BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24437_g1_i6 len=4371 path=[8603:0-758 @9362@!:759-2029
@8602@!:2030-2975 11576:2976-3057 7509:3058-3058 11657:3059-3232
6392:3233-3292 4682:3293-3323 27236:3324-3337 11933:3338-3371
27764:3372-3378 26582:3379-3963 24953:3964-4370]

Length=4371
                                                                      Score     E

ref|XP_010656414.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    788   0.0      
gb|KDP32382.1|  hypothetical protein JCGZ_13307                         786   0.0      
ref|XP_010047816.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    785   0.0      
emb|CAN63498.1|  hypothetical protein VITISV_011673                     785   0.0      Vitis vinifera
ref|XP_007202129.1|  hypothetical protein PRUPE_ppa006078mg             782   0.0      
ref|XP_008242752.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    781   0.0      
ref|XP_006450966.1|  hypothetical protein CICLE_v10008382mg             779   0.0      
ref|XP_007013397.1|  Galactose oxidase/kelch repeat superfamily p...    778   0.0      
gb|KHG30540.1|  hypothetical protein F383_04954                         778   0.0      
ref|XP_003524553.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    778   0.0      
ref|XP_007154990.1|  hypothetical protein PHAVU_003G163600g             777   0.0      
ref|XP_003554163.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    776   0.0      
ref|XP_004287344.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    776   0.0      
gb|KHN23508.1|  F-box/kelch-repeat protein                              773   0.0      
ref|XP_010093732.1|  F-box/kelch-repeat protein                         772   0.0      
ref|XP_004508512.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    769   0.0      
ref|XP_010688026.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    768   0.0      
ref|XP_010250048.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    768   0.0      
ref|XP_002524469.1|  Protein AFR, putative                              762   0.0      Ricinus communis
ref|XP_004150018.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    761   0.0      
ref|XP_007013402.1|  Galactose oxidase/kelch repeat superfamily p...    760   0.0      
ref|XP_008444019.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    760   0.0      
ref|XP_009368827.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    758   0.0      
ref|XP_010688025.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    755   0.0      
gb|KHG13775.1|  hypothetical protein F383_18309                         753   0.0      
ref|XP_008385738.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    753   0.0      
ref|XP_008337311.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    753   0.0      
ref|XP_011084133.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    751   0.0      
ref|XP_003609293.1|  F-box/kelch-repeat protein                         744   0.0      
ref|XP_010250049.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    736   0.0      
ref|XP_008784962.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    719   0.0      
emb|CBI28177.3|  unnamed protein product                                716   0.0      
ref|XP_010914885.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    713   0.0      
ref|XP_010925234.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    710   0.0      
ref|XP_010257584.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    700   0.0      
emb|CDP10385.1|  unnamed protein product                                698   0.0      
ref|XP_006445823.1|  hypothetical protein CICLE_v10015292mg             699   0.0      
ref|XP_010243433.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    698   0.0      
ref|XP_010925232.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    696   0.0      
ref|XP_009603913.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    695   0.0      
ref|XP_009603914.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    694   0.0      
ref|XP_009785251.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    693   0.0      
ref|XP_009785252.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    693   0.0      
ref|XP_007014726.1|  Galactose oxidase/kelch repeat superfamily p...    692   0.0      
ref|XP_004294988.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    692   0.0      
gb|KDP26940.1|  hypothetical protein JCGZ_21033                         691   0.0      
ref|XP_002527061.1|  Protein AFR, putative                              691   0.0      Ricinus communis
ref|XP_004228650.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    691   0.0      
ref|XP_002283484.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    689   0.0      Vitis vinifera
ref|XP_006354154.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    686   0.0      
ref|XP_009364116.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    686   0.0      
ref|XP_011089119.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    685   0.0      
ref|XP_011025173.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    685   0.0      
ref|XP_004142161.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    684   0.0      
ref|XP_008449801.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    683   0.0      
ref|XP_010101133.1|  F-box/kelch-repeat protein                         682   0.0      
emb|CDP17358.1|  unnamed protein product                                681   0.0      
ref|XP_002304010.2|  kelch repeat-containing F-box family protein       681   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009375482.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    680   0.0      
ref|XP_011010683.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    678   0.0      
gb|KHG22974.1|  hypothetical protein F383_01277                         677   0.0      
ref|XP_011048244.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    677   0.0      
ref|XP_008344671.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    676   0.0      
ref|XP_008351710.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    676   0.0      
ref|XP_009388524.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    674   0.0      
ref|XP_006341889.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    674   0.0      
ref|XP_011089699.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    673   0.0      
ref|XP_011010684.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    671   0.0      
ref|XP_011048245.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    670   0.0      
emb|CCH50979.1|  T4.18                                                  672   0.0      
ref|XP_002297645.2|  hypothetical protein POPTR_0001s04530g             669   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU39245.1|  hypothetical protein MIMGU_mgv1a006629mg                669   0.0      
ref|XP_010535866.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    669   0.0      
gb|KHG22975.1|  hypothetical protein F383_01278                         668   0.0      
ref|XP_004228331.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    667   0.0      
ref|XP_008243705.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    667   0.0      
ref|XP_009763739.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    666   0.0      
ref|XP_010673508.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    665   0.0      
ref|XP_007205219.1|  hypothetical protein PRUPE_ppa005930mg             664   0.0      
ref|XP_009626412.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    663   0.0      
ref|XP_009407660.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    662   0.0      
ref|XP_010534884.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    660   0.0      
ref|XP_003524946.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    660   0.0      
ref|XP_007159398.1|  hypothetical protein PHAVU_002G235000g             660   0.0      
ref|XP_010932959.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    658   0.0      
ref|XP_004504335.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    656   0.0      
ref|XP_003629702.1|  F-box/kelch-repeat protein                         656   0.0      
ref|XP_003531234.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    654   0.0      
gb|AFK40250.1|  unknown                                                 653   0.0      
ref|XP_008803430.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    653   0.0      
ref|XP_008778886.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    652   0.0      
ref|XP_002894497.1|  kelch repeat-containing F-box family protein       650   0.0      
ref|NP_564684.1|  Galactose oxidase/kelch repeat superfamily protein    650   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY26117.1|  BnaC06g10790D                                          650   0.0      
emb|CDY08233.1|  BnaA05g13860D                                          649   0.0      
ref|XP_006392663.1|  hypothetical protein EUTSA_v10011496mg             649   0.0      
emb|CDY10574.1|  BnaC03g70400D                                          649   0.0      
gb|EPS58278.1|  hypothetical protein M569_16536                         649   0.0      
ref|XP_007159399.1|  hypothetical protein PHAVU_002G235000g             648   0.0      
ref|XP_009103742.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    648   0.0      
ref|XP_010462371.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    647   0.0      
ref|XP_010480054.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    646   0.0      
ref|XP_010501139.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    645   0.0      
emb|CDY02451.1|  BnaA08g00580D                                          645   0.0      
ref|XP_009106890.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    644   0.0      
ref|XP_010032898.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    644   0.0      
ref|XP_006307563.1|  hypothetical protein CARUB_v10009185mg             644   0.0      
ref|XP_009394427.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    635   0.0      
emb|CBI16496.3|  unnamed protein product                                628   0.0      
ref|XP_009411264.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    627   0.0      
ref|XP_004983160.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    627   0.0      
ref|XP_002464634.1|  hypothetical protein SORBIDRAFT_01g022240          626   0.0      Sorghum bicolor [broomcorn]
ref|XP_002978427.1|  hypothetical protein SELMODRAFT_443893             624   0.0      
ref|XP_001753278.1|  predicted protein                                  624   0.0      
ref|XP_002970270.1|  hypothetical protein SELMODRAFT_411144             624   0.0      
ref|XP_008384436.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-...    622   0.0      
gb|EEC66927.1|  hypothetical protein OsI_33535                          622   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009411265.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    620   0.0      
ref|NP_001131994.1|  uncharacterized protein LOC100193397               620   0.0      Zea mays [maize]
gb|ACN32130.1|  unknown                                                 620   0.0      Zea mays [maize]
ref|NP_001064574.1|  Os10g0409900                                       619   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ16045.1|  hypothetical protein OsJ_31487                          619   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662347.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    612   0.0      
gb|AAG51566.1|AC027034_12  unknown protein; 58496-60308                 611   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049085.1|  Os03g0167800                                       607   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651075.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    605   0.0      
gb|EMT18179.1|  hypothetical protein F775_31347                         602   0.0      
gb|EAZ25721.1|  hypothetical protein OsJ_09555                          603   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAL84293.1|AC073556_10  putative Kelch motif containing protein      602   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY33062.1|  BnaC06g07170D                                          600   0.0      
ref|XP_009394722.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    584   0.0      
ref|XP_002468444.1|  hypothetical protein SORBIDRAFT_01g046015          582   0.0      Sorghum bicolor [broomcorn]
dbj|BAK06395.1|  predicted protein                                      580   0.0      
gb|KHN19693.1|  F-box/kelch-repeat protein                              579   0.0      
dbj|BAJ89199.1|  predicted protein                                      577   0.0      
ref|XP_004985575.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    577   0.0      
gb|EMT22353.1|  hypothetical protein F775_26656                         576   0.0      
emb|CDM81477.1|  unnamed protein product                                574   0.0      
ref|NP_001147489.1|  kelch motif family protein                         573   0.0      Zea mays [maize]
emb|CDY24045.1|  BnaA06g00430D                                          571   0.0      
ref|XP_003562030.2|  PREDICTED: F-box/kelch-repeat protein At1g55270    568   0.0      
ref|XP_009147515.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    568   0.0      
gb|ABD16062.1|  Kelch-motif containing protein                          560   0.0      Oryza rufipogon [common wild rice]
gb|ABD16065.1|  Kelch-motif containing protein                          560   0.0      Oryza rufipogon [common wild rice]
gb|ABD16060.1|  Kelch-motif containing protein                          560   0.0      Oryza sativa Indica Group [Indian rice]
gb|ABD16045.1|  Kelch-motif containing protein                          559   0.0      Oryza barthii [African wild rice]
gb|ABD16054.1|  Kelch-motif containing protein                          558   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABD16044.1|  Kelch-motif containing protein                          558   0.0      Oryza barthii [African wild rice]
gb|ABD16046.1|  Kelch-motif containing protein                          558   0.0      Oryza meridionalis [Australian wild rice]
gb|ABD16071.1|  Kelch-motif containing protein                          557   0.0      Oryza rufipogon [common wild rice]
gb|ABD16056.1|  Kelch-motif containing protein                          556   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABD16061.1|  Kelch-motif containing protein                          556   0.0      Oryza sativa Indica Group [Indian rice]
gb|ABD16058.1|  Kelch-motif containing protein                          556   0.0      Oryza sativa Indica Group [Indian rice]
gb|ABD16047.1|  Kelch-motif containing protein                          556   0.0      Oryza meridionalis [Australian wild rice]
gb|ABD16057.1|  Kelch-motif containing protein                          556   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC74590.1|  hypothetical protein OsI_10170                          558   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002962792.1|  hypothetical protein SELMODRAFT_438121             558   0.0      
ref|XP_002962493.1|  hypothetical protein SELMODRAFT_404324             558   0.0      
ref|XP_006842862.1|  hypothetical protein AMTR_s00081p00156000          548   3e-179   
gb|ACU23020.1|  unknown                                                 535   5e-174   Glycine max [soybeans]
gb|ABD16059.1|  Kelch-motif containing protein                          533   1e-172   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98018.1|  predicted protein                                      532   1e-171   
gb|EYU39246.1|  hypothetical protein MIMGU_mgv1a006629mg                517   1e-167   
gb|EYU29783.1|  hypothetical protein MIMGU_mgv1a010673mg                516   3e-167   
ref|NP_001046235.1|  Os02g0202900                                       516   2e-165   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84922.1|  hypothetical protein OsI_06290                          516   3e-165   Oryza sativa Indica Group [Indian rice]
dbj|BAD15502.1|  putative kelch repeat-containing F-box family pr...    516   5e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004951526.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    504   8e-161   
ref|XP_008643766.1|  PREDICTED: ring canal kelch isoform X1             499   3e-159   
ref|NP_001150390.1|  ring canal kelch                                   497   2e-158   Zea mays [maize]
ref|XP_008643767.1|  PREDICTED: ring canal kelch isoform X2             493   8e-157   
gb|EEE56522.1|  hypothetical protein OsJ_05806                          463   6e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006598348.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    467   2e-143   
gb|KHN14372.1|  F-box/kelch-repeat protein                              453   9e-143   
gb|EYU24437.1|  hypothetical protein MIMGU_mgv1a024107mg                443   2e-140   
ref|XP_009795061.1|  PREDICTED: probable ethanolamine kinase            447   2e-140   
gb|EYU24438.1|  hypothetical protein MIMGU_mgv1a026698mg                442   7e-140   
gb|KHN22962.1|  F-box/kelch-repeat protein                              449   3e-138   
ref|XP_009611033.1|  PREDICTED: probable ethanolamine kinase            440   1e-137   
ref|XP_002285099.1|  PREDICTED: probable ethanolamine kinase isof...    437   1e-136   Vitis vinifera
ref|XP_010656415.1|  PREDICTED: probable ethanolamine kinase isof...    434   1e-136   
emb|CAN63497.1|  hypothetical protein VITISV_011672                     437   1e-136   Vitis vinifera
tpg|DAA43582.1|  TPA: kelch motif family protein, mRNA isoform 1        434   2e-136   
gb|KCW79807.1|  hypothetical protein EUGRSUZ_C01140                     430   3e-135   
ref|XP_010047817.1|  PREDICTED: LOW QUALITY PROTEIN: probable eth...    432   9e-135   
ref|XP_006367512.1|  PREDICTED: probable ethanolamine kinase-like       431   2e-134   
gb|KHG13777.1|  putative ethanolamine kinase A                          430   7e-134   
ref|XP_002524470.1|  choline/ethanolamine kinase, putative              426   3e-133   Ricinus communis
ref|XP_007202147.1|  hypothetical protein PRUPE_ppa007064mg             428   3e-133   
ref|XP_008242753.1|  PREDICTED: probable ethanolamine kinase            428   4e-133   
ref|XP_008463048.1|  PREDICTED: probable ethanolamine kinase isof...    427   9e-133   
ref|XP_008463050.1|  PREDICTED: probable ethanolamine kinase isof...    427   1e-132   
ref|XP_004138363.1|  PREDICTED: probable ethanolamine kinase A-li...    426   2e-132   
ref|XP_004138364.1|  PREDICTED: probable ethanolamine kinase A-li...    426   2e-132   
gb|KHG00049.1|  putative ethanolamine kinase A                          422   4e-131   
ref|XP_004287343.1|  PREDICTED: probable ethanolamine kinase A-like     422   6e-131   
emb|CDP10387.1|  unnamed protein product                                421   9e-131   
ref|XP_007013403.1|  Kinase superfamily protein isoform 1               421   1e-130   
ref|XP_010254375.1|  PREDICTED: probable ethanolamine kinase            420   2e-130   
ref|XP_004245179.1|  PREDICTED: probable ethanolamine kinase            420   3e-130   
ref|XP_006450957.1|  hypothetical protein CICLE_v10008632mg             419   6e-130   
ref|XP_006381367.1|  choline/ethanolamine kinase family protein         419   9e-130   
ref|XP_011018823.1|  PREDICTED: probable ethanolamine kinase isof...    418   1e-129   
ref|XP_008337310.1|  PREDICTED: probable ethanolamine kinase            419   1e-129   
ref|XP_010093730.1|  putative ethanolamine kinase A                     418   2e-129   
ref|XP_011018821.1|  PREDICTED: probable ethanolamine kinase isof...    418   2e-129   
gb|EYU29782.1|  hypothetical protein MIMGU_mgv1a008431mg                416   8e-129   
ref|XP_008344084.1|  PREDICTED: probable ethanolamine kinase            416   9e-129   
ref|XP_008385729.1|  PREDICTED: probable ethanolamine kinase            416   1e-128   
ref|XP_010250053.1|  PREDICTED: probable ethanolamine kinase isof...    413   5e-128   
ref|XP_009368829.1|  PREDICTED: probable ethanolamine kinase            414   5e-128   
gb|KDP32383.1|  hypothetical protein JCGZ_13308                         414   7e-128   
ref|XP_010250052.1|  PREDICTED: probable ethanolamine kinase isof...    412   7e-128   
ref|XP_010250050.1|  PREDICTED: probable ethanolamine kinase isof...    411   3e-127   
ref|XP_011084093.1|  PREDICTED: probable ethanolamine kinase            409   2e-126   
ref|XP_008784349.1|  PREDICTED: probable ethanolamine kinase            405   9e-125   
ref|XP_010688024.1|  PREDICTED: probable ethanolamine kinase            403   5e-124   
ref|XP_010533172.1|  PREDICTED: probable ethanolamine kinase            403   6e-124   
ref|XP_010917426.1|  PREDICTED: probable ethanolamine kinase isof...    403   1e-123   
ref|XP_004956895.1|  PREDICTED: probable ethanolamine kinase A-like     400   8e-123   
ref|XP_006842861.1|  hypothetical protein AMTR_s00081p00154850          398   3e-122   
ref|XP_006661274.1|  PREDICTED: probable ethanolamine kinase-like       396   1e-121   
ref|XP_002460268.1|  hypothetical protein SORBIDRAFT_02g025680          395   5e-121   Sorghum bicolor [broomcorn]
ref|XP_009103553.1|  PREDICTED: probable ethanolamine kinase            395   6e-121   
gb|ACG37870.1|  choline/ethanolamine kinase                             394   1e-120   Zea mays [maize]
emb|CDY04460.1|  BnaA07g12860D                                          393   3e-120   
ref|NP_001132180.1|  uncharacterized protein LOC100193605               391   4e-120   Zea mays [maize]
ref|XP_010541898.1|  PREDICTED: probable ethanolamine kinase isof...    392   5e-120   
gb|ACF82580.1|  unknown                                                 390   5e-120   Zea mays [maize]
tpg|DAA61638.1|  TPA: choline/ethanolamine kinase                       392   5e-120   
gb|EPS66866.1|  hypothetical protein M569_07911                         390   1e-119   
ref|XP_006578442.1|  PREDICTED: probable ethanolamine kinase            391   1e-119   
tpg|DAA61639.1|  TPA: hypothetical protein ZEAMMB73_138989              393   2e-119   
ref|XP_006450962.1|  hypothetical protein CICLE_v10008632mg             385   2e-119   
dbj|BAD36072.1|  putative ethanolamine kinase 1                         390   2e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296073.1|  hypothetical protein CARUB_v10025223mg             390   3e-119   
gb|KHN24262.1|  Putative ethanolamine kinase A                          390   4e-119   
emb|CDX71494.1|  BnaC04g17290D                                          390   4e-119   
ref|XP_006408728.1|  hypothetical protein EUTSA_v10002015mg             390   4e-119   
ref|XP_006408727.1|  hypothetical protein EUTSA_v10002015mg             389   4e-119   
ref|NP_001146697.1|  choline/ethanolamine kinase                        390   6e-119   Zea mays [maize]
ref|XP_008650912.1|  PREDICTED: uncharacterized protein LOC100193...    393   6e-119   
gb|ACG32241.1|  choline/ethanolamine kinase                             390   6e-119   Zea mays [maize]
gb|KEH37939.1|  choline/ethanolamine kinase                             389   9e-119   
ref|XP_008803395.1|  PREDICTED: probable ethanolamine kinase isof...    389   1e-118   
ref|XP_002879014.1|  EMB1187                                            386   5e-118   
ref|XP_010510853.1|  PREDICTED: probable ethanolamine kinase isof...    387   6e-118   
dbj|BAK04334.1|  predicted protein                                      386   6e-118   
dbj|BAJ95686.1|  predicted protein                                      386   8e-118   
ref|XP_003578170.1|  PREDICTED: probable ethanolamine kinase isof...    386   8e-118   
ref|XP_010473069.1|  PREDICTED: probable ethanolamine kinase            385   1e-117   
gb|KCW79806.1|  hypothetical protein EUGRSUZ_C01140                     380   2e-117   
ref|XP_007138304.1|  hypothetical protein PHAVU_009G197300g             384   3e-117   
gb|KHN35895.1|  Putative ethanolamine kinase A                          384   5e-117   
ref|XP_009401315.1|  PREDICTED: probable ethanolamine kinase            384   6e-117   
gb|KFK32459.1|  hypothetical protein AALP_AA6G244500                    383   7e-117   
ref|XP_008650913.1|  PREDICTED: uncharacterized protein LOC100193...    387   1e-116   
ref|NP_180251.1|  protein embryo defective 1187                         382   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391720.1|  PREDICTED: probable ethanolamine kinase isof...    382   5e-116   
ref|XP_003527156.2|  PREDICTED: probable ethanolamine kinase-like       384   1e-115   
gb|AAM65218.1|  putative choline kinase                                 379   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417828.1|  PREDICTED: probable ethanolamine kinase            379   3e-115   
ref|XP_010238204.1|  PREDICTED: probable ethanolamine kinase isof...    379   4e-115   
gb|ACU18853.1|  unknown                                                 370   6e-114   Glycine max [soybeans]
ref|XP_004488530.1|  PREDICTED: probable ethanolamine kinase A-li...    372   7e-114   
ref|XP_009391719.1|  PREDICTED: probable ethanolamine kinase isof...    375   9e-114   
ref|XP_004488529.1|  PREDICTED: probable ethanolamine kinase A-li...    373   3e-113   
ref|XP_008803396.1|  PREDICTED: probable ethanolamine kinase isof...    374   4e-113   
ref|XP_010541899.1|  PREDICTED: probable ethanolamine kinase isof...    366   3e-111   
ref|XP_010541896.1|  PREDICTED: probable ethanolamine kinase isof...    367   8e-111   
ref|XP_006450961.1|  hypothetical protein CICLE_v10008632mg             358   4e-108   
gb|EEC84637.1|  hypothetical protein OsI_31512                          338   8e-101   Oryza sativa Indica Group [Indian rice]
gb|EEE69789.1|  hypothetical protein OsJ_29506                          338   8e-101   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA40143.1|  TPA: hypothetical protein ZEAMMB73_803950              332   9e-101   
gb|KCW79808.1|  hypothetical protein EUGRSUZ_C01140                     330   4e-100   
tpg|DAA61637.1|  TPA: hypothetical protein ZEAMMB73_138989              333   2e-99    
ref|XP_001755632.1|  predicted protein                                  333   1e-98    
ref|XP_008650914.1|  PREDICTED: uncharacterized protein LOC100193...    335   2e-98    
gb|KHG30539.1|  putative ethanolamine kinase A                          330   2e-98    
ref|XP_006450958.1|  hypothetical protein CICLE_v10008632mg             325   2e-98    
ref|XP_002963499.1|  hypothetical protein SELMODRAFT_438648             322   2e-95    
ref|XP_001783840.1|  predicted protein                                  316   4e-93    
ref|XP_006450956.1|  hypothetical protein CICLE_v10008632mg             311   3e-92    
ref|XP_002988210.1|  hypothetical protein SELMODRAFT_127783             310   4e-91    
gb|EMT11296.1|  hypothetical protein F775_09005                         307   7e-89    
gb|KCW79809.1|  hypothetical protein EUGRSUZ_C01140                     294   1e-87    
gb|EMS67822.1|  putative ethanolamine kinase A                          295   3e-85    
gb|ACN29000.1|  unknown                                                 286   4e-84    
ref|XP_007013406.1|  Kinase superfamily protein isoform 4               285   7e-83    
ref|XP_002453508.1|  hypothetical protein SORBIDRAFT_04g007050          281   3e-82    
ref|XP_010238205.1|  PREDICTED: probable ethanolamine kinase isof...    283   4e-82    
ref|XP_002988135.1|  hypothetical protein SELMODRAFT_127146             275   7e-79    
ref|XP_002972669.1|  hypothetical protein SELMODRAFT_98401              274   1e-78    
ref|XP_010932719.1|  PREDICTED: probable ethanolamine kinase            245   2e-68    
ref|XP_010917425.1|  PREDICTED: probable ethanolamine kinase isof...    246   7e-68    
gb|EYU26761.1|  hypothetical protein MIMGU_mgv1a0182172mg               234   1e-66    
ref|NP_001063269.1|  Os09g0438400                                       238   4e-65    
ref|XP_010250054.1|  PREDICTED: probable ethanolamine kinase isof...    209   2e-60    
ref|XP_006450955.1|  hypothetical protein CICLE_v10008632mg             213   1e-57    
ref|XP_006450965.1|  hypothetical protein CICLE_v10008632mg             210   4e-57    
ref|XP_006628608.1|  PREDICTED: ethanolamine kinase 1-like              209   2e-55    
dbj|GAM18000.1|  hypothetical protein SAMD00019534_011750               209   2e-55    
emb|CDS08084.1|  hypothetical protein LRAMOSA02033                      209   3e-55    
ref|XP_006408726.1|  hypothetical protein EUTSA_v10002015mg             204   1e-54    
ref|XP_005645428.1|  putative ethanolamine kinase 1                     207   1e-54    
gb|EFA74777.1|  ethanolamine kinase A                                   206   1e-54    
gb|KFH66281.1|  hypothetical protein MVEG_08380                         206   3e-54    
emb|CDH49124.1|  ethanolamine kinase 2                                  206   3e-54    
ref|XP_644218.1|  ethanolamine kinase A                                 205   4e-54    
ref|XP_005991748.1|  PREDICTED: ethanolamine kinase 1-like              201   2e-53    
gb|ESA02400.1|  hypothetical protein GLOINDRAFT_337399                  202   3e-53    
ref|XP_002453509.1|  hypothetical protein SORBIDRAFT_04g007055          196   5e-53    
ref|XP_008298417.1|  PREDICTED: ethanolamine kinase 1-like              201   1e-52    
ref|XP_007251461.1|  PREDICTED: ethanolamine kinase 1-like              202   1e-52    
ref|XP_010894441.1|  PREDICTED: ethanolamine kinase 2                   201   1e-52    
emb|CDQ76285.1|  unnamed protein product                                200   3e-52    
emb|CBN80609.1|  Ethanolamine kinase 1                                  200   3e-52    
ref|NP_001029347.1|  ethanolamine kinase 2                              200   3e-52    
ref|XP_003973790.1|  PREDICTED: ethanolamine kinase 1-like              199   5e-52    
ref|XP_010735079.1|  PREDICTED: ethanolamine kinase 2 isoform X2        198   6e-52    
ref|XP_005799116.1|  PREDICTED: ethanolamine kinase 1-like              199   6e-52    
ref|XP_007560961.1|  PREDICTED: ethanolamine kinase 2                   198   1e-51    
ref|XP_010735078.1|  PREDICTED: ethanolamine kinase 2 isoform X1        198   1e-51    
ref|XP_003442801.1|  PREDICTED: ethanolamine kinase 1-like              197   3e-51    
gb|KFQ78482.1|  Ethanolamine kinase 1                                   195   3e-51    
gb|KFV03522.1|  Ethanolamine kinase 1                                   194   7e-51    
gb|KFP53464.1|  Ethanolamine kinase 1                                   194   7e-51    
gb|KGL85449.1|  Ethanolamine kinase 1                                   194   8e-51    
ref|XP_008318709.1|  PREDICTED: ethanolamine kinase 1-like isofor...    195   1e-50    
ref|XP_006800248.1|  PREDICTED: ethanolamine kinase 1-like              195   1e-50    
ref|XP_008408455.1|  PREDICTED: ethanolamine kinase 2                   195   1e-50    
ref|XP_005933551.1|  PREDICTED: ethanolamine kinase 1-like              195   1e-50    
gb|KFP11025.1|  Ethanolamine kinase 1                                   194   1e-50    
ref|XP_004559958.1|  PREDICTED: ethanolamine kinase 1-like              195   1e-50    
ref|XP_005726726.1|  PREDICTED: ethanolamine kinase 1-like isofor...    195   1e-50    
gb|KFO69307.1|  Ethanolamine kinase 1                                   193   2e-50    
gb|KGL88874.1|  Ethanolamine kinase 1                                   193   2e-50    
gb|KFQ16037.1|  Ethanolamine kinase 1                                   193   2e-50    
gb|KFQ28691.1|  Ethanolamine kinase 1                                   192   3e-50    
ref|XP_004362389.1|  ethanolamine kinase A                              201   3e-50    
gb|KFP27874.1|  Ethanolamine kinase 1                                   192   3e-50    
gb|ELK24021.1|  Ethanolamine kinase 2                                   192   3e-50    
gb|KFV18609.1|  Ethanolamine kinase 1                                   192   3e-50    
ref|XP_005511385.1|  PREDICTED: ethanolamine kinase 1-like              194   3e-50    
ref|XP_003357431.1|  PREDICTED: ethanolamine kinase 2 isoform X1        195   3e-50    
gb|KFQ32646.1|  Ethanolamine kinase 1                                   192   3e-50    
gb|KFQ65462.1|  Ethanolamine kinase 1                                   192   4e-50    
ref|XP_010199752.1|  PREDICTED: ethanolamine kinase 1                   193   4e-50    
gb|KFP67242.1|  Ethanolamine kinase 1                                   192   4e-50    
ref|XP_009957311.1|  PREDICTED: ethanolamine kinase 1                   192   4e-50    
ref|XP_010179566.1|  PREDICTED: ethanolamine kinase 1                   192   4e-50    
ref|XP_009904472.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    194   4e-50    
ref|XP_009488475.1|  PREDICTED: ethanolamine kinase 1                   192   4e-50    
gb|KFP99798.1|  Ethanolamine kinase 1                                   192   4e-50    
gb|EDL39648.1|  ethanolamine kinase 2, isoform CRA_a                    192   4e-50    
ref|XP_006133147.1|  PREDICTED: ethanolamine kinase 2 isoform X2        192   4e-50    
ref|XP_001370544.2|  PREDICTED: ethanolamine kinase 2 isoform X1        195   4e-50    
ref|XP_009576061.1|  PREDICTED: ethanolamine kinase 1                   193   5e-50    
ref|XP_010015776.1|  PREDICTED: ethanolamine kinase 1                   192   5e-50    
gb|KFU93623.1|  Ethanolamine kinase 1                                   192   5e-50    
gb|KFV75418.1|  Ethanolamine kinase 1                                   192   5e-50    
gb|KFP75464.1|  Ethanolamine kinase 1                                   192   5e-50    
ref|XP_010118967.1|  PREDICTED: ethanolamine kinase 1                   192   6e-50    
ref|XP_009702976.1|  PREDICTED: ethanolamine kinase 1                   192   6e-50    
ref|XP_009930387.1|  PREDICTED: ethanolamine kinase 1                   192   6e-50    
ref|XP_006772068.1|  PREDICTED: ethanolamine kinase 2                   192   6e-50    
gb|EPQ15365.1|  Ethanolamine kinase 2                                   192   6e-50    
gb|KFR07482.1|  Ethanolamine kinase 1                                   192   6e-50    
ref|XP_005240197.1|  PREDICTED: ethanolamine kinase 1                   192   7e-50    
ref|XP_008925523.1|  PREDICTED: ethanolamine kinase 1                   192   8e-50    
ref|XP_007895485.1|  PREDICTED: ethanolamine kinase 1                   193   8e-50    
ref|XP_004069091.1|  PREDICTED: ethanolamine kinase 1-like              193   8e-50    
gb|AAP47267.1|  putative ethanolamine kinase                            191   9e-50    
emb|CEJ00597.1|  hypothetical protein RMCBS344292_14649                 189   9e-50    
gb|KFW91508.1|  Ethanolamine kinase 1                                   191   1e-49    
ref|XP_009503859.1|  PREDICTED: ethanolamine kinase 1                   191   1e-49    
gb|KFO98110.1|  Ethanolamine kinase 1                                   191   1e-49    
ref|XP_007071272.1|  PREDICTED: ethanolamine kinase 1                   191   1e-49    
ref|XP_005428467.1|  PREDICTED: ethanolamine kinase 1                   191   1e-49    
gb|KFO03578.1|  Ethanolamine kinase 1                                   191   1e-49    
gb|KFV38805.1|  Ethanolamine kinase 1                                   191   1e-49    
ref|XP_004610105.1|  PREDICTED: ethanolamine kinase 2                   193   1e-49    
ref|XP_005148216.1|  PREDICTED: ethanolamine kinase 1                   192   2e-49    
ref|XP_005040180.1|  PREDICTED: ethanolamine kinase 1                   192   2e-49    
ref|XP_008683379.1|  PREDICTED: ethanolamine kinase 2 isoform X1        189   2e-49    
ref|XP_005433726.1|  PREDICTED: ethanolamine kinase 1                   192   2e-49    
ref|XP_008577450.1|  PREDICTED: ethanolamine kinase 1                   192   2e-49    
ref|XP_009868219.1|  PREDICTED: ethanolamine kinase 1                   190   2e-49    
ref|XP_005878645.1|  PREDICTED: ethanolamine kinase 2                   192   2e-49    
gb|KFP89230.1|  Ethanolamine kinase 1                                   190   2e-49    
gb|EDL39649.1|  ethanolamine kinase 2, isoform CRA_b                    191   2e-49    
ref|XP_006133146.1|  PREDICTED: ethanolamine kinase 2 isoform X1        192   2e-49    
ref|XP_010564393.1|  PREDICTED: ethanolamine kinase 1                   192   2e-49    
ref|XP_005492936.1|  PREDICTED: ethanolamine kinase 1                   191   2e-49    
gb|KFO86783.1|  Ethanolamine kinase 1                                   190   2e-49    
gb|KFW83755.1|  Ethanolamine kinase 1                                   189   2e-49    
ref|XP_010714214.1|  PREDICTED: ethanolamine kinase 1                   191   2e-49    
ref|XP_005072984.1|  PREDICTED: ethanolamine kinase 1                   189   2e-49    
ref|XP_010129671.1|  PREDICTED: ethanolamine kinase 1                   190   3e-49    
gb|EGV97870.1|  Ethanolamine kinase 1                                   189   3e-49    
gb|EPB88258.1|  hypothetical protein HMPREF1544_04966                   192   3e-49    
ref|XP_005611108.1|  PREDICTED: ethanolamine kinase 1                   191   3e-49    
ref|XP_005527044.1|  PREDICTED: ethanolamine kinase 1                   191   3e-49    
ref|XP_005023099.1|  PREDICTED: ethanolamine kinase 1                   192   3e-49    
ref|XP_006024863.1|  PREDICTED: ethanolamine kinase 2                   191   4e-49    
ref|XP_416426.3|  PREDICTED: ethanolamine kinase 1 isoform X2           191   4e-49    
ref|XP_006062395.1|  PREDICTED: ethanolamine kinase 2                   190   4e-49    
ref|NP_780652.2|  ethanolamine kinase 2                                 191   4e-49    
ref|XP_006264882.1|  PREDICTED: ethanolamine kinase 2                   191   4e-49    
gb|ACJ74076.1|  choline kinase                                          191   4e-49    
ref|XP_004896564.1|  PREDICTED: ethanolamine kinase 2                   189   5e-49    
ref|XP_004634612.1|  PREDICTED: ethanolamine kinase 1                   191   5e-49    
ref|XP_005690442.1|  PREDICTED: ethanolamine kinase 2                   188   5e-49    
ref|XP_009093432.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   5e-49    
ref|XP_005364638.1|  PREDICTED: ethanolamine kinase 1                   191   5e-49    
gb|ERE65957.1|  ethanolamine kinase 1-like protein                      189   5e-49    
ref|XP_002918257.1|  PREDICTED: ethanolamine kinase 2-like              189   6e-49    
ref|XP_008257762.1|  PREDICTED: ethanolamine kinase 1                   190   6e-49    
ref|XP_007631813.1|  PREDICTED: ethanolamine kinase 1                   189   6e-49    
ref|XP_689471.3|  PREDICTED: ethanolamine kinase 1 isoform X1           190   7e-49    
ref|XP_010402575.1|  PREDICTED: ethanolamine kinase 1                   190   7e-49    
ref|XP_005898442.1|  PREDICTED: ethanolamine kinase 2                   187   7e-49    
ref|XP_008528262.1|  PREDICTED: ethanolamine kinase 2                   191   8e-49    
ref|XP_005296668.1|  PREDICTED: ethanolamine kinase 1                   190   8e-49    
ref|XP_006121332.1|  PREDICTED: ethanolamine kinase 1 isoform X1        189   8e-49    
ref|XP_005992337.1|  PREDICTED: ethanolamine kinase 1                   189   8e-49    
gb|ELK11993.1|  Ethanolamine kinase 1                                   190   1e-48    
ref|XP_006897270.1|  PREDICTED: ethanolamine kinase 1-like              190   1e-48    
ref|XP_010016567.1|  PREDICTED: ethanolamine kinase 2                   188   1e-48    
ref|XP_008633789.1|  PREDICTED: ethanolamine kinase 1                   190   1e-48    
ref|XP_002946615.1|  choline                                            188   1e-48    
ref|XP_004892040.1|  PREDICTED: ethanolamine kinase 1-like              189   1e-48    
ref|XP_008488484.1|  PREDICTED: ethanolamine kinase 1                   190   1e-48    
ref|XP_009964287.1|  PREDICTED: ethanolamine kinase 1-like              190   1e-48    
ref|XP_005570613.1|  PREDICTED: ethanolamine kinase 1                   189   1e-48    
ref|XP_008152442.1|  PREDICTED: ethanolamine kinase 2                   190   1e-48    
ref|XP_003405741.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    192   1e-48    
ref|XP_004685589.1|  PREDICTED: ethanolamine kinase 2 isoform X1        190   1e-48    
ref|XP_006184604.1|  PREDICTED: ethanolamine kinase 1                   189   1e-48    
gb|EDM09770.1|  ethanolamine kinase 2 (predicted), isoform CRA_b        189   2e-48    
gb|ELR54510.1|  Ethanolamine kinase 2                                   187   2e-48    
ref|XP_005680810.1|  PREDICTED: ethanolamine kinase 1                   189   2e-48    
ref|XP_005379138.1|  PREDICTED: ethanolamine kinase 1                   189   2e-48    
gb|ELK03338.1|  Ethanolamine kinase 2                                   189   2e-48    
gb|ERE74391.1|  ethanolamine kinase 2-like protein                      188   2e-48    
ref|XP_010613716.1|  PREDICTED: ethanolamine kinase 1                   189   2e-48    
ref|XP_004592677.1|  PREDICTED: ethanolamine kinase 1                   189   2e-48    
ref|XP_004444130.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   3e-48    
ref|XP_007433115.1|  PREDICTED: ethanolamine kinase 1                   189   3e-48    
ref|NP_001044073.1|  Os01g0717000                                       189   3e-48    
ref|XP_006990102.1|  PREDICTED: ethanolamine kinase 1                   188   3e-48    
sp|D3ZRW8.1|EKI2_RAT  RecName: Full=Ethanolamine kinase 2; Short=...    189   3e-48    
ref|XP_004425196.1|  PREDICTED: ethanolamine kinase 2 isoform 1         189   3e-48    
ref|XP_008691349.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   3e-48    
ref|XP_002915323.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   3e-48    
ref|XP_004776047.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   3e-48    
ref|XP_010821315.1|  PREDICTED: ethanolamine kinase 2                   187   3e-48    
ref|XP_004001394.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   3e-48    
ref|XP_007086631.1|  PREDICTED: ethanolamine kinase 2                   186   4e-48    
ref|XP_005328956.1|  PREDICTED: ethanolamine kinase 1                   188   4e-48    
ref|XP_007099168.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   4e-48    
ref|XP_004383641.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    191   4e-48    
ref|XP_006731615.1|  PREDICTED: ethanolamine kinase 2 isoform X1        189   4e-48    
gb|EQB78156.1|  hypothetical protein CB1_000597055                      194   4e-48    
ref|XP_003505806.1|  PREDICTED: ethanolamine kinase 2 isoform X1        188   4e-48    
ref|XP_006922986.1|  PREDICTED: ethanolamine kinase 2                   188   4e-48    
dbj|BAC33939.1|  unnamed protein product                                187   4e-48    
ref|XP_010142144.1|  PREDICTED: ethanolamine kinase 2                   186   5e-48    
ref|XP_543764.3|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine ki...    190   5e-48    
ref|XP_007633894.1|  PREDICTED: ethanolamine kinase 2 isoform X2        188   6e-48    
ref|XP_007944987.1|  PREDICTED: ethanolamine kinase 1                   187   6e-48    
ref|XP_007425234.1|  PREDICTED: ethanolamine kinase 2                   188   6e-48    
gb|AAP96922.1|  choline kinase                                          187   6e-48    
ref|NP_001101364.1|  ethanolamine kinase 1                              187   6e-48    
ref|XP_004862227.1|  PREDICTED: ethanolamine kinase 2                   188   6e-48    
ref|NP_083526.2|  ethanolamine kinase 1                                 187   8e-48    
ref|XP_004700034.1|  PREDICTED: ethanolamine kinase 1                   187   8e-48    
ref|XP_007508004.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    187   8e-48    
ref|XP_007481261.1|  PREDICTED: ethanolamine kinase 2 isoform X2        187   9e-48    
ref|XP_003828930.1|  PREDICTED: ethanolamine kinase 1 isoform X1        189   1e-47    
ref|XP_004392864.1|  PREDICTED: ethanolamine kinase 2                   187   1e-47    
ref|XP_004693270.1|  PREDICTED: ethanolamine kinase 1                   187   1e-47    
ref|XP_006769700.1|  PREDICTED: ethanolamine kinase 1-like              187   1e-47    
ref|NP_061108.2|  ethanolamine kinase 1 isoform A                       189   1e-47    
ref|XP_006912747.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    189   1e-47    
gb|EHH66148.1|  Ethanolamine kinase 1                                   189   1e-47    
ref|XP_004052911.1|  PREDICTED: ethanolamine kinase 1 isoform 1         189   1e-47    
ref|XP_002823070.1|  PREDICTED: ethanolamine kinase 1 isoform X1        189   1e-47    
ref|XP_005869610.1|  PREDICTED: ethanolamine kinase 1-like              185   1e-47    
ref|XP_004578791.1|  PREDICTED: ethanolamine kinase 2                   187   1e-47    
ref|XP_007166206.1|  PREDICTED: ethanolamine kinase 2 isoform X1        187   1e-47    
ref|XP_006215572.1|  PREDICTED: ethanolamine kinase 2                   186   1e-47    
gb|EHB07681.1|  Ethanolamine kinase 1                                   189   1e-47    
ref|XP_004282522.1|  PREDICTED: ethanolamine kinase 2 isoform 1         187   1e-47    
ref|XP_003265642.1|  PREDICTED: ethanolamine kinase 1                   189   1e-47    
ref|XP_007886040.1|  PREDICTED: ethanolamine kinase 1-like              187   1e-47    
ref|XP_007966096.1|  PREDICTED: ethanolamine kinase 1                   189   1e-47    
ref|XP_004363700.1|  choline/ethanolamine kinase                        186   1e-47    
ref|XP_006199998.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    189   1e-47    
ref|XP_008511023.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    190   1e-47    



>ref|XP_010656414.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Vitis vinifera]
Length=431

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/429 (86%), Positives = 402/429 (94%), Gaps = 1/429 (0%)
 Frame = +2

Query  731   RMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-D  907
             +MDRVIQPPLVDTTACLCRVDAGLKTVAGAK++VPGTKLCLQP IKPSIHPTR KP R D
Sbjct  3     KMDRVIQPPLVDTTACLCRVDAGLKTVAGAKKFVPGTKLCLQPDIKPSIHPTRHKPSRGD  62

Query  908   KNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEE  1087
             ++R+QSPLLPGLPDDLAIACLIRVPRIEH KLRLVCKRWYRLL GNFYYSLRK L IAEE
Sbjct  63    RSRSQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLVGNFYYSLRKNLGIAEE  122

Query  1088  WIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPV  1267
             WIYVIKRDR+GK+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+
Sbjct  123   WIYVIKRDREGKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPL  182

Query  1268  KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYD  1447
             KGSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SLRSAEVYD
Sbjct  183   KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVYD  242

Query  1448  PNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVT  1627
             PN+NRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPETD+W  VYDGMV 
Sbjct  243   PNRNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPETDSWYPVYDGMVA  302

Query  1628  GWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSG  1807
             GWRNPS +LNG+LYALDC+DGCKLRVYDE ++SWSKHIDS+MHLG S+ALEAAAL+PL G
Sbjct  303   GWRNPSASLNGQLYALDCKDGCKLRVYDEVSDSWSKHIDSKMHLGNSQALEAAALVPLHG  362

Query  1808  KLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSH  1987
             KLCIIRNNMSISLV+V+K +D    T+EHLWETI G+GQFKT+VTN  SSLAGR+RLKSH
Sbjct  363   KLCIIRNNMSISLVNVSKSEDMTGPTAEHLWETIAGRGQFKTLVTNLWSSLAGRNRLKSH  422

Query  1988  IVHCQVLQT  2014
             IVHCQVLQ 
Sbjct  423   IVHCQVLQA  431



>gb|KDP32382.1| hypothetical protein JCGZ_13307 [Jatropha curcas]
Length=428

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/428 (87%), Positives = 400/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR IQPPLVDTTACLCRVDAGLKTVA AK+YVPG+KLCLQP IKPSIHPTR KP R D+
Sbjct  1     MDRGIQPPLVDTTACLCRVDAGLKTVASAKKYVPGSKLCLQPDIKPSIHPTRSKPSRGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNF+YSLR+ L IAEEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFFYSLRRNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRD K+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDRKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG H SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGGHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY+G+W+LKGLG+HRQV+SEVY+PETD+W  VYDGMV+G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYEGRWFLKGLGSHRQVLSEVYEPETDSWYPVYDGMVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS +LNG LYALDC+DGCKLRVYD+ TNSWSKHIDS+MH+G S+ALEAAAL+PL+GK
Sbjct  301   WRNPSASLNGHLYALDCKDGCKLRVYDDVTNSWSKHIDSKMHMGNSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +D   AT+EHLWETI GKGQFKT+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSEDLRGATAEHLWETISGKGQFKTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_010047816.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Eucalyptus 
grandis]
 gb|KCW79805.1| hypothetical protein EUGRSUZ_C01139 [Eucalyptus grandis]
Length=432

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/431 (85%), Positives = 400/431 (93%), Gaps = 1/431 (0%)
 Frame = +2

Query  725   RSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR  904
             R  MDRVIQPPLVD+TACLCRVDAGLKTVAGAK+YVPGTKLCLQP IKPSIHPTR KP R
Sbjct  2     RRDMDRVIQPPLVDSTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRNKPAR  61

Query  905   -DKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIA  1081
              D+NR QSPLLPGLPDDLAIACLIRVPR+EHCKLRLVCK+WY+LL+GNF+YSLRK L IA
Sbjct  62    GDRNRNQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKKWYKLLSGNFFYSLRKSLGIA  121

Query  1082  EEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKD  1261
             EEW+YVIKRDRDGK+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKD
Sbjct  122   EEWVYVIKRDRDGKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKD  181

Query  1262  PVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEV  1441
             P+KGSMRRV+FYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH ++RSAEV
Sbjct  182   PLKGSMRRVVFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRTMRSAEV  241

Query  1442  YDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGM  1621
             YDPN+NRWS IS+MSTAMVPFIGVVY+GKWYLKGLG+HRQV+SEVYQPETD+W  VYDGM
Sbjct  242   YDPNRNRWSFISEMSTAMVPFIGVVYEGKWYLKGLGSHRQVLSEVYQPETDSWFPVYDGM  301

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             V GWRNPS + NG LYALDC+DGCKLRVYDE T+SWSKHIDS+MHLG S+ALEAAAL+PL
Sbjct  302   VAGWRNPSVSFNGHLYALDCKDGCKLRVYDEVTDSWSKHIDSKMHLGNSQALEAAALVPL  361

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLK  1981
             +GKLC+IRNNMSIS+VDV+K D    AT+EHLWETI GK Q +TMVTN  S++AGR+RLK
Sbjct  362   NGKLCVIRNNMSISVVDVSKSDGGRGATAEHLWETIAGKSQLRTMVTNLWSNIAGRNRLK  421

Query  1982  SHIVHCQVLQT  2014
             SHIVHCQVLQ 
Sbjct  422   SHIVHCQVLQA  432



>emb|CAN63498.1| hypothetical protein VITISV_011673 [Vitis vinifera]
Length=428

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/428 (86%), Positives = 400/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRVIQPPLVDTTACLCRVDAGLKTVAGAK++VPGTKLCLQP IKPSIHPTR KP R D+
Sbjct  1     MDRVIQPPLVDTTACLCRVDAGLKTVAGAKKFVPGTKLCLQPDIKPSIHPTRHKPSRGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPRIEH KLRLVCKRWYRLL GNFYYSLRK L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLVGNFYYSLRKNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDR+GK+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDREGKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SLRSAE YDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEXYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             N+NRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPETD+W  VYDGMV G
Sbjct  241   NRNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPETDSWYPVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS +LNG+LYALDC+DGCKLRVYDE ++SWSKHIDS+MHLG S+ALEAAAL+PL GK
Sbjct  301   WRNPSASLNGQLYALDCKDGCKLRVYDEVSDSWSKHIDSKMHLGNSQALEAAALVPLHGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLV+V+K +D    T+EHLWETI G+GQFKT+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVNVSKSEDMTGPTAEHLWETIAGRGQFKTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_007202129.1| hypothetical protein PRUPE_ppa006078mg [Prunus persica]
 gb|EMJ03328.1| hypothetical protein PRUPE_ppa006078mg [Prunus persica]
Length=428

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/428 (86%), Positives = 397/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR IQPPLVDTTACLCRVDAGLKTV+GAK+YVPG KLCLQP IKPSIHPTR KP R D 
Sbjct  1     MDRRIQPPLVDTTACLCRVDAGLKTVSGAKKYVPGAKLCLQPDIKPSIHPTRSKPSRGDG  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+YSLRK L IAEEW
Sbjct  61    SRIQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IY+IKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYLIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPE D+W +VYDGMV G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPENDSWYSVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS  LNG LYALDC+DGCKLRVYDEAT+SW KHIDS+MHLG S+ALEAA+L+PL+GK
Sbjct  301   WRNPSAALNGHLYALDCKDGCKLRVYDEATDSWGKHIDSKMHLGNSRALEAASLVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K  D G A++EHLWETI G+GQF+T+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSSDVGGASAEHLWETIAGRGQFRTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_008242752.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Prunus 
mume]
Length=428

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/428 (86%), Positives = 397/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR IQPPLVDTTACLCRVDAGLKTV+GAK+YVPG KLCLQP IKPSIHPTR KP R D 
Sbjct  1     MDRRIQPPLVDTTACLCRVDAGLKTVSGAKKYVPGAKLCLQPDIKPSIHPTRSKPSRGDG  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+YSLRK L IAEEW
Sbjct  61    SRIQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IY+IKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYLIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPE D+W +VYDGMV G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPENDSWYSVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS  LNG LYALDC+DGCKLRVYDEAT+SW KHIDS+MHLG S+ALEAA+L+PL+GK
Sbjct  301   WRNPSAALNGHLYALDCKDGCKLRVYDEATDSWGKHIDSKMHLGNSRALEAASLVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K  + G A++EHLWETI G+GQF+T+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSSEVGGASAEHLWETIAGRGQFRTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_006450966.1| hypothetical protein CICLE_v10008382mg [Citrus clementina]
 ref|XP_006475820.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Citrus 
sinensis]
 gb|ESR64206.1| hypothetical protein CICLE_v10008382mg [Citrus clementina]
 gb|KDO80283.1| hypothetical protein CISIN_1g014222mg [Citrus sinensis]
Length=428

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/428 (86%), Positives = 397/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR+IQPPLVDTTACLCRVDAGLKTVAGAK+YVPGTKLCLQP IKPSIHPTR KP    +
Sbjct  1     MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRSKPASGSR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EHCKLRLVCKRW+RLL+GNFYYSLRK L IAEEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDR+GK+SWHAFDPIYQLWQPLPP+PKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDREGKISWHAFDPIYQLWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGEN GVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SE YQPETD+W  VYDGMV G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEAYQPETDSWFPVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS +LN  LYALDC+DGCK+RVYDE T+SWSKHIDS+MHLG S+ALEAAAL+PL+GK
Sbjct  301   WRNPSASLNRHLYALDCKDGCKIRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +    A++EHLWETI GKGQFKT+VTN  SS+AGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSNGERGASAEHLWETISGKGQFKTLVTNLWSSIAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_007013397.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013398.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013399.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013400.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013401.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31016.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31017.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31018.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31019.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31020.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=428

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/428 (86%), Positives = 397/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR+IQPPLVDTTACLCRVDAGLKTVAGAK+YVPGTKLCLQP IKPSIHPTR KP R D+
Sbjct  1     MDRMIQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRNKPARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLRK L IAEEW
Sbjct  61    SRHQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVI+YSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIYYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS IS+MSTAMVPFIGVVY+GKW+LKGLG HRQV+SEVY+PETD+W  VY+GMV G
Sbjct  241   NKNRWSFISEMSTAMVPFIGVVYEGKWFLKGLGPHRQVLSEVYRPETDSWYPVYNGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNP   LNG LYALDC+DGCKL+VYDE T+SWSKHIDSR+HLG S+ALEAAA +PL+GK
Sbjct  301   WRNPCAFLNGHLYALDCKDGCKLKVYDEVTDSWSKHIDSRIHLGNSRALEAAAFVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K DD   AT+EHLWETI GKG FKT+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSDDLRGATAEHLWETIAGKGHFKTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>gb|KHG30540.1| hypothetical protein F383_04954 [Gossypium arboreum]
Length=428

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/428 (86%), Positives = 395/428 (92%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR+IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQP IKPSIHPTR K  R D+
Sbjct  1     MDRMIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPDIKPSIHPTRSKATRGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLRK L IAEEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY+GKW+LKGLG H+QVMSEVYQPETD W  VY+GMV G
Sbjct  241   NKNRWSYISDMSTAMVPFIGVVYEGKWFLKGLGPHQQVMSEVYQPETDNWYPVYNGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNP T+LNG LYAL+C+DGCKLRVYDE T+SW KHIDSR+HLG S+ALEAAAL+PL+ K
Sbjct  301   WRNPCTSLNGHLYALECKDGCKLRVYDEVTDSWGKHIDSRIHLGNSRALEAAALIPLNRK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMS+SLVDV K DD   AT+EHLWETI GKGQFKT+ TN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSVSLVDVTKSDDLRGATAEHLWETIAGKGQFKTLFTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_003524553.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
 gb|KHN27455.1| F-box/kelch-repeat protein [Glycine soja]
Length=428

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/428 (85%), Positives = 400/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRVIQPPLVDTTACLCRVD GLKTVAGAKRYVPGTKLCL+P IKPSIHPTR KP R D+
Sbjct  1     MDRVIQPPLVDTTACLCRVDTGLKTVAGAKRYVPGTKLCLRPDIKPSIHPTRNKPARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+YSLRK L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYS ALGFGCAVL+GCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFY+ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYNARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY GKW+LKGLG+HRQV+SEVYQPE D+W  +YDG+V+G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYDGKWFLKGLGSHRQVLSEVYQPENDSWYPIYDGLVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPSTTLNG+LYALDC+DGCK+RVYDE  +SWSKHIDS++HLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSTTLNGKLYALDCKDGCKIRVYDEVADSWSKHIDSKLHLGSSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +D   +++E LWETI GKGQFKT+VTN  SSLAGR+RLK+HI
Sbjct  361   LCIIRNNMSISLVDVSKLEDLKGSSAEQLWETIAGKGQFKTLVTNLWSSLAGRNRLKTHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_007154990.1| hypothetical protein PHAVU_003G163600g [Phaseolus vulgaris]
 gb|ESW26984.1| hypothetical protein PHAVU_003G163600g [Phaseolus vulgaris]
Length=428

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/428 (85%), Positives = 398/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRVIQPPLVDTTACLCRVD GLKTVAGAKRYVPGTKLCL+P IKPSIHPTR KP R D+
Sbjct  1     MDRVIQPPLVDTTACLCRVDTGLKTVAGAKRYVPGTKLCLRPDIKPSIHPTRNKPARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+YSLRK L IAEEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRD K+SWHAFDP+YQLWQPLPPVP+EYS ALGFGCAVL+GCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDAKISWHAFDPVYQLWQPLPPVPREYSGALGFGCAVLNGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS +SDMSTAMVPFIGVVY GKW+LKGLG H+QV+SEVYQPE D+W  +YDGMV+G
Sbjct  241   NKNRWSFVSDMSTAMVPFIGVVYDGKWFLKGLGPHQQVLSEVYQPENDSWYPIYDGMVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPSTTLNG+LYALDC+DGCK+RVYDE T+SWSKHIDS+MHLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSTTLNGKLYALDCKDGCKVRVYDEVTDSWSKHIDSKMHLGSSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +D   +++E LWETI GKGQFKT+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKLEDLKGSSAEQLWETIAGKGQFKTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_003554163.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
Length=428

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/428 (85%), Positives = 398/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRVIQPPLVDTTACLCRVD GLKTVAGAK+YVPGTKLCL+P IKPSIHPTR KP R D+
Sbjct  1     MDRVIQPPLVDTTACLCRVDTGLKTVAGAKKYVPGTKLCLRPDIKPSIHPTRNKPARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+Y LRK L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYFLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYS ALGFGCAVL+GCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY GKW++KGLG+HRQV+SEVYQPE D+W T+YDGMV+G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYDGKWFMKGLGSHRQVLSEVYQPENDSWYTIYDGMVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS TLN +LYALDC+DGCK+RVYDE  +SWSKHIDS+MHLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSCTLNEKLYALDCKDGCKIRVYDEVADSWSKHIDSKMHLGSSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +D   +++E LWETI GKGQFKT+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKLEDLKGSSAEQLWETIAGKGQFKTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_004287344.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/432 (84%), Positives = 400/432 (93%), Gaps = 4/432 (1%)
 Frame = +2

Query  722   DRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPP  901
             DR RM   IQPPLVD+TACLCRVDAGLKTVAGAK+YVPG KLCLQP IK SIHPTR KP 
Sbjct  2     DRRRM---IQPPLVDSTACLCRVDAGLKTVAGAKKYVPGAKLCLQPDIKASIHPTRSKPA  58

Query  902   R-DKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEI  1078
             R + +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCK+WYRLLAGNF+YSLRK + I
Sbjct  59    RGESSRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKKWYRLLAGNFFYSLRKSIGI  118

Query  1079  AEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGK  1258
             AEEWIY+IKRDRDGK+SWHAFDP+YQLWQ LPPVPKEYSEALGFGCAVL GCHLYLFGGK
Sbjct  119   AEEWIYLIKRDRDGKISWHAFDPVYQLWQSLPPVPKEYSEALGFGCAVLGGCHLYLFGGK  178

Query  1259  DPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAE  1438
             DP+KGSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAE
Sbjct  179   DPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAE  238

Query  1439  VYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDG  1618
             VYDPNKNRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPE D+W++VYDG
Sbjct  239   VYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPENDSWDSVYDG  298

Query  1619  MVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLP  1798
             MV GWRNPS +L G LYAL+C+DGCKLRVYDEAT+SWSKHIDS++HLG S+ALEAA+L+P
Sbjct  299   MVAGWRNPSASLKGHLYALECKDGCKLRVYDEATDSWSKHIDSKIHLGNSRALEAASLVP  358

Query  1799  LSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRL  1978
             L+GKLCIIRNNMSISLVDV+K +DAG A++EHLWET+ GKGQF+TMVTN  SSLAGR+RL
Sbjct  359   LNGKLCIIRNNMSISLVDVSKSNDAGGASAEHLWETLAGKGQFRTMVTNLWSSLAGRNRL  418

Query  1979  KSHIVHCQVLQT  2014
             KSHIVHCQVLQ 
Sbjct  419   KSHIVHCQVLQA  430



>gb|KHN23508.1| F-box/kelch-repeat protein [Glycine soja]
Length=428

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/428 (85%), Positives = 397/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRVIQPPLVDTTACLCRVD GLKTVAGAK+YVPGTKLCL+P IKPSIHPTR KP R D+
Sbjct  1     MDRVIQPPLVDTTACLCRVDTGLKTVAGAKKYVPGTKLCLRPDIKPSIHPTRNKPARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+Y LRK L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYFLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYS ALGFGCAVL+GCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS IS MSTAMVPFIGVVY GKW++KGLG+HRQV+SEVYQPE D+W T+YDGMV+G
Sbjct  241   NKNRWSFISGMSTAMVPFIGVVYDGKWFMKGLGSHRQVLSEVYQPENDSWYTIYDGMVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS TLN +LYALDC+DGCK+RVYDE  +SWSKHIDS+MHLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSCTLNEKLYALDCKDGCKIRVYDEVADSWSKHIDSKMHLGSSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +D   +++E LWETI GKGQFKT+VTN  SSLAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKLEDLKGSSAEQLWETIAGKGQFKTLVTNLWSSLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_010093732.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXB54538.1| F-box/kelch-repeat protein [Morus notabilis]
Length=475

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/422 (86%), Positives = 389/422 (92%), Gaps = 3/422 (1%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR---DKNRTQSP  928
             LVDTTACLCRVDAGLKTVAGAK+YVPGTKLCLQP IKPSIHPTR KP R    +N  QSP
Sbjct  54    LVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRNKPSRGDRSRNPNQSP  113

Query  929   LLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKR  1108
             LLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGNF+YSLRK L IAEEWIY+IKR
Sbjct  114   LLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGIAEEWIYIIKR  173

Query  1109  DRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRV  1288
             DRDGK+SWHAFDP+YQLWQPLPPVP+EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRRV
Sbjct  174   DRDGKISWHAFDPVYQLWQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRV  233

Query  1289  IFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWS  1468
             IFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDPNKNRWS
Sbjct  234   IFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDPNKNRWS  293

Query  1469  LISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPST  1648
              ISDMSTAMVPFIGVVY+GKWYLKGLG+HRQV+SEVYQPE D+W  VYDGMV GWRNPS 
Sbjct  294   FISDMSTAMVPFIGVVYEGKWYLKGLGSHRQVLSEVYQPENDSWYPVYDGMVAGWRNPSA  353

Query  1649  TLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRN  1828
             +LNG LYAL+C+DGCKLRVYDE T+SWSKHIDS+MHLG S+ALEAAAL+PL+GKLCIIRN
Sbjct  354   SLNGNLYALECKDGCKLRVYDEVTDSWSKHIDSKMHLGNSRALEAAALVPLNGKLCIIRN  413

Query  1829  NMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVL  2008
             NMSISLVDV+K  D   AT+EHLWETI G+GQFKT+VTN  SSLAGR+RLKSHIVHCQVL
Sbjct  414   NMSISLVDVSKSSDVSGATAEHLWETIAGRGQFKTLVTNLWSSLAGRNRLKSHIVHCQVL  473

Query  2009  QT  2014
             Q 
Sbjct  474   QA  475



>ref|XP_004508512.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Cicer arietinum]
 ref|XP_004508513.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Cicer arietinum]
Length=428

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/428 (84%), Positives = 396/428 (93%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRV+QPPLVDTTACLCRVD GL+TVAGAK+YVPGTKLCL+P IKPSIHPTR KP R D+
Sbjct  1     MDRVLQPPLVDTTACLCRVDTGLRTVAGAKKYVPGTKLCLRPDIKPSIHPTRNKPARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+YSLRK L I+EEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLRISEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDP+YQ WQPLPPVPKEY  ALGFGCAVL+GCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPVYQQWQPLPPVPKEYFGALGFGCAVLNGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY GKW+L+GLG+HRQV+SEVY PE D+W  V+DGMV+G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYDGKWFLQGLGSHRQVLSEVYLPENDSWYPVHDGMVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS TLNG+LYALDC+DGCKL+VYDEATNSWSKHIDSRMHLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSATLNGKLYALDCKDGCKLKVYDEATNSWSKHIDSRMHLGSSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K +D   +++E LWETI GKGQFKT+VTN  SSL+GR+R KSHI
Sbjct  361   LCIIRNNMSISLVDVSKLEDLKGSSAEQLWETIAGKGQFKTLVTNLWSSLSGRNRPKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_010688026.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688027.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=429

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/429 (83%), Positives = 398/429 (93%), Gaps = 2/429 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MD++IQPPLVD+TACLCRVDAGLKTVAGAK+YVPGT+LC++P IKPSIHPTRQK  R D+
Sbjct  1     MDKIIQPPLVDSTACLCRVDAGLKTVAGAKKYVPGTRLCIRPDIKPSIHPTRQKSSRGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPR+EH  LRLVCKRWYRLLAGNF+YSLR+ L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRVEHRNLRLVCKRWYRLLAGNFFYSLRRSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             +YVIKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGK P+K
Sbjct  121   VYVIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKHPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFY+ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SLRSAEVYDP
Sbjct  181   GSMRRVIFYNARTNKWHRAPDMLRRRHFFGACVINNCLYVAGGENEGIHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS+ISDMSTAMVPFIGVV+ GKWYLKGLGTHRQV+SEVY PE+D W  VYDGMV G
Sbjct  241   NKNRWSIISDMSTAMVPFIGVVFDGKWYLKGLGTHRQVLSEVYHPESDNWYPVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS  +NG+LYALDC+DGCKLRVYDEA++SWSKHIDSR+HLG SKALEAAAL+PL+GK
Sbjct  301   WRNPSAAMNGKLYALDCKDGCKLRVYDEASDSWSKHIDSRVHLGNSKALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAA-TSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSH  1987
             LCI+RNNMSIS VD ++ +D G+A TSEHLWETI G+GQFKT++ N  SS+AGR  LKSH
Sbjct  361   LCIVRNNMSISFVDASRSEDVGSAETSEHLWETITGRGQFKTIMMNIWSSIAGRKHLKSH  420

Query  1988  IVHCQVLQT  2014
             IVHCQ+LQT
Sbjct  421   IVHCQILQT  429



>ref|XP_010250048.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nelumbo nucifera]
Length=428

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/428 (84%), Positives = 395/428 (92%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             M+R IQPPLVDTTAC CRVDAGLKTVAGAK++V GTK+C+QP I+PSIHPTRQK  R ++
Sbjct  1     MERGIQPPLVDTTACFCRVDAGLKTVAGAKKFVSGTKICIQPDIRPSIHPTRQKAARGER  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
              R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L IAEEW
Sbjct  61    VRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDGK+SWHAFDPIYQLWQPLPPVP EY+EALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDRDGKISWHAFDPIYQLWQPLPPVPGEYAEALGFGCAVLSGCHLYLFGGKDPIK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE+EG H  LRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGAHRFLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS I+DMSTAMVPFIGVVY+G+W+LKGLG HRQV+SEVY PETD+W  VY+GMV G
Sbjct  241   NKNRWSFIADMSTAMVPFIGVVYEGRWFLKGLGPHRQVLSEVYHPETDSWYPVYNGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPST LNG+LYALDC+DGCKLRV+DEA++SWSKHIDS+MHLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSTALNGQLYALDCKDGCKLRVFDEASDSWSKHIDSKMHLGSSRALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSIS+VDV+K DDA  A +EHLWETI GKGQFKT VTN  SS+AGRSRLKSHI
Sbjct  361   LCIIRNNMSISMVDVSKADDANGAATEHLWETIAGKGQFKTFVTNLWSSIAGRSRLKSHI  420

Query  1991  VHCQVLQT  2014
             +HCQVLQ 
Sbjct  421   LHCQVLQA  428



>ref|XP_002524469.1| Protein AFR, putative [Ricinus communis]
 gb|EEF37909.1| Protein AFR, putative [Ricinus communis]
Length=436

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/419 (85%), Positives = 389/419 (93%), Gaps = 1/419 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DKNRTQSPLLP  937
             VDTTACLCRVDA LKTVA AKRYVPG+KLCLQP IKPSIHPTR KP R D++R QSPLLP
Sbjct  18    VDTTACLCRVDASLKTVANAKRYVPGSKLCLQPDIKPSIHPTRSKPSRGDRSRNQSPLLP  77

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L IAEEWIY+IKRDRD
Sbjct  78    GLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGIAEEWIYIIKRDRD  137

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SWHAFDP+YQ+WQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRRVIFY
Sbjct  138   GKISWHAFDPVYQIWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFY  197

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             SARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGEN+G H SLRSAEVYDPNKNRWS IS
Sbjct  198   SARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENDGGHRSLRSAEVYDPNKNRWSFIS  257

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             DMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVY+PETD+W+ VYDGMV GWRNPS +LN
Sbjct  258   DMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYRPETDSWDPVYDGMVAGWRNPSASLN  317

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             G LYALDC+DGCKLRVYD+ ++SWSKHIDS+ HLG S+ALEAAAL+PL+GKLCIIRNNMS
Sbjct  318   GHLYALDCKDGCKLRVYDDVSDSWSKHIDSKTHLGNSRALEAAALVPLNGKLCIIRNNMS  377

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             ISLVDV+K DD     +EHLWETI GKGQFKT+VTN LSSLAGR+RLKSHIVHCQVLQ 
Sbjct  378   ISLVDVSKSDDLRETPAEHLWETISGKGQFKTLVTNLLSSLAGRNRLKSHIVHCQVLQA  436



>ref|XP_004150018.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 ref|XP_004167918.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 gb|KGN65315.1| hypothetical protein Csa_1G320320 [Cucumis sativus]
Length=428

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/428 (83%), Positives = 393/428 (92%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             M+R+IQPPLVDTTACLCRVDAGLKTVAGAK++VPG+KLCLQP+IKPSIHPTR KP R D+
Sbjct  1     MERMIQPPLVDTTACLCRVDAGLKTVAGAKKFVPGSKLCLQPSIKPSIHPTRPKPARSDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGVAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRD K+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLY+FGG+DP+K
Sbjct  121   IYVIKRDRDNKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYVFGGRDPIK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             G+MRRVIFYSARTNKWHRAPDMLRRRH FG CVINNCLYVAGGENEG H SL+SAEVYDP
Sbjct  181   GTMRRVIFYSARTNKWHRAPDMLRRRHVFGSCVINNCLYVAGGENEGGHRSLKSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRW+ ISDMST MVP IGVVY+GKWYLKG G  RQV+S+VYQPETD+W +VYDGMV G
Sbjct  241   NKNRWTFISDMSTPMVPIIGVVYEGKWYLKGFGAQRQVLSDVYQPETDSWCSVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS +LNG LY++DC+DGCKLRVYDE +NSW+K IDS++HLG SKALEAAAL+PL+GK
Sbjct  301   WRNPSVSLNGHLYSVDCKDGCKLRVYDEVSNSWNKSIDSKLHLGNSKALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+KC+DA  A  EHLWET+ GKGQ  T+VTN  SSL+GRSRLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKCEDADGAPGEHLWETLAGKGQLITLVTNLWSSLSGRSRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_007013402.1| Galactose oxidase/kelch repeat superfamily protein isoform 6, 
partial [Theobroma cacao]
 gb|EOY31021.1| Galactose oxidase/kelch repeat superfamily protein isoform 6, 
partial [Theobroma cacao]
Length=419

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/419 (86%), Positives = 388/419 (93%), Gaps = 1/419 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DKNRTQSPLLP  937
             VDTTACLCRVDAGLKTVAGAK+YVPGTKLCLQP IKPSIHPTR KP R D++R QSPLLP
Sbjct  1     VDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRNKPARGDRSRHQSPLLP  60

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLRK L IAEEWIYVIKRDRD
Sbjct  61    GLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRKSLGIAEEWIYVIKRDRD  120

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRRVI+Y
Sbjct  121   GKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIYY  180

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             SARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDPNKNRWS IS
Sbjct  181   SARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDPNKNRWSFIS  240

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             +MSTAMVPFIGVVY+GKW+LKGLG HRQV+SEVY+PETD+W  VY+GMV GWRNP   LN
Sbjct  241   EMSTAMVPFIGVVYEGKWFLKGLGPHRQVLSEVYRPETDSWYPVYNGMVAGWRNPCAFLN  300

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             G LYALDC+DGCKL+VYDE T+SWSKHIDSR+HLG S+ALEAAA +PL+GKLCIIRNNMS
Sbjct  301   GHLYALDCKDGCKLKVYDEVTDSWSKHIDSRIHLGNSRALEAAAFVPLNGKLCIIRNNMS  360

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             ISLVDV+K DD   AT+EHLWETI GKG FKT+VTN  SSLAGR+RLKSHIVHCQVLQ 
Sbjct  361   ISLVDVSKSDDLRGATAEHLWETIAGKGHFKTLVTNLWSSLAGRNRLKSHIVHCQVLQA  419



>ref|XP_008444019.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
melo]
Length=428

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/428 (83%), Positives = 392/428 (92%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             M+R+IQPPLVDTTACLCRVDAGLKTVAGAK++VPG+KLCLQP+IKPSIHPTR KP R D+
Sbjct  1     MERMIQPPLVDTTACLCRVDAGLKTVAGAKKFVPGSKLCLQPSIKPSIHPTRPKPARSDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW
Sbjct  61    SRNQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGVAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRD K+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGG+DP+K
Sbjct  121   IYVIKRDRDNKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGRDPIK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             G+MRRVIFYSARTNKWHRAPDMLRRRH FG CVINNCLYVAGGENEG H SL+SAEVYDP
Sbjct  181   GTMRRVIFYSARTNKWHRAPDMLRRRHVFGSCVINNCLYVAGGENEGGHRSLKSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRW+ ISDMST MVP IGVVY+GKWYLKG G  RQV+S+VYQPETD+W  VYDGMV G
Sbjct  241   NKNRWTFISDMSTPMVPIIGVVYEGKWYLKGFGAQRQVLSDVYQPETDSWCPVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS +LNG LY++DC+DGCKLRVYDE +NSW+K IDS++HLG SKALEAAAL+PL+GK
Sbjct  301   WRNPSVSLNGHLYSVDCKDGCKLRVYDEVSNSWNKSIDSKLHLGNSKALEAAALVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+KC+DA  A  EHLWET+ GKGQ  T+VTN  SSL+GRSRLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKCEDADGAPGEHLWETLAGKGQLITLVTNLWSSLSGRSRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQA  428



>ref|XP_009368827.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
 ref|XP_009368828.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=428

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/428 (82%), Positives = 392/428 (92%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR IQPPLVD+TACLCRVDAGLKTVAGAK+YVPG KLCLQP IK SIHPTR KP R + 
Sbjct  1     MDRRIQPPLVDSTACLCRVDAGLKTVAGAKKYVPGAKLCLQPDIKSSIHPTRSKPLRGES  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLA+ACL+RVPR+EH KLRLVCKRWYRLLA NF+YSLR+ L IAEEW
Sbjct  61    SRIQSPLLPGLPDDLAVACLVRVPRVEHRKLRLVCKRWYRLLAANFFYSLRRNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IY+IKRDR+GKVSWHAFDP+YQLWQPLPPVPKEYS ALGFGCAVL GCHLYLFGGKDP+K
Sbjct  121   IYLIKRDREGKVSWHAFDPVYQLWQPLPPVPKEYSAALGFGCAVLGGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFY ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SL+SAEVYDP
Sbjct  181   GSMRRVIFYDARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGIHRSLKSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS IS+MSTAM P+IGV+Y+GKW+LKGLG+HRQV+SEVYQPE D+W +VYDGMV G
Sbjct  241   NKNRWSFISEMSTAMAPYIGVIYEGKWFLKGLGSHRQVLSEVYQPENDSWYSVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS  LNG LYA +C+DGCKL+VYD+AT+SWSKHIDS+MHLG SKALEAA+L+PL+GK
Sbjct  301   WRNPSVALNGHLYASECKDGCKLKVYDKATDSWSKHIDSKMHLGNSKALEAASLVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K  D G A++E+LWETI GKGQF+T+VTN  S+LAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSSDVGEASAEYLWETIAGKGQFRTLVTNLWSNLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQV  428



>ref|XP_010688025.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/438 (80%), Positives = 394/438 (90%), Gaps = 2/438 (0%)
 Frame = +2

Query  707   FVEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPT  886
             +++M +            VD+TACLCRVDAGLKTVAGAK+YVPGT+LC++P IKPSIHPT
Sbjct  6     YIQMMENKPKSITASVAQVDSTACLCRVDAGLKTVAGAKKYVPGTRLCIRPDIKPSIHPT  65

Query  887   RQKPPR-DKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLR  1063
             RQK  R D++R+QSPLLPGLPDDLAIACLIRVPR+EH  LRLVCKRWYRLLAGNF+YSLR
Sbjct  66    RQKSSRGDRSRSQSPLLPGLPDDLAIACLIRVPRVEHRNLRLVCKRWYRLLAGNFFYSLR  125

Query  1064  KKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLY  1243
             + L IAEEW+YVIKRDRDGK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLY
Sbjct  126   RSLGIAEEWVYVIKRDRDGKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLY  185

Query  1244  LFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGS  1423
             LFGGK P+KGSMRRVIFY+ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H S
Sbjct  186   LFGGKHPLKGSMRRVIFYNARTNKWHRAPDMLRRRHFFGACVINNCLYVAGGENEGIHRS  245

Query  1424  LRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWN  1603
             LRSAEVYDPNKNRWS+ISDMSTAMVPFIGVV+ GKWYLKGLGTHRQV+SEVY PE+D W 
Sbjct  246   LRSAEVYDPNKNRWSIISDMSTAMVPFIGVVFDGKWYLKGLGTHRQVLSEVYHPESDNWY  305

Query  1604  TVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEA  1783
              VYDGMV GWRNPS  +NG+LYALDC+DGCKLRVYDEA++SWSKHIDSR+HLG SKALEA
Sbjct  306   PVYDGMVAGWRNPSAAMNGKLYALDCKDGCKLRVYDEASDSWSKHIDSRVHLGNSKALEA  365

Query  1784  AALLPLSGKLCIIRNNMSISLVDVAKCDDAGAA-TSEHLWETIGGKGQFKTMVTNFLSSL  1960
             AAL+PL+GKLCI+RNNMSIS VD ++ +D G+A TSEHLWETI G+GQFKT++ N  SS+
Sbjct  366   AALVPLNGKLCIVRNNMSISFVDASRSEDVGSAETSEHLWETITGRGQFKTIMMNIWSSI  425

Query  1961  AGRSRLKSHIVHCQVLQT  2014
             AGR  LKSHIVHCQ+LQT
Sbjct  426   AGRKHLKSHIVHCQILQT  443



>gb|KHG13775.1| hypothetical protein F383_18309 [Gossypium arboreum]
Length=428

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/429 (83%), Positives = 391/429 (91%), Gaps = 3/429 (1%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKN  913
             MDR++QPPLVDTTACLCRVDAGLKTVAGAK+YVP TKLCLQP+IKPSIHPTR K  R  N
Sbjct  1     MDRMVQPPLVDTTACLCRVDAGLKTVAGAKKYVPRTKLCLQPSIKPSIHPTRNKAARS-N  59

Query  914   RT--QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEE  1087
             R+  QSPLLPGLPDDLAIACL+RVPR+EH KLR+VCKRWYRLL GNF+YSLRK L IAEE
Sbjct  60    RSCYQSPLLPGLPDDLAIACLVRVPRVEHRKLRVVCKRWYRLLCGNFFYSLRKSLGIAEE  119

Query  1088  WIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPV  1267
             WIY+IKRDR+GK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKD +
Sbjct  120   WIYIIKRDREGKISWHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDLL  179

Query  1268  KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYD  1447
             KGSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVI N LYVAGGENEGVH SLRSAEVYD
Sbjct  180   KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVIKNRLYVAGGENEGVHRSLRSAEVYD  239

Query  1448  PNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVT  1627
             PNKNRWS ISDMSTAMVPFIGVVY+ KW+LKGLG HRQVMSE+YQPETD+W   Y+GMV 
Sbjct  240   PNKNRWSFISDMSTAMVPFIGVVYEDKWFLKGLGPHRQVMSEIYQPETDSWYPFYNGMVA  299

Query  1628  GWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSG  1807
             GWRNP  +LNG+LYALDC+DGCKLRVYDE  +SWSKHIDS++HLG S+ALEAAAL+PL+G
Sbjct  300   GWRNPCASLNGQLYALDCKDGCKLRVYDEVGDSWSKHIDSKIHLGNSRALEAAALVPLNG  359

Query  1808  KLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSH  1987
             KLCIIRNNMSISLVD++K +D    T++HLWETI GKGQFKT+VTN  SSLAGR+RLKSH
Sbjct  360   KLCIIRNNMSISLVDISKSNDLKGTTAQHLWETIAGKGQFKTLVTNLWSSLAGRNRLKSH  419

Query  1988  IVHCQVLQT  2014
             IVHCQVLQ 
Sbjct  420   IVHCQVLQA  428



>ref|XP_008385738.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=428

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/428 (82%), Positives = 389/428 (91%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MD  IQPPLVDTTACLCRV+AGLK+VAGAK+YVPG KLCLQP  K SIHPTR KP R + 
Sbjct  1     MDTRIQPPLVDTTACLCRVBAGLKSVAGAKKYVPGAKLCLQPDTKSSIHPTRSKPSRGES  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLA+ACL+RVPR+EH KLRLVCKRW+RLLA NF+YSLR+ L IAEEW
Sbjct  61    SRIQSPLLPGLPDDLAVACLVRVPRVEHRKLRLVCKRWFRLLAANFFYSLRRNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IY+IKRDR+GK++WHAFDP+ QLWQPLPPVPKEYS ALGFGCAVL GCHLYLFGGKDP+K
Sbjct  121   IYLIKRDREGKITWHAFDPVCQLWQPLPPVPKEYSAALGFGCAVLGGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFY+ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGV+ SL+SAEVYDP
Sbjct  181   GSMRRVIFYNARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVNRSLKSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS IS+MSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPE DTWN+VYDGMV G
Sbjct  241   NKNRWSFISEMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPENDTWNSVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS +LN  LYAL+C+DGCKLRVYDEAT+SWSKHIDS+MHLG S+ALEAA+L+PL+GK
Sbjct  301   WRNPSASLNXHLYALECKDGCKLRVYDEATDSWSKHIDSKMHLGNSRALEAASLVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCI+RNNMSISLVDV+   D    ++EHLWETI GKGQFKT+VTN  SSLAGR RLKSHI
Sbjct  361   LCIVRNNMSISLVDVSNSSDVHGESAEHLWETIAGKGQFKTLVTNLWSSLAGRGRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQV  428



>ref|XP_008337311.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
 ref|XP_008337312.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=428

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/428 (82%), Positives = 390/428 (91%), Gaps = 1/428 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDR IQPPLVD+TACLCRVDAGLKTVAGAK+YVPG KLCLQP IK SIHPTR KP R + 
Sbjct  1     MDRRIQPPLVDSTACLCRVDAGLKTVAGAKKYVPGAKLCLQPDIKSSIHPTRSKPSRGES  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R QSPLLPGLPDDLA+ACL+RVPR+EH KLRLVCKRWYRLLA NF+YSLR+ L IAEEW
Sbjct  61    SRIQSPLLPGLPDDLAVACLVRVPRVEHRKLRLVCKRWYRLLAANFFYSLRRNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IY+IKRD +GKVSWHAFDP+YQLWQPLPPVPKEYS ALGFGCAVL GCHLYLFGGKDP+K
Sbjct  121   IYLIKRDGEGKVSWHAFDPVYQLWQPLPPVPKEYSAALGFGCAVLGGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFY+ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGEN G+H SL+SAEVYDP
Sbjct  181   GSMRRVIFYNARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENGGIHRSLKSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS IS+MST M P+IGVVY+GKW+LKGLG+HRQV+SEVYQPE D+W +VYDGMV G
Sbjct  241   NKNRWSFISEMSTGMAPYIGVVYEGKWFLKGLGSHRQVLSEVYQPENDSWYSVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS  LNG LYA +C+DGCKLRVYD+AT+SWSKHIDS+MHLG SKALEAA+L+PL+GK
Sbjct  301   WRNPSVALNGHLYASECKDGCKLRVYDKATDSWSKHIDSKMHLGNSKALEAASLVPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLVDV+K  D G A++E+LWETI GKGQF+T+VTN  S+LAGR+RLKSHI
Sbjct  361   LCIIRNNMSISLVDVSKSSDVGEASAEYLWETIAGKGQFRTLVTNLWSNLAGRNRLKSHI  420

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  421   VHCQVLQV  428



>ref|XP_011084133.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
 ref|XP_011084134.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
 ref|XP_011084135.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
Length=427

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/427 (83%), Positives = 389/427 (91%), Gaps = 0/427 (0%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKN  913
             MDRVIQPPLVDTTACLCRVDAGLKT+AGAK+YVPGTKLCLQP IKPSIHPTRQK PRD+N
Sbjct  1     MDRVIQPPLVDTTACLCRVDAGLKTIAGAKKYVPGTKLCLQPDIKPSIHPTRQKAPRDRN  60

Query  914   RTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWI  1093
             R+QSPLLPGLPDDLAIACLIRVPRIEH KLRLVCKRWYRLLAGNF+YSLRK L IAEEWI
Sbjct  61    RSQSPLLPGLPDDLAIACLIRVPRIEHFKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEWI  120

Query  1094  YVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKG  1273
             Y++KRDRDGK+SWHAFDP++Q+WQPLPPVP+EY EA  FGCAVLSGCHLYL GGKDPVKG
Sbjct  121   YIMKRDRDGKLSWHAFDPMHQVWQPLPPVPREYCEARDFGCAVLSGCHLYLVGGKDPVKG  180

Query  1274  SMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPN  1453
             SMRRV+FYSARTN+WHRAPDMLRRRHFFG CVINNCLYVAGGENEG H SL+SAEVYDPN
Sbjct  181   SMRRVVFYSARTNRWHRAPDMLRRRHFFGCCVINNCLYVAGGENEGTHRSLKSAEVYDPN  240

Query  1454  KNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGW  1633
             KNRWS ISDMSTAMVPFIGVVY GKW+LKGLG+ RQV+ EVYQPETD+W+ VYDGMV GW
Sbjct  241   KNRWSFISDMSTAMVPFIGVVYGGKWFLKGLGSQRQVVCEVYQPETDSWSPVYDGMVAGW  300

Query  1634  RNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKL  1813
             R+P TT+NG LYALDC+DGCKLR+YDE + SWSK IDS+MHLG SKALEAAA+LPL+GKL
Sbjct  301   RHPCTTINGHLYALDCKDGCKLRIYDETSGSWSKRIDSKMHLGNSKALEAAAILPLNGKL  360

Query  1814  CIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIV  1993
             CIIRNNMSISLV V+K D    AT++HL ETI GKG  KT+VT+FLS+LAGR+R K+ IV
Sbjct  361   CIIRNNMSISLVHVSKSDHGSTATTDHLGETIPGKGHLKTLVTSFLSNLAGRNRHKNRIV  420

Query  1994  HCQVLQT  2014
              CQVLQ 
Sbjct  421   QCQVLQA  427



>ref|XP_003609293.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AES91490.1| galactose oxidase/kelch repeat protein [Medicago truncatula]
Length=442

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/419 (83%), Positives = 386/419 (92%), Gaps = 1/419 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DKNRTQSPLLP  937
             VDTTACLCRVD GL+TVAGAK+YVPGTKLCL+P IK SIHPTR KP R D++R QSPLLP
Sbjct  24    VDTTACLCRVDTGLRTVAGAKKYVPGTKLCLRPDIKHSIHPTRNKPARGDRSRNQSPLLP  83

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNF+YSLRK L +AEEWIYVIKRDRD
Sbjct  84    GLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLIGNFFYSLRKSLRLAEEWIYVIKRDRD  143

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SWHAFDP+YQ WQPLPPVPKEYS ALGFGCAVL+GCHLYLFGGKDP+KGSMRRVIFY
Sbjct  144   GKISWHAFDPVYQQWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLKGSMRRVIFY  203

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             S RTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEGVH SLRSAEVYDPNKNRWS IS
Sbjct  204   STRTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSAEVYDPNKNRWSFIS  263

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             DMSTAMVPFIGVVY GKW+LKGLG+HRQV+SEVYQ   D+W  V +GM++GWRNPSTTLN
Sbjct  264   DMSTAMVPFIGVVYDGKWFLKGLGSHRQVLSEVYQLANDSWCPVQNGMISGWRNPSTTLN  323

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             G+LYAL+C+DGCKLRVYD+AT+SWSKHIDS+MHLG+S+ALEAAAL+PL+GKLCIIRNNMS
Sbjct  324   GKLYALECKDGCKLRVYDDATDSWSKHIDSKMHLGSSRALEAAALVPLNGKLCIIRNNMS  383

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             ISLVDV+K +D   +++E LWETI GKGQFKT+ TN LSSLAGR+RLK+HIVHCQVLQ 
Sbjct  384   ISLVDVSKLEDLKGSSAEQLWETIAGKGQFKTLFTNLLSSLAGRNRLKTHIVHCQVLQA  442



>ref|XP_010250049.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nelumbo nucifera]
Length=421

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/410 (84%), Positives = 378/410 (92%), Gaps = 1/410 (0%)
 Frame = +2

Query  788   VDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DKNRTQSPLLPGLPDDLAIA  964
              DAGLKTVAGAK++V GTK+C+QP I+PSIHPTRQK  R ++ R QSPLLPGLPDDLAIA
Sbjct  12    ADAGLKTVAGAKKFVSGTKICIQPDIRPSIHPTRQKAARGERVRNQSPLLPGLPDDLAIA  71

Query  965   CLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFD  1144
             CLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L IAEEWIYVIKRDRDGK+SWHAFD
Sbjct  72    CLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEWIYVIKRDRDGKISWHAFD  131

Query  1145  PIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHR  1324
             PIYQLWQPLPPVP EY+EALGFGCAVLSGCHLYLFGGKDP+KGSMRRVIFYSARTNKWHR
Sbjct  132   PIYQLWQPLPPVPGEYAEALGFGCAVLSGCHLYLFGGKDPIKGSMRRVIFYSARTNKWHR  191

Query  1325  APDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPF  1504
             APDMLRRRHFFG CVINNCLYVAGGE+EG H  LRSAEVYDPNKNRWS I+DMSTAMVPF
Sbjct  192   APDMLRRRHFFGSCVINNCLYVAGGESEGAHRFLRSAEVYDPNKNRWSFIADMSTAMVPF  251

Query  1505  IGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCR  1684
             IGVVY+G+W+LKGLG HRQV+SEVY PETD+W  VY+GMV GWRNPST LNG+LYALDC+
Sbjct  252   IGVVYEGRWFLKGLGPHRQVLSEVYHPETDSWYPVYNGMVAGWRNPSTALNGQLYALDCK  311

Query  1685  DGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKC  1864
             DGCKLRV+DEA++SWSKHIDS+MHLG+S+ALEAAAL+PL+GKLCIIRNNMSIS+VDV+K 
Sbjct  312   DGCKLRVFDEASDSWSKHIDSKMHLGSSRALEAAALVPLNGKLCIIRNNMSISMVDVSKA  371

Query  1865  DDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             DDA  A +EHLWETI GKGQFKT VTN  SS+AGRSRLKSHI+HCQVLQ 
Sbjct  372   DDANGAATEHLWETIAGKGQFKTFVTNLWSSIAGRSRLKSHILHCQVLQA  421



>ref|XP_008784962.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Phoenix 
dactylifera]
Length=431

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/433 (78%), Positives = 381/433 (88%), Gaps = 6/433 (1%)
 Frame = +2

Query  719   TDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKP  898
             +DR +M+R  QPPLVD++ACLCRVDAGLKTVAGAK++VPG+KLC+QP+IK SIHP++ + 
Sbjct  4     SDRRKMERRNQPPLVDSSACLCRVDAGLKTVAGAKKFVPGSKLCIQPSIKASIHPSKPRA  63

Query  899   PR-DKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLE  1075
              R D+NR+QSPLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L 
Sbjct  64    ARGDRNRSQSPLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLG  123

Query  1076  IAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGG  1255
             IAEEWIYVIKRDRDG++SW AFDP+Y LW PLPP+P EYS ALGFGCAVLSGCHLYLFGG
Sbjct  124   IAEEWIYVIKRDRDGRISWDAFDPVYHLWHPLPPIPGEYSGALGFGCAVLSGCHLYLFGG  183

Query  1256  KDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSA  1435
             KDP KGSMRRVIFYSARTNKWHRAPDMLRRRHFFG CV+NNCLYVAGGE+EG H SLRSA
Sbjct  184   KDPQKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVMNNCLYVAGGESEGFHHSLRSA  243

Query  1436  EVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYD  1615
             EVYDPNKNRW+ I+DMSTAMVPFIGVVY+GKW+LKGLG+ RQV+SEVY PE D W   +D
Sbjct  244   EVYDPNKNRWAFIADMSTAMVPFIGVVYEGKWFLKGLGSQRQVLSEVYVPEADGWYPAFD  303

Query  1616  GMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALL  1795
             GMVTGWRNPS  LNGRLY+LDC DGC+LRVYD AT+SWSKHIDS+MHLG+S+ALEAAAL+
Sbjct  304   GMVTGWRNPSVCLNGRLYSLDCEDGCRLRVYDGATDSWSKHIDSKMHLGSSRALEAAALV  363

Query  1796  PLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSR  1975
             PL GKLCI+RNNMSI++ DV     AG    +  WETI GKGQ KT VTN  SS+AGRSR
Sbjct  364   PLDGKLCIVRNNMSITVADV-----AGKDGGDLRWETIAGKGQLKTFVTNLWSSVAGRSR  418

Query  1976  LKSHIVHCQVLQT  2014
             LKSHIVHCQVLQ 
Sbjct  419   LKSHIVHCQVLQA  431



>emb|CBI28177.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/428 (81%), Positives = 373/428 (87%), Gaps = 31/428 (7%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             MDRVIQPPLVDTTACLCRVDAGLKTVAGAK++VPGTKLCLQP IKPSIHPTR KP R D+
Sbjct  1     MDRVIQPPLVDTTACLCRVDAGLKTVAGAKKFVPGTKLCLQPDIKPSIHPTRHKPSRGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPRIEH KLRLVCKRWYRLL GNFYYSLRK L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLVGNFYYSLRKNLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDR+GK+SWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP+K
Sbjct  121   IYVIKRDREGKISWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG+H SLRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             N+NRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+HRQV+SEVYQPETD+W  VYDGMV G
Sbjct  241   NRNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSEVYQPETDSWYPVYDGMVAG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
                                           +SWSKHIDS+MHLG S+ALEAAAL+PL GK
Sbjct  301   ------------------------------DSWSKHIDSKMHLGNSQALEAAALVPLHGK  330

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCIIRNNMSISLV+V+K +D    T+EHLWETI G+GQFKT+VTN  SSLAGR+RLKSHI
Sbjct  331   LCIIRNNMSISLVNVSKSEDMTGPTAEHLWETIAGRGQFKTLVTNLWSSLAGRNRLKSHI  390

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  391   VHCQVLQA  398



>ref|XP_010914885.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Elaeis 
guineensis]
Length=426

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/428 (79%), Positives = 382/428 (89%), Gaps = 3/428 (1%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DK  910
             M+R  QPPLV+++ACLCRVDAGLKTVAGAK++VPG+KLC+QP+IK SIHP++ K  R D+
Sbjct  1     MERRKQPPLVESSACLCRVDAGLKTVAGAKKFVPGSKLCIQPSIKASIHPSKLKAARGDR  60

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +R+QSPLLPGLPDDLAIACLIRVPR EH KLRLVCKRW+RLLAGN++YSLRK L IAEEW
Sbjct  61    SRSQSPLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWHRLLAGNYFYSLRKSLGIAEEW  120

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             IYVIKRDRDG++SW AFDP+YQLW PLPPVP EYSEALGFGCAVLSGCHLYLFGGKDP K
Sbjct  121   IYVIKRDRDGRISWDAFDPVYQLWHPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPHK  180

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE+EGVH  LRSAEVYDP
Sbjct  181   GSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGVHRFLRSAEVYDP  240

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRWS ISDMSTAMVPFIGVVY+GKW+LKGLG+ RQV+SEVY PET  W   +DGMV+G
Sbjct  241   NKNRWSFISDMSTAMVPFIGVVYEGKWFLKGLGSQRQVLSEVYVPETGNWYPAFDGMVSG  300

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
             WRNPS  LNG+LYALDC+DGC+LRVYD AT+SWSKHIDS+MHLG+S+ALEAAAL+PL+GK
Sbjct  301   WRNPSVCLNGQLYALDCKDGCRLRVYDGATDSWSKHIDSKMHLGSSRALEAAALIPLNGK  360

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             LCI+RNNMSI++VDVA  +     + +  WETI GKG  KT VTN  S++AGR+RLKSHI
Sbjct  361   LCIVRNNMSITVVDVAGKNSRD--SEDQCWETIAGKGHLKTFVTNLWSNIAGRNRLKSHI  418

Query  1991  VHCQVLQT  2014
             +HCQVLQ 
Sbjct  419   IHCQVLQA  426



>ref|XP_010925234.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Elaeis guineensis]
Length=449

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/429 (77%), Positives = 381/429 (89%), Gaps = 6/429 (1%)
 Frame = +2

Query  731   RMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-D  907
             +M+R  QPPLVD++ACLCRVD GLKTVAGAK++VPG+KLC+QP+IK SIHP++ K  R D
Sbjct  26    KMERRNQPPLVDSSACLCRVDTGLKTVAGAKKFVPGSKLCIQPSIKASIHPSKPKAARGD  85

Query  908   KNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEE  1087
             +NR+QSPLLPGLPDDLAIACLIRVPR EH KLR VCKRWYRLLAGN++YSLRK L I EE
Sbjct  86    RNRSQSPLLPGLPDDLAIACLIRVPRAEHHKLRRVCKRWYRLLAGNYFYSLRKSLGITEE  145

Query  1088  WIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPV  1267
             W+YVIKRDR+G++SW AFDP+YQLW PLPP+P EYS ALGFGCAVLSGCHLYLFGGKDP 
Sbjct  146   WVYVIKRDREGRISWDAFDPVYQLWHPLPPIPGEYSGALGFGCAVLSGCHLYLFGGKDPH  205

Query  1268  KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYD  1447
             KGSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE+EG H  LRSAEVYD
Sbjct  206   KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGFHHCLRSAEVYD  265

Query  1448  PNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVT  1627
             PNKNRWS ISDMSTAMVPFIG+VY+GKW+LKGLG+ RQV+SEVY PETD+W   ++GMV+
Sbjct  266   PNKNRWSFISDMSTAMVPFIGIVYEGKWFLKGLGSQRQVLSEVYVPETDSWYPAFNGMVS  325

Query  1628  GWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSG  1807
             GWRNPS  L+GRLY+LDC DGC+LRVYD AT+SWSKH+DS++HLG+S+ALEAAAL+PL+G
Sbjct  326   GWRNPSVGLDGRLYSLDCEDGCRLRVYDGATDSWSKHMDSKVHLGSSRALEAAALVPLNG  385

Query  1808  KLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSH  1987
             KLCI+RNNMSI++VDV     AG  + +H WETI G+GQ KT +TN  S++AGRSRLKSH
Sbjct  386   KLCIVRNNMSITVVDV-----AGKDSGDHRWETIAGRGQLKTFLTNLWSNIAGRSRLKSH  440

Query  1988  IVHCQVLQT  2014
             IVHCQVLQ 
Sbjct  441   IVHCQVLQA  449



>ref|XP_010257584.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nelumbo 
nucifera]
Length=436

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/423 (76%), Positives = 374/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             IQ PLV + +C CRVDAGLKTV GA+++VPG+KLC+QP I P  H ++    R++ R Q 
Sbjct  16    IQAPLVGSVSCYCRVDAGLKTVVGARKFVPGSKLCIQPDINPHAHKSKNSR-RERTRIQP  74

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PL+PGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEWIYVIK
Sbjct  75    PLIPGLPDDLAIACLIRVPRFEHRKLRLVCKRWYRLLAGNFFYSLRKNLGMAEEWIYVIK  134

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDPIYQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  135   RDRDGRISWHAFDPIYQLWQPLPPVPVEYSAALGFGCAVLSGCHLYLFGGKDPLRGSMRR  194

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  195   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  254

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG+HRQVMSE Y PET++W  ++DGMV+GWRNPS
Sbjct  255   SFIADMSTAMVPFIGVVYNGKWFLKGLGSHRQVMSEAYIPETNSWTPIHDGMVSGWRNPS  314

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDC+DGCKLRVYDEA++SW+K +DS++HLG+S+ALEAAA++PL+GKLCIIR
Sbjct  315   ISLNGKLYALDCKDGCKLRVYDEASDSWNKFMDSKLHLGSSQALEAAAIVPLNGKLCIIR  374

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+V+V+  D     ++ HLWETIG KG F+T+VTN LSS+AGR  LKSHIVHCQV
Sbjct  375   NNMSISMVNVSSTDK-NVESNPHLWETIGSKGHFRTLVTNILSSIAGRGGLKSHIVHCQV  433

Query  2006  LQT  2014
             LQ 
Sbjct  434   LQA  436



>emb|CDP10385.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/428 (81%), Positives = 376/428 (88%), Gaps = 32/428 (7%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKN  913
             MDR++QPPLVDTTACLCRVDAGLKTVAGAK+YVPGTKLCLQP IKPSIHPTRQKPPRDKN
Sbjct  1     MDRMLQPPLVDTTACLCRVDAGLKTVAGAKKYVPGTKLCLQPDIKPSIHPTRQKPPRDKN  60

Query  914   RTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWI  1093
             R+QSPLLPGLPDDLAIACLIRVPRIEH KLRLVCKRWYRLLAGNF+YSLRK L IAEEWI
Sbjct  61    RSQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEWI  120

Query  1094  YVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKG  1273
             Y++KRDRDGK+SWHAFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKG
Sbjct  121   YIMKRDRDGKISWHAFDPMYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKG  180

Query  1274  SMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPN  1453
             SMRRVIFYSARTNKWHRAPDML+RRHFFG CVINNCLYVAGGEN+G+H SLRSAEVYDPN
Sbjct  181   SMRRVIFYSARTNKWHRAPDMLQRRHFFGSCVINNCLYVAGGENDGIHRSLRSAEVYDPN  240

Query  1454  KNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGW  1633
             KNRWS+I +MSTAMVPFIGVVY+GKW+LKGLG+HRQV+SE+YQPETD W  V        
Sbjct  241   KNRWSIICEMSTAMVPFIGVVYEGKWFLKGLGSHRQVLSELYQPETDRWYPV--------  292

Query  1634  RNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKL  1813
                                    VYDEAT+SWSKHIDS+MHLG SKALEAAALLPL+GKL
Sbjct  293   -----------------------VYDEATDSWSKHIDSKMHLGNSKALEAAALLPLNGKL  329

Query  1814  CIIRNNMSISLVDVAKCDDA-GAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             CIIRNNMSIS+VDV+K DD+   A +EHLWETI GKGQ KT+VTNFLS LAGR+R+K HI
Sbjct  330   CIIRNNMSISVVDVSKSDDSRSGAPAEHLWETISGKGQLKTLVTNFLSGLAGRNRVKHHI  389

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  390   VHCQVLQA  397



>ref|XP_006445823.1| hypothetical protein CICLE_v10015292mg [Citrus clementina]
 ref|XP_006492713.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Citrus 
sinensis]
 gb|ESR59063.1| hypothetical protein CICLE_v10015292mg [Citrus clementina]
 gb|KDO63008.1| hypothetical protein CISIN_1g013863mg [Citrus sinensis]
Length=435

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/423 (75%), Positives = 376/423 (89%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAGLKTVA A+++VPG+KLC+QP I P+ H ++    R+++R Q 
Sbjct  15    VQAPLVDSVSCYCKVDAGLKTVAEARKFVPGSKLCIQPDINPNAHKSKNSR-RERSRIQP  73

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YV K
Sbjct  74    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVFK  133

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDP+YQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  134   RDRDGKISWNAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLRGSMRR  193

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CV+NNCLYVAGGE EG+  +LRSAE+YDPNKNRW
Sbjct  194   VIFYSARTNKWHRAPDMLRKRHFFGSCVLNNCLYVAGGECEGIQRTLRSAEIYDPNKNRW  253

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGV+Y GKW+LKGLG+HR+VMSE Y PET++W  + DG+V GWRNPS
Sbjct  254   SFIADMSTAMVPFIGVIYDGKWFLKGLGSHREVMSEAYDPETNSWTPISDGLVAGWRNPS  313

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNGRLYALDCRDGCKLRVYDEAT+SW+K +DS++HLG+S+ALEAAA++PL+GKLCIIR
Sbjct  314   VSLNGRLYALDCRDGCKLRVYDEATDSWNKFMDSKLHLGSSRALEAAAIVPLNGKLCIIR  373

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    ++ H+WE I GKG F+T+VTN LSS+AGRS LKSHIVHCQV
Sbjct  374   NNMSISMVDVSS-PDKHVESNPHIWENIAGKGHFRTLVTNLLSSIAGRSGLKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_010243433.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nelumbo 
nucifera]
Length=436

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/423 (77%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             IQ PLV++ +C CRVDAGLKTVAGA+++VPG+KLC+QP I P  H ++    R++ R Q 
Sbjct  16    IQAPLVESVSCYCRVDAGLKTVAGARKFVPGSKLCIQPDINPRAHKSKNSR-RERTRIQP  74

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PL+PGLPDDLAIACLIRVPR EH KLRLVCKRWYRLL+GNF+YSLRK L +AEEW+YVIK
Sbjct  75    PLIPGLPDDLAIACLIRVPRFEHRKLRLVCKRWYRLLSGNFFYSLRKNLGMAEEWVYVIK  134

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDPIYQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  135   RDRDGRISWHAFDPIYQLWQPLPPVPVEYSAALGFGCAVLSGCHLYLFGGKDPLRGSMRR  194

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  195   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  254

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG+HRQVMSEVY PE ++W  V+DGMV+GWRNPS
Sbjct  255   SFIADMSTAMVPFIGVVYNGKWFLKGLGSHRQVMSEVYIPENNSWAPVHDGMVSGWRNPS  314

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLRVYDEA++SW+K +DS++HLG+S+ALEAAA++PL+GKLCIIR
Sbjct  315   ISLNGKLYALDCRDGCKLRVYDEASDSWNKFMDSKLHLGSSRALEAAAIVPLNGKLCIIR  374

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLV+V+  D +   T+  LWETIG KG  +T+VTN LSS+AGR  LKSHIVHCQV
Sbjct  375   NNMSISLVNVSSPDKS-VETNPQLWETIGSKGPLRTLVTNILSSIAGRGGLKSHIVHCQV  433

Query  2006  LQT  2014
             LQ 
Sbjct  434   LQA  436



>ref|XP_010925232.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Elaeis guineensis]
Length=468

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/420 (77%), Positives = 374/420 (89%), Gaps = 6/420 (1%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR-DKNRTQSPLL  934
             LVD++ACLCRVD GLKTVAGAK++VPG+KLC+QP+IK SIHP++ K  R D+NR+QSPLL
Sbjct  54    LVDSSACLCRVDTGLKTVAGAKKFVPGSKLCIQPSIKASIHPSKPKAARGDRNRSQSPLL  113

Query  935   PGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDR  1114
             PGLPDDLAIACLIRVPR EH KLR VCKRWYRLLAGN++YSLRK L I EEW+YVIKRDR
Sbjct  114   PGLPDDLAIACLIRVPRAEHHKLRRVCKRWYRLLAGNYFYSLRKSLGITEEWVYVIKRDR  173

Query  1115  DGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIF  1294
             +G++SW AFDP+YQLW PLPP+P EYS ALGFGCAVLSGCHLYLFGGKDP KGSMRRVIF
Sbjct  174   EGRISWDAFDPVYQLWHPLPPIPGEYSGALGFGCAVLSGCHLYLFGGKDPHKGSMRRVIF  233

Query  1295  YSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLI  1474
             YSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE+EG H  LRSAEVYDPNKNRWS I
Sbjct  234   YSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGFHHCLRSAEVYDPNKNRWSFI  293

Query  1475  SDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTL  1654
             SDMSTAMVPFIG+VY+GKW+LKGLG+ RQV+SEVY PETD+W   ++GMV+GWRNPS  L
Sbjct  294   SDