKAVQSAEEAHQDMLNWFAKHV  238



>gb|AFJ92670.1| GLU protein [Vitis amurensis]
Length=275

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YVSGPS SKLA+LL+SDV+GYEA NLR LA
Sbjct  40   MSGPQCCENPPTLSSSSGAGCVTEIGGLKAYVSGPSDSKLAILLISDVYGYEAPNLRNLA  99

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+ GAGFYVVVPDFF+GDP++     P  VW+K H  D    DAK +I +L++ G+  +
Sbjct  100  DKVAGAGFYVVVPDFFYGDPFLPETNIP--VWIKAHGTDKGFEDAKPIIAELRSKGINAI  157

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K A++L+K   ++A VLLHP+FV +DDI++VK PI+I+GAE D+ +P +++
Sbjct  158  GAAGFCWGAKVAIELSKAGHIQAAVLLHPSFVNVDDIKEVKAPIAILGAEIDQYSPPKLL  217

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L  KPEV+  VKIF GV HGW+VRY  +D+ AVK AEEAHQ+++ WF +++
Sbjct  218  KQFEEVLSTKPEVNGYVKIFPGVDHGWSVRYKVEDEEAVKQAEEAHQNMMDWFAQYV  274



>ref|XP_002885571.1| dienelactone hydrolase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61830.1| dienelactone hydrolase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L  + G+G V++LG L+ YVSG +HSKLAVLLVS VFGYE  NLRKLA
Sbjct  1    MSGHQCTENPPHLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFF+GDPY  EN  +P+  W KDH  +    D+K ++E LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFYGDPYNPENKDRPLLTWAKDHGQEKGFEDSKPIVEALKNKGITS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LAK   V+ATVLLHP+ VT+DDI+DV +PI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKDVNIPIAVLGAELDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            V+QFE  L +KPEV S VKIF  V HGWTVRY+E+D + V+AAEEAH D+L W + ++
Sbjct  181  VRQFEDILASKPEVKSFVKIFPRVKHGWTVRYNENDPSEVEAAEEAHMDMLAWLIDYV  238



>ref|XP_010035807.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW84303.1| hypothetical protein EUGRSUZ_B01154 [Eucalyptus grandis]
Length=236

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  S G G ++QLG LN YV G   SKLA+LL+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCDNPPTLNPSSGDGFMEQLGGLNAYVIGSQDSKLAILLISDIFGYEAPNFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYV VPD+F+GDP+  EN  +P  VWLKDH  D      K +I+ LK+ G++K
Sbjct  61   DKVAAAGFYVAVPDYFNGDPFSPENPERPFTVWLKDHGTDKGFEATKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LAK   ++A VLLHP FVTLDDI++VKVPI+++GAE D  +P E+
Sbjct  121  IGAAGFCWGSKVAVELAKCELIQAAVLLHPVFVTLDDIKEVKVPIAVLGAEIDRFSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD  VKI+   +HGWT+RY         AA EAH D+++WFVK +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIYPKTSHGWTIRY---KVEDEAAAMEAHSDMIQWFVKFV  235



>ref|XP_008390813.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=244

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 175/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G G V++LG L+ YV+G   SKLAVLLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH +D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGLDKAFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +   G C G K  V+LAK   ++A VL HP+FVT+DDI+ VKVPISI+GAE D  +P E+
Sbjct  121  IXAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L A   V S VKIF  V+HGWTVRY+ +DKAA K+AEEAHQDLL WF+KH+
Sbjct  181  VKQFEEVLTAN-GVKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLDWFLKHV  237



>ref|XP_010035799.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Eucalyptus 
grandis]
Length=237

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 164/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  S G G ++QLG LN YV G   SKLA+LL+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCDNPPTLNPSSGDGFMEQLGGLNAYVIGSQDSKLAILLISDIFGYEAPNFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYV VPD+F+GDP+  EN  +P  VWLKDH  D      K +I+ LK+ G++K
Sbjct  61   DKVAAAGFYVAVPDYFNGDPFSPENPERPFTVWLKDHGTDKGFEATKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LAK   ++A VLLHP FVTLDDI++VKVPI+++GAE D  +P E+
Sbjct  121  IGAAGFCWGSKVAVELAKCELIQAAVLLHPVFVTLDDIKEVKVPIAVLGAEIDRFSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD  VKI+   +HGWT+RY         AA EAH D+++WFVK +
Sbjct  181  LKQFEEVLAAKSEVDGFVKIYPKTSHGWTIRY---KVEDEAAAMEAHSDMIQWFVKFV  235



>gb|KDP40090.1| hypothetical protein JCGZ_02088 [Jatropha curcas]
Length=239

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    GAG+V+Q+G  N Y++GPS SKLA+LLVSD++GYEA  LRKLA
Sbjct  1    MSGPQCCANPPTLNPESGAGRVEQVGGFNSYLTGPSDSKLAILLVSDIYGYEAPILRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            D I  AGFYVVVPDFF+G+PY  +N  + I VW KDH +D    DAK V++ +K+ GV+ 
Sbjct  61   DMIAAAGFYVVVPDFFYGEPYSPDNAERHIQVWFKDHGLDKGFEDAKPVVQAIKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V LAK   ++A VLLHP+ VT+DDI+ V+VPI+++GAE D  +P  +
Sbjct  121  IGAAGFCWGAKVVVQLAKSEFIQAAVLLHPSLVTVDDIKAVEVPIAVLGAEIDHISPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPE+D  VKIF  V HGWTVRYDE D+ AVK AEEAH D L WF KH+
Sbjct  181  VKQFEEVLTAKPEIDCHVKIFPKVEHGWTVRYDERDETAVKNAEEAHGDTLDWFTKHV  238



>emb|CAN78076.1| hypothetical protein VITISV_041962 [Vitis vinifera]
Length=237

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 165/237 (70%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  Y +GP  SKL +LLVSD+ GYEA NLRKLA
Sbjct  1    MSGPQCCENPPVLSSSCGAGSVAEIGGLKAYFTGPPDSKLVILLVSDILGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFYVVVPDFFHGDP+V    K + VW+K H  D    D K +I  L++ G+  +
Sbjct  61   DKVAAAGFYVVVPDFFHGDPFVPE-TKTLPVWIKSHGPDKGFEDVKPIIAALRSKGINSI  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V+LAK   ++A VLLHP+F T+DDI+++K PISI+GAE D  +P E+V
Sbjct  120  GAAGFCWGAKVVVELAKAGDIQAAVLLHPSFTTVDDIKEIKAPISILGAETDHVSPPELV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L  KPE+ S VKIF GV HGW VRY  D++ AVK AEEA Q+++ WF++H+
Sbjct  180  KQFEEVLATKPEIKSFVKIFPGVAHGWAVRYKVDBEEAVKRAEEAQQNMMDWFIEHV  236



>ref|XP_002275763.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Vitis vinifera]
 emb|CBI32344.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 165/237 (70%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  Y +GP  SKL +LLVSD+ GYEA NLRKLA
Sbjct  1    MSGPQCCENPPVLSSSCGAGSVAEIGGLKAYFTGPPDSKLVILLVSDILGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFYVVVPDFFHGDP+V    K + VW+K H  D    D K +I  L++ G+  +
Sbjct  61   DKVAAAGFYVVVPDFFHGDPFVPE-TKTLPVWIKSHGPDKGFEDVKPIIAALRSKGINSI  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V+LAK   ++A VLLHP+F T+DDI+++K PISI+GAE D  +P E+V
Sbjct  120  GAAGFCWGAKVVVELAKAGDIQAAVLLHPSFTTVDDIKEIKAPISILGAETDHVSPPELV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L  KPE+ S VKIF GV HGW VRY  DD+ AVK AEEA Q+++ WF++H+
Sbjct  180  KQFEEVLATKPEIKSFVKIFPGVAHGWAVRYKVDDEEAVKRAEEAQQNMMDWFIEHV  236



>ref|XP_008368976.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=244

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 175/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G G V++LG L+ YV+G   SKLAVLLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGTGHVEKLGGLDSYVTGSPDSKLAVLLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPYV E+  +P+ VW+KDH +D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYVPEDANRPLPVWIKDHGLDKAFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +   G C G K  V+LAK   ++A VL HP+FVT+DDI+ VKVPISI+GAE D  +P E+
Sbjct  121  ICAAGFCWGAKVVVELAKHALIQAAVLCHPSFVTVDDIKKVKVPISILGAEIDRMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L A   V S VKIF  V+HGWTVRY+ +DKAA K+AEEAHQDLL WF+KH+
Sbjct  181  VKQFEEVLTAN-GVKSHVKIFPKVSHGWTVRYNVEDKAACKSAEEAHQDLLDWFLKHV  237



>ref|XP_010488428.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=241

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 173/240 (72%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPH--CIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS  H  C  NPP L  + G+G V++LG L+ YVSG +HSKLAVLLVS VFGYE  NLRK
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            LADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +    ++K ++E LK  G+
Sbjct  61   LADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPIVEALKNKGI  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            T +G  G C G K AV+LAK   V+ATVLLHP+ VT+DDI+ V +PI+++GAE D+ +P 
Sbjct  121  TSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVSIPIAVLGAEFDQVSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+V+QFE  L +KPEV   VKIF  V HGWTVRY+E+D   V+AAEEAH+D+L W   H+
Sbjct  181  ELVRQFEDVLASKPEVKIFVKIFPSVKHGWTVRYNENDPFEVEAAEEAHKDMLSWLTNHV  240



>gb|KCW84310.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=218

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    G+G V+QLG L  YV G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D    + K +I+ LK+ G++K
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FVT+DDI+ VKVPI+++GAE D+ +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIKGVKVPIAVLGAEIDQMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRY  694
            +KQFE  L AK EVD  VKIF  V+HGWT+RY
Sbjct  181  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRY  212



>ref|XP_010527412.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Tarenaya hassleriana]
Length=239

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  + G+G V++LG L+ YV G   SKL +LLVS VFGYE  NLRKLA
Sbjct  1    MSHPQCCENPPTLDPNSGSGHVEKLGGLDSYVVGSPDSKLGILLVSHVFGYETPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPDFFHGDPY  EN  +P+ VW+KDH  D    ++K VIE LK+ G+T 
Sbjct  61   DKVANSGFYVVVPDFFHGDPYNPENQDRPLLVWIKDHEPDKGFEESKPVIEALKSKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LAK   V+A VLLHP+ VT+DDI+ V+VPISI+GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVAVELAKQELVQAVVLLHPSRVTVDDIKGVEVPISILGAEFDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV   VKIF  V HGWTVRY+  D +  +AAEEAH+D+L+W + ++
Sbjct  181  VKQFEEILASKPEVKRFVKIFPRVKHGWTVRYNPSDPSEAEAAEEAHEDMLEWLIHYV  238



>ref|XP_004290676.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP LCS+ GAG V ++G L  YV+GPS SKLAVLLVSD+FG+EA N RKLA
Sbjct  1    MSGPQCCENPPSLCSTCGAGSVTEIGGLKAYVTGPSDSKLAVLLVSDIFGFEAPNFRKLA  60

Query  242  DKIGG-AGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK     GF+VVVPDFF+GDP++    + + VWL+ H  D    DAKVVI  L+  G++ 
Sbjct  61   DKTARVGGFHVVVPDFFYGDPFIPEKTERL-VWLQSHGTDKGFEDAKVVIAALRNKGIST  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V+L+K  C++A VLLHP+ VT+DDI++VK PI+++GAE D+ +P E+
Sbjct  120  IGAAGFCWGGKVVVELSKSDCIQAAVLLHPSRVTVDDIKEVKAPIAVLGAEFDKISPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L  KP+V   VKIF GV HGW VRY +DD+ AVK A EAHQD+L WF K++ 
Sbjct  180  LKQFEEVLSTKPDVSGYVKIFPGVPHGWAVRYKDDDETAVKLANEAHQDMLDWFTKYVQ  238



>gb|KCW84301.1| hypothetical protein EUGRSUZ_B01152 [Eucalyptus grandis]
Length=293

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 166/241 (69%), Gaps = 4/241 (2%)
 Frame = +2

Query  53   YNIMSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            +  MS P C  NPP L  S GAG V+QL  LN Y+ G   SKLA+LL+SD+FGYEA N R
Sbjct  55   FKAMSGPQCCENPPTLDPSCGAGHVEQLCGLNTYIVGSQDSKLAILLLSDIFGYEAPNFR  114

Query  233  KLADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGG  409
            K+ADK+  AGFYVVVPD+F+GD +V +N  +P+ VW+KDH  D    D K +I+ LK+ G
Sbjct  115  KIADKVAAAGFYVVVPDYFNGDTFVLDNPERPLMVWMKDHGTDKGFEDTKPIIQALKSKG  174

Query  410  VTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTP  589
            ++K+G  G C G K A +LAK   ++A V+LHPAFVTLDDI+ VKVP +++ AEND  TP
Sbjct  175  ISKIGAAGFCWGAKVATELAKCELIQAAVMLHPAFVTLDDIKGVKVPTAVLAAENDHLTP  234

Query  590  AEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
             E+VKQFE  L AKPEVD  VKI+   +HGWT RY         AA EAH D+++W VK+
Sbjct  235  LELVKQFEEELAAKPEVDGFVKIYPKTSHGWTTRY---KAEDEAAAMEAHSDMIQWVVKY  291

Query  770  L  772
            +
Sbjct  292  V  292



>ref|XP_007223756.1| hypothetical protein PRUPE_ppa010552mg [Prunus persica]
 gb|EMJ24955.1| hypothetical protein PRUPE_ppa010552mg [Prunus persica]
Length=245

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 174/239 (73%), Gaps = 1/239 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP +  S G+G V++LG L+ YV+G   SKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGPQCCSNPPTINPSSGSGHVEKLGGLDSYVTGSPDSKLAILLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF +GDPY  E+  +P+ VW+KDH   N   DAK V+  L+  G + 
Sbjct  61   DKVAAAGFFVVVPDFLYGDPYAPEDANRPLPVWIKDHGPANGFEDAKPVLGALRRKGFSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C GGK  V+LAK   ++A VL HP+FV +DDI+ VKVPISI+GAE D  +P EV
Sbjct  121  VGAAGFCWGGKVVVELAKHDFIQAAVLCHPSFVIVDDIKAVKVPISILGAEIDHMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            VKQFE  L AK EV S VKIF  V HGWTVRY+ +D+AAVK AEEAHQ+LL+WF+ H+ 
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVAHGWTVRYNVEDEAAVKCAEEAHQNLLEWFLNHVR  239



>ref|XP_007154155.1| hypothetical protein PHAVU_003G095100g [Phaseolus vulgaris]
 gb|ESW26149.1| hypothetical protein PHAVU_003G095100g [Phaseolus vulgaris]
Length=239

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + GAG V++L  L+ Y++G  +S LAVLL+SDVFGYEA NLR +A
Sbjct  1    MSGPECCSNPPLLNPNAGAGHVEKLAGLDSYIAGSPNSNLAVLLISDVFGYEAPNLRNIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFF GDPY  EN  + I VWLKDH  D     AK ++E LK+ GV+ 
Sbjct  61   DKVAAAGYYVVVPDFFFGDPYNPENANRAIHVWLKDHGTDKGSEAAKSIVEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VLLHP+FV++DDI+ V +P +++GAE D+ +P E+
Sbjct  121  IGAVGFCWGAKVVVELSKSRLIQAAVLLHPSFVSVDDIKGVDIPTAVLGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKP +D  VKIF  V+HGW+VRY  DD  AVKAAEEAHQDLL WF +HL
Sbjct  181  VKQFEQVLTAKPGIDCFVKIFPQVSHGWSVRYRNDDAIAVKAAEEAHQDLLNWFARHL  238



>ref|XP_010035787.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=236

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 165/238 (69%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  S GAG V+QL  LN Y+ G   SKLA+LL+SD+FGYEA N RK+A
Sbjct  1    MSGPQCCENPPTLDPSCGAGHVEQLCGLNTYIVGSQDSKLAILLLSDIFGYEAPNFRKIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPD+F+GD +V +N  +P+ VW+KDH  D    D K +I+ LK+ G++K
Sbjct  61   DKVAAAGFYVVVPDYFNGDTFVLDNPERPLMVWMKDHGTDKGFEDTKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K A +LAK   ++A V+LHPAFVTLDDI+ VKVP +++ AEND  TP E+
Sbjct  121  IGAAGFCWGAKVATELAKCELIQAAVMLHPAFVTLDDIKGVKVPTAVLAAENDHLTPLEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEVD  VKI+   +HGWT RY         AA EAH D+++W VK++
Sbjct  181  VKQFEEELAAKPEVDGFVKIYPKTSHGWTTRY---KAEDEAAAMEAHSDMIQWVVKYV  235



>gb|KHG15388.1| Endo-1,3(4)-beta-D-glucanase [Gossypium arboreum]
Length=238

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L S+ GAG V+ L  LN YVSG   SKLAV L+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCSNPPTLDSASGAGHVENLAGLNTYVSGSLQSKLAVFLISDIFGYEAPNFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVV PDFF+G+PY  N   +P+ VW+KDH  D    DAK+VI+ LK+ GV+ 
Sbjct  61   DKVAASGFYVVAPDFFYGEPYDPNNPDRPLSVWIKDHGADKGYEDAKLVIDALKSKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K    LAK P ++A V+LHP+FV +DDI+ VKVPI+I+GAE D  +  E+
Sbjct  121  IGAAGFCWGAKVVARLAKDPLIQAAVMLHPSFVNVDDIKSVKVPIAILGAEQDHISTPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQF+  L+A  EVDS VKIF  V HGW+VRYD +D  AV +A EA QD+L WF K++
Sbjct  181  LKQFDEILKAS-EVDSFVKIFPKVGHGWSVRYDVNDPTAVSSANEAQQDMLAWFAKYV  237



>ref|XP_010512613.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Camelina sativa]
Length=241

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 175/240 (73%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPH--CIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS  H  C  NPP L  + G+G V++LG L+ YVSG +HSKLAVLLVS VFGYE  NLRK
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            LADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +    ++K ++E LK  G+
Sbjct  61   LADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPIVEALKNKGI  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            T +G  G C G K AV+LAK   V+ATVLLHP+ VT+DDI+ V +PI+++GA+ D+ +P 
Sbjct  121  TSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVNIPIAVLGAKFDQVSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+V+QFE  L +K EV S+VKIF  V HGWTVRY+E+D + V+AAEEAH+D+L W   H+
Sbjct  181  ELVRQFEYVLASKSEVKSVVKIFPSVKHGWTVRYNENDPSEVEAAEEAHKDMLAWLTNHV  240



>gb|KFK39652.1| hypothetical protein AALP_AA3G271900 [Arabis alpina]
Length=239

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPPKL  + G+  V++L  L+ YVSG  HS LAVLLVS VFGYE  +LRKLA
Sbjct  1    MSDHQCTENPPKLDPNSGSCHVEKLAGLDSYVSGSLHSNLAVLLVSHVFGYETPHLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY  EN  +P+ VW+KDH  D    ++K V++ LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENHDRPLPVWIKDHGQDKAFEESKPVVDALKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G+ G C G K AV+LAK   VEATVLLHP+ VT+DDI+ VKVPI+++GAE D+ +P E+
Sbjct  121  IGVAGFCWGAKIAVELAKQELVEATVLLHPSRVTVDDIKGVKVPIAVLGAEFDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L  K EV S VKIF  V HGWTVRY+ +D   V+AAEEAH+D+L W + H+
Sbjct  181  VKQFEDILATKTEVKSFVKIFPRVKHGWTVRYNVNDPFEVEAAEEAHKDMLTWLIDHV  238



>gb|KEH32209.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=238

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 172/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + G+G V++LGALN Y++G  +SK +VLLVSDVFGYEA NLRKLA
Sbjct  1    MSGPECCSNPPILNPNAGSGHVEKLGALNAYIAGSPNSKSSVLLVSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG++VVVPDF +G+PY  EN  +P+ +W+KDH  D    DAK +IE +K+ GV+ 
Sbjct  61   DKVAAAGYFVVVPDFLNGEPYNPENPDRPLPIWIKDHGTDKGFEDAKPIIEAIKSKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K   +LAK   ++A VLLHP+FV++DDI+ V +P SI+GAE D  +P E+
Sbjct  121  VGAAGFCWGAKVVTELAKSRLIQAAVLLHPSFVSVDDIKAVDIPYSILGAEIDRLSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK    S VKIF  V+HGWTVRY  +D  AVKAAEEAHQDLL WF KHL
Sbjct  181  VKQFEEILSAK-SAPSFVKIFPKVSHGWTVRYSPEDAEAVKAAEEAHQDLLDWFAKHL  237



>ref|XP_010527418.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=240

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 175/235 (74%), Gaps = 1/235 (0%)
 Frame = +2

Query  71   PHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKI  250
            P C  N P L  S G+G+V++LG L+ YVSG   SKL ++L SDVFGYEA NLR LADKI
Sbjct  5    PQCCENRPTLNPSSGSGRVEKLGGLDAYVSGSPDSKLGIVLFSDVFGYEAPNLRNLADKI  64

Query  251  GGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGI  427
              AGF VVVPDF  GDPY  EN  +P+ VWLKDH  D    D+K +IE LK+ G++ VG 
Sbjct  65   AAAGFLVVVPDFLKGDPYEPENQDRPLHVWLKDHEPDKGFEDSKPLIEALKSKGISAVGA  124

Query  428  GGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQ  607
             G C GGK  V++AK   ++A VLLHP+FVT+DDI++VK PI+++GAEND T+P E++KQ
Sbjct  125  AGACFGGKVVVEMAKNELIQAAVLLHPSFVTVDDIKEVKAPIAVLGAENDRTSPPELLKQ  184

Query  608  FEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            FE  L +KPEV S VKI++ V+HGW +RYD DD++AVKAAEEAH+D+L+W + H+
Sbjct  185  FEQVLASKPEVKSHVKIYENVSHGWGIRYDPDDESAVKAAEEAHKDMLEWSLIHV  239



>ref|NP_566731.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAK48958.1|AF370531_1 Unknown protein [Arabidopsis thaliana]
 gb|AEE76778.1| dienelactone hydrolase-like protein [Arabidopsis thaliana]
Length=239

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L  + G+G V++LG L+ YV G +HSKLAVLLV  VFGYE  NLRKLA
Sbjct  1    MSGHQCTENPPDLDPTSGSGHVEKLGNLDTYVCGSTHSKLAVLLVPHVFGYETPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY  EN  +P  +W+KDH ++    ++K ++E LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENQDRPFPIWMKDHELEKGFEESKPIVEALKNKGITS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LAK   V+ATVLLHPA VT+DDI++V +PI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVAVELAKEKLVDATVLLHPARVTVDDIKEVNLPIAVLGAEIDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            V+QFE  L +KP+V S VKIF    HGWTVRY+E+D + V+AA EAH+D+L W + +L
Sbjct  181  VRQFEDILASKPQVKSFVKIFPRCKHGWTVRYNENDPSEVEAAMEAHKDMLAWLIDYL  238



>ref|XP_008353277.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=245

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S LAVLL+SD +G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNLAVLLISDXYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  + I VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDAXRXISVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VL HP+ VT+DDI++VKVPIS++GAE D+ +P EV
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKEVKVPISVLGAEIDQMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEV S VKIF  V+HGWTVRY+ +D+AA K+AEEAHQDLL+W + H+
Sbjct  181  VKQFEEVLTAKPEVKSHVKIFPKVSHGWTVRYNVEDEAACKSAEEAHQDLLEWLLNHV  238



>ref|XP_004296954.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=241

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + G+G V++LG L+ Y++G   SKLA++LVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLNPTSGSGHVEKLGGLDSYLTGSPDSKLAIVLVSDIFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DKI  AGF+ VVPDFF+GDPYV   +     +  WLK H  D    D KVVIE LK+ GV
Sbjct  61   DKIAAAGFFAVVPDFFYGDPYVPAADGSLDSLPAWLKGHGADKGFEDVKVVIEALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
              +G  G C G K  V+LAK   ++A VL HP+FVTLDDI+ VKVPISI+GAE D  +P 
Sbjct  121  CAIGAVGFCWGAKVVVELAKGDFIQAAVLAHPSFVTLDDIKAVKVPISILGAEIDRMSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+VKQFE AL AK E+ S VKIF  V+HGWTVRYD  DK AVK AEEAH+D+L WFV H+
Sbjct  181  ELVKQFEEALTAKSEIKSHVKIFPKVSHGWTVRYDVSDKEAVKPAEEAHKDMLDWFVNHV  240



>gb|AAN65058.1| Unknown protein [Arabidopsis thaliana]
Length=239

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L  + G+G V++LG L+ YV G +HSKLAVLLV  VFGYE  NLRKLA
Sbjct  1    MSVHQCTENPPDLDPTSGSGHVEKLGNLDTYVCGSTHSKLAVLLVPHVFGYETPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFY VVPDFFHGDPY  EN  +P  +W+KDH ++    ++K ++E LK  G+T 
Sbjct  61   DKVAEAGFYAVVPDFFHGDPYNPENQDRPFPIWMKDHELEKGFEESKPIVEALKNKGITS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K AV+LAK   V+ATVLLHPA VT+DDI++V +PI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVAVELAKEKLVDATVLLHPARVTVDDIKEVNLPIAVLGAEIDQVSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            V+QFE  L +KP+V S VKIF    HGWTVRY+E+D + V+AA EAH+D+L W + +L
Sbjct  181  VRQFEDILASKPQVKSFVKIFPRCKHGWTVRYNENDPSEVEAAMEAHKDMLAWLIDYL  238



>ref|XP_002524812.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF37655.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 170/239 (71%), Gaps = 1/239 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L S  G G V ++G L  Y +GPS  K +++L+SD+FG+EA NLRKLA
Sbjct  1    MSGSQCCENPPTLSSGSGIGSVTEIGGLKVYATGPSDCKRSIVLISDIFGWEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+GDPYV EN  +P+ +W+K H  D    DAK +I  LK+ GV+ 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPYVPENADRPLPIWIKSHGTDKGFEDAKPIIAALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FVT+DDI+++K PI+I+GAE D  +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKSDPIQAAVLLHPSFVTVDDIKEIKEPIAILGAEIDHLSPPTL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L A+PE++  VKIF GV HGWTVRY  +D+ AV+ AEEAH+D+L WF +++ 
Sbjct  181  LKQFEEVLSARPEINGYVKIFPGVAHGWTVRYKTEDEKAVECAEEAHKDMLDWFAEYVQ  239



>ref|XP_009102600.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Brassica rapa]
Length=239

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL V+L+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVSGSGHVEKLGGLDAYVSGSLDSKLCVILISDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDP+   N  +PI +WLKDH  D    D K VIE +K+ G+T 
Sbjct  61   DKVAASGFYVVVPDYFYGDPFDASNQERPISLWLKDHGADKGFEDTKPVIEAMKSKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K   V+A VLLHP+FVT+DDI+  KVPI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKQELVQAAVLLHPSFVTVDDIKGGKVPIAILGAEIDQLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI   VTHGWTVRY  DD  AVKAAEEAH+++L WFV ++
Sbjct  181  LKQFEEILASKPEVNSYVKIHPKVTHGWTVRYKTDDPEAVKAAEEAHKEMLDWFVTYV  238



>gb|AFK33996.1| unknown [Medicago truncatula]
Length=238

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 172/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + G+G V++LGALN Y++G  +SK +VLLVSDVFGYEA NLRKLA
Sbjct  1    MSGPECCSNPPILNPNAGSGHVEKLGALNAYIAGSPNSKSSVLLVSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG++VVVPDF +G+PY  EN  +P+ +W+KDH  D    DAK +IE +K+ GV+ 
Sbjct  61   DKVAAAGYFVVVPDFLNGEPYNPENPDRPLPIWIKDHGTDKGFEDAKPIIEAIKSKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K   +LAK   ++A VLLHP+FV++DDI+ V +P SI+GAE D  +P E+
Sbjct  121  VGAAGFCWGAKVVTELAKSRLIQAAVLLHPSFVSVDDIKAVDIPYSILGAEIDRLSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK    S VKIF  V+HGWTVRY  +D  AVKAAEEAHQDLL WF KHL
Sbjct  181  VKQFEEILSAK-FAPSFVKIFPKVSHGWTVRYSPEDAEAVKAAEEAHQDLLDWFAKHL  237



>ref|XP_004508363.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cicer arietinum]
Length=237

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 171/238 (72%), Gaps = 3/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP L  S G+G V +L +LN Y++G  +S LAVLLVSD+FGYEA NLRKLA
Sbjct  1    MSGAECCSNPPTLNPSAGSGHVDKLASLNAYITGSPNSNLAVLLVSDIFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AG+YVVVPDFF+GDPY  EN  +P+ VWLKDH  D    DAK +IE +K+ GV+ 
Sbjct  61   DKIAAAGYYVVVPDFFNGDPYNPENPDRPLLVWLKDHGADKGFEDAKSIIEAIKSKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K  V LAK   + A VLLHP+FVT+DDI+ V +PISI+GAE D+ +P E+
Sbjct  121  VGAAGFCWGAKVVVGLAKSRLIPAAVLLHPSFVTVDDIKSVDIPISILGAEIDQISPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK  V S VKIF    HGWTVRY+ DD  AVKAAEEAH+DLL WF KHL
Sbjct  181  VKQFEEVLSAK-SVASFVKIFPK-AHGWTVRYNPDDAEAVKAAEEAHKDLLDWFAKHL  236



>ref|XP_002312740.1| dienelactone hydrolase family protein [Populus trichocarpa]
 gb|EEE90107.1| dienelactone hydrolase family protein [Populus trichocarpa]
Length=240

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 175/239 (73%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C A+PP L  S GAG V+++G L+ YVSG   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MAGPQCCAHPPTLNPSVGAGHVEKVGGLDTYVSGSPDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGFY VVPDFF+GDP+  +N  +PI VWLKDH +     DAK VIE L + GV+ 
Sbjct  61   DKIAAAGFYAVVPDFFYGDPFAPDNAERPIKVWLKDHGMHKGFEDAKPVIEALNSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPC-VEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            +G  G C G K  V+L K    ++A VL HP+FVT+DD ++ KVPISI+GAE D+ +P  
Sbjct  121  IGAVGFCWGAKVVVELGKSSAFIKAAVLCHPSFVTVDDFKEFKVPISILGAETDQLSPPA  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L +K EVDS VKIF  V HGWTVRYD +D+AAVK+AEEAH +LL+WF K++
Sbjct  181  LLKQFEELLASKSEVDSFVKIFPKVAHGWTVRYDVEDEAAVKSAEEAHGNLLEWFAKYV  239



>ref|XP_007223790.1| hypothetical protein PRUPE_ppa010646mg [Prunus persica]
 gb|EMJ24989.1| hypothetical protein PRUPE_ppa010646mg [Prunus persica]
Length=241

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 176/240 (73%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G+G V++ G L+ YV+G   SKLA+LL SD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSNPPTLDPSGGSGHVEKFGGLDTYVTGSPDSKLAILLASDIFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGF+VVVPDFF+GDP+V   +     +  WLKDH  D    ++K V+E LK+ GV
Sbjct  61   DKVAAAGFFVVVPDFFYGDPFVPGDDGSYANLPTWLKDHGPDKAFEESKPVLEVLKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + VG  G C G K  V+L+K   ++A VL HP+FVTLDDI+ VKVPISI+GAE D+ +P 
Sbjct  121  SAVGAAGFCYGAKVVVELSKHDFIQAAVLCHPSFVTLDDIKAVKVPISILGAEIDKMSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            EVVKQFE AL AK E++  VKIF  V HGWTVRY+ +D+AAVKAAEEAHQDLL+WF+ H+
Sbjct  181  EVVKQFEEALTAKSEIECHVKIFPKVAHGWTVRYNVEDEAAVKAAEEAHQDLLEWFLNHV  240



>ref|XP_003550071.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Glycine max]
Length=239

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 168/239 (70%), Gaps = 3/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + GAG V++L  LN Y+SG  +S +A+LL+SD++GYEA NLR +A
Sbjct  1    MSGPECCSNPPVLNPNAGAGHVEKLAGLNSYLSGSPNS-IAILLISDIYGYEAPNLRNIA  59

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFFHGDPY  EN ++ I VWLKDH  D     AK +IE LK+ GV  
Sbjct  60   DKVAAAGYYVVVPDFFHGDPYNPENASRSIPVWLKDHGTDKGSEAAKSIIEALKSKGVMA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FV++DDI+ V  P +++GAE D+ +P E+
Sbjct  120  IGAAGFCWGAKVVVELAKSRLIQAAVLLHPSFVSVDDIKGVDTPTAVLGAEIDKMSPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYded-dkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKP VD  VKIF  V+HGWTVR++    +    AAEEAHQD+L WF KHL
Sbjct  180  VKQFEQVLTAKPGVDCFVKIFPKVSHGWTVRFNPKDAETVKAAAEEAHQDMLNWFAKHL  238



>emb|CDX85115.1| BnaC07g07910D [Brassica napus]
Length=239

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL V+L+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVSGSGHVEKLGGLDAYVSGSLDSKLCVILISDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+G +GFYVVVPD+F+GDP+   N  +PI +W+KDH  D    D K VIE +K  G+T 
Sbjct  61   DKVGASGFYVVVPDYFYGDPFDASNQERPISLWIKDHGADKGFEDTKPVIEAIKTKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K   V+A VLLHP+FVT+DDI+  KVPI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKQELVQADVLLHPSFVTVDDIKGGKVPIAILGAEIDQVSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI+  V HGWTVRY  DD  AVKAAEEAH+++L WFV ++
Sbjct  181  LKQFEEILASKPEVNSYVKIYPKVAHGWTVRYKTDDPDAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_008438728.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Cucumis melo]
Length=239

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S GAG ++QLG L  YVSG   SK A+L ++DV+G+EA  +RKLA
Sbjct  1    MSGPQCCSNPPTLNPSSGAGHIEQLGGLTTYVSGSPDSKRAILFITDVYGFEAPLVRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VV PDFFHGDP+V + A + I VWL+DH  D   +DAK V+E LK  G++ 
Sbjct  61   DKVAAAGFFVVAPDFFHGDPFVPDDANRTISVWLQDHGPDKGFDDAKPVVEALKNKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  GVC G K  V+LAK+  ++A VLLHP+ VT+DDI+ VK  I I+GAE D+ +P E+
Sbjct  121  IGAAGVCWGAKVVVELAKVELIQAAVLLHPSLVTVDDIKGVKAHILILGAEIDQISPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFV  763
            +KQFE  L AKPEVD  VKIF  V+HGWTVRY+ +D  A+K A+EAH+DLL WF 
Sbjct  181  LKQFEEILSAKPEVDGFVKIFSKVSHGWTVRYNVEDAEAIKCADEAHEDLLAWFT  235



>ref|XP_008802649.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Phoenix 
dactylifera]
Length=238

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G  V  LG L  Y +GPS SKLA+LL++DVFGYEA NLRKL
Sbjct  1    MASSQCCENPPTLNPASGQGCVVDDLGGLKAYTAGPSDSKLAILLIADVFGYEAPNLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADK+  AGF+VVVPDFF+GDPYV +  KPI  W++ H  D    DAK+VIE LK  GV+ 
Sbjct  61   ADKVAAAGFFVVVPDFFYGDPYVPD-QKPIMTWIEGHGTDKGFEDAKLVIEALKNKGVSA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   +LAK   ++A V+LHP+FVT+DDI++VK  I+I+GAE D+ +P E+
Sbjct  120  IGAAGFCWGAKVVAELAKFNYIKAAVMLHPSFVTVDDIKEVKCHIAILGAEIDKMSPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L  K EV+S VKIF GV HGWTVRYD  D+ AVK AEEAH+D+ +WF KHL+
Sbjct  180  LKQFEEILSVKSEVNSYVKIFPGVVHGWTVRYDTSDEPAVKKAEEAHRDMFEWFTKHLN  238



>ref|XP_008352794.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Malus 
domestica]
Length=240

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 170/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKL-CSSYGAGQ-VQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS P C +NPP L   SYG     ++LG LN YV+G  +SKLA+LL+S+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNCXEKLGGLNVYVAGSPNSKLAILLISNVFGYRVPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D    DAK +I  LK  GV+
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVYDNNRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K   +LAK   ++A VLLHP+FVTLDDIQ+VKVPI+I GAE D+ +P E
Sbjct  121  AIGAAGFCWGAKVVTELAKSDFIQAAVLLHPSFVTLDDIQEVKVPIAIQGAEIDDYSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE  L AKPEVDS VKIF    H WT+ Y+ +D+ AVK AEEAH++ L WFVKH+
Sbjct  181  LVKQFEQILAAKPEVDSFVKIFPKAEHXWTMSYNVEDEEAVKRAEEAHRNTLAWFVKHV  239



>ref|XP_009362383.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Pyrus 
x bretschneideri]
Length=240

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 170/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKL-CSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS P C +NPP L   SYG     ++LG LN YV G  +SKLA+LLVS+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNSDEKLGGLNVYVVGSPNSKLAILLVSNVFGYRVPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D    DAK +I  LK  GV+
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVHDNDRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  ++LAK   ++A +LLHP+FV LDDIQ+VKVPI+I GAE D+ +P E
Sbjct  121  AIGAAGFCWGAKVVIELAKSDFIQAALLLHPSFVALDDIQEVKVPIAIQGAEIDDYSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE  L AKPEVDS VKIF    HGWT+ Y+ +D+ AVK AEEAH++ L WFVKH+
Sbjct  181  LVKQFEQILAAKPEVDSFVKIFPKAEHGWTMSYNAEDEEAVKRAEEAHRNTLAWFVKHV  239



>gb|KCW60882.1| hypothetical protein EUGRSUZ_H03614 [Eucalyptus grandis]
Length=237

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 170/238 (71%), Gaps = 3/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  + G G V++LG L  YVSG S S LA++LVSDVFGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLNPASGQGHVEELGGLKSYVSGSSDSNLAIVLVSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF GDP+V EN  +PI  WLKDH    +  DAK ++E +K  G + 
Sbjct  61   DKVAAAGFYVVVPDFFGGDPFVRENAERPIMEWLKDHGTVGI-EDAKRIVEAVKGKGASA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A+ LLHP+FV++DDI+ VK PI+I+GAE D  +P E+
Sbjct  120  IGAAGFCWGAKVVVELAKTGAIKASALLHPSFVSVDDIK-VKAPIAILGAEIDRMSPPEL  178

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD+ VKIF  V+HGWTVRYD  D+ AVK AEEAH D+L+WF K +
Sbjct  179  LKQFEEILAAKSEVDAQVKIFPKVSHGWTVRYDVADEEAVKCAEEAHSDMLEWFAKFV  236



>ref|XP_002275597.2| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Vitis vinifera]
Length=245

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 169/239 (71%), Gaps = 3/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YVSGPS SKL +LLVSD+FGYEA NLRKLA
Sbjct  7    MSGPQCCENPPTLTSSSGAGCVAEIGGLKAYVSGPSDSKLVILLVSDLFGYEAPNLRKLA  66

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHA--VDNVCNDAKVVIEDLKAGGVT  415
            DK+  AGFYVVVPDFF+GDP+V      I VW+K H    D    DAK V+ +L++ G+ 
Sbjct  67   DKVAAAGFYVVVPDFFYGDPFVPETMT-IPVWIKKHMEWFDKGFEDAKPVVAELRSKGIN  125

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  V+L+K+  ++A VL HPA VT+DDI+++K P +I+GAE D  +P E
Sbjct  126  AIGAAGFCWGAKVVVELSKVDQIQAAVLFHPARVTVDDIKEIKAPTAILGAETDHVSPPE  185

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L  KPEV+  VKIF GV HGW+VRY  +D+ AVK A+E+HQ+++ WF +++
Sbjct  186  LLKQFEEVLSTKPEVNGYVKIFPGVAHGWSVRYKVEDEEAVKRADESHQNMMDWFAQYV  244



>ref|XP_010527420.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=240

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +2

Query  71   PHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKI  250
            P C  N P L  S G+G+V+++G L+ YVSG   SKL ++L SDVFGYEA NLR LADKI
Sbjct  5    PQCCENRPTLNPSSGSGRVEKIGGLDAYVSGSLDSKLGIVLFSDVFGYEAPNLRNLADKI  64

Query  251  GGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGI  427
              +GF VVVPDF  GDPY  EN  +P+ VW++DH  D    D+K ++E LK+ G+T VG 
Sbjct  65   AASGFLVVVPDFLKGDPYEPENQDRPLHVWMRDHEPDRGFEDSKPLVEALKSKGITAVGA  124

Query  428  GGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQ  607
             G+C GGK  V++AK   ++A VLLHP+FVT+DDI++VK PI+++GAEND T+P E++KQ
Sbjct  125  AGLCFGGKVVVEMAKNELIQAAVLLHPSFVTVDDIKEVKTPIAVLGAENDRTSPPELLKQ  184

Query  608  FEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            FE  L +KPEV S VKI++ V+HGW +RYD DD++AVKAAEEAH+D+L+W + H+
Sbjct  185  FEQVLASKPEVKSHVKIYENVSHGWGIRYDPDDESAVKAAEEAHKDMLEWSLIHV  239



>ref|XP_010512630.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=239

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL  +LVSDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGNVEKLGGLDAYVSGSPDSKLCAILVSDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D    + K ++E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFCGDPYDPSNQERPIQVWIKDHGCDKGFEETKPLLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K+  ++A VLLHP+FVT+DDI+DVK PI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKVELIQAAVLLHPSFVTVDDIKDVKAPIAILGAEIDKLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV S VKIF  V+HGWTVRY+ D+  AVKAA+E+H+++L WFV ++
Sbjct  181  VKQFEEILASKPEVYSYVKIFPKVSHGWTVRYNIDEPEAVKAADESHKEMLDWFVTYV  238



>emb|CBI32342.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 169/239 (71%), Gaps = 3/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS GAG V ++G L  YVSGPS SKL +LLVSD+FGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLTSSSGAGCVAEIGGLKAYVSGPSDSKLVILLVSDLFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHA--VDNVCNDAKVVIEDLKAGGVT  415
            DK+  AGFYVVVPDFF+GDP+V      I VW+K H    D    DAK V+ +L++ G+ 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVPETMT-IPVWIKKHMEWFDKGFEDAKPVVAELRSKGIN  119

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  V+L+K+  ++A VL HPA VT+DDI+++K P +I+GAE D  +P E
Sbjct  120  AIGAAGFCWGAKVVVELSKVDQIQAAVLFHPARVTVDDIKEIKAPTAILGAETDHVSPPE  179

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L  KPEV+  VKIF GV HGW+VRY  +D+ AVK A+E+HQ+++ WF +++
Sbjct  180  LLKQFEEVLSTKPEVNGYVKIFPGVAHGWSVRYKVEDEEAVKRADESHQNMMDWFAQYV  238



>gb|ACJ85031.1| unknown [Medicago truncatula]
Length=238

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 171/238 (72%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + G+G V++LGALN Y++G  +SK +VLLVSDVFGYEA NLRKLA
Sbjct  1    MSGPECCSNPPILNPNAGSGHVEKLGALNAYIAGSPNSKSSVLLVSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG++VVVPDF +G+PY  EN  +P+ +W+KDH  D    DAK +IE +K+ GV+ 
Sbjct  61   DKVAAAGYFVVVPDFLNGEPYNPENPDRPLPIWIKDHGTDKGFEDAKPIIEAIKSKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K   +LAK   ++A VLLHP+FV++DDI+ V +P SI+GAE D  +P E+
Sbjct  121  VGAAGFCWGAKVVTELAKSRLIQAAVLLHPSFVSVDDIKAVDIPYSILGAEIDRLSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK    S VKIF  V+HGWTVRY  +D  AVKAAEEAHQDLL W  KHL
Sbjct  181  VKQFEEILSAK-SAPSFVKIFPKVSHGWTVRYSPEDAEAVKAAEEAHQDLLDWVAKHL  237



>emb|CDX77495.1| BnaA07g06330D [Brassica napus]
Length=239

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL V+L+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVCGSGHVEKLGGLDAYVSGSLDSKLCVILISDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDP+   N  +PI +WLKDH  D    D K VIE +K+ G+T 
Sbjct  61   DKVAASGFYVVVPDYFYGDPFDASNQERPISLWLKDHGADKGFEDTKPVIEAIKSKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L K   V+A VLLHP+FVT+DDI+  KVPI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWGAKVVVELCKQELVQAAVLLHPSFVTVDDIKGGKVPIAILGAEIDQLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI   VTHGWTVRY  DD  AVKAAEEAH+++L WFV ++
Sbjct  181  LKQFEEILASKPEVNSYVKIHPKVTHGWTVRYKTDDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_010466702.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=250

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 175/249 (70%), Gaps = 12/249 (5%)
 Frame = +2

Query  62   MSSPH--CIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR-  232
            MS  H  C  NPP L  + G+G V++LG L+ YVSG +HSKLAVLLVS VFGYE  NLR 
Sbjct  1    MSGHHHQCTENPPNLDPNSGSGHVEKLGNLDTYVSGSTHSKLAVLLVSHVFGYETPNLRF  60

Query  233  --------KLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVV  385
                    KLADK+  AGFY VVPDFFHGDPY  EN  +P+ +W+KDH  +    ++K +
Sbjct  61   QNLYLISLKLADKVAEAGFYAVVPDFFHGDPYNPENQDRPLPIWIKDHGQEKGFEESKPI  120

Query  386  IEDLKAGGVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIG  565
            +E LK  G+T +G  G C G K AV+LAK   V+ATVLLHP+ VT+DDI+ V +PI+++G
Sbjct  121  VEALKNKGITSIGAAGFCWGAKVAVELAKQKLVDATVLLHPSRVTVDDIKGVNIPIAVLG  180

Query  566  AENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQD  745
            AE D+ +P E+V+QFE  L +KPEV S VKIF  V HGWTVRY+E+D + V+AAEEAH+D
Sbjct  181  AELDQVSPPELVRQFEDVLASKPEVKSFVKIFPSVKHGWTVRYNENDPSEVEAAEEAHKD  240

Query  746  LLKWFVKHL  772
            +L W   H+
Sbjct  241  MLAWLTNHV  249



>ref|XP_010035774.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW84300.1| hypothetical protein EUGRSUZ_B01151 [Eucalyptus grandis]
Length=236

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 168/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  S GAG V+Q+G L+ YV G   SKLA++L+SD+FGYEA N RKLA
Sbjct  1    MSGPQCCANPPTLDPSNGAGHVEQVGGLDAYVVGSLDSKLAIILLSDIFGYEAPNFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVV PD+F+GD Y  EN  +PI VW+KDH V++  +D   VIE LK+ G++K
Sbjct  61   DKVASAGFYVVAPDYFYGDAYDPENAERPILVWVKDHGVESGYDDTLPVIEALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V+L K   ++A V+LHPA VT DDI+ VKVPI+++GAE DE    E+
Sbjct  121  IGAAGFCWGGKGVVELNKRELIQAGVILHPALVTTDDIKGVKVPIAVLGAEVDENASPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AKPEVD  VK++   THGWTVRY         AAEEAH D+++WFVK++
Sbjct  181  LKQFEEVLAAKPEVDGFVKVYPRTTHGWTVRY---KDEEKAAAEEAHVDMVQWFVKYV  235



>ref|XP_008223023.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=241

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 175/240 (73%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +N P L  S G+G V++ G L+ YV+G   SKLA+LL SD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSNAPTLNPSSGSGHVEKFGGLDTYVTGSPDSKLAILLASDIFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGF+VVVPDFF+GDP+V   +     +  WLKDH  D    ++K V+E LK+ GV
Sbjct  61   DKVAAAGFFVVVPDFFYGDPFVPGDDGSYANLPTWLKDHGPDKAFEESKPVLEVLKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + VG  G C G K  V+L+K   ++A VL HP+FVTLDDI+ VKVPISI+GAE D+ +P 
Sbjct  121  SAVGAAGFCYGAKVVVELSKHDFIQAAVLCHPSFVTLDDIKAVKVPISILGAEIDKMSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            EVVKQFE AL AK E++  VKIF  V HGWTVRY+ +D+AAVKAAEEAHQDLL+WF+ H+
Sbjct  181  EVVKQFEEALTAKSEIECHVKIFPKVAHGWTVRYNVEDEAAVKAAEEAHQDLLEWFLNHV  240



>ref|XP_010466706.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Camelina sativa]
Length=241

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL V+LVSDV+GYEA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGNVEKLGGLDAYVSGSPDSKLCVILVSDVYGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D    + K ++E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFCGDPYDPSNQERPIQVWIKDHGCDKGFEETKPLLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K+  ++A VLLHP+FVT+DDI+ VK PI+I+GAE D  +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKVELIQAAVLLHPSFVTVDDIKVVKAPIAILGAEFDNLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE +L +KPEV S VKIF  V+HGWTVRY  D+  AVKAA+EAH+++L WFV +L
Sbjct  181  VKQFEESLASKPEVYSYVKIFPKVSHGWTVRYKIDEPEAVKAADEAHKEMLDWFVTYL  238



>gb|EPS69745.1| hypothetical protein M569_05020 [Genlisea aurea]
Length=238

 Score =   253 bits (645),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSS-YGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+   C  NPP+L +    AG V++ G L+ YVSGP+ S  AVLLVSDVFGYEA NLRKL
Sbjct  1    MAGAQCCENPPELIAGGSAAGSVEEFGGLSSYVSGPADSGFAVLLVSDVFGYEAPNLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADKIG AGF+ VVPD F GDP+    +  +G W+K H  D    DAK V+E LKA GV K
Sbjct  61   ADKIGDAGFFAVVPDLFRGDPFAPEKSG-LGDWIKGHGTDKGFEDAKPVVEALKAKGVAK  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VLLHP+FVTL+DI  VKVPISI+GAE D+ +P E+
Sbjct  120  IGAAGFCWGAKVVVELSKEAHIQAAVLLHPSFVTLEDIHGVKVPISILGAEIDKASPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            + QFE AL++K EVDS VKIF GV HGW++RYD  D  AVK AEEAH DLL+W  KHL+
Sbjct  180  LIQFEAALKSKAEVDSFVKIFPGVGHGWSIRYDVSDAEAVKRAEEAHADLLQWLHKHLN  238



>ref|XP_011010276.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Populus euphratica]
Length=240

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C ANPP L  S GAG V+++G L+ YVSG   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MAGPQCCANPPILNPSSGAGYVEKVGGLDSYVSGSPDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGFY VVPDFF+GDP+  +N  +PI VWLKDH       DAK VIE L + GV+ 
Sbjct  61   DKIAAAGFYAVVPDFFYGDPFAPDNAERPIKVWLKDHGTHKGLEDAKPVIEALNSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPC-VEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            +G  G C G K  V+L K    ++A VL HP+FVT DD ++ KVPISI+GAE D  +P  
Sbjct  121  IGAVGFCWGAKVVVELGKSSAFIKAAVLCHPSFVTADDFKEFKVPISILGAETDHLSPPA  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L +K EVDS VKIF  V HGWTVRYD +D+AAVK+AEEAH +LL+W  K++
Sbjct  181  LLKQFEEVLASKSEVDSFVKIFPKVAHGWTVRYDVEDEAAVKSAEEAHGNLLEWLAKYV  239



>ref|XP_008223022.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Prunus 
mume]
Length=245

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP +  S G+G V++LG L+ YV+G   SKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGLQCCSNPPTINPSSGSGHVEKLGGLDSYVTGFPDSKLAILLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF +GDPY  E+  +P+ VW+KDH       DAK V+  L+  G + 
Sbjct  61   DKVAAAGFFVVVPDFLYGDPYAPEDANRPLPVWIKDHGPAKGFEDAKPVLGALRRKGFSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C GGK  V+LAK   ++A VL HP+FVT+DDI+ VKVPISI+GAE D  +P EV
Sbjct  121  VGAAGFCWGGKVVVELAKHNFIQAAVLCHPSFVTVDDIKAVKVPISILGAEIDHMSPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK EV S VKIF  V HGWTVRY+ +D+AAVK AEEAHQ+LL+WF+ H+
Sbjct  181  VKQFEEVLTAKSEVKSHVKIFPKVAHGWTVRYNVEDEAAVKCAEEAHQNLLEWFLNHV  238



>ref|XP_010527419.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=240

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 172/234 (74%), Gaps = 1/234 (0%)
 Frame = +2

Query  74   HCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIG  253
             C  N P L  S G+G+V++LG L+ YVSG   SKL ++L SDVFGYEA NLR LADKI 
Sbjct  6    QCCENRPTLNPSSGSGRVEKLGGLDAYVSGSPDSKLGIVLFSDVFGYEAPNLRNLADKIA  65

Query  254  GAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIG  430
             AGF VVVPDF  GDPY  EN  +P+ VWLKDH  D    D+K +IE LK+ G+T VG  
Sbjct  66   AAGFLVVVPDFLKGDPYEPENQDRPLHVWLKDHEPDKGFEDSKPLIEALKSKGITAVGAA  125

Query  431  GVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQF  610
            G C GGK  V++AK   ++A VLLHP+FVT+DDI++ K PI+++GAEND T+P E++KQF
Sbjct  126  GACFGGKVVVEMAKNELIQAAVLLHPSFVTVDDIKEFKAPIAVLGAENDRTSPPELLKQF  185

Query  611  EIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E  L  KPEV S VKI++ V+HGW +RYD DD++AVKAAEEAH+D+L+W + H+
Sbjct  186  EQVLAFKPEVKSHVKIYENVSHGWGIRYDPDDESAVKAAEEAHKDMLEWSLIHV  239



>ref|XP_010488433.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Camelina sativa]
Length=239

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL V+LVSDV+GYEA NLR LA
Sbjct  1    MSGPQCCENPPTLDPVSGSGNVEKLGGLDAYVSGSPDSKLCVILVSDVYGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F GDP+   N  +PI VW+KDH  D    + K ++E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFCGDPFDPSNQERPIQVWIKDHGCDKGFEETKPLLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K+  ++A VLLHP+FVT+DDI+DVK PI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKVELIQAAVLLHPSFVTVDDIKDVKAPIAILGAEIDKLSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV S VKIF  V+HGWTVRY+ ++  AVKAA+EAH+++L WFV ++
Sbjct  181  VKQFEEILASKPEVYSYVKIFPKVSHGWTVRYNINEPEAVKAADEAHKEMLDWFVTYV  238



>gb|KFK39658.1| hypothetical protein AALP_AA3G272500 [Arabis alpina]
Length=239

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L S  G+G V++LG L+ YVSG   SKL VLL+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNSGSGSGHVEKLGGLDAYVSGSPDSKLCVLLISDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDPY   N  + I VW+KDH  D    D K V+E +K+ G+T 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYDPSNQERSITVWIKDHGADKGFEDTKPVLEAIKSKGITG  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K   ++A VL+HP+FVT+DDI+  KVPI+I+GAE D  +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKQELIQAAVLMHPSFVTVDDIKSGKVPIAILGAEIDNMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI   V+HGWTVRY  DD  AVKAAEEAH+++L WFV ++
Sbjct  181  LKQFEEILASKPEVNSYVKIHPKVSHGWTVRYSTDDAEAVKAAEEAHKEMLDWFVTYV  238



>emb|CAN80740.1| hypothetical protein VITISV_016685 [Vitis vinifera]
Length=251

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 172/250 (69%), Gaps = 13/250 (5%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNL----  229
            MS P C  +PP L  + G+G V+QLG L+CY++G  HSKLA+LLVSD++GY         
Sbjct  1    MSGPQCCEHPPSLNPNSGSGHVEQLGGLSCYIAGSPHSKLAILLVSDIYGYNTNCFSCMA  60

Query  230  --------RKLADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKV  382
                    +KLADK+  AGFYVV PDF +GDPYV + A +P+ VW+KDH +D    D K 
Sbjct  61   SKPDIMKNKKLADKVAAAGFYVVAPDFLYGDPYVPDKAERPLPVWIKDHGMDKGFEDTKP  120

Query  383  VIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISII  562
            VIE LK+ GV+ +G  G C G K  V+LAK   ++A VLLHP+FV+LDDI+ VKVP +++
Sbjct  121  VIEALKSKGVSAIGAAGFCWGAKVVVELAKSGYIQAAVLLHPSFVSLDDIKGVKVPTAVL  180

Query  563  GAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQ  742
            GAE D+ +P  +VKQFE  L AKP VD  VKIF GV HGWTVRY+ +D  AVK AEEAHQ
Sbjct  181  GAEIDQMSPPALVKQFEEILTAKPGVDGFVKIFPGVAHGWTVRYNAEDAGAVKCAEEAHQ  240

Query  743  DLLKWFVKHL  772
            D+L WF K++
Sbjct  241  DMLGWFSKYV  250



>ref|XP_010909270.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Elaeis guineensis]
Length=238

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G  V  LG L  Y +GPS SKLA+LL +D FGYEA NLRKL
Sbjct  1    MASSQCYENPPTLNPASGQGCVVDDLGGLKAYTAGPSDSKLAILLAADAFGYEAPNLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADK+  AGF+VVVPDFFHGDPYV +  KP+  W++ H  D    DAK+VIE LK  GV+ 
Sbjct  61   ADKVAAAGFFVVVPDFFHGDPYVPD-QKPVKTWIESHEKDKGFEDAKLVIEALKNKGVSA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G +   +LAK   +++ V+LHP+FVT+DDI++VK  I+I GAE D+T+P E+
Sbjct  120  IGAAGFCWGAQVVAELAKSGYIKSAVMLHPSFVTVDDIKEVKCHIAIFGAEIDKTSPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L  K EV+S VKIF GV HGWT+RYD  D+ AVK AEEAHQ +L+WF KHL
Sbjct  180  LKQFEEILSLKSEVNSYVKIFPGVAHGWTMRYDTSDETAVKKAEEAHQGMLEWFAKHL  237



>gb|KCW84308.1| hypothetical protein EUGRSUZ_B01156 [Eucalyptus grandis]
Length=230

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 167/238 (70%), Gaps = 10/238 (4%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L    G+G V+QLG L  YV G   SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGPQCCANPPTLSPGSGSGHVEQLGGLKAYVVGSQDSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F GDPY  EN  +PIGVW+KDH  D    + K +I+ LK+ G++K
Sbjct  61   DKVAAAGYYVVVPDYFKGDPYAPENAERPIGVWIKDHGADKGFEETKPIIQALKSKGISK  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FVT+DDI+         GAE D+ +P  +
Sbjct  121  IGAAGFCWGAKVVVELAKCELIQAAVLLHPSFVTVDDIK---------GAEIDQMSPPAL  171

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AK EVD  VKIF  V+HGWT+RY  +D+AAVK AEEAH D+++WFVK +
Sbjct  172  LKQFEEVLAAKSEVDGFVKIFPKVSHGWTMRYKVEDEAAVKCAEEAHLDMIQWFVKFV  229



>ref|XP_006361507.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X4 [Solanum 
tuberosum]
Length=254

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 166/237 (70%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V QLG+ N YVSGPS SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H       DAK V+  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +L+K   ++A VLLHP+ V +DD ++VKVPI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L +KPEVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_006361509.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X6 [Solanum 
tuberosum]
Length=236

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 166/237 (70%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V QLG+ N YVSGPS SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H       DAK V+  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +L+K   ++A VLLHP+ V +DD ++VKVPI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L +KPEVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_006361508.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X5 [Solanum 
tuberosum]
Length=251

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V QLG+ N YVSGPS SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H       DAK V+  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +L+K   ++A VLLHP+ V +DD ++VKVPI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            KQFE  L +KPEVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K+
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKY  234



>ref|XP_002275501.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase [Vitis vinifera]
 emb|CAN67688.1| hypothetical protein VITISV_036609 [Vitis vinifera]
Length=239

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L S  G G V ++G L  YV+GPS SK A+LLVSD+FGYEA   RKLA
Sbjct  1    MSDSQCCENPPNLTSICGGGSVIEVGGLKAYVAGPSDSKHAILLVSDIFGYEAPKFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVEN-GAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+GDP+V +   KPI VW + H  D    DAK VI  LK+ G++ 
Sbjct  61   DKVAAAGFYVVVPDFFYGDPFVFDIPEKPIEVWRESHGTDKGFEDAKPVIAALKSKGIST  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   +++ VLLHP+ VT+DDI++VK PI+++GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVVVELAKSDYIQSAVLLHPSRVTVDDIKEVKAPIAVLGAEIDKASPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L  KPEV+S VKIF GV HGW+VRY ++++  VK+AEEAHQ+++ WF +++
Sbjct  181  LKQFEEVLSTKPEVNSYVKIFPGVVHGWSVRYKDENEIEVKSAEEAHQNMVDWFTRYV  238



>ref|XP_008367180.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=240

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G V++LG L+ Y+ G   SK+AVLLVSDVFGY+A NLRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKLGGLDTYLVGSPDSKVAVLLVSDVFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+   GF+VV+PDFF+GDP+V  E G      W+K H  D    DAK ++E LK+ G++
Sbjct  61   DKLAAGGFFVVIPDFFYGDPFVLGEEGFAAFPGWIKHHGTDKALEDAKPILEALKSKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+L+K   ++A  + HP+FVTLDDI+ VKVP  I+GAE D  +P E
Sbjct  121  AVGAVGFCYGAKVVVELSKHDFIQAAAMCHPSFVTLDDIKAVKVPTQILGAEIDNMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE AL AKPE+ S VKIF  V HGWT RY+++D+AA KAAEEAHQDLL+WF+ H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWFLNHV  239



>ref|XP_010532702.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=239

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 174/240 (73%), Gaps = 5/240 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  + G G+V++ G L+ Y++G  +S   +LLVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCENPPTLDPNSGLGRVEKFGGLDTYITGSPNSNRGILLVSDIFGYQAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAK---PIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGFYVVVPDFF+GDPY  NG +   PI VWLK+H       D+K VIE LK  G+
Sbjct  61   DKVAAAGFYVVVPDFFYGDPY--NGVEDYGPIAVWLKNHGPLKGFEDSKPVIEALKCKGI  118

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            T +G  G+C G K  V+L K   ++A V LHP+FVT+DDI+DVKVP++I+GAE D  +P 
Sbjct  119  TAIGAAGMCWGAKVVVELDKTELIQAGVFLHPSFVTVDDIKDVKVPLAILGAELDHVSPP  178

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             ++KQFE  L +KPEV S VKIF GV+HGW+VRYD +D AAVKAAEE+H+++L WF+ ++
Sbjct  179  ALLKQFEEVLASKPEVKSYVKIFPGVSHGWSVRYDTNDPAAVKAAEESHKEMLDWFITYV  238



>gb|KHN03434.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=240

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 168/240 (70%), Gaps = 4/240 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + GAG V++L  LN Y+SG  +S +A+LL+SD++GYEA NLR +A
Sbjct  1    MSGPECCSNPPVLNPNAGAGHVEKLAGLNSYLSGSPNS-IAILLISDIYGYEAPNLRNIA  59

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFFHGDPY  EN ++ I VWLKDH  D     AK +IE LK+ GV  
Sbjct  60   DKVAAAGYYVVVPDFFHGDPYNPENASRSIPVWLKDHGTDKGSEAAKSIIEALKSKGVMA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FV++DDI+ V  P +++GAE D+ +P E+
Sbjct  120  IGAAGFCWGAKVVVELAKSRLIQAAVLLHPSFVSVDDIKGVDTPTAVLGAEIDKMSPPEL  179

Query  599  VKQFEIALQAKPE-VDSLVKIFDGVTHGWTVRYded-dkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKP  VD  VKIF  V+HGWTVR++    +    AAEEAHQD+L WF KHL
Sbjct  180  VKQFEQVLTAKPGVVDCFVKIFPKVSHGWTVRFNPKDAETVKAAAEEAHQDMLNWFAKHL  239



>gb|AFK41285.1| unknown [Lotus japonicus]
Length=239

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 165/238 (69%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + GAG V ++  +N Y SG SHS LAVLL+SDVFGYEA NLR LA
Sbjct  1    MSGPECCSNPPTLNPTGGAGHVDKIAGVNAYFSGSSHSNLAVLLLSDVFGYEAPNLRNLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD   G+P  + N  +P   W+KDH  D    D K +IE LK+ GV+ 
Sbjct  61   DKVAAAGYYVVVPDLLKGEPLDLGNPDRPFPAWIKDHGPDKGFEDTKPIIEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP+FV+LDDI+ V +PIS++ AE D  +P E+
Sbjct  121  IGAVGFCWGAKVVVELAKSRLIQAAVLLHPSFVSLDDIKGVDIPISVLAAEIDTISPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK +V S VKIF  V+HGW+VRY+ +D  AVK AEEAHQDLL WF KHL
Sbjct  181  VKQFEQVLAAKSQVASFVKIFPKVSHGWSVRYNLEDTEAVKEAEEAHQDLLDWFAKHL  238



>ref|XP_008340899.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
 ref|XP_008361979.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=237

 Score =   249 bits (637),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 174/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G+G V++LG  + YV+G   SKLAVLLV D FGYEA   R LA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSKLAVLLVHDAFGYEAPKARMLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGF VV+PDFF+ DP+  + A  I VW+K HA D    DAK+VIE LK+ GV+ +
Sbjct  61   DKIAAAGFIVVLPDFFNRDPFNGDLAS-IPVWIKAHAPDKTIEDAKLVIEALKSXGVSAI  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C GGK  V+LAK   ++A VL HP+FVTLDDI+ VKVPIS++GAE D+ TP EVV
Sbjct  120  GAVGFCWGGKGVVELAKHDFIQAAVLCHPSFVTLDDIKAVKVPISVLGAEIDQLTPPEVV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L AKPE+ S VKIF  + HGWT+RY+++D+AAVKAAEEAHQDLL WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKIAHGWTLRYNDEDEAAVKAAEEAHQDLLGWFLEHI  236



>ref|XP_010938744.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Elaeis guineensis]
Length=238

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G  V  LG L  Y  GP   K AVLLVSDVFGYEA NLRKL
Sbjct  1    MASSQCCENPPTLNPASGQGCVVDDLGGLKAYTVGPPACKTAVLLVSDVFGYEAPNLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADK+  AGF+VVVPDFF GDPYV +  KP+ +WL  H  D    DAK+VIE LK  GV+ 
Sbjct  61   ADKVAAAGFFVVVPDFFRGDPYVPD-KKPLDIWLASHGTDKGFEDAKLVIEALKNKGVST  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K   DLAK   ++A V+LHP+FVT+DDI+ VK  ++I+GAE D+ +P E+
Sbjct  120  VGAAGFCWGAKVVADLAKYDYIKAAVMLHPSFVTVDDIKLVKCHLAILGAEIDKMSPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L  K EV+S VKIF GV HGWTVRYD  D+ AVK AEE+HQD+L+WF KHL+
Sbjct  180  LKQFEEILSLKSEVNSYVKIFPGVVHGWTVRYDTGDETAVKKAEESHQDMLEWFAKHLN  238



>ref|XP_011071533.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=240

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 169/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  68   SPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADK  247
            S  C +NPP L    GAG+VQ+LG L CY+SG + SK++++L+SD+FGYEA  LRKLADK
Sbjct  4    SDQCCSNPPTLIPDCGAGEVQELGGLTCYISGSADSKISIILISDIFGYEAPKLRKLADK  63

Query  248  IGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVG  424
            +  AGFY VVPD+F GDP   E   +    W+K+H       D K +IE LK+ G+TK+G
Sbjct  64   VAAAGFYTVVPDYFRGDPCDAERFHQVFPGWIKNHCPTQGSKDTKPLIEALKSKGITKIG  123

Query  425  IGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVK  604
              G C G K  V+LAK   ++A VL+HP+ V+L+DIQ VKVPISI+GAE+D  +P E+VK
Sbjct  124  AAGFCWGAKVVVELAKEGYIQAGVLIHPSLVSLEDIQGVKVPISILGAEHDHASPPELVK  183

Query  605  QFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            QFE AL AKPEVD+ VKIF GV+HGW +R  +DD  AV +AEEAH D+L WFVK+L
Sbjct  184  QFETALNAKPEVDAFVKIFPGVSHGWAIRCSDDDDHAVNSAEEAHGDMLDWFVKYL  239



>ref|XP_006361504.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
tuberosum]
Length=300

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V QLG+ N YVSGPS SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H       DAK V+  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +L+K   ++A VLLHP+ V +DD ++VKVPI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            KQFE  L +KPEVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K+++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYVN  236



>ref|XP_006361506.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X3 [Solanum 
tuberosum]
Length=295

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V QLG+ N YVSGPS SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H       DAK V+  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +L+K   ++A VLLHP+ V +DD ++VKVPI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            KQFE  L +KPEVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K+++
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYVN  236



>emb|CBI32341.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L S  G G V ++G L  YV+GPS SK A+LLVSD+FGYEA   RKLA
Sbjct  19   MSDSQCCENPPNLTSICGGGSVIEVGGLKAYVAGPSDSKHAILLVSDIFGYEAPKFRKLA  78

Query  242  DKIGGAGFYVVVPDFFHGDPYVEN-GAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+GDP+V +   KPI VW + H  D    DAK VI  LK+ G++ 
Sbjct  79   DKVAAAGFYVVVPDFFYGDPFVFDIPEKPIEVWRESHGTDKGFEDAKPVIAALKSKGIST  138

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   +++ VLLHP+ VT+DDI++VK PI+++GAE D+ +P E+
Sbjct  139  IGAAGFCWGAKVVVELAKSDYIQSAVLLHPSRVTVDDIKEVKAPIAVLGAEIDKASPPEL  198

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L  KPEV+S VKIF GV HGW+VRY ++++  VK+AEEAHQ+++ WF +++
Sbjct  199  LKQFEEVLSTKPEVNSYVKIFPGVVHGWSVRYKDENEIEVKSAEEAHQNMVDWFTRYV  256



>ref|XP_008219062.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=238

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 166/237 (70%), Gaps = 0/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C +NPP L  SYG    ++LG LN Y +G   SKLA++LVSDVFGY A NLRKLA
Sbjct  1    MAGPQCCSNPPILNPSYGVDCAEKLGGLNVYAAGSPDSKLAIVLVSDVFGYRAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            +K+  AGF+VVVP+FF+ DP+V +  +P+ VWL+DH  D    DAK +I  LK  G + +
Sbjct  61   EKVAAAGFFVVVPNFFYDDPFVYDNNRPLAVWLEDHGTDKGFEDAKSIINALKEKGYSAI  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C GGK   +LAK   V+A VLLHP+FV LDDI+ VKVP++++GAE DE +P E++
Sbjct  121  GAAGFCWGGKVVTELAKSDFVQAAVLLHPSFVALDDIEGVKVPMAVLGAEIDEYSPLELL  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L AK  +DS VKIF    H WTVRY+ +D+ AVK AEEAH +++ WF KH+
Sbjct  181  KQFEEILAAKSGIDSYVKIFPKAEHSWTVRYNVEDEEAVKRAEEAHNNMIDWFSKHV  237



>ref|XP_009365787.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 170/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G V++L  L+ Y+ G   SK+AVLLVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKLSGLDTYLVGSPDSKVAVLLVSDIFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+   GF+VVVPDFF+GDP+V  E G      W+K H  D    DAK V+E LK+ G++
Sbjct  61   DKLAAGGFFVVVPDFFYGDPFVLGEEGFAAFPGWIKHHGTDKALEDAKPVLEALKSKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+L+K   ++A  + HP+FVTLDDI+ VKVP  I+GAE D  +P E
Sbjct  121  AVGAVGFCYGAKVVVELSKHDFIQAAAMCHPSFVTLDDIKAVKVPTQILGAEIDHMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE AL AKPE+ S VKIF  V HGWT RY+++D+AA KAAEEAHQDLL+WF+ H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWFLNHV  239



>gb|EYU38136.1| hypothetical protein MIMGU_mgv1a012773mg [Erythranthe guttata]
Length=240

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ANPP L  + G G V + G L  YVSGPS SKLAVLL SDVFGYEA  LRK+A
Sbjct  1    MSGPQCCANPPTLSPNSGVGSVIEFGGLKSYVSGPSDSKLAVLLASDVFGYEAPELRKIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AG+YVVVPDFF+GDP   +N  K + VWL  H       +AK+VI+ LK+ G+T 
Sbjct  61   DKIAAAGYYVVVPDFFNGDPLDPDNVEKLLPVWLSLHEPAKAYEEAKLVIDALKSKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            +G  G C G K  V+LAK    ++A VLLHP+FVTLDD+++VK P++I+GAE D+ TP E
Sbjct  121  IGAAGFCYGAKVVVELAKSSDLIQAGVLLHPSFVTLDDVKEVKAPLAILGAEMDQYTPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VKQFE  L +  EV+S VKIF GV HGWTVRYD DD+ AVK+AEEA QD L W +K +
Sbjct  181  LVKQFEEILSSNSEVESFVKIFPGVAHGWTVRYDLDDEMAVKSAEEAQQDTLDWIMKFV  239



>ref|XP_009339923.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=237

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 173/237 (73%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G+G V++LG  + YV+G   SKLAVLLV D FGYEA   R LA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPESKLAVLLVHDAFGYEAPKARMLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGF VV+PDFF+ DP+  + A  + VW+K HA D    DAK+VIE LK+ GV+ V
Sbjct  61   DKIAAAGFIVVLPDFFNRDPFNGDLAS-LPVWIKAHAPDKTIEDAKLVIEALKSKGVSAV  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C GGK  V+LAK   ++A VL HP+FVTLDDI+ VKVPIS++GAE D+ TP EVV
Sbjct  120  GAVGFCWGGKGVVELAKHDFIQAAVLCHPSFVTLDDIKAVKVPISVLGAEIDQLTPPEVV  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L AKPE+ S VKIF  + HGWT+RY+++D+AAVK AEEAHQDLL WF++++
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKLVHGWTLRYNDEDEAAVKVAEEAHQDLLGWFLENI  236



>ref|XP_009352128.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G V++L  L+ Y+ G   SK+AVLLVSD+FGY+A NLRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKLSGLDTYLVGSPDSKVAVLLVSDIFGYDAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+   GF+VVVPDFF+GDP+V  E G   +  W+K H  D    DAK V+E +K+ G++
Sbjct  61   DKLAAGGFFVVVPDFFYGDPFVLGEEGFAALPGWIKHHGTDKALEDAKQVLEAVKSKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+L+K   ++A  + HP+FVTLDDI+ VKVP  I+GAE D  +P E
Sbjct  121  AVGAVGFCYGAKVVVELSKHDFIQAAAMCHPSFVTLDDIKAVKVPTQILGAEIDNMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE AL AKPE+ S VKIF  V HGWT RY+++D+AA KAAEEAHQDLL+WF+ H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWFLNHV  239



>ref|XP_008223021.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Prunus 
mume]
Length=246

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 173/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP +  S G+G V++LG L+ YV+G   SKLA+LLVSD+FG+EA NLRKLA
Sbjct  1    MSGLQCCSNPPTINPSSGSGHVEKLGGLDSYVTGFPDSKLAILLVSDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF +GDPY  E+  +P+ VW+KDH       DAK V+  L+  G + 
Sbjct  61   DKVAAAGFFVVVPDFLYGDPYAPEDANRPLPVWIKDHGPAKGFEDAKPVLGALRRKGFSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C GGK  V+LAK   ++A VL HP+FVT+DDI+ VKVPISI+GAE D  +P EV
Sbjct  121  VGAAGFCWGGKVVVELAKHNFIQAAVLCHPSFVTVDDIKAVKVPISILGAEIDHMSPPEV  180

Query  599  VKQFEIALQAKPE-VDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK E V S VKIF  V HGWTVRY+ +D+AAVK AEEAHQ+LL+WF+ H+
Sbjct  181  VKQFEEVLTAKSEVVKSHVKIFPKVAHGWTVRYNVEDEAAVKCAEEAHQNLLEWFLNHV  239



>gb|KFK39657.1| hypothetical protein AALP_AA3G272500 [Arabis alpina]
Length=240

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 172/239 (72%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L S  G+G V++LG L+ YVSG   SKL VLL+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNSGSGSGHVEKLGGLDAYVSGSPDSKLCVLLISDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDH-AVDNVCNDAKVVIEDLKAGGVT  415
            DK+  +GFYVVVPD+F+GDPY   N  + I VW+KDH A D    D K V+E +K+ G+T
Sbjct  61   DKVAASGFYVVVPDYFYGDPYDPSNQERSITVWIKDHGAQDKGFEDTKPVLEAIKSKGIT  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G+C G K  V+L+K   ++A VL+HP+FVT+DDI+  KVPI+I+GAE D  +P  
Sbjct  121  GIGAAGMCWGAKVVVELSKQELIQAAVLMHPSFVTVDDIKSGKVPIAILGAEIDNMSPPA  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L +KPEV+S VKI   V+HGWTVRY  DD  AVKAAEEAH+++L WFV ++
Sbjct  181  LLKQFEEILASKPEVNSYVKIHPKVSHGWTVRYSTDDAEAVKAAEEAHKEMLDWFVTYV  239



>ref|XP_008802648.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Phoenix dactylifera]
Length=238

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 168/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G  V  LG L  Y +GPS SKLA+LL+SDVFGYEA NLRKL
Sbjct  1    MASSQCCENPPTLNPAGGQGCVVDDLGGLKAYTAGPSDSKLAILLISDVFGYEAPNLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADK+  AGF+VVVPDFF+GDPYV +  KPI  W+  H  D    DAK+VIE LK  GV+ 
Sbjct  61   ADKVAAAGFFVVVPDFFYGDPYVPD-QKPITTWIGSHGTDKGFEDAKLVIEALKNKGVSA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   +L K   ++A V+LHP+ VT+DDI++VK  I+I+GAE D+ +P E+
Sbjct  120  IGAAGFCWGAKVVAELGKSDYIKAAVMLHPSLVTVDDIKEVKCHIAILGAEIDKISPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +KQFE  L  K EV+S VKIF GV HGWTVRYD  D+ AVK AEEAHQ +L+WF K+L+
Sbjct  180  LKQFEEILSVKSEVNSYVKIFPGVAHGWTVRYDTSDEPAVKKAEEAHQGMLEWFTKYLN  238



>ref|XP_010038123.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW49940.1| hypothetical protein EUGRSUZ_K03402 [Eucalyptus grandis]
Length=240

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCS-SYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            MS   C  NPP   + S G G V ++G L  Y++GP  ++L+VLLVSDVFGYEA  LRKL
Sbjct  1    MSETQCCENPPTPSTMSVGIGCVAEIGGLKAYITGPPDAELSVLLVSDVFGYEAPKLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+   GFYVVVPDFF+GDPYV +N  +PI VW + H  D    DA  V+  L++ GV+
Sbjct  61   ADKVAACGFYVVVPDFFYGDPYVPDNPERPIAVWRQSHGTDKGFEDAIRVVSALRSEGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  V+L K   V+A VLLHP+ VT++DI++VK PI+++GAE+D+ +P E
Sbjct  121  AIGAAGFCWGAKVVVELGKSDHVQAAVLLHPSRVTVEDIKEVKAPIAVLGAEHDKMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L AKPEVD  VKIF GV HGWTVRY ++D+  VK+AEEAH+D+L W  KHL
Sbjct  181  LLKQFEEILSAKPEVDGYVKIFAGVEHGWTVRYKDEDEVVVKSAEEAHKDMLDWLTKHL  239



>gb|AFK40311.1| unknown [Lotus japonicus]
Length=239

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP +  + GAG V++   L+ Y++G  HSKLA+LLVSD++GYEA NLR LA
Sbjct  1    MSGPQCCSNPPTINPTAGAGHVEKFAGLDSYLTGSPHSKLAILLVSDIYGYEAPNLRNLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFF+GDPY  EN  +P+ VWLKDH  D     AK ++E LK+ GV+ 
Sbjct  61   DKVVAAGYYVVVPDFFYGDPYNPENANRPLPVWLKDHGTDKGFEVAKPIVEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A V LHP+FV+LDDI  V +PI+I+GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVVVELAKSRLIQAAVQLHPSFVSLDDINGVDIPIAILGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AKP VDS VKIF  V+HGW+VRY+ +D  AVKAAEEAHQD+L WF KHL
Sbjct  181  LKQFEQVLTAKPGVDSYVKIFPKVSHGWSVRYNIEDAEAVKAAEEAHQDMLDWFAKHL  238



>ref|XP_008390811.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=237

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 172/238 (72%), Gaps = 3/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G+G V++LG  + YV+G   S+L+VLLV D FGYEA   RKLA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGYEAPKARKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAK-PIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DKI  AGF VV+PDFF+GDP+  NG +  I VW K HA +    DAK+VIE L++ GV+ 
Sbjct  61   DKIAAAGFIVVLPDFFNGDPF--NGDRASIPVWRKTHAPEKTIEDAKLVIEALRSKGVSA  118

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  +DLAK   ++A VL HP+ VTLDDI+ VKVPIS++GAE D+  P EV
Sbjct  119  IGAAGFCWGXKGVIDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDQMYPPEV  178

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AKPE+ S VKIF  V HGWT+RYD++D+AAVKAA EAHQDLL WF++H+
Sbjct  179  IKQFEEVLTAKPEIKSHVKIFPKVAHGWTLRYDDEDEAAVKAAGEAHQDLLGWFLEHV  236



>ref|XP_010905246.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Elaeis guineensis]
Length=240

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 171/242 (71%), Gaps = 6/242 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQ---VQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            M+S  C ANPP L  S G+GQ   V  LG L  Y +G   SK+A++L SDV+G+EA NLR
Sbjct  1    MASSQCCANPPTL--SPGSGQGCVVDDLGGLKAYTAGSPDSKIAIILASDVYGFEAPNLR  58

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGG  409
            K+ADKI G+GF+VVVPDFF+G+PY  N A +P+ +W++ H       DAK VI  LK+ G
Sbjct  59   KIADKIAGSGFFVVVPDFFYGEPYAPNNAERPLPIWIQSHTTAKGFEDAKSVIAALKSKG  118

Query  410  VTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTP  589
            ++ VG  G C G K AV+LAK   ++A VLLHP+FV++DDI++VK PI+I+GAE+D  +P
Sbjct  119  ISAVGAAGFCWGAKVAVELAKADEIQAAVLLHPSFVSVDDIKEVKCPIAILGAESDHLSP  178

Query  590  AEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
             ++VKQFE  L AK  V   VKIF GV HGW+VRY  DD +AV++AEEAHQD L WF KH
Sbjct  179  PQLVKQFEQILSAKKRVSYFVKIFPGVAHGWSVRYKTDDASAVRSAEEAHQDTLDWFAKH  238

Query  770  LH  775
            + 
Sbjct  239  VR  240



>ref|XP_006361505.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Solanum 
tuberosum]
Length=297

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V QLG+ N YVSGPS SKLA+LLVSDV+GYEA NLRKLA
Sbjct  1    MSGRECCENPPALSSSSGNGCVLQLGSFNTYVSGPSTSKLAILLVSDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF+GDPY     K + +W++ H       DAK V+  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFYGDPYTME--KTLSIWIQSHGTAKGFEDAKQVVAALKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +L+K   ++A VLLHP+ V +DD ++VKVPI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELSKSDYIQAVVLLHPSLVKVDDFKEVKVPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            KQFE  L +KPEVD  VK F GV HGWTVRY+ ++K AV+ AEEAH+D+L W    
Sbjct  179  KQFEEILSSKPEVDKFVKNFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTNE  234



>ref|NP_566732.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAB02778.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36041.1| AT3g23600/MDB19_9 [Arabidopsis thaliana]
 gb|AAM19921.1| AT3g23600/MDB19_9 [Arabidopsis thaliana]
 gb|AAM61180.1| contains similarity to endo-1,3-1,4-beta-D-glucanase [Arabidopsis 
thaliana]
 gb|AEE76781.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=239

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG + SKL VLL+SD+FG+EA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSAESKLCVLLISDIFGFEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D    + K V+E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFGGDPYNPSNQDRPIPVWIKDHGCDKGFENTKPVLETIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K   ++A VLLHP+FV +DDI+  K PI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKEELIQAAVLLHPSFVNVDDIKGGKAPIAILGAEIDQMSPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI   V+HGWTVRY+ D+  AVKAAEEAH+++L WFV ++
Sbjct  181  LKQFEEILSSKPEVNSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYI  238



>ref|XP_004290675.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=261

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 170/240 (71%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            +S P C+ +PP L  + GAG+V Q+G L  YV+GP HSKLA++L SDV+GYEA NLRK+A
Sbjct  21   LSGPQCLEHPPNLNGTSGAGRVIQVGGLKAYVTGPPHSKLAIILASDVYGYEAPNLRKIA  80

Query  242  DKIGG-AGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+   AGF+VVVPDFF+G+PY  N   + + VWLKDH  D    DAK +I  LK  G +
Sbjct  81   DKVASTAGFHVVVPDFFYGEPYNPNNTQRNMTVWLKDHGTDKGFEDAKRLIAALKKKGAS  140

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            K+G  G C GGK   +LAK    +A VLLHP+ VTLDDI++VK PISI+ A+ D  TP E
Sbjct  141  KIGAAGFCWGGKVVAELAKGYYTKAAVLLHPSRVTLDDIKEVKTPISILVAQFDNGTPPE  200

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            ++KQF+  L    +VD+ VKIF GV+HGWTVRY +D+  AVK+A EAHQD+L WF K++ 
Sbjct  201  LMKQFKEVLSTN-KVDNFVKIFPGVSHGWTVRYQQDNVTAVKSANEAHQDMLDWFTKYVQ  259



>ref|XP_010695954.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 gb|AFM94017.1| dienelactone hydrolase-1 [Beta vulgaris]
Length=262

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 170/237 (72%), Gaps = 3/237 (1%)
 Frame = +2

Query  71   PHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKI  250
            P C  NPP L  + G G V+ +G L  YVSG  HS  A+LL+SD FGYEA NLRKLADK+
Sbjct  25   PQCCKNPPILKPNSGTGHVEVIGGLKSYVSGSPHSNFAILLISDFFGYEAPNLRKLADKV  84

Query  251  GGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGI  427
              AG+YVVVPDFFHGDP+  N   +P+ VWL+DH  D    +AK VIE LK  G+ K+G 
Sbjct  85   AAAGYYVVVPDFFHGDPFNPNNTDRPVQVWLQDHGTDQGYEEAKPVIESLKRKGICKIGA  144

Query  428  GGVCSGGKAAVDLAKI-PCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVK  604
             G C GG+    LA+    ++A VLLHPA VT++DI+ VKVPI+++GAE D+ +P E++K
Sbjct  145  AGFCWGGRVVALLAQSDEYIQAGVLLHPAGVTVNDIKGVKVPIAVLGAEFDQVSPPELLK  204

Query  605  QF-EIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +F E+ +  +PEVDS VKIF GV HGWT+RYD +D +AVK+AEEAHQD+L WF +++
Sbjct  205  EFQEVLIAKRPEVDSYVKIFPGVAHGWTMRYDPEDASAVKSAEEAHQDMLSWFQRYI  261



>emb|CDY09037.1| BnaC01g30540D [Brassica napus]
Length=239

 Score =   244 bits (624),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M  P C  NPP L    G+G V++LG L+ YVSG   S   VLLVSD++GYEA NLR LA
Sbjct  1    MLGPQCCENPPVLNPLSGSGHVEKLGGLDVYVSGSPDSNKCVLLVSDIYGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPDFF+GDPY   +  +P+ VW+KDH  D    D K V+E +K  G+  
Sbjct  61   DKVAASGFYVVVPDFFYGDPYDPSHQDRPVPVWIKDHGPDKGFEDTKPVLEAIKNKGIIA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C GGK  V+L++   ++A VLLHP +VT+DDI+DVKVPI+I+GAE+D  TP  +
Sbjct  121  IGAAGMCWGGKVVVELSEEELIQAAVLLHPTYVTVDDIKDVKVPIAILGAEDDFLTPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV S VKIF  V+HGWT RYD +D  AVKAAEEAH+++L WFV ++
Sbjct  181  VKQFEEILASKPEVGSYVKIFPNVSHGWTTRYDINDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_011071517.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=253

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 168/237 (71%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            +SS  C  NPP      GAG++Q+LG L+CYVSG + S  +V+L+SD+FGYE  +LR LA
Sbjct  18   VSSHQCTDNPPTQSPYRGAGKIQKLGGLDCYVSGSADSNFSVILISDIFGYEVPHLRMLA  77

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AGFY VVPDFF GDP+ +  +  + +W K H  D    DAK +++ ++  G++K+
Sbjct  78   DKVAAAGFYTVVPDFFRGDPFKDGDS--LQIWFKHHGYDQGFKDAKAIVKAIERNGISKI  135

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G+ G C GGK  V+L +   +EA VLLHP+ VT+ DI+ V+VPISI+GA  DE TP E+V
Sbjct  136  GVAGFCWGGKVNVELMERAYIEAGVLLHPSNVTVPDIRGVRVPISILGAGIDEVTPPELV  195

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++FE  L+ KPEVDS VKIF GV HGWT RY++DDK AVK AEEAH  +L WF+KHL
Sbjct  196  RKFEAVLKKKPEVDSFVKIFPGVQHGWTTRYNDDDKLAVKRAEEAHNAMLHWFIKHL  252



>ref|XP_010532693.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=259

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 167/242 (69%), Gaps = 2/242 (1%)
 Frame = +2

Query  56   NIMSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
              +S+P C+ NPP L  + G+G V ++G L  YVSG SHSK  ++LVSDV+GYEA NLRK
Sbjct  18   RTISNPQCLENPPNLDPNSGSGHVTKIGGLKAYVSGSSHSKRGIILVSDVYGYEAPNLRK  77

Query  236  LADKIGGAGFYVVVPDFFHGDPY-VENGAK-PIGVWLKDHAVDNVCNDAKVVIEDLKAGG  409
            +ADK+  AGFY VVPD+F GDPY +E   K P+ VW+KDH      ND+K VIE LK  G
Sbjct  78   IADKVAAAGFYAVVPDYFFGDPYKIEYKEKRPVPVWIKDHPPAKGFNDSKPVIEALKRKG  137

Query  410  VTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTP  589
            +T +G  G+C G K  V+LAK   ++A V  HP++VT+DDI++VK P++I GAE D  +P
Sbjct  138  ITTIGATGICWGAKVVVELAKTDLIQAAVFFHPSYVTVDDIKEVKAPLAIFGAEFDGGSP  197

Query  590  AEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
              ++KQFE  L AK +V S VKIF  V HGWTVRY+  D  AVKAAEEAH D+L+WF   
Sbjct  198  PALLKQFEQILAAKSDVKSCVKIFPNVKHGWTVRYNVTDPVAVKAAEEAHNDMLQWFATL  257

Query  770  LH  775
            L 
Sbjct  258  LQ  259



>gb|ACU19417.1| unknown [Glycine max]
Length=239

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 164/239 (69%), Gaps = 3/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + GAG V++L  LN Y+SG  +S +A+LL+SD++ YEA NLR +A
Sbjct  1    MSGPECCSNPPVLNPNAGAGHVEKLAGLNSYLSGSPNS-IAILLISDIYDYEAPNLRNIA  59

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFFHGDPY  EN ++   VWLKDH  D     AK +IE LK+ GV  
Sbjct  60   DKVAAAGYYVVVPDFFHGDPYNPENASRSTPVWLKDHGTDKGSEAAKSIIEALKSKGVMA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK   ++A VLLHP FV++DDI+ V  P +++GAE D+ +P E+
Sbjct  120  IGAAGFCWGAKVVVELAKSRLIQAAVLLHPWFVSVDDIKGVDTPTAMLGAEIDKMSPPEL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYded-dkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKP VD  VKIF  V+HGWTVR++    +    AAEEAHQD++ W  KHL
Sbjct  180  VKQFEQVLTAKPGVDCFVKIFPKVSHGWTVRFNPKDAETVKAAAEEAHQDMVNWSAKHL  238



>emb|CDO98981.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 169/237 (71%), Gaps = 0/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  N P L S  GAG V++LG L  YV+G + S++AVLLVSDVFGYEA  LRKLA
Sbjct  1    MSGPQCCENAPSLSSGSGAGHVEELGGLQSYVTGSADSEIAVLLVSDVFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+ GAGF+VVVPDFF GDP +      +  WLK H  D     AK VIE LK  G+TKV
Sbjct  61   DKVAGAGFFVVVPDFFFGDPVLVLEGTDLDAWLKKHGPDQGFEHAKSVIEALKGKGITKV  120

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  V+LA   C++A V+LHPAFVTL+DIQ VKVP+SI+GAE D T P E++
Sbjct  121  GAAGFCWGAKVVVELATYACIQAAVILHPAFVTLEDIQGVKVPMSILGAETDHTGPPELL  180

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++F  AL AKPEVD  VKIF GV HGW+VRY ++D+  VKAAEEAHQDLL W VK+L
Sbjct  181  RKFGQALDAKPEVDGFVKIFPGVAHGWSVRYKDEDEKEVKAAEEAHQDLLGWLVKYL  237



>ref|XP_002309880.2| dienelactone hydrolase family protein [Populus trichocarpa]
 gb|EEE90330.2| dienelactone hydrolase family protein [Populus trichocarpa]
Length=239

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 170/238 (71%), Gaps = 5/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSSP C  NPPKL   YGAG VQ+LG L  YV+G S SKLA+LL++D FGYEA NLRKLA
Sbjct  1    MSSPQCFENPPKLTPDYGAGTVQELGGLKTYVTGASDSKLAILLIADAFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKP---IGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGF+VVVPDFF+GDP   + ++P   I  W K H  D    +AK+VI  LK+ GV
Sbjct  61   DKVAAAGFFVVVPDFFYGDPV--DLSRPGFDIEAWKKLHNTDKGHENAKLVIATLKSKGV  118

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
              +G  G C GG  AV LA    ++A V+LHP  +T+D+I++VK+PI+++GAE D  +P 
Sbjct  119  NSIGAAGFCWGGNVAVKLASSNDIQAAVILHPGPLTIDEIREVKIPIAVLGAEIDHYSPP  178

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
            E +K+F   L AK ++ SL+KIF GV+HGWTVRY+ +D+ AVK+AEEAH+D+L WF K
Sbjct  179  EQLKEFGEILSAKSQLASLLKIFPGVSHGWTVRYNVEDEPAVKSAEEAHRDMLHWFTK  236



>ref|XP_009417917.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 167/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G  V  LG +  Y +G  +SK+AVLL+SDV+G+EA NLRK+
Sbjct  1    MASPQCCANPPTLSPACGDGIVVDDLGGVRAYTAGSPNSKIAVLLISDVYGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADKI  +GF+VVVPD  + DPY  +N  +PI +W++ H+ D  C DAK +I  LK  G++
Sbjct  61   ADKIATSGFFVVVPDLLYDDPYSADNPERPISIWIQSHSPDKGCQDAKPIIAALKNKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C GGK   +LAK   +EA VL HP+FV +DD++ VK PISI+GAEND  +P E
Sbjct  121  AVGAAGFCWGGKVVFELAKSSEIEAAVLCHPSFVNVDDVKGVKCPISILGAENDHISPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE AL    E   +VKIF GV HGWTVR+  DD AAVK A+EAHQD+L WF++H+
Sbjct  181  LLKQFERALSLTSEERHIVKIFPGVAHGWTVRHKADDAAAVKRAQEAHQDMLNWFIQHV  239



>ref|XP_010532707.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=241

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 170/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M  P C  NPP    + G+G V++LG L+ YV+G   SK A+LL SD FG+EA NLRKLA
Sbjct  3    MMGPQCCQNPPVKIPNAGSGHVEKLGGLDAYVTGSPDSKFAILLASDAFGFEAPNLRKLA  62

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFFHGD Y  EN  +P+ VW+KDH  +     +K VIE LK+ G+  
Sbjct  63   DKVAAAGFYVVVPDFFHGDSYTPENQDRPLPVWIKDHGPEKGFEYSKPVIEALKSKGIDA  122

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  GVC G K  V+LAK   +++ VLLHP+ V++DDI++VK PI+++GAE D TTP E+
Sbjct  123  IGATGVCFGAKVVVELAKRQLIQSAVLLHPSLVSVDDIKEVKTPIAVLGAEIDGTTPPEL  182

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VK+F  AL +KP+V S VKI+  V HGW+VRY+E D  AVKAAEEAH+D+L+W + H+
Sbjct  183  VKKFSEALASKPDVKSYVKIYPNVEHGWSVRYEESDAEAVKAAEEAHKDMLEWSLIHV  240



>ref|XP_010038125.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=241

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 169/240 (70%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCS-SYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            MS   C  NPP   + S G G V ++G L  Y++GP  +KL+VLLVSDVFGYEA  LRKL
Sbjct  1    MSETQCCENPPTRSTMSVGIGCVAEIGGLKAYITGPPDAKLSVLLVSDVFGYEAPKLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDH-AVDNVCNDAKVVIEDLKAGGV  412
            ADK+   GFYVVVPDFF+GDPYV +N  +PI VW + H  V     DA  V+  L++ GV
Sbjct  61   ADKVASCGFYVVVPDFFYGDPYVPDNPERPIAVWRQSHGTVRKGFEDAIRVVSALRSEGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + +G  G C G K  V+L K   ++A VLLHP+ VT++DI++VK PI+++GAE D+ +P 
Sbjct  121  SAIGAAGFCWGAKVVVELGKSDYIQAVVLLHPSRVTVEDIKEVKAPIAVLGAEYDKLSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E++KQFE  L AKPEVD  VKIF GV HGWTVRY ++D A VK+AEEAH+D+L WF KHL
Sbjct  181  ELLKQFEEILSAKPEVDGCVKIFAGVEHGWTVRYKDEDAAEVKSAEEAHKDMLDWFNKHL  240



>ref|XP_009352126.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
 ref|XP_009352127.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=237

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G+G V++LG  + YV+G   S+L+VLLV D FGYEA   RKLA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGYEAPKARKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGF VV+PDF +GDP+  + +  I VW K HA +    DAK+VIE L++ GV+ +
Sbjct  61   DKIAAAGFIVVLPDFLNGDPFNWDRSS-IPVWKKAHAPEKTIEDAKLVIEALRSKGVSAI  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  VDLAK   ++A VL HP+ VTLDDI+ VKVPIS++GAE DE  P EV+
Sbjct  120  GAAGFCWGAKGVVDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDEMYPPEVI  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L AKPE+ S VKIF  V HGWT+RYD++D+AAVKAAEEAHQDLL WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKVAHGWTLRYDDEDEAAVKAAEEAHQDLLGWFLEHV  236



>ref|XP_008223025.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=243

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 171/242 (71%), Gaps = 5/242 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G  +  G L+ YV+G  HSKLAVL +SD+FG++A  LRK A
Sbjct  1    MSGPQCCSHPPVLNPSSGSGHAETFGGLDSYVTGSPHSKLAVLFLSDIFGFQAPKLRKFA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AG++VVVPDFF+GDP+V   +     + VWLKDH+ +    DAK+VIE LK+ GV
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVVADDGSFDRLPVWLKDHSPEKGLEDAKLVIEALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIP--CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETT  586
            + +G  G C G K AV+L K     + A VLLHPAF T+DDI++VKVPI+++GAE D  T
Sbjct  121  SAIGAAGFCWGAKVAVELGKHDHDFIHAGVLLHPAFTTVDDIKEVKVPIAVLGAEFDHIT  180

Query  587  PAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
            P EV+KQ+E  L AK E+ S VKIF  V HGWT RY+ +D+ +VK+AEEAHQDLL+WF  
Sbjct  181  PPEVLKQWEEVLIAKTEIKSYVKIFPEVEHGWTTRYNVEDEKSVKSAEEAHQDLLEWFSN  240

Query  767  HL  772
            H+
Sbjct  241  HV  242



>ref|XP_009106630.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Brassica rapa]
Length=239

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M  P C  NPP L    G+G V++L  L+ YVSG   S   VLLVSD++GYEA NLR LA
Sbjct  1    MLGPQCCENPPVLNPLSGSGHVEKLAGLDVYVSGSPDSNKCVLLVSDIYGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDPY   +  + + VW+KDH  D    D K V+E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYDPSHQDRSVPVWIKDHGPDKGFEDTKPVLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C GGK  V+L+K   ++A VLLHP +VT+DDI+DVKVPI+I+GAE+D  TP  +
Sbjct  121  IGAAGMCWGGKVVVELSKEELIQAAVLLHPTYVTVDDIKDVKVPIAILGAEDDFLTPPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV S VKIF  V+HGWT RYD +D  AVKAAEEAH+++L WFV ++
Sbjct  181  VKQFEEILASKPEVSSYVKIFPNVSHGWTTRYDINDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_011023033.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Populus euphratica]
 ref|XP_011012726.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Populus euphratica]
Length=239

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS+P C  NPPKL   YGAG VQ+LG L  YV+G S SKLA+LL++D FGYEA NLRKLA
Sbjct  1    MSNPQCFENPPKLTPGYGAGTVQELGGLKTYVTGASDSKLAILLIADAFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKP---IGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGF+VVVPDFF+GDP   + ++P   +  W K H  D    DAK+VI  LK+ GV
Sbjct  61   DKVAAAGFFVVVPDFFYGDPI--DLSRPGFDVEAWKKLHNTDKGHEDAKLVIATLKSKGV  118

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
              +G+ G C GG  AV LA    ++A V+LHP  +T+D+I++VK+PI+++GAE D  +P 
Sbjct  119  NSIGVAGFCWGGNVAVKLASSNDIQAAVILHPGPLTVDEIREVKIPIAVLGAEIDLYSPP  178

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
            E +K+F   L AK ++ SL+KIF GV+HGWTVRY+ +D+ AVK+AEEAH+D+L WF K
Sbjct  179  EQLKEFGEILSAKSQLPSLLKIFPGVSHGWTVRYNVEDEPAVKSAEEAHRDMLHWFTK  236



>gb|KHN03435.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=239

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 164/237 (69%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G G V ++G ++ Y SG SHSKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPSGGGGHVNKVGGVDSYFSGSSHSKLALLMLSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD   G+P+  +N  +P+ VWLKDH  D      K +IE LK+ GV+ 
Sbjct  61   DKVAAAGYYVVVPDLLDGEPFNYQNSNRPLPVWLKDHGPDKGSEATKPIIEALKSKGVSV  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +   G C G K  V+L K   ++  VL+HP+FV+LDDI+ V +PI+I+GAE D+ +P E+
Sbjct  121  IAAVGFCWGAKVVVELVKSKLIQTAVLMHPSFVSLDDIKAVDIPIAILGAEIDQYSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            VKQFE  L AK  V S VKIF  ++HGW VRY+ +D  AVK AEEAH+D+L W  KH
Sbjct  181  VKQFEQVLAAKAGVASFVKIFPKISHGWAVRYNAEDAEAVKVAEEAHRDMLDWLAKH  237



>ref|XP_008352792.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Malus 
domestica]
Length=261

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 171/260 (66%), Gaps = 23/260 (9%)
 Frame = +2

Query  62   MSSPHCIANPPKL-CSSYGAGQ-VQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS P C +NPP L   SYG     ++LG LN YV+G  +SKLA+LL+S+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNCXEKLGGLNVYVAGSPNSKLAILLISNVFGYRVPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D    DAK +I  LK  GV+
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVYDNNRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  416  KVGIGGVCSGG---------------------KAAVDLAKIPCVEATVLLHPAFVTLDDI  532
             +G  G C GG                     K   +LAK   ++A VLLHP+FVTLDDI
Sbjct  121  AIGAAGFCWGGEWFLSQTTFSTGCLISSIAQAKVVTELAKSDFIQAAVLLHPSFVTLDDI  180

Query  533  QDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddka  712
            Q+VKVPI+I GAE D+ +P E+VKQFE  L AKPEVDS VKIF    H WT+ Y+ +D+ 
Sbjct  181  QEVKVPIAIQGAEIDDYSPPELVKQFEQILAAKPEVDSFVKIFPKAEHXWTMSYNVEDEE  240

Query  713  avkaaeeaHQDLLKWFVKHL  772
            AVK AEEAH++ L WFVKH+
Sbjct  241  AVKRAEEAHRNTLAWFVKHV  260



>ref|XP_009362382.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Pyrus 
x bretschneideri]
Length=261

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 171/260 (66%), Gaps = 23/260 (9%)
 Frame = +2

Query  62   MSSPHCIANPPKL-CSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            MS P C +NPP L   SYG     ++LG LN YV G  +SKLA+LLVS+VFGY   NLRK
Sbjct  1    MSGPQCCSNPPILKPESYGVDNSDEKLGGLNVYVVGSPNSKLAILLVSNVFGYRVPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            LA+ I  AGF+V+VPDFF+GDP+V +  +P+ VWL+DH  D    DAK +I  LK  GV+
Sbjct  61   LAENIAAAGFFVLVPDFFYGDPFVHDNDRPLAVWLQDHGTDKGFEDAKSIINALKGKGVS  120

Query  416  KVGIGGVCSGG---------------------KAAVDLAKIPCVEATVLLHPAFVTLDDI  532
             +G  G C GG                     K  ++LAK   ++A +LLHP+FV LDDI
Sbjct  121  AIGAAGFCWGGEWLLSHTTFSTGCLISSIAQAKVVIELAKSDFIQAALLLHPSFVALDDI  180

Query  533  QDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddka  712
            Q+VKVPI+I GAE D+ +P E+VKQFE  L AKPEVDS VKIF    HGWT+ Y+ +D+ 
Sbjct  181  QEVKVPIAIQGAEIDDYSPPELVKQFEQILAAKPEVDSFVKIFPKAEHGWTMSYNAEDEE  240

Query  713  avkaaeeaHQDLLKWFVKHL  772
            AVK AEEAH++ L WFVKH+
Sbjct  241  AVKRAEEAHRNTLAWFVKHV  260



>ref|XP_009365788.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
 ref|XP_009365789.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=237

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G+G V++LG  + YV+G   S+L+VLLV D FGYEA   RKLA
Sbjct  1    MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGYEAPKARKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGF VV+PDF +GDP+  + +  I VW K HA +    DAK+VIE L++ GV+ +
Sbjct  61   DKIAAAGFIVVLPDFLNGDPFNWDRSS-IPVWKKAHAPEKTIEDAKLVIEALRSKGVSAI  119

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  VDLAK   ++A VL HP+ VTLDDI+ VKVPIS++GAE DE  P EV+
Sbjct  120  GAAGFCWGAKGVVDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDEMYPPEVI  179

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L AKPE+ S VKIF  V HGWT RYD++D+AAVKAAEEAHQDLL WF++H+
Sbjct  180  KQFEEVLTAKPEIKSHVKIFPKVAHGWTSRYDDEDEAAVKAAEEAHQDLLGWFLEHV  236



>ref|XP_006406009.1| hypothetical protein EUTSA_v10021427mg [Eutrema salsugineum]
 dbj|BAJ33610.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47462.1| hypothetical protein EUTSA_v10021427mg [Eutrema salsugineum]
Length=239

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL +LL+SD+FGYEA NLR LA
Sbjct  1    MSGPQCCENPPALNPVSGSGHVEKLGGLDAYVSGSLDSKLCILLISDIFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDPY   N  + + VW+KDH  D    D K V+E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYNPSNQERQVPVWIKDHGPDKGFQDTKPVLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K   ++A VLLHP+FV++DDI+  KVPI+I+GAE D  +P  +
Sbjct  121  IGAAGMCWGAKVVVELSKQELIQAAVLLHPSFVSVDDIKGGKVPIAILGAEFDNLSPPSL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +K EV+S VKI+  V HGWTVRY+ DD  AVKAAEEAH+++L WFV ++
Sbjct  181  LKQFEEILASKSEVNSCVKIYPKVAHGWTVRYNTDDPEAVKAAEEAHKEMLDWFVTYV  238



>ref|XP_009599203.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009599204.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X3 [Nicotiana 
tomentosiformis]
Length=239

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C  NPP L SS G G V ++G    YVSGPS SKLA+LL SDV+GYEA NLRKLA
Sbjct  1    MAGAQCCENPPTLSSSSGVGSVLEIGGFKAYVSGPSSSKLAILLASDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDF +GDPY  EN  KP+ +W++ H  D    DAK V+  LK  G++ 
Sbjct  61   DKVAAAGYYVVVPDFLYGDPYNPENTEKPLSIWVQSHGTDKGFEDAKKVVAALKDKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   DLAK   ++A V LHP+ V +DDI++VK PI+I+ AE D  +P E+
Sbjct  121  IGAAGFCWGAKVVTDLAKSDYIQAAVQLHPSLVKVDDIKEVKAPIAILAAEIDRISPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEVDS VKIF  V HGWTVRY+ +D+ AV++AEEAH+ +L WF K++
Sbjct  181  IKQFEEILSSKPEVDSFVKIFPSVKHGWTVRYNVEDQEAVQSAEEAHRHMLDWFTKYV  238



>ref|XP_009339924.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Pyrus 
x bretschneideri]
Length=273

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 172/272 (63%), Gaps = 35/272 (13%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G   S  AVLL+SDV+G+EA NLRKLA
Sbjct  1    MASSECCSNPPTLNPSSGTGHVESLGGLDSYVTGSPDSNFAVLLISDVYGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDF + DPY  E+  +P+ VW+KDH  D    DAK V+E LK+ GV+ 
Sbjct  61   DKVAAAGFFVVVPDFLNKDPYAPEDANRPVSVWIKDHGPDKGFEDAKPVLEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQ---------------------  535
            +G  G C G K  V+L+K   ++A VL HP+ VT+DDI+                     
Sbjct  121  IGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKGKIPVLIFRKYLHHYWNKKLV  180

Query  536  -------------DVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTH  676
                         +VKVPISI+GAE D  +P EVV+QFE  L  KPEV S VKIF  V+H
Sbjct  181  SHSLYDLFLDLLSEVKVPISILGAEIDRMSPPEVVRQFEEVLTTKPEVKSHVKIFPKVSH  240

Query  677  GWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            GWTVRY  +D+AA K+AEEAHQDLLKWF+ H+
Sbjct  241  GWTVRYSVEDEAACKSAEEAHQDLLKWFLNHV  272



>ref|XP_006419788.1| hypothetical protein CICLE_v10006994mg, partial [Citrus clementina]
 gb|ESR33028.1| hypothetical protein CICLE_v10006994mg, partial [Citrus clementina]
Length=246

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 164/231 (71%), Gaps = 8/231 (3%)
 Frame = +2

Query  98   LCSSY------GAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGA  259
            LC S       G G V+ LG LN YV+G  HSKLAVLLVSDV  Y+A NLRKLADKI  A
Sbjct  17   LCESTNIEPTTGGGHVENLGGLNTYVNGSPHSKLAVLLVSDV--YDALNLRKLADKIAAA  74

Query  260  GFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVC  439
            GFYV VPDF HGDPYV N  + +  W+KDH  D    DAK VI+ +K+ G+T +G  G C
Sbjct  75   GFYVAVPDFLHGDPYVPNAGRTLQDWIKDHGTDKAFEDAKPVIQAIKSKGITAIGAAGFC  134

Query  440  SGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIA  619
             G K AV LAK   ++A VLLHP+FVT+DDI+ V+VP +++GAE D+ +P  ++K+FE  
Sbjct  135  WGAKIAVQLAKREFIQAAVLLHPSFVTVDDIKTVEVPTAVLGAEFDQISPPALLKRFEEV  194

Query  620  LQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            L AK EVD  VKIF  V+HGWTVRY  +DK+AVK AEEAHQ++L+WF K++
Sbjct  195  LTAKSEVDGYVKIFPKVSHGWTVRYKVEDKSAVKCAEEAHQNMLEWFAKYV  245



>ref|XP_007224824.1| hypothetical protein PRUPE_ppa023469mg [Prunus persica]
 gb|EMJ26023.1| hypothetical protein PRUPE_ppa023469mg [Prunus persica]
Length=243

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 173/242 (71%), Gaps = 5/242 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M++  C ++PP L  S G+G V++ G L+ YV+G  HSKLA+L +SD+FG++A  LRK A
Sbjct  1    MAASKCCSHPPVLNPSSGSGHVEKFGGLDSYVTGSPHSKLAILFLSDIFGFQAPKLRKFA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV---ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AG++VVVPDFF+GDP+V   +     + VWLKDH+ +    DAK+VIE LK+ GV
Sbjct  61   DKVAAAGYFVVVPDFFYGDPFVLADDGSFDRLPVWLKDHSPEKGFEDAKLVIEALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIP--CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETT  586
            + +G  G C G K AV+L K     + A VLLHPAF T+DDI++VKVPI+I+GAE D  T
Sbjct  121  SAIGAAGFCWGAKVAVELGKHDHDFIHAGVLLHPAFTTVDDIKEVKVPIAILGAEFDHIT  180

Query  587  PAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
            P EV+KQ+E  L AK E+ S VKIF  V HGWT RY+ +D+ +VK+AEEAHQDLL+WF  
Sbjct  181  PPEVLKQWEEVLIAKTEIKSYVKIFPEVEHGWTTRYNVEDEKSVKSAEEAHQDLLEWFSN  240

Query  767  HL  772
            H+
Sbjct  241  HV  242



>ref|XP_009599202.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=250

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C  NPP L SS G G V ++G    YVSGPS SKLA+LL SDV+GYEA NLRKLA
Sbjct  1    MAGAQCCENPPTLSSSSGVGSVLEIGGFKAYVSGPSSSKLAILLASDVYGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDF +GDPY  EN  KP+ +W++ H  D    DAK V+  LK  G++ 
Sbjct  61   DKVAAAGYYVVVPDFLYGDPYNPENTEKPLSIWVQSHGTDKGFEDAKKVVAALKDKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   DLAK   ++A V LHP+ V +DDI++VK PI+I+ AE D  +P E+
Sbjct  121  IGAAGFCWGAKVVTDLAKSDYIQAAVQLHPSLVKVDDIKEVKAPIAILAAEIDRISPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEVDS VKIF  V HGWTVRY+ +D+ AV++AEEAH+ +L WF K++
Sbjct  181  IKQFEEILSSKPEVDSFVKIFPSVKHGWTVRYNVEDQEAVQSAEEAHRHMLDWFTKYV  238



>gb|EEC79184.1| hypothetical protein OsI_19879 [Oryza sativa Indica Group]
Length=240

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 168/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G+V    G +  YVSG + SK AV+LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVDSFGGIKAYVSGAAESKAAVVLVSDVFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPDF HGDP+V EN  +PI VW+KDH  D    +AK VI  LK  GV+
Sbjct  61   ADKVASSGYFVVVPDFLHGDPFVRENTERPIEVWIKDHGADKGFEEAKPVIAALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+LAK   + A V+ HP+ VT+DD+++VK PI+I+GAE D  +P E
Sbjct  121  SVGAAGYCWGAKVVVELAKAHEIHAAVMCHPSLVTVDDMKEVKCPIAILGAEIDHVSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE  L +K E+   VKIF GV HGWTVRY +DD AAVK+AEEA  D++ WF K+L
Sbjct  181  VVKQFEQVLSSKSEIGHFVKIFPGVEHGWTVRYKDDDAAAVKSAEEALADMIDWFNKNL  239



>ref|XP_008360320.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=240

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (71%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G+V++ G L+ Y+ G   SKLAVLL+SD+FGY+A NLRK+A
Sbjct  1    MSGPQCCSHPPTLNPSSGSGRVEKFGGLDTYLVGSPDSKLAVLLLSDIFGYDAPNLRKMA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+  AGF+VVVPDFF+GDP+   E G   +  W+K H  D    D K ++E LK+ G++
Sbjct  61   DKLAAAGFFVVVPDFFYGDPFELGEXGFAALPGWIKHHEPDKAFEDTKPLLEALKSKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+L+K   ++A  + HPAFVTLDDI+ VKVP  I+GAE D  +P E
Sbjct  121  AVGAVGFCYGAKVVVELSKHDLIQAAAMCHPAFVTLDDIKAVKVPTQILGAEIDHLSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE AL AKPE+ S VKIF  V HGWT RY+++D+AA KAAEEA+QDLL+W   H+
Sbjct  181  VVKQFEEALAAKPEIKSRVKIFPKVEHGWTTRYNDEDEAACKAAEEAYQDLLEWLQNHV  239



>ref|XP_010322752.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum lycopersicum]
Length=238

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C+ NPP L S+ G G +Q++G L+ YVSG  HSKLA+LL+SDVFGYEA  LRKLA
Sbjct  1    MAGAQCMKNPPTLNSASGVGDLQEIGGLSSYVSGSIHSKLAILLISDVFGYEAPLLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  +G+ VVVPDFF+G+P ++     +  WLKDH +D  C DAKVV+E LK+ GV+ +
Sbjct  61   DKVAASGYLVVVPDFFYGEP-LDREKHDVQTWLKDHGIDKGCEDAKVVVESLKSKGVSAI  119

Query  422  GIGGVCSGGKAAVDLAKI-PCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            G  G C GG     LAK    ++A V+LHP  +T+DDI +VKVPI+I+ AE+D   P + 
Sbjct  120  GAAGFCWGGMVVSKLAKYESTIDAAVILHPGPITVDDINEVKVPIAILAAEHDHIFPPDQ  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             K    AL AKPE++S VKIF GV HGWTVRY+ +D+ AVKAAEE+H D+L WF K +
Sbjct  180  AKLLGNALSAKPEIESFVKIFPGVEHGWTVRYNVEDEPAVKAAEESHTDMLNWFTKFI  237



>ref|NP_001242164.1| uncharacterized protein LOC100801095 [Glycine max]
 gb|ACU22986.1| unknown [Glycine max]
Length=239

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 163/237 (69%), Gaps = 1/237 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  S G G V ++G ++ Y SG SHSKLA+L++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPSGGGGHVNKVGGVDSYFSGSSHSKLALLMLSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD   G+P+  +N  +P+ VWLKD   D      K +IE LK+ GV+ 
Sbjct  61   DKVAAAGYYVVVPDLLDGEPFNYQNSNRPLPVWLKDRGPDKGSEATKPIIEALKSKGVSV  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +   G C G K  V+L K   ++  VL+HP+FV+LDDI+ V +PI+I+GAE D+ +P E+
Sbjct  121  IAAVGFCWGAKVVVELVKSKLIQTAVLMHPSFVSLDDIKAVDIPIAILGAEIDQYSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            VKQFE  L AK  V S VKIF  ++HGW VRY+ +D  AVK AEEAH+D+L W  KH
Sbjct  181  VKQFEQVLAAKAGVASFVKIFPKISHGWAVRYNAEDAEAVKVAEEAHRDMLDWLAKH  237



>ref|XP_009417919.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C ANPP L  + G G  V  LG +  Y +G  +SKLAVLL+SD+FG+EA NLRK+
Sbjct  3    MASSQCCANPPTLSPACGDGIVVDDLGGVRAYTAGSPNSKLAVLLISDIFGFEAPNLRKI  62

Query  239  ADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADKI  +GF+VVVP+  + DPY  +N  +PI +W++ H+ D  C DAK +I  LK  G++
Sbjct  63   ADKIATSGFFVVVPNLLYDDPYSADNPERPISIWIQSHSPDKGCQDAKPIIAALKNKGIS  122

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C GGK  V+LAK   +EA VL HP+FV +DD++ VK PISI+GAEND  +P E
Sbjct  123  AVGAAGFCWGGKVVVELAKSSEIEAAVLCHPSFVNIDDMKGVKCPISILGAENDHISPPE  182

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE AL    E   +VKIF GV HGWTV++  DD AAVK A+EAHQD+L WF +H+
Sbjct  183  LLKQFEQALSLTSEERHIVKIFPGVAHGWTVKHKADDAAAVKRAQEAHQDMLNWFTQHV  241



>ref|XP_006339415.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Solanum tuberosum]
Length=238

 Score =   240 bits (612),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 166/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C+ NPP L S+ G G +Q++G L+ YVSG  HSKLA+LL+SDVFGYEA  LRKLA
Sbjct  1    MSGAECMKNPPTLNSASGIGNLQEIGGLSSYVSGSIHSKLAILLISDVFGYEAPLLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  +G+ VVVPDFF+G+P ++     +  W KDH +D  C DAKVV+E LK+ GV+ +
Sbjct  61   DKVAASGYLVVVPDFFYGEP-LDREKHDLQTWFKDHGIDKGCEDAKVVVESLKSKGVSAI  119

Query  422  GIGGVCSGGKAAVDLAKI-PCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            G  G C GG     LAK    ++A V+LHP  +T+DDI +VKVP +I+ AE+D   P + 
Sbjct  120  GAAGFCWGGMVVSKLAKYESTIDAAVILHPGPITVDDINEVKVPTAILAAEHDHIFPPDQ  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             K    AL AKPE++S VKIF GV HGWTVRY+ +D++AVKAAEEAH D+L WF K +
Sbjct  180  AKLLANALSAKPEIESFVKIFPGVEHGWTVRYNVEDESAVKAAEEAHSDMLNWFTKFI  237



>ref|XP_007034581.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY05507.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=215

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 159/217 (73%), Gaps = 4/217 (2%)
 Frame = +2

Query  125  VQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGDPY  304
            V++L  L  Y +G   SKLAVLLVSDVFGY+A NLRKLADK+  AGFYVVVPDFF+GDP+
Sbjct  1    VEELAGLKTYFTGSLDSKLAVLLVSDVFGYDAPNLRKLADKVAAAGFYVVVPDFFYGDPF  60

Query  305  V-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIPC  481
            V E   +P+ VWLKDH       DAK+VI+ LK+ GV+ +G  G+C G K  V LAK   
Sbjct  61   VAERSDRPLAVWLKDH---GPVEDAKLVIDALKSKGVSAIGAAGICWGAKVVVGLAKEAL  117

Query  482  VEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIF  661
            + A VLLHP+FVT+DDI+ VKVPI+I+GAE D+ +P  +VKQF+  L+AKPEV S VKIF
Sbjct  118  IPAAVLLHPSFVTVDDIKSVKVPIAILGAEIDQLSPPALVKQFDEILKAKPEVGSFVKIF  177

Query  662  DGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
                HGWTVRY+ +D  AV  A+EAHQD+L WF K++
Sbjct  178  PKCAHGWTVRYNVNDATAVSYADEAHQDMLNWFTKYV  214



>ref|XP_010327302.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X2 [Solanum 
lycopersicum]
Length=236

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 162/237 (68%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V ++G+ N YVSGPS SKLA+LLVSDV+GYEA NLR + 
Sbjct  1    MSGRECCENPPALSSSSGNGCVLKVGSFNAYVSGPSTSKLAILLVSDVYGYEAPNLRNIV  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF GDPY     K + +W++ H       DAK +I  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFCGDPYTIE--KTLSIWIQSHGTAKGFEDAKQIIAVLKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +LAK   ++A VLLHP+ V +DD ++VK PI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELAKSDYIQAAVLLHPSLVKVDDFKEVKAPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             QFE  L +KPEVD  VKIF GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K++
Sbjct  179  IQFEEVLSSKPEVDKFVKIFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_010551668.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Tarenaya hassleriana]
Length=241

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = +2

Query  71   PHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKI  250
            P C  N P    + G+G V++LG L+ YV+G   SK A+LL SD FG+EA NLRKLADK+
Sbjct  6    PQCCQNAPTRIPNAGSGHVEKLGGLDAYVTGSPESKFAILLASDAFGFEAPNLRKLADKV  65

Query  251  GGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGI  427
              +GFYVV+PDFF GD Y  EN  +P+ VW+KDH  +     +K VIE LK+ G+  +G 
Sbjct  66   AASGFYVVIPDFFRGDSYSPENQDRPLPVWIKDHGPEKGFEYSKPVIEALKSRGIDAIGA  125

Query  428  GGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQ  607
             G+C G K  V+LAK   +++ VLLHP+ V+LDDI++VK PI++ GAE D TTP E+V+Q
Sbjct  126  TGICFGAKVVVELAKRELIQSAVLLHPSLVSLDDIKEVKAPIAVFGAEIDSTTPPELVQQ  185

Query  608  FEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            F  AL +KPEV S VKI++ V HGW+VRY+ DD  AVKAAEEAH+D+L+W + H+
Sbjct  186  FAEALASKPEVKSYVKIYNNVEHGWSVRYNVDDAEAVKAAEEAHKDMLEWSLIHV  240



>ref|XP_008808248.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Phoenix 
dactylifera]
Length=240

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 167/241 (69%), Gaps = 6/241 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQ---VQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            M+S  C ANPP L  S G+GQ   V  LG L  Y +G   SKLA++LVSDV+G+EA NLR
Sbjct  1    MASSQCCANPPTL--SPGSGQGCVVDDLGGLKAYTAGSPDSKLAIILVSDVYGFEAPNLR  58

Query  233  KLADKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGG  409
            K+ADK   +GF+VVVPDF +GDPY  N A +P+ +W++ H       DAK VI  LK+ G
Sbjct  59   KIADKAAASGFFVVVPDFLYGDPYSPNNAERPLPIWIQSHTTAKGFEDAKPVIAALKSKG  118

Query  410  VTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTP  589
            ++ VG  G C G K  V+LAK   ++A V LHP+FV++DDI++VK PI+I+GAE D  +P
Sbjct  119  ISAVGAAGFCWGAKVVVELAKAAEIQAAVFLHPSFVSVDDIKEVKCPIAILGAEFDHLSP  178

Query  590  AEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
             E+VKQFE  L AK  V   VKIF GV HGW+VRY  DD +AVK+AEEAHQD+L WF KH
Sbjct  179  PELVKQFEQILSAKTGVSYFVKIFPGVAHGWSVRYKVDDASAVKSAEEAHQDMLDWFAKH  238

Query  770  L  772
            +
Sbjct  239  V  239



>ref|NP_001030749.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE76782.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=236

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG + SKL VLL+SD+FG+EA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSAESKLCVLLISDIFGFEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F GDPY   N  +PI VW+KDH  D    + K V+E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFGGDPYNPSNQDRPIPVWIKDHGCDKGFENTKPVLETIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G    V+L+K   ++A VLLHP+FV +DDI+  K PI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWG---VVELSKEELIQAAVLLHPSFVNVDDIKGGKAPIAILGAEIDQMSPPAL  177

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI   V+HGWTVRY+ D+  AVKAAEEAH+++L WFV ++
Sbjct  178  LKQFEEILSSKPEVNSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYI  235



>ref|XP_002883437.1| hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59696.1| hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=236

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V++LG L+ YVSG   SKL VLL+SDVFGYEA NLR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSPDSKLCVLLISDVFGYEAPNLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F GDP+   N  +PI VW+KDH  D   ++ K V+E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFGGDPFDPSNQDRPIAVWIKDHGWDKGFDNTKPVLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G    V+L+K   ++A VLLHP+FVT+DDI+  K PI+I+GAE D+ +P  +
Sbjct  121  IGAAGMCWG---VVELSKEELIQAAVLLHPSFVTVDDIKGGKAPIAILGAEIDQMSPPAL  177

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEV+S VKI+  V+HGWTVRY  DD  AVKAAEEAH+++L WF  ++
Sbjct  178  LKQFEEILASKPEVNSYVKIYLKVSHGWTVRYSIDDPEAVKAAEEAHKEMLDWFATYV  235



>emb|CDY09036.1| BnaC01g30550D [Brassica napus]
Length=238

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M  P C  NPP L    G+G V++LG  + YVSG   S   VLLVSD++GY+A NLR LA
Sbjct  1    MLGPQCCENPPVLNPLSGSGHVEKLGG-DVYVSGSPDSNKCVLLVSDIYGYKAPNLRALA  59

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDPY   +  +P+ VW+KDH  D    D   V+E +K  G+T 
Sbjct  60   DKVAASGFYVVVPDYFYGDPYDPSHQDRPVPVWIKDHGHDKGFEDTNPVLEAIKNKGITA  119

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C GGK   +L+K   +EA VLLHP +VT+DDI+DVKVPI+I+GAEND  TP  +
Sbjct  120  IGAAGMCWGGKVVAELSKEELIEAAVLLHPTYVTVDDIKDVKVPIAILGAENDFLTPPAL  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV S VKIF  V+HGWT RYD +D  AVKAAEEAH+++L WFV ++
Sbjct  180  VKQFEEILPSKPEVGSYVKIFPNVSHGWTTRYDINDPEAVKAAEEAHKEMLDWFVTYV  237



>ref|XP_003529606.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Glycine 
max]
 gb|KHN03037.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=240

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 162/238 (68%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L    G G V ++G ++ Y +G  HSKLAVL++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPGGGVGHVDKVGGVDSYFTGSPHSKLAVLMLSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHA-VDNVCNDAKVVIEDLKAGGVT  415
            DK+G AG+YVVVPD   G+P+  +N  +P   W+KDH  V+      K +IE LK+ GV+
Sbjct  61   DKVGAAGYYVVVPDLLDGEPFNPQNSDRPFPAWIKDHGPVEKGAEATKPIIEALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +   G C G K  V+LAK   ++  VLLHP+FV+LDDI+ V +PI+I+GAE D+ +P E
Sbjct  121  AIAAVGFCWGAKVVVELAKSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            +VKQFE  L AK  V S VKIF  V+HGW VRY+ +D   VK AEEAHQDLL W  KH
Sbjct  181  LVKQFEQVLAAKSGVASFVKIFPKVSHGWAVRYNTEDAETVKVAEEAHQDLLDWLAKH  238



>ref|XP_010327300.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327301.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Solanum 
lycopersicum]
Length=254

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 162/237 (68%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C  NPP L SS G G V ++G+ N YVSGPS SKLA+LLVSDV+GYEA NLR + 
Sbjct  1    MSGRECCENPPALSSSSGNGCVLKVGSFNAYVSGPSTSKLAILLVSDVYGYEAPNLRNIV  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+YVVVPDFF GDPY     K + +W++ H       DAK +I  LK  G++ +
Sbjct  61   DKVAAAGYYVVVPDFFCGDPYTIE--KTLSIWIQSHGTAKGFEDAKQIIAVLKDKGISAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K   +LAK   ++A VLLHP+ V +DD ++VK PI+I+ AE D+ +P E++
Sbjct  119  GAAGFCWGAKVVTELAKSDYIQAAVLLHPSLVKVDDFKEVKAPIAILAAEIDKISPPELI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             QFE  L +KPEVD  VKIF GV HGWTVRY+ ++K AV+ AEEAH+D+L W  K++
Sbjct  179  IQFEEVLSSKPEVDKFVKIFPGVKHGWTVRYNVENKEAVQHAEEAHRDMLDWLTKYV  235



>ref|XP_009352130.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G V++ G L+ Y+ G   SKLAVLL+SD+FGY+A  LRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKFGGLDTYLVGSPDSKLAVLLLSDIFGYDAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK   AGF+VVVPDFF+GDP+   E G   +  WLK H  D    D K ++E LK+ G++
Sbjct  61   DKFADAGFFVVVPDFFYGDPFELGEEGFDALPGWLKHHEPDKAFEDTKPLLEALKSKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G+C G K  V+L+K   ++A  + HPAFVT+DD + VKVP  I+GAE D  +P E
Sbjct  121  AVGAVGLCFGAKVVVELSKHDLIQAAAMCHPAFVTVDDFKAVKVPTQILGAEIDHLSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE AL AKPE+ S VKIF  V HGWT RY+++D+AA KAAEEAHQDLL+W   H+
Sbjct  181  VVKQFEEALAAKPEIKSHVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWLQNHV  239



>ref|XP_003568483.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Brachypodium distachyon]
Length=240

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 168/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G+V    G +  YV+G   SK AV+LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVDSFGGIRAYVAGAQESKAAVILVSDVFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPDF HGDPYV E+  KPI VW+K+HA +    +AK VI  LK  G +
Sbjct  61   ADKVALSGYFVVVPDFIHGDPYVPESVDKPIAVWIKEHAPEKAFEEAKPVIAALKKQGAS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+LAK   ++A V+LHP+FVT+DDI++VK PI+I+GAE D+ +P E
Sbjct  121  SVGAAGYCWGAKVVVELAKANEIQAAVMLHPSFVTVDDIKEVKCPIAILGAEIDKMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE  L +   V   VKIF GV HGWTVRY+ DD +AVK+AEEA  D+  WF ++L
Sbjct  181  VVKQFEQVLSSNSGVGHFVKIFPGVAHGWTVRYNSDDASAVKSAEEALADMTSWFDQNL  239



>ref|XP_007224354.1| hypothetical protein PRUPE_ppa020844mg [Prunus persica]
 gb|EMJ25553.1| hypothetical protein PRUPE_ppa020844mg [Prunus persica]
Length=263

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 167/262 (64%), Gaps = 25/262 (10%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVF-----------  208
            M+ P C +NPP L  SYG    ++LG LN Y +G  +SKLA++LVSDVF           
Sbjct  1    MAGPQCCSNPPILSPSYGVDCAEKLGGLNVYAAGSPNSKLAIVLVSDVFEEPITYNQLGF  60

Query  209  --------------GYEATNLRKLADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKD  346
                          GY A NLRKL +K+  AGF+VVVP+FF+ DP+V +  +P+ VWL+D
Sbjct  61   VKQFTELTYLICPAGYRAPNLRKLGEKVAAAGFFVVVPNFFYDDPFVYDNNRPLAVWLED  120

Query  347  HAVDNVCNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLD  526
            H  D    DAK +I  LK  G + +G  G C GGK   +LAK   V+A VLLHP+FV LD
Sbjct  121  HGTDKGFEDAKSIINALKEKGYSAIGAAGFCWGGKVVTELAKSDFVQAAVLLHPSFVALD  180

Query  527  DIQDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdedd  706
            DI+ VKVP++++GAE DE +P E++KQFE  L AK E+DS VKIF    H WTVRY+ +D
Sbjct  181  DIEGVKVPMAVLGAEIDEYSPLELLKQFEEILAAKTEIDSYVKIFPKAEHSWTVRYNVED  240

Query  707  kaavkaaeeaHQDLLKWFVKHL  772
            + AVK AEEAH +++ WF KH+
Sbjct  241  EEAVKRAEEAHNNMIDWFSKHV  262



>ref|XP_002516792.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF45406.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 162/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG VQ+ G L  YV+GP HS LA++L+SD+FG+EA NLRKLA
Sbjct  1    MSSSQCFENPPSLTSTCGAGTVQEFGGLKIYVTGPPHSTLAIILISDIFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+V+VPDFF+GDP  + N       W K H  D    DAK VI  LK  GV+ 
Sbjct  61   DKVAAAGFFVLVPDFFYGDPVDLNNPEFDRESWRKVHNADKGYEDAKQVIAALKCKGVSS  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +   G C GG+  V LA    ++A V+LHP  +T+DDI +VKVPI+ +GAE D  +P E 
Sbjct  121  ISAAGFCWGGRVVVKLASSDDIKAAVVLHPGRLTVDDINEVKVPIAFLGAEFDHASPPEQ  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQF   L AK E DS VKIF GV+HGW+VRY+ +D++AV++AEEA  D+L WF K++
Sbjct  181  LKQFGEVLSAKSEFDSFVKIFPGVSHGWSVRYNVEDESAVRSAEEAQSDMLNWFTKYV  238



>ref|XP_009788741.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Nicotiana sylvestris]
Length=239

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 173/238 (73%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L SS G G V + G L  YVS  S+SK A+LLVSD+FGYEA NLRKLA
Sbjct  1    MSGPQCCENPPTLSSSSGVGSVLEFGGLKTYVSASSNSKHAILLVSDIFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G+YVVVPDF +GDPY  E   KP+ +WL+ H VD    DAK V+  LK  G++ 
Sbjct  61   DKVAAVGYYVVVPDFLYGDPYNPETMEKPLSIWLQSHGVDKGFEDAKQVVAALKDKGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V LAK   ++A VLLHP+FVT+DDI++VK PI+I+GAE D+ +P E+
Sbjct  121  IGAAGFCWGAKVVVQLAKSDDIQAAVLLHPSFVTVDDIKEVKAPIAILGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L +KPEVD+ VKI+ GV HGWTVRYD +DK AV++AEEAH+D+L+WF KH+
Sbjct  181  IKQFEEILSSKPEVDNFVKIYPGVAHGWTVRYDVEDKKAVESAEEAHRDMLEWFTKHV  238



>ref|XP_006654368.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Oryza brachyantha]
Length=240

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 167/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G GQV    G +  YVSG + SK AV+LVSDV+G+EA NLRK+
Sbjct  1    MASPQCCANPPTLDPAGGEGQVVDSFGGIKAYVSGAADSKAAVVLVSDVYGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++V+VPDF HGDP+V EN  +PI VW+K+H  D    +AK VI  LK  GV+
Sbjct  61   ADKVASSGYFVMVPDFLHGDPFVRENTERPIQVWIKEHGADKGFEEAKPVIAALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  V+LAK   ++A V+ HP+FVT+DDI++VK PI+I+GAE D  +P E
Sbjct  121  SIGAVGYCWGAKVVVELAKAHEIQAAVMCHPSFVTVDDIKEVKCPIAILGAETDIMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L +K  +   VKIF GV HGWTVRY  DD AAVK+AEEA  D+  WF K+L
Sbjct  181  LIKQFEQVLSSKSRIAHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMTDWFNKNL  239



>ref|XP_010488431.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Camelina 
sativa]
Length=239

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L    G+G V+++G L+ YVSG   SKL +LL+S+VFGYEA  LR LA
Sbjct  1    MSGPQCCENPPTLNPVSGSGHVEKVGGLDAYVSGSPDSKLCILLISEVFGYEAPKLRALA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  +GFYVVVPD+F+GDPY   +  +P+ VW+KDH  D    D   V+E +K  G+T 
Sbjct  61   DKVAASGFYVVVPDYFYGDPYNPADQDRPVLVWIKDHGCDKGFEDTIPVLEAIKNKGITA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G+C G K  V+L+K+  ++A VLLHP FVT+DDI+  K PI+I+GAE D  T   +
Sbjct  121  IGAAGMCWGAKVVVELSKMELIQAAVLLHPTFVTVDDIKGGKAPIAILGAELDHWTSPAL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L +KPEV S VKI   V+HGWTVRY+ D+  AVKAAEEAH+++L WFV +L
Sbjct  181  VKQFEETLASKPEVPSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYL  238



>gb|ACU23923.1| unknown [Glycine max]
Length=240

 Score =   237 bits (604),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 162/238 (68%), Gaps = 2/238 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L    G G V ++G ++ Y +G  HSKLAVL++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPGGGVGHVDKVGGVDSYFTGSPHSKLAVLMLSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHA-VDNVCNDAKVVIEDLKAGGVT  415
            DK+G AG+YVVVPD   G+P+  +N  +P   W+KDH  V+      K +IE LK+ GV+
Sbjct  61   DKVGAAGYYVVVPDLLDGEPFNPQNSDRPFPAWIKDHGPVEKGAEATKPIIEALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +   G C G K  V+LAK   ++  VLLHP+FV+LDDI+ V +PI+I+GAE D+  P E
Sbjct  121  AIAAVGFCWGAKVVVELAKSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVFPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
            +VKQFE  L AK  V S VKIF  V+HGW VRY+ +D  AVK AEEAHQDLL W  KH
Sbjct  181  LVKQFEQVLAAKSGVASFVKIFPKVSHGWAVRYNTEDAEAVKVAEEAHQDLLDWLAKH  238



>gb|EYU45607.1| hypothetical protein MIMGU_mgv1a012169mg [Erythranthe guttata]
Length=259

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 155/219 (71%), Gaps = 3/219 (1%)
 Frame = +2

Query  119  GQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGD  298
            G+V+Q G L+CY+SGPS+SK A++L++DVFG+  ++ R++ADK+  AG+Y V+PDFF GD
Sbjct  43   GKVKQFGGLDCYISGPSYSKTAIILITDVFGFAPSHSREIADKVAAAGYYTVLPDFFRGD  102

Query  299  PYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIP  478
            PYV    KP   W+K HA +    DA  +I+ LKA G+TK+G+ G C GGK A DL+K P
Sbjct  103  PYVR--GKPFAPWIKKHAPEKGIKDAIPIIKALKARGITKIGVAGFCWGGKVAADLSKYP  160

Query  479  CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKI  658
             VEATVLLHP + T +DIQ  KVPISI+G E D     E+VK+FE  L++KPEVDS VKI
Sbjct  161  YVEATVLLHPTYTTTEDIQGDKVPISILGGEKDTYCKPELVKEFENILKSKPEVDSFVKI  220

Query  659  FDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
              GV HGWT+RY    + A+K A E+H D+L WF  HL 
Sbjct  221  VPGVDHGWTLRY-NSSEFALKKAAESHNDMLDWFEMHLR  258



>ref|XP_009588353.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Nicotiana tomentosiformis]
Length=238

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 165/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C+ NPP L S+ GAG +Q +G LN YV+G   SKLA+LL+SDVFGYEA  LRK+A
Sbjct  1    MSRPQCLKNPPTLNSASGAGDLQDIGGLNSYVTGSVDSKLAILLISDVFGYEAPLLRKIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  AG+ VVVPDFF+G+P ++     +  WLKDH  D  C DAK V+E LK+ GV+ +
Sbjct  61   DKVAAAGYLVVVPDFFYGEP-LDREKHNVQTWLKDHGADKGCEDAKAVVESLKSKGVSSI  119

Query  422  GIGGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            G  G C GG     LAK    + A V+LHP  +T+D+I +VKVP +I+ AE+D   P + 
Sbjct  120  GAAGFCWGGMVVSKLAKHENSIGAAVILHPGPITVDEINEVKVPTAILAAEHDHIFPPDQ  179

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
             KQ   AL AK E++S VKIF GV HGWTVRY+ +D++AVKAAEEAH D+L WF K ++
Sbjct  180  AKQLTDALSAKSEIESCVKIFPGVEHGWTVRYNVEDESAVKAAEEAHSDMLNWFTKFIN  238



>ref|XP_009365791.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Pyrus x bretschneideri]
Length=240

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C ++PP L  S G+G V++ G L+ Y+ G   SKLAVLL+SD+FGY+A  LRKLA
Sbjct  1    MSGPQCCSHPPTLNPSSGSGHVEKFGGLDTYLVGSPDSKLAVLLLSDIFGYDAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYV--ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK   AGF+VVVPDFF+GDP+   E G   +  WLK H  D    D K ++E LK+ G++
Sbjct  61   DKFADAGFFVVVPDFFYGDPFELGEEGFDALPGWLKHHEPDKAFEDTKPLLEALKSKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G+C G K  V+L+K   ++A  + HPAFVT+DD + VKVP  I+GAE D  +P E
Sbjct  121  AVGAVGLCFGAKVVVELSKHDLIQAAAMCHPAFVTVDDFKAVKVPTQILGAEIDHMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE AL AKPE+ S VKIF  V HGWT RY+++D+AA KAAEEAHQDLL+W   ++
Sbjct  181  VVKQFEEALAAKPEIKSHVKIFPKVEHGWTTRYNDEDEAACKAAEEAHQDLLEWLQNYV  239



>ref|XP_002439762.1| hypothetical protein SORBIDRAFT_09g019630 [Sorghum bicolor]
 gb|EES18192.1| hypothetical protein SORBIDRAFT_09g019630 [Sorghum bicolor]
Length=239

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 162/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G+V    G L  YV+GP  SK AV+LV+DVFG+EA  LRK+
Sbjct  1    MASSQCCDNPPALNPACGEGKVVDSFGGLKAYVAGPEDSKAAVVLVADVFGFEAPILRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADK+  +G++VVVPDFFHGDPYV    KPI  WLK H  +    +AK VI  LK  GV+ 
Sbjct  61   ADKVASSGYFVVVPDFFHGDPYVPENGKPIPEWLKSHTPEKGFEEAKPVIATLKEKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C G K  V+LAK   ++A VLLHP+FVT+DDI++VK PISI+GAE D+ +P E+
Sbjct  121  VGAAGYCWGAKVVVELAKAHEIQAAVLLHPSFVTIDDIKEVKCPISILGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L     V   VKIF GV HGW+VRY  DD AAVK+AEEA  D+L WF K+L
Sbjct  181  VKQFEQVLSVNSGVGHFVKIFPGVAHGWSVRYSHDDAAAVKSAEEAFADMLDWFNKNL  238



>gb|KDP40091.1| hypothetical protein JCGZ_02089 [Jatropha curcas]
Length=240

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 157/239 (66%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS HC  NPP L  +YGAG VQ+LG L  YV+GP  SKLA+LLV D FGYE  NLRKLA
Sbjct  1    MSSSHCFENPPTLNPNYGAGTVQELGGLKTYVTGPPDSKLAILLVCDAFGYETPNLRKLA  60

Query  242  DKIGGA-GFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+  A GF VVVPDF +GDP  V N      VWLK+H     C DAK VI  LK+ G++
Sbjct  61   DKVAAAAGFLVVVPDFLYGDPADVNNPQFDRHVWLKNHDTTEGCKDAKAVIAGLKSRGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP  +T D+I  VKVP +I+GAE D+  P E
Sbjct  121  SIGAAGFCWGGMVVVKLASCNDIQAAVILHPGLITADEINAVKVPTAILGAEKDKICPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +KQ    L  K E++S VKIF GV HGWT+RY ++D +AVK AEEAH DLL WF  H+
Sbjct  181  QLKQLGELLAVKSEIESYVKIFPGVAHGWTLRYSDEDDSAVKIAEEAHSDLLNWFTTHV  239



>ref|XP_011090811.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Sesamum indicum]
Length=236

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 161/237 (68%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C  NPP L  + GAG VQQ+G  N YV+G   SKLA++ ++D FG+E   LRKLA
Sbjct  1    MSGPQCAHNPPTLDPASGAGHVQQIGGFNTYVTGDQDSKLAIIFLADAFGWEVPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  +GF VVVPDF++GD +    A     W+  H  D  C+DA+ +I  LK+ GV+K+
Sbjct  61   DKVAESGFLVVVPDFYYGDKFTLEKAGQ--GWVDTHPPDRGCDDARTIIAALKSKGVSKI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C GG  AV LAK  C+EA V+LHP  +T+++I +VK PI+I+GAE D   P E+V
Sbjct  119  GAAGFCWGGMVAVRLAKYDCIEAAVVLHPGPITVEEINEVKTPIAILGAEIDHIGPPEMV  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQ E  L +KPEVDS VKIF GV HGWTVRY++DD+  VK+A E+H D+L W  K++
Sbjct  179  KQLEDVLSSKPEVDSFVKIFPGVGHGWTVRYNDDDEFEVKSALESHSDMLNWLTKYV  235



>gb|EYU45606.1| hypothetical protein MIMGU_mgv1a012169mg [Erythranthe guttata]
Length=259

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 157/219 (72%), Gaps = 3/219 (1%)
 Frame = +2

Query  119  GQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGD  298
            G+V+Q G L+CY+SGPSHS+ A++L++DVFG+  ++ R++ADK+  AG+Y V+PDFF GD
Sbjct  43   GKVKQFGGLDCYISGPSHSETAIILITDVFGFAPSHSREIADKVAAAGYYTVLPDFFRGD  102

Query  299  PYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIP  478
            PY ++GA P+  WLK HA +    DA  +IE LK  G+TK+G+ G C GGK A DL+K P
Sbjct  103  PY-QHGA-PLTPWLKKHAPEEGIKDAIPIIEALKGRGITKIGVAGFCWGGKVAADLSKYP  160

Query  479  CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKI  658
             VEATVLLHP + T +DIQ  KVPISI+G E D     E+VK+FE  L++KPEVDS VKI
Sbjct  161  YVEATVLLHPTYTTTEDIQGDKVPISILGGEKDTYCKPELVKEFENILKSKPEVDSFVKI  220

Query  659  FDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
              GV HGWT+RY    + A+K A E+H D+L WF  HL 
Sbjct  221  VPGVDHGWTLRY-NSSEFALKKAAESHNDMLDWFEMHLR  258



>ref|XP_010103444.1| hypothetical protein L484_010046 [Morus notabilis]
 gb|EXB95847.1| hypothetical protein L484_010046 [Morus notabilis]
Length=527

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 171/236 (72%), Gaps = 3/236 (1%)
 Frame = +2

Query  71   PHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKI  250
            PHC +NPP L +S GAG V++LG L+ YV+G   SK AV+LVSDV+GY+A NLRKLADKI
Sbjct  31   PHCGSNPPTLNASSGAGHVEKLGGLDSYVTGFPISKHAVILVSDVYGYQAPNLRKLADKI  90

Query  251  GGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGI  427
              AGF+V VPDFFHG+PY   N ++P   WL DH  +    +AK +I+DLK+ G + +G+
Sbjct  91   AAAGFFVAVPDFFHGEPYDPNNTSRPKDAWLNDHRPEKGFEEAKPLIKDLKSKGFSAIGV  150

Query  428  GGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVK  604
             G C G K A++LAK+   V+AT +LHP+FVTLDDI++VKVP+ + GAE D+  P E+V 
Sbjct  151  AGFCWGAKVAIELAKLKNFVQATAILHPSFVTLDDIKEVKVPLGVFGAELDKQYPRELVN  210

Query  605  QFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            QFE  L+A  ++D  VKI+ GV HG+T+RYD  D  A K A+EAH+DLL WF K++
Sbjct  211  QFEEVLRAN-KIDHFVKIYQGVKHGFTLRYDVQDDLARKRAKEAHKDLLNWFTKNV  265


 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 164/233 (70%), Gaps = 11/233 (5%)
 Frame = +2

Query  107  SYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGAGFYVVVPDF  286
            S GAG V++LG L+ YV+G  +SKLAVLL+SDV+GYEA NLRKLADKI  AGF+V V DF
Sbjct  294  SSGAGHVEKLGGLDSYVTGSPNSKLAVLLISDVYGYEAPNLRKLADKIAAAGFFVAVSDF  353

Query  287  FHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVD  463
             HGDPYV N A + + VW+KDH  D    +AK VIE LK+ G + +   G C G K  ++
Sbjct  354  LHGDPYVPNDASRSVSVWIKDHGTDKGFEEAKPVIEGLKSKGFSAIVAAGFCWGAKVVIE  413

Query  464  LAKIP-CVEATVLLHPAFVTLDDI---------QDVKVPISIIGAENDETTPAEVVKQFE  613
            LAK    ++A  LLHP+FV +DDI         ++VKV  +I+GAE+D  +P  +VKQFE
Sbjct  414  LAKFTNFIQAAALLHPSFVIVDDIKGMLETLNSKEVKVSTAILGAEHDNLSPPPLVKQFE  473

Query  614  IALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
              L AKPE+++ VKI+ GV HGWTVRYD  D+AA K AEEAH+DLL++F KH+
Sbjct  474  KVLSAKPEINTFVKIYPGVAHGWTVRYDVKDEAASKRAEEAHKDLLEFFTKHV  526



>ref|XP_006850805.1| hypothetical protein AMTR_s00025p00112220 [Amborella trichopoda]
 gb|ERN12386.1| hypothetical protein AMTR_s00025p00112220 [Amborella trichopoda]
Length=239

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 165/240 (69%), Gaps = 5/240 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+ P C  NPP L SS G G V++LG L  YV+G S SK A++LVSD+FG+EA NLR+LA
Sbjct  1    MAGPQCCENPPTLRSSSGEGHVEELGGLKAYVTGSSDSKRAIVLVSDIFGFEAPNLRRLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV---WLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AG+YVVV D+F+GDP+  +  +P      WL+ H  +     +K +IE LK+ G+
Sbjct  61   DKVASAGYYVVVTDYFYGDPFAPD--QPFDAFPNWLQSHKPEKAFEVSKPIIEALKSKGI  118

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + +G GG C G K  V+LAK   ++A VLLHP+ V  +DI +VK PI+I+GAE D+ +P 
Sbjct  119  SAIGAGGFCWGAKVVVELAKSGSIQAAVLLHPSLVKPEDISEVKCPIAILGAEIDKASPP  178

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+VKQFE  L  + +VD+ VKIF GV HGWTVRY  DD+  VK AEEAH D+L WF K++
Sbjct  179  ELVKQFEEILSTRNKVDNFVKIFPGVAHGWTVRYSLDDETVVKNAEEAHTDMLNWFNKYV  238



>gb|EYU45608.1| hypothetical protein MIMGU_mgv1a012169mg [Erythranthe guttata]
Length=259

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = +2

Query  119  GQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGD  298
            G+V+Q G L+CY+SGPS+SK A++L++DVFG+  ++ R++ADK+  AG+Y V+PDFF GD
Sbjct  43   GKVKQFGGLDCYISGPSYSKTAIILITDVFGFAPSHSREIADKVAAAGYYTVLPDFFRGD  102

Query  299  PYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIP  478
            PYV    KP   W+K HA +    DA  +I+ LKA G+TK+G+ G C GGK A DL+K P
Sbjct  103  PYVR--GKPFAPWIKKHAPEKGIKDAIPIIKALKARGITKIGVAGFCWGGKVAADLSKHP  160

Query  479  CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKI  658
             VEATVLLHP   T +DI+  KVPISI+G E D+    E+VK+FE  L++KPEVDS VKI
Sbjct  161  YVEATVLLHPTSTTTEDIRGDKVPISILGGELDDLCKPELVKEFENILKSKPEVDSFVKI  220

Query  659  FDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            F GV HGWT+RY  + + A+K AEE+H D+L WF  HL 
Sbjct  221  FPGVAHGWTLRY-NNTEFAIKKAEESHSDMLHWFDMHLR  258



>ref|XP_004962159.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Setaria italica]
Length=239

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + GAG+V    G L  YV+G   SK AV+L++DVFG+EA NLRK+
Sbjct  1    MASSQCCENPPALDPAGGAGKVVDSFGGLKAYVAGAEDSKAAVVLIADVFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            ADK+  +G++VVVPDFFHGD Y+    KPI  WLK HA +    DAK VI  LK  GV+ 
Sbjct  61   ADKVALSGYFVVVPDFFHGDAYIPENEKPIHEWLKSHAPEKGFEDAKPVIAALKEQGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VLLHP+FV++DD+++VK PISI+GAE D+ +P E+
Sbjct  121  IGAAGYCWGAKVVVELSKAQEIQAAVLLHPSFVSVDDMKEVKCPISILGAEVDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AK  V   VK+F GV+HGW+VRY  DD AAVK+AEEA  D++ WF K+L
Sbjct  181  VKQFEQVLSAKSGVGHFVKVFPGVSHGWSVRYSHDDAAAVKSAEEALADMIDWFNKNL  238



>ref|XP_004296955.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Fragaria vesca 
subsp. vesca]
Length=244

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 168/244 (69%), Gaps = 8/244 (3%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + G+G V++L  L+ YV+G   SKLA+LL++D+FGYEA  LRKLA
Sbjct  1    MSGPACCSNPPALNPASGSGHVEKLAGLDSYVTGSPDSKLAILLIADIFGYEAPLLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG------VWLKDHAVDNVCNDAKVVIEDLKA  403
            DKI   G++VVVPDFF+GD +    A P+G      +WLK H     C  AK ++E LK+
Sbjct  61   DKIAAVGYFVVVPDFFYGDAF-PGDAGPVGNSSALPIWLKTHIPIKACEAAKPLVEALKS  119

Query  404  GGVTKVGIGGVCSGGKAAVDLAKIP-CVEATVLLHPAFVTLDDIQDVKVPISIIGAENDE  580
             GV+ +G  G C G KA V+LAK    + A VL HP+FVT+DD + VKVPISI+GAE D 
Sbjct  120  RGVSAIGAVGFCWGAKAVVELAKYDNFLHAAVLCHPSFVTVDDCKAVKVPISILGAEIDP  179

Query  581  TTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWF  760
             +P +VVKQFE  L AK E+ S VKIF  V HGWTVRY+ +D+AAVK AEEAHQD+L WF
Sbjct  180  ISPPDVVKQFEEVLTAKTEIKSHVKIFPKVQHGWTVRYNAEDEAAVKCAEEAHQDILDWF  239

Query  761  VKHL  772
              HL
Sbjct  240  FSHL  243



>gb|KEH32215.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=239

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 160/238 (67%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M  P C +NPP L S  GAG V +LG ++ Y++G       +LLVSD+FGY+A  LR  A
Sbjct  1    MLGPACCSNPPILNSFSGAGHVAKLGGVDAYLTGSPLCTFVILLVSDIFGYKAPILRMFA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G+YVVVPDFF+GDPY   N  +PI VW+KDH  +     ++ +IE LK+ G++ 
Sbjct  61   DKVAATGYYVVVPDFFNGDPYDPRNVDRPIDVWVKDHLPETGFEVSQPIIEALKSKGIST  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   +L K   ++A VL HP+++T+DDI  V +PI+I+GAEND+ TP EV
Sbjct  121  IGAAGFCWGAKTVCELGKSKLIQAAVLAHPSYITVDDINGVNIPIAILGAENDQVTPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L A  EVDS VKIF  V+HGWT+RYD  D  AVKA+EEA Q LL WF KHL
Sbjct  181  IKQFEQVLAANSEVDSFVKIFPNVSHGWTIRYDTKDPEAVKASEEARQILLDWFDKHL  238



>gb|AAU10802.1| putative endo-1,3;1,4-beta-D-glucanase [Oryza sativa Japonica 
Group]
 dbj|BAG87591.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63648.1| hypothetical protein OsJ_18465 [Oryza sativa Japonica Group]
Length=240

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 166/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G+V +  G +  YV+G + SK AV+L+SDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVESFGGIKAYVAGAAESKAAVVLISDVFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPDF HGDP V E+  KP  +W+K+H  D    +AK +I  LK  GV+
Sbjct  61   ADKVASSGYFVVVPDFLHGDPLVPESTEKPFQMWIKEHGPDKAFEEAKPIIAALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  V+L K   ++A V+ HP+FVT+DD+++VK PI+I+GAE D  +P E
Sbjct  121  SIGAVGYCWGAKVVVELVKAHEIQAAVMCHPSFVTVDDMKEVKCPIAILGAEIDRMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE  L +K  +   VKIF GV HGWTVRY  DD AAVK+AEEA  D++ WF K+L
Sbjct  181  VVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMIDWFNKNL  239



>ref|XP_008367178.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=236

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 166/237 (70%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C  NPP L  S  +G V++LG  + YV+G   S+L+VLLV D FG   T   KLA
Sbjct  1    MASSECCLNPPALNPSSSSGHVEKLGGFDSYVTGSPDSRLSVLLVHDAFGTLPTT-PKLA  59

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DKI  AGF VV+PDFF+GDP+  + A  I VW K HA +    DAK+VIE L++ GV+ +
Sbjct  60   DKIAAAGFIVVLPDFFNGDPFNGDRAS-IPVWRKTHAPEKTIEDAKLVIEALRSKGVSAI  118

Query  422  GIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVV  601
            G  G C G K  +DLAK   ++A VL HP+ VTLDDI+ VKVPIS++GAE D+  P EV+
Sbjct  119  GAAGFCWGAKGVIDLAKHDFIQAAVLCHPSSVTLDDIKAVKVPISVLGAEIDQMYPPEVI  178

Query  602  KQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            KQFE  L AKPE+ S VKIF  V HGWT+RYD++D+AAVKAA EAHQDLL WF++H+
Sbjct  179  KQFEEVLTAKPEIKSHVKIFPKVAHGWTLRYDDEDEAAVKAAGEAHQDLLGWFLEHV  235



>ref|XP_010101277.1| hypothetical protein L484_011641 [Morus notabilis]
 gb|EXB88212.1| hypothetical protein L484_011641 [Morus notabilis]
Length=270

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 169/270 (63%), Gaps = 32/270 (12%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+   C +NPP +    G G V++LG L  Y SG   SK+AV+L+SDVFGYEA N+R +A
Sbjct  1    MAGNQCCSNPPVMDPGSGEGSVEELGGLKVYTSGSPSSKMAVILISDVFGYEAPNIRMVA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKV  421
            DK+  +GF+VVVPDFFHGDP+  +  KP+ VWLKDH  D    + K V+E LK+ G + +
Sbjct  61   DKVAASGFFVVVPDFFHGDPFAYSNNKPLAVWLKDHGTDKGFEEVKPVVEALKSKGFSSL  120

Query  422  GIGGVCSGGKAAVDLAKIPCV--------------------------------EATVLLH  505
            G  G C G K   +++K   +                                +A VLLH
Sbjct  121  GAAGFCWGAKVVTEISKSKSIIQAAVLLHPSFVTLDDITAKVVTEISKSKSIIQAAVLLH  180

Query  506  PAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWT  685
            P+FVTLDDI  V VPI+I+GAE D+ +P  ++KQFE  L AKPEVDS V+IF  V HGWT
Sbjct  181  PSFVTLDDITGVNVPIAILGAEIDDYSPPALLKQFEAILIAKPEVDSHVEIFPNVKHGWT  240

Query  686  VRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +RY+ +D+AAV +AEEAH+ +L+WF K+++
Sbjct  241  LRYNVNDEAAVNSAEEAHRKMLEWFSKYVN  270



>ref|NP_001055474.1| Os05g0399100 [Oryza sativa Japonica Group]
 dbj|BAF17388.1| Os05g0399100, partial [Oryza sativa Japonica Group]
Length=284

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 171/256 (67%), Gaps = 2/256 (1%)
 Frame = +2

Query  11   LRTKKAT*SQSKA*YNIMSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAV  187
            LR +K    +       M+SP C ANPP L  + G G+V +  G +  YV+G + SK AV
Sbjct  28   LRLEKHRDQEKFQQEQAMASPQCCANPPTLNPAGGEGKVVESFGGIKAYVAGAAESKAAV  87

Query  188  LLVSDVFGYEATNLRKLADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNV  364
            +L+SDVFG+EA NLRK+ADK+  +G++VVVPDF HGDP V E+  KP  +W+K+H  D  
Sbjct  88   VLISDVFGFEAPNLRKIADKVASSGYFVVVPDFLHGDPLVPESTEKPFQMWIKEHGPDKA  147

Query  365  CNDAKVVIEDLKAGGVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVK  544
              +AK +I  LK  GV+ +G  G C G K  V+L K   ++A V+ HP+FVT+DD+++VK
Sbjct  148  FEEAKPIIAALKEKGVSSIGAVGYCWGAKVVVELVKAHEIQAAVMCHPSFVTVDDMKEVK  207

Query  545  VPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavka  724
             PI+I+GAE D  +P EVVKQFE  L +K  +   VKIF GV HGWTVRY  DD AAVK+
Sbjct  208  CPIAILGAEIDRMSPPEVVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKS  267

Query  725  aeeaHQDLLKWFVKHL  772
            AEEA  D++ WF K+L
Sbjct  268  AEEALADMIDWFNKNL  283



>ref|XP_010024433.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60877.1| hypothetical protein EUGRSUZ_H03609 [Eucalyptus grandis]
Length=240

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 167/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M S  C  NPP L S+ GAG+V++L  L  YV+GPS SK A+L + D FGYEA  LRKLA
Sbjct  1    MLSSQCFENPPNLSSTCGAGRVEELAGLKTYVTGPSDSKRALLFIPDAFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+  AGF+VVVPDF++GDP ++  +    I VWLK+H+ D    DAK VI  LK+ GV+
Sbjct  61   DKVASAGFFVVVPDFYYGDPVIDVNDPNFNIEVWLKNHSPDKGYEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G+ G C GG   V LA    ++A V+LHP  +T D+I+ VK+P +I+GAEND   PA+
Sbjct  121  AIGVAGFCWGGMVLVKLAGTEDIQAAVILHPGRITEDEIRAVKIPTAILGAENDHIFPAD  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+    + AK E +S VKIF GV HGW+VRY++DD++AVK+A+EA +D+L WF+KH+
Sbjct  181  ELKKLGEIMSAKTEFESYVKIFPGVRHGWSVRYNDDDESAVKSAKEAQEDMLNWFLKHV  239



>gb|KEH32211.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=293

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP L    GAG V+++G L+ Y++G   S  A+L VSD++GYE+  +R LA
Sbjct  55   MSGHACCSNPPILNPFSGAGHVEKIGGLDAYLTGSPLSTKAILFVSDIYGYESPIIRNLA  114

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F+GDPY ++   +P+ +W++DH  D     ++ +IE LK+ GV+ 
Sbjct  115  DKVAAAGYYVVVPDYFYGDPYDDDRVDRPLPIWMEDHEPDKGFEASQPIIEALKSKGVSA  174

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   +L K   ++A VL HP+ +T++DI  V +PI+I+GAE D  TP EV
Sbjct  175  IGAAGYCWGAKTVCELGKSKLIQAVVLAHPSLITVEDINGVNIPIAILGAELDPITPPEV  234

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AKPEVDS VKIF  V+HGWT+RYD +D  AVKAAEEAHQ LL WFVK++
Sbjct  235  IKQFEQVLAAKPEVDSFVKIFPNVSHGWTIRYDTEDPEAVKAAEEAHQILLDWFVKYV  292



>ref|XP_010024431.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60873.1| hypothetical protein EUGRSUZ_H03606 [Eucalyptus grandis]
Length=240

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG +++L  L  YV+GPS SK AVLL++D FGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHIEELAGLKTYVTGPSDSKRAVLLIADAFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV--WLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI  AGF VVVPDFF+GDP ++  +    +  W K+H  D    DAK VI  LK+ GV+
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNLEAWFKNHGTDKGYEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP  +T D+I+ VK+P +I+GAE D ++P E
Sbjct  121  AIGAAGFCWGGMVLVKLAGTEDIQAAVILHPGPMTEDEIKAVKIPTAILGAEIDHSSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+F   + AK E +S VKIF GV+HGW+VRYD+D++  VK+AEEA +D L WF+KH+
Sbjct  181  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNEFVVKSAEEAQEDTLNWFLKHV  239



>ref|XP_008340900.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Malus domestica]
Length=239

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 168/238 (71%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+S  C +NPP L  S G G V+ LG L+ YV+G  HS LAVLLVSD+ G+EA  LRKLA
Sbjct  1    MASSQCCSNPPTLNPSSGTGHVENLGGLDSYVTGSPHSNLAVLLVSDIHGFEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VVVPDFF  DPY  + A +P  VW  DH  D     AK  +E LK+ G + 
Sbjct  61   DKVAAAGFFVVVPDFFBKDPYAPDDANRPFDVWKIDHHPDKGFEAAKPXLEALKSKGXSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+LAK+P ++A VL HPA VT+DD ++VKVPISI+GAE D+  P EV
Sbjct  121  IGAAGFCWGAKVVVELAKLPLIQAAVLCHPAVVTVDDFKEVKVPISILGAEIDQMCPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VKQFE  L AKPEV S VKIF  V HGWTVRY+ +DKAA KAAEEAHQDLL+WF+ H+
Sbjct  181  VKQFEXVLTAKPEVKSHVKIFPKVAHGWTVRYNVEDKAACKAAEEAHQDLLEWFLNHV  238



>ref|XP_010024432.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60879.1| hypothetical protein EUGRSUZ_H03610 [Eucalyptus grandis]
Length=240

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 162/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG +++L  L  YV+GPS SK AVLL++D FGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHIEELAGLKTYVTGPSDSKRAVLLIADAFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV--WLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI  AGF VVVPDFF+GDP ++  +    +  W K+H  D    D K VI  LK+ GV+
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNLEAWFKNHGTDKGYEDVKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP   T D+I+ VK+P +I+GAE D+ +P E
Sbjct  121  AIGAAGFCWGGMVLVKLAGTEDIQAAVILHPGPTTEDEIKAVKIPTAILGAEIDQHSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+F   + AK E +S VKIF GV+HGW+VRYD+D++  VK+AEEAH+D L WF+KH+
Sbjct  181  KLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNEFVVKSAEEAHEDALNWFLKHV  239



>ref|XP_007150409.1| hypothetical protein PHAVU_005G151000g [Phaseolus vulgaris]
 gb|ESW22403.1| hypothetical protein PHAVU_005G151000g [Phaseolus vulgaris]
Length=239

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = +2

Query  77   CIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGG  256
            C++NPP L +S G G V  +  +N YV+G   + LA++L+SDV+G++   LRK+ADK+  
Sbjct  5    CLSNPPILNASTGVGYVTNIAGVNSYVTGSPLAILAIVLISDVYGFKPPLLRKIADKVAN  64

Query  257  AGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGG  433
             G++VVVPDFFHG+PY  EN ++P   WLKDH        AK +IE LK  G + VG+ G
Sbjct  65   HGYFVVVPDFFHGEPYNKENASRPFDPWLKDHDPAKGIETAKPIIEALKRKGASAVGVAG  124

Query  434  VCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFE  613
             C G +    L K   V+A+VLLHP+++T+DDI+ V+VPI+I+GAE+D  +P +++KQF+
Sbjct  125  FCWGARTVTKLGKAKLVQASVLLHPSYITVDDIRGVEVPIAILGAEHDSLSPPKLLKQFK  184

Query  614  IALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
              L AKPE+DS VKIF  V+HGWTVRYD +D  AVKAA +AH+ ++ WF KHL
Sbjct  185  QVLDAKPEIDSYVKIFANVSHGWTVRYDPNDPKAVKAAGKAHKIMINWFDKHL  237



>gb|EAY97963.1| hypothetical protein OsI_19880 [Oryza sativa Indica Group]
Length=240

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 165/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G+V    G +  YV+G + SK AV+LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTLNPAGGEGKVVDSFGGIKAYVAGAAESKAAVVLVSDVFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPDF  GDP V E+  KP  +W+K+H  D    +AK +I  LK  GV+
Sbjct  61   ADKVASSGYFVVVPDFLDGDPLVPESTEKPFQMWIKEHGPDKAFEEAKPIIAALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C G K  V+LAK   ++A V+ HP+FVT+DD+++VK PI+I+GAE D  +P E
Sbjct  121  SIGAVGYCWGAKVVVELAKAHEIQAAVMCHPSFVTVDDMKEVKCPIAILGAEIDRMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE  L +K  +   VKIF GV HGWTVRY  DD AAVK+AEEA  D++ WF K+L
Sbjct  181  VVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMIDWFNKNL  239



>dbj|BAJ98176.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G+V    G +  YV+G   SK AV+L+SDVFG+ A NLRK+
Sbjct  1    MASPQCCANPPTLNPAAGEGKVVDSFGGIKAYVAGAQESKAAVVLISDVFGFGAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPDF HGDPYV E+  +PI VW+K+H       +AK VI  LK  G +
Sbjct  61   ADKVAASGYFVVVPDFLHGDPYVPEDADRPIAVWIKEHTAGKAFEEAKPVIAALKEQGAS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K   +LAK   ++  V+ HP+FVT+DDI++VK PI+++GAE D  +P E
Sbjct  121  SVGAAGYCWGAKVVAELAKANEIQTAVMSHPSFVTVDDIKEVKCPIAVLGAETDVMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +VK+FE  L +   +   VKIF GV+HGWTVRY+ +D AAVK+AEEA  D++ WF K+L
Sbjct  181  LVKEFEQVLSSNSGIAHFVKIFPGVSHGWTVRYNGEDAAAVKSAEEALTDMIDWFNKNL  239



>ref|XP_006654369.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Oryza brachyantha]
Length=240

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 162/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP    + G G+V    G +  YVSG + SK AV+LVSDVFG+EA NLRK+
Sbjct  1    MASPQCCANPPTPDPAGGEGKVVDSFGGIKAYVSGAAESKAAVILVSDVFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADKI  +GF+VVVPDF HGDP V E+  KP  VW+K+H  D    +AK VI  LK  GV+
Sbjct  61   ADKIALSGFFVVVPDFLHGDPLVPESTEKPFPVWIKEHGPDKAFEEAKPVIAALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K   +LAK   ++  V+ HP+FVT+DDI++VK  I+I+GAE D  +P E
Sbjct  121  TVGAAGYCWGAKVVAELAKAHEIQTAVMCHPSFVTVDDIKEVKCSIAILGAEIDRMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            VVKQFE  L +K  +   VKIF GV HGWTVRY  DD AAVK+AEEA  D++ WF K+L
Sbjct  181  VVKQFEQVLSSKSGIGHFVKIFPGVEHGWTVRYKNDDAAAVKSAEEALADMIDWFNKNL  239



>ref|XP_010024428.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 ref|XP_010024429.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60871.1| hypothetical protein EUGRSUZ_H03605 [Eucalyptus grandis]
Length=240

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 167/239 (70%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M S  C  NPP L S+ GAG+V++L  L  YV+GPS SK A+L + D FGYEA  LRKLA
Sbjct  1    MLSSQCFENPPNLSSTCGAGRVEELAGLKTYVTGPSDSKRALLFIPDAFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+  A F+VVVPDF++GDP ++  +    I VWLK+H+ D    DAK VI  LK+ GV+
Sbjct  61   DKVASAEFFVVVPDFYYGDPVIDVNDPNFNIEVWLKNHSPDKGYEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G+ G C GG   V LA    ++A V+LHP  +T D+I+ VK+P +I+GAEND   PA+
Sbjct  121  AIGVAGFCWGGMVLVKLAGTEDIQAAVILHPGHITEDEIRAVKIPTAILGAENDHIFPAD  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+    + AK E++S VKIF GV HGW+VRY++DD++AVK+A+EA +D+L WF+KH+
Sbjct  181  ELKKLGEIMSAKTEIESYVKIFPGVRHGWSVRYNDDDESAVKSAKEAQEDMLNWFLKHV  239



>gb|AFK37956.1| unknown [Medicago truncatula]
Length=239

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 165/238 (69%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS   C +NPP L    GAG V+++G L+ Y++G   S  A+L VSD++GYE+  +R LA
Sbjct  1    MSGHACCSNPPILNPFSGAGHVEKIGGLDAYLTGSPLSTKAILFVSDIYGYESPIIRNLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGA-KPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPD+F+GDPY ++   +P+ +W++DH  D     ++ +IE LK+ GV  
Sbjct  61   DKVAAAGYYVVVPDYFYGDPYDDDRVDRPLPIWMEDHEPDKGFEASQPIIEALKSKGVFA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K   +L K   ++A VL HP+ +T++DI  V +PI+I+GAE D  TP EV
Sbjct  121  IGAAGYCWGAKTVCELGKSKLIQAVVLAHPSLITVEDINGVNIPIAILGAELDPITPPEV  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQFE  L AKPEVDS VK+F  V+HGWT+RYD +D  AVKAAEEAHQ LL WFVK++
Sbjct  181  IKQFEQVLAAKPEVDSFVKVFPNVSHGWTIRYDTEDPEAVKAAEEAHQILLDWFVKYV  238



>ref|XP_007226805.1| hypothetical protein PRUPE_ppa024774mg [Prunus persica]
 gb|EMJ28004.1| hypothetical protein PRUPE_ppa024774mg [Prunus persica]
Length=326

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 164/232 (71%), Gaps = 7/232 (3%)
 Frame = +2

Query  80   IANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLADKIGGA  259
            +  P  L  S G+G V++LG  N YV+G   SKLA+L      GYEA   RKLADKI  A
Sbjct  102  LLKPTTLNPSSGSGHVEKLGGFNSYVTGSPDSKLAIL------GYEAPKARKLADKIAAA  155

Query  260  GFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTKVGIGGVC  439
            GF VV+PDFF+GDP+  N A  + VW+K H VD    DAK VIE LK+ GV+ +G  G C
Sbjct  156  GFIVVLPDFFNGDPFDGNLAS-LPVWIKAHGVDKTIEDAKPVIEALKSKGVSAIGAVGFC  214

Query  440  SGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEVVKQFEIA  619
             GGK  V+LAK   ++A VL HP+FVT+DDI+ VKVPIS++GAE D+ +P EVVKQFE  
Sbjct  215  WGGKGVVELAKYDFIQAAVLCHPSFVTVDDIKAVKVPISVLGAEIDQLSPPEVVKQFEEV  274

Query  620  LQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            L AKPE+ S VKIF  V HGWT+RY+++D+AAVKAAEEAHQDLL WF+ H+ 
Sbjct  275  LSAKPEIKSHVKIFPKVVHGWTLRYNDEDEAAVKAAEEAHQDLLGWFLSHVR  326



>ref|XP_010024435.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60875.1| hypothetical protein EUGRSUZ_H03608 [Eucalyptus grandis]
Length=240

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 162/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG V++L  L  YV+GPS SK AVLL++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHVEELAGLKTYVTGPSDSKRAVLLIADVFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG--VWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI  AGF VVVPDFF+GDP ++  +       W K+H  D    DAK VI  LK+ GV+
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNFEAWFKNHGTDKGHEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP  +T D I+ VK+P +I+GAE D ++P E
Sbjct  121  AIGAAGFCWGGVVLVKLAGTEDIQAAVILHPGPMTEDAIKAVKIPTAILGAEIDHSSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+F   + AK E +S VKIF GV+HGW+VRYD+D++  VK+AEEA +D L WF+KH+
Sbjct  181  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNELVVKSAEEAQEDTLNWFLKHV  239



>ref|XP_002516791.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
 gb|EEF45405.1| endo-1,3-1,4-beta-d-glucanase, putative [Ricinus communis]
Length=239

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 159/238 (67%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C+ NPP L  +YG G VQ+LG L  Y++GP  SKLA+LL  D FG+EA NLRKLA
Sbjct  1    MSSSQCLENPPILNPNYGLGTVQELGGLKAYITGPPDSKLAILLACDAFGFEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF  VVPDF +GDP+ +++       WLK H     C DAKVVI  LK  G++ 
Sbjct  61   DKVAAAGFLAVVPDFLYGDPFQLDSPQFNREAWLKIHDTAKGCEDAKVVIAALKNRGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG  G C GG   V LA    + A V+LHP ++T D+I+ VKVP +I+GAE D+ +P E 
Sbjct  121  VGAAGFCWGGMVVVKLASCDDIHAAVILHPGWITADEIKAVKVPTAILGAEIDQISPPEQ  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +K+F   L  K E +S VKIF GV HGWT+RY+++D +AVK AEEAH D+L WF KH+
Sbjct  181  MKEFGEILAEKSEFESYVKIFPGVVHGWTLRYNDEDDSAVKFAEEAHLDMLNWFTKHV  238



>ref|XP_007150406.1| hypothetical protein PHAVU_005G150700g [Phaseolus vulgaris]
 gb|ESW22400.1| hypothetical protein PHAVU_005G150700g [Phaseolus vulgaris]
Length=240

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 162/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M    C+ANPP L +S G G +  +  +N YVSG   + L ++L+SD+FG+E   LRK+A
Sbjct  1    MVGSECLANPPILNASTGVGYLTNIAGVNSYVSGSPLAILTIVLISDIFGFEPPLLRKIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+   G++VVVPDFFHG+PY  EN ++P+  WLKDH        AK +IE LK  G + 
Sbjct  61   DKVANHGYFVVVPDFFHGEPYNAENASRPLNSWLKDHNSTKGIETAKPIIEALKRKGASA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG+ G C G + A  L     VEA+V+LHP+ VT+D+I+ V+VPI+I+ AE+D  +P ++
Sbjct  121  VGVAGFCWGARTATKLGITKLVEASVILHPSSVTVDEIRGVEVPIAILAAEHDSFSPPKL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +K+F+  L AKPE+DS VKIF  V+HGWTVRYD +D  AVK A +AH+ ++ WF +HL
Sbjct  181  IKKFKQVLDAKPEIDSYVKIFANVSHGWTVRYDPNDPKAVKDARKAHKIMINWFDRHL  238



>gb|AGV54685.1| endo-13;14-beta-D-glucanase-like protein [Phaseolus vulgaris]
Length=255

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 159/236 (67%), Gaps = 1/236 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + GAG V++L  L+ Y++G  +S LAVLL+SDVFGYEA NLR +A
Sbjct  1    MSGPECCSNPPLLNPNAGAGHVEKLAGLDSYIAGSPNSNLAVLLISDVFGYEAPNLRNIA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AG+YVVVPDFF GDPY  EN  + I VWLKDH  D     AK ++E LK+ GV+ 
Sbjct  61   DKVAAAGYYVVVPDFFFGDPYNPENADRAIHVWLKDHGTDKGSEAAKSIVEALKSKGVSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C G K  V+L+K   ++A VLLHP+FV++DDI+ V +P +++GAE D+ +P E+
Sbjct  121  IGAVGFCWGAKVVVELSKSRLIQAAVLLHPSFVSVDDIKGVDIPTAVLGAEIDKMSPPEL  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVK  766
            VKQFE  L AKP VD  VKIF  V  GW V   + D  AVK A  A   L+KWF +
Sbjct  181  VKQFEQVLNAKPGVDFFVKIFSPVFPGWGVGDRKGDAKAVKGAGGAPPGLVKWFSR  236



>ref|XP_008223020.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Prunus mume]
Length=239

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 163/239 (68%), Gaps = 1/239 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L  + GAG + +LG L  Y +GPS SK A+LLVSDVFGYE  NLRKLA
Sbjct  1    MSSAECFKNPPVLGPTSGAGTLLELGGLKTYFTGPSESKHAILLVSDVFGYENLNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF+VV+PDFF+GDP  ++N       W K H+ +    DAK+VI  LK+ G++ 
Sbjct  61   DKVAAAGFFVVIPDFFYGDPVNLDNPQFDRESWHKAHSREKGYEDAKLVIAALKSQGISA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GG   V LAK   ++A V+LHP  +T ++I +VKVP +I+GAE D+T+P E 
Sbjct  121  IGAAGFCWGGNVVVKLAKTNDIQAAVILHPGRLTDEEIVEVKVPTAILGAEIDKTSPPEQ  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHLH  775
            +K F   L  K E +S VKIF GV HGWT RY+ +D++AVK+AEEAH D+L WF K+++
Sbjct  181  MKHFGEILSTKSEFNSFVKIFPGVAHGWTTRYNAEDESAVKSAEEAHLDMLNWFTKYVN  239



>ref|XP_010024430.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=240

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 161/239 (67%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG V++L  L  YV+GPS SK AVLL++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHVEELAGLKTYVTGPSDSKRAVLLIADVFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG--VWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI  AGF V VPDFF+GDP ++  +       W K+H  D    DAK VI  LK+ GV+
Sbjct  61   DKIASAGFLVAVPDFFYGDPIIDFTSPNFNFEAWFKNHGTDKGHEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP  +T D I+ VK+P +I+GAE D ++P E
Sbjct  121  TIGAAGFCWGGVVLVKLAGTEDIQAAVILHPGPMTEDAIKAVKIPTAILGAEIDHSSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+F   + AK E +S VKIF GV+HGW+VRYD+D++  VK+AEEA +D L WF+KH+
Sbjct  181  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNELVVKSAEEAQEDTLNWFLKHV  239



>ref|XP_010024439.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
 gb|KCW60881.1| hypothetical protein EUGRSUZ_H03613 [Eucalyptus grandis]
Length=239

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 163/238 (68%), Gaps = 1/238 (0%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG+V++L  L  YV+GPS SK AV+L++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPDLSSTCGAGRVEELAGLKTYVTGPSDSKRAVILIADVFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGF VVVPDF +GDP  + N       W K H+ D    D K VI  L++ G++ 
Sbjct  61   DKVASAGFLVVVPDFLYGDPIDLSNPNFDREAWKKIHSTDKGYEDVKPVISALRSKGLSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            +G  G C GGK  V LA I  ++A V+LHP  +T D+IQ VK+P +I+GAE D  +P E 
Sbjct  121  IGAAGFCWGGKVLVKLAGIEDIQAAVILHPGHMTEDEIQAVKIPTAILGAEIDHASPPEE  180

Query  599  VKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +K+F   + AK E +S VKIF  V+HGW+VRYD++++ AVK+AEEA +D+L WF+KH+
Sbjct  181  LKKFGEIMSAKTEFESYVKIFPSVSHGWSVRYDDNNEFAVKSAEEAQKDMLNWFLKHV  238



>ref|XP_003542895.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Glycine max]
Length=241

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 160/240 (67%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSS-YGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            MSSP C  NPP L S  +GAG VQ+LG LN YV+G S SKLA++LVSDVFGYEA  LRKL
Sbjct  1    MSSPQCFENPPNLNSDIHGAGTVQELGGLNSYVTGSSDSKLALILVSDVFGYEAPKLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            ADK+  AGF VVVPD  +GD  V+  N       W K H  D  C D K +I  LK+ GV
Sbjct  61   ADKVAAAGFLVVVPDLLYGDYIVDLNNPQFDRESWRKAHGKDKACEDTKPLISALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
              VG  G C GG   V LA    ++A V+LHP  +  ++  +V++PI+I+GAE D   P 
Sbjct  121  KSVGAAGFCWGGVVVVKLAISTDIQAAVILHPGLIADNEFNEVRIPIAILGAEIDHLFPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E +KQ E  L  K E +S VK++ GV+HGWT+RY++DD+A VK+A+EAHQD+L WF+KH+
Sbjct  181  ERLKQIEEMLSVKAEFESFVKLYPGVSHGWTLRYNDDDEATVKSAKEAHQDMLNWFIKHV  240



>ref|XP_010024440.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Eucalyptus grandis]
Length=241

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 161/240 (67%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG+V++L  L  YV+GPS SK A++L++DVFGYEA  LRKLA
Sbjct  1    MSSSQCFENPPDLSSTCGAGRVEELAGLKTYVTGPSDSKRAIILIADVFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY---VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGF VVVPDF +GDPY     N       W K H+ D    D K VI  L++ G+
Sbjct  61   DKVTSAGFLVVVPDFLYGDPYPLDYSNRNFDREAWKKIHSTDKGYEDVKPVISALRSKGL  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + +G  G C GGK  V LA    ++A V+LHP  +T D+IQ VK+P +I+GAE D  +P 
Sbjct  121  SAIGAAGFCWGGKVLVKLAGTEDIQAAVILHPGHMTEDEIQAVKIPTAILGAEIDHASPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E +K+F   + AK E +S VKIF  V+HGW+VRYD+++  AVK+AEEA +D+L WF+KH+
Sbjct  181  EELKKFGEIMSAKTEFESYVKIFPSVSHGWSVRYDDNNDFAVKSAEEAQEDMLNWFLKHV  240



>ref|XP_009417916.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 167/270 (62%), Gaps = 33/270 (12%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAG-QVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+SP C ANPP L  + G G  V  LG +  Y +G  +SK+AVLL+SDV+G+EA NLRK+
Sbjct  1    MASPQCCANPPTLSPACGDGIVVDDLGGVRAYTAGSPNSKIAVLLISDVYGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADKI  +GF+VVVPD  + DPY  +N  +PI +W++ H+ D  C DAK +I  LK  G++
Sbjct  61   ADKIATSGFFVVVPDLLYDDPYSADNPERPISIWIQSHSPDKGCQDAKPIIAALKNKGIS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQD-------------------  538
             VG  G C GGK   +LAK   +EA VL HP+FV +DD++                    
Sbjct  121  AVGAAGFCWGGKVVFELAKSSEIEAAVLCHPSFVNVDDVKGIPSFKNWSNSCFLNMFLLL  180

Query  539  ------------VKVPISIIGAENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGW  682
                        VK PISI+GAEND  +P E++KQFE AL    E   +VKIF GV HGW
Sbjct  181  RVETICFHHLPGVKCPISILGAENDHISPPELLKQFERALSLTSEERHIVKIFPGVAHGW  240

Query  683  TVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            TVR+  DD AAVK A+EAHQD+L WF++H+
Sbjct  241  TVRHKADDAAAVKRAQEAHQDMLNWFIQHV  270



>gb|KHN37559.1| Endo-1,3(4)-beta-D-glucanase [Glycine soja]
Length=241

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 160/240 (67%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSS-YGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            MSSP C  NPP L S  +GAG VQ+LG LN YV+G S SKLA++LVSDVFGYEA  LRKL
Sbjct  1    MSSPQCFENPPNLNSDIHGAGTVQELGGLNSYVTGSSDSKLALILVSDVFGYEAPKLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            ADK+  AGF VVVPD  +GD  V+  N       W K H  D  C D K +I  LK+ GV
Sbjct  61   ADKVAAAGFLVVVPDLLYGDYIVDLNNPQFDRESWRKAHGKDKACEDTKPLISALKSKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
              +G  G C GG   V LA    ++A V+LHP  +  ++  +V++PI+I+GAE D   P 
Sbjct  121  KSIGAAGFCWGGVVVVKLAISTDIQAAVILHPGLIADNEFNEVRIPIAILGAEIDHLFPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E +KQ E  L  K E +S VK++ GV+HGWT+RY++DD+A VK+A+EAHQD+L WF+KH+
Sbjct  181  ERLKQIEEMLSVKAEFESFVKLYPGVSHGWTLRYNDDDEATVKSAKEAHQDMLNWFIKHV  240



>gb|KCW60876.1| hypothetical protein EUGRSUZ_H03609 [Eucalyptus grandis]
Length=245

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 168/244 (69%), Gaps = 7/244 (3%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M S  C  NPP L S+ GAG+V++L  L  YV+GPS SK A+L + D FGYEA  LRKLA
Sbjct  1    MLSSQCFENPPNLSSTCGAGRVEELAGLKTYVTGPSDSKRALLFIPDAFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DK+  AGF+VVVPDF++GDP ++  +    I VWLK+H+ D    DAK VI  LK+ GV+
Sbjct  61   DKVASAGFFVVVPDFYYGDPVIDVNDPNFNIEVWLKNHSPDKGYEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G+ G C GG   V LA    ++A V+LHP  +T D+I+ VK+P +I+GAEND   PA+
Sbjct  121  AIGVAGFCWGGMVLVKLAGTEDIQAAVILHPGRITEDEIRAVKIPTAILGAENDHIFPAD  180

Query  596  VVKQFEIALQAKPEV-----DSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWF  760
             +K+    + AK E+     +S VKIF GV HGW+VRY++DD++AVK+A+EA +D+L WF
Sbjct  181  ELKKLGEIMSAKTEIPVLQFESYVKIFPGVRHGWSVRYNDDDESAVKSAKEAQEDMLNWF  240

Query  761  VKHL  772
            +KH+
Sbjct  241  LKHV  244



>ref|XP_010650032.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Vitis vinifera]
Length=244

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 156/241 (65%), Gaps = 4/241 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGA---LNCYVSGPSHSKLAVLLVSDVFGYEATNLR  232
            MS   C  NPP      GAG VQ++G    L  YV+GP  SKLA+L VSDVFGYEA NLR
Sbjct  1    MSISRCYENPPSFSPGSGAGTVQEVGGGGRLKAYVTGPLDSKLAILFVSDVFGYEAPNLR  60

Query  233  KLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGG  409
            KLADK+  AGF VV PDFF+GDP  + N      VW+  H  D  C DAK VI  L++ G
Sbjct  61   KLADKVAAAGFLVVAPDFFYGDPVDLSNPNFDRQVWIAAHGTDKGCEDAKAVIAALRSKG  120

Query  410  VTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTP  589
            V+ +G  G C GGK  V+LA    ++A V+LHP  +T D+I +VK PI+I+GAE D+ +P
Sbjct  121  VSAIGAAGFCWGGKVVVNLASSDHIQAAVVLHPGRITDDEINEVKTPIAILGAEIDDASP  180

Query  590  AEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKH  769
             E ++ F   L AK  +D  VKIF GV HGWTVRY  +D+  VK+AEEAH D+L WF K+
Sbjct  181  PEQLEHFGEILSAKSGIDCFVKIFPGVAHGWTVRYSVEDEWGVKSAEEAHGDMLNWFSKY  240

Query  770  L  772
            +
Sbjct  241  M  241



>ref|NP_001148765.1| endo-1,3;1,4-beta-D-glucanase [Zea mays]
 gb|ACG32824.1| endo-1,3;1,4-beta-D-glucanase precursor [Zea mays]
Length=241

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 162/240 (68%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G+V    G L  YV+GP  SK AV+LV+DVFG+EA  LR +
Sbjct  1    MASSQCCDNPPALNPACGKGKVVDSFGGLKAYVAGPEDSKAAVVLVADVFGFEAPILRNI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPDFFHGDPYV EN  K I VWLK H  +    +AK VI  LK  GV+
Sbjct  61   ADKVASSGYFVVVPDFFHGDPYVPENAEKLIPVWLKSHTPEKGFEEAKPVIAALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKI-PCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
             VG  G C G K  V+LAK    ++A VLLHP+FVT+DDI++VK  I+I+GAE D  +P 
Sbjct  121  AVGAAGYCWGAKVVVELAKANELLQAAVLLHPSFVTVDDIKEVKCSIAILGAEMDVRSPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E+VKQFE AL     V   VKIF GV HGW+VRY  DD AAVK+AEEA  D+L WF K+L
Sbjct  181  ELVKQFEQALSVNSGVGHFVKIFPGVAHGWSVRYSLDDAAAVKSAEEAFADMLDWFNKNL  240



>gb|KCW60874.1| hypothetical protein EUGRSUZ_H03607 [Eucalyptus grandis]
Length=310

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 161/239 (67%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG V++L  L  YV+GPS SK AVLL++DVFGYEA  LRKLA
Sbjct  71   MSSSQCFENPPNLSSTCGAGHVEELAGLKTYVTGPSDSKRAVLLIADVFGYEAPKLRKLA  130

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIG--VWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI  AGF V VPDFF+GDP ++  +       W K+H  D    DAK VI  LK+ GV+
Sbjct  131  DKIASAGFLVAVPDFFYGDPIIDFTSPNFNFEAWFKNHGTDKGHEDAKPVIAALKSKGVS  190

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP  +T D I+ VK+P +I+GAE D ++P E
Sbjct  191  TIGAAGFCWGGVVLVKLAGTEDIQAAVILHPGPMTEDAIKAVKIPTAILGAEIDHSSPPE  250

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
             +K+F   + AK E +S VKIF GV+HGW+VRYD+D++  VK+AEEA +D L WF+KH+
Sbjct  251  QLKKFGEIMSAKTEFESYVKIFPGVSHGWSVRYDDDNELVVKSAEEAQEDTLNWFLKHV  309



>ref|XP_002439763.1| hypothetical protein SORBIDRAFT_09g019650 [Sorghum bicolor]
 gb|EES18193.1| hypothetical protein SORBIDRAFT_09g019650 [Sorghum bicolor]
Length=239

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = +2

Query  59   IMSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRK  235
            + +S HC  NPP L  + G G+V    G    Y++G + SK AV+L+SD FG+EA NLRK
Sbjct  1    MATSSHCFENPPALEPASGGGEVVDDFGGQKAYITGSAGSKAAVVLISDAFGFEAPNLRK  60

Query  236  LADKIGGAGFYVVVPDFFHGDPYVENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            +AD++  +G++VVVPDF HGDPY  + + P G+W++ H   N   +AK VI  +K  GV+
Sbjct  61   IADQVASSGYFVVVPDFLHGDPYDLSSSNP-GMWIQAHNPQNAFKEAKPVIAAIKEKGVS  119

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
            ++G  G C G K  V+LAK+  ++A VLLHP+ +T DDI++VK PISI+GAE D ++P E
Sbjct  120  RIGAAGYCWGAKVVVELAKVHEIQAAVLLHPSLLTDDDIKEVKCPISILGAEIDRSSPPE  179

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQF   L A  E+D  VKIF GV HGW VRY +DD +AV +A+EA QD+  WF K+L
Sbjct  180  LLKQFGQILSANSEIDHFVKIFPGVAHGWAVRYSDDDASAVASAKEALQDMSHWFNKYL  238



>ref|XP_007147786.1| hypothetical protein PHAVU_006G155000g [Phaseolus vulgaris]
 gb|ESW19780.1| hypothetical protein PHAVU_006G155000g [Phaseolus vulgaris]
Length=240

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 162/240 (68%), Gaps = 4/240 (2%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSS-YGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            MSS  C  NPP L S  +GAG +Q+L  L+ YV+G   SKLA++L+SD+FGYEA NLRKL
Sbjct  1    MSSSQCFQNPPNLNSGIHGAGTIQELAGLSSYVTGSPDSKLALILISDIFGYEAPNLRKL  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYVE--NGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            ADK+  +GF VVVPD  +GD Y +  N       W K H  D  C D + +I DLK+ GV
Sbjct  61   ADKVAASGFLVVVPDLLYGD-YADFHNPKFDRESWRKAHGKDKACEDTQPLIADLKSKGV  119

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
              +G  G C GG  A+ LA    ++A V+LHP  ++ D+I + KVPI+I+GAE D   P 
Sbjct  120  KSIGAAGFCWGGGVAIKLAISSDIQAAVILHPGPISDDEINEAKVPIAILGAEIDHLFPP  179

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E +KQ E  L  K E +S VK+F GVTHGWTVRY++DD+AAVK+A+EAHQD+L WFVKH+
Sbjct  180  ERLKQVEEKLSTKSEFESFVKLFPGVTHGWTVRYNDDDEAAVKSAKEAHQDMLNWFVKHV  239



>gb|KCW60872.1| hypothetical protein EUGRSUZ_H03606 [Eucalyptus grandis]
Length=245

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 163/244 (67%), Gaps = 7/244 (3%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG +++L  L  YV+GPS SK AVLL++D FGYEA  LRKLA
Sbjct  1    MSSSQCFENPPNLSSTCGAGHIEELAGLKTYVTGPSDSKRAVLLIADAFGYEAPKLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPYVENGAKPIGV--WLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            DKI  AGF VVVPDFF+GDP ++  +    +  W K+H  D    DAK VI  LK+ GV+
Sbjct  61   DKIASAGFLVVVPDFFYGDPIIDFTSPNFNLEAWFKNHGTDKGYEDAKPVIAALKSKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             +G  G C GG   V LA    ++A V+LHP  +T D+I+ VK+P +I+GAE D ++P E
Sbjct  121  AIGAAGFCWGGMVLVKLAGTEDIQAAVILHPGPMTEDEIKAVKIPTAILGAEIDHSSPPE  180

Query  596  VVKQFEIALQAKPEV-----DSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWF  760
             +K+F   + AK E      +S VKIF GV+HGW+VRYD+D++  VK+AEEA +D L WF
Sbjct  181  QLKKFGEIMSAKTETPVLQFESYVKIFPGVSHGWSVRYDDDNEFVVKSAEEAQEDTLNWF  240

Query  761  VKHL  772
            +KH+
Sbjct  241  LKHV  244



>ref|XP_006601393.1| PREDICTED: endo-1,3;1,4-beta-D-glucanase-like [Glycine max]
Length=258

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 162/256 (63%), Gaps = 20/256 (8%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MS P C +NPP L  + G G V ++G ++ Y +G  HSKLAVL++SDVFGYEA NLRKLA
Sbjct  1    MSGPQCCSNPPSLNPTGGGGHVDKVGGIDSYFTGSPHSKLAVLMLSDVFGYEAPNLRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAV---------DNVCNDAKVVIE  391
            DK+G AG+YVVVPD   G+P+  +N  +P   W+KD A          +      K +IE
Sbjct  61   DKVGAAGYYVVVPDLLDGEPFNPQNSDRPFPAWIKDCATGLPHLLAVSEKGAEPTKPIIE  120

Query  392  DLKAGGVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAE  571
             LK+ GV+ +   G C G K  ++LAK   ++  VLLHP+F++LDDI+ V  PI+I+GAE
Sbjct  121  ALKSKGVSAIAAVGFCWGAKVVIELAKSKLIQTAVLLHPSFISLDDIKGVDTPIAILGAE  180

Query  572  NDETTPAEVVKQFEIALQAKPEVD----------SLVKIFDGVTHGWTVRYdeddkaavk  721
             D+ +P E+VKQFE  L AK  +           S VKIF  V+HGW VRY+ +D  AVK
Sbjct  181  IDQVSPPELVKQFEQVLAAKSGISFMSIFFVLVASFVKIFPKVSHGWAVRYNTEDAEAVK  240

Query  722  aaeeaHQDLLKWFVKH  769
             AEEAHQDLL W  KH
Sbjct  241  VAEEAHQDLLDWLAKH  256



>ref|XP_007154161.1| hypothetical protein PHAVU_003G095400g [Phaseolus vulgaris]
 gb|ESW26155.1| hypothetical protein PHAVU_003G095400g [Phaseolus vulgaris]
Length=241

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            M+     +N P L +S GAG V  +G LN YV+    + LA+LLVSDVFGY+A   RKLA
Sbjct  1    MAGNQGHSNSPVLNASSGAGHVTNIGGLNSYVTASPLAILAILLVSDVFGYKAPLFRKLA  60

Query  242  DKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVTK  418
            DK+  AGFYVVVPDFF+ DP+  +N  +P+ VWL+DH  +     AK VIE LK+ G + 
Sbjct  61   DKVAAAGFYVVVPDFFYDDPFDPDNVNRPLPVWLQDHEPEEGFEAAKPVIEALKSKGFSA  120

Query  419  VGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAEV  598
            VG+ G C GGK   DL K   VEA VLLHPA+V ++DI+ +K PI+I+G +ND  TP  +
Sbjct  121  VGVAGFCWGGKTVTDLGKSKHVEAAVLLHPAYVEVNDIRGIKTPIAILGGQNDTITPPNL  180

Query  599  VKQFEIALQ-AKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            +KQF+  LQ AKP+V S VKIF  V HGWTVRYD +D  AVKAAE+AH+ ++ WF K+L
Sbjct  181  IKQFKQILQDAKPKVRSEVKIFPNVGHGWTVRYDPNDPKAVKAAEKAHRIMIDWFDKYL  239



>ref|NP_001148665.1| LOC100282281 [Zea mays]
 gb|ACF85452.1| unknown [Zea mays]
 gb|ACG32441.1| endo-1,3;1,4-beta-D-glucanase precursor [Zea mays]
 gb|AFW81549.1| 1,4-beta-D-glucanase [Zea mays]
Length=241

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 158/241 (66%), Gaps = 3/241 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G+V    G    YVSG + SK AV+L+SD FG+EA NLRK+
Sbjct  1    MASSRCFENPPVLEPASGGGEVVDDFGGQKAYVSGSAGSKAAVVLISDAFGFEAPNLRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPY--VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            ADK+   G++VVVPDF HGDPY    N     G W++ H       +AK VI  +K  GV
Sbjct  61   ADKVASLGYFVVVPDFLHGDPYDPSNNAHSNPGTWIQSHNPQTAFEEAKPVIAAIKEKGV  120

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + +G  G C G K  V+LAK+  ++A VL HP+ +T+DD++DVK PISI+GAE D + P 
Sbjct  121  SSIGAAGYCWGAKVVVELAKVHEIQAAVLAHPSLLTVDDMKDVKCPISILGAEIDRSAPP  180

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E++KQFE  L A PEVD  VK+F GV HGW VRY +DD AAV +AEEA +D+  WF K+L
Sbjct  181  ELLKQFEQVLSANPEVDHFVKVFPGVAHGWAVRYSDDDAAAVTSAEEALRDMSHWFNKYL  240

Query  773  H  775
            +
Sbjct  241  N  241



>gb|KCW60880.1| hypothetical protein EUGRSUZ_H03611 [Eucalyptus grandis]
Length=339

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 161/240 (67%), Gaps = 3/240 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKLA  241
            MSS  C  NPP L S+ GAG+V++L  L  YV+GPS SK A++L++DVFGYEA  LRKLA
Sbjct  99   MSSSQCFENPPDLSSTCGAGRVEELAGLKTYVTGPSDSKRAIILIADVFGYEAPKLRKLA  158

Query  242  DKIGGAGFYVVVPDFFHGDPY---VENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGV  412
            DK+  AGF VVVPDF +GDPY     N       W K H+ D    D K VI  L++ G+
Sbjct  159  DKVTSAGFLVVVPDFLYGDPYPLDYSNRNFDREAWKKIHSTDKGYEDVKPVISALRSKGL  218

Query  413  TKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPA  592
            + +G  G C GGK  V LA    ++A V+LHP  +T D+IQ VK+P +I+GAE D  +P 
Sbjct  219  SAIGAAGFCWGGKVLVKLAGTEDIQAAVILHPGHMTEDEIQAVKIPTAILGAEIDHASPP  278

Query  593  EVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            E +K+F   + AK E +S VKIF  V+HGW+VRYD+++  AVK+AEEA +D+L WF+KH+
Sbjct  279  EELKKFGEIMSAKTEFESYVKIFPSVSHGWSVRYDDNNDFAVKSAEEAQEDMLNWFLKHV  338



>gb|KEH32213.1| endo-1,3-1,4-beta-D-glucanase-like protein [Medicago truncatula]
Length=250

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 160/249 (64%), Gaps = 12/249 (5%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQVQQLGALNCYVSGPSHSKLAVLLVSDVF-----------  208
            M  P C +NPP L S  GAG V +LG ++ Y++G       +LLVSD+F           
Sbjct  1    MLGPACCSNPPILNSFSGAGHVAKLGGVDAYLTGSPLCTFVILLVSDIFVFVFTCLICFV  60

Query  209  GYEATNLRKLADKIGGAGFYVVVPDFFHGDPY-VENGAKPIGVWLKDHAVDNVCNDAKVV  385
            GY+A  LR  ADK+   G+YVVVPDFF+GDPY   N  +PI VW+KDH  +     ++ +
Sbjct  61   GYKAPILRMFADKVAATGYYVVVPDFFNGDPYDPRNVDRPIDVWVKDHLPETGFEVSQPI  120

Query  386  IEDLKAGGVTKVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIG  565
            IE LK+ G++ +G  G C G K   +L K   ++A VL HP+++T+DDI  V +PI+I+G
Sbjct  121  IEALKSKGISTIGAAGFCWGAKTVCELGKSKLIQAAVLAHPSYITVDDINGVNIPIAILG  180

Query  566  AENDETTPAEVVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQD  745
            AEND+ TP EV+KQFE  L A  EVDS VKIF  V+HGWT+RYD  D  AVKA+EEA Q 
Sbjct  181  AENDQVTPPEVIKQFEQVLAANSEVDSFVKIFPNVSHGWTIRYDTKDPEAVKASEEARQI  240

Query  746  LLKWFVKHL  772
            LL WF KHL
Sbjct  241  LLDWFDKHL  249



>ref|NP_001140497.1| hypothetical protein [Zea mays]
 gb|ACF83943.1| unknown [Zea mays]
 gb|AFW77922.1| hypothetical protein ZEAMMB73_089561 [Zea mays]
 gb|AFW77923.1| hypothetical protein ZEAMMB73_089561 [Zea mays]
Length=240

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 161/239 (67%), Gaps = 2/239 (1%)
 Frame = +2

Query  62   MSSPHCIANPPKLCSSYGAGQV-QQLGALNCYVSGPSHSKLAVLLVSDVFGYEATNLRKL  238
            M+S  C  NPP L  + G G+V    G L  YV+GP  SK AV+LV+DVFG+EA  +RK+
Sbjct  1    MASSQCCDNPPALNPACGEGKVVDSFGGLKAYVAGPEDSKAAVVLVADVFGFEAPIMRKI  60

Query  239  ADKIGGAGFYVVVPDFFHGDPYV-ENGAKPIGVWLKDHAVDNVCNDAKVVIEDLKAGGVT  415
            ADK+  +G++VVVPD FHGDPY  EN  KP  VW+K H  +    + K VI  LK  GV+
Sbjct  61   ADKVASSGYFVVVPDLFHGDPYAPENVEKPFPVWIKSHTPEKGFEETKQVIGALKEKGVS  120

Query  416  KVGIGGVCSGGKAAVDLAKIPCVEATVLLHPAFVTLDDIQDVKVPISIIGAENDETTPAE  595
             VG  G C G K  V+LAK   ++A VLLHP+FVT+DDI++VK  ISI+GAE D+ +P E
Sbjct  121  AVGAAGYCWGAKVVVELAKAHEIQAAVLLHPSFVTVDDIKEVKCAISILGAEIDKMSPPE  180

Query  596  VVKQFEIALQAKPEVDSLVKIFDGVTHGWTVRYdeddkaavkaaeeaHQDLLKWFVKHL  772
            ++KQFE  L     V   VKIF GV HGW+VRY+ DD AAVK+AEEA  D+L WF K+L
Sbjct  181  LIKQFEQVLSLNSGVGHFVKIFPGVAHGWSVRYNHDDAAAVKSAEEAFADMLDWFNKNL  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2254357392324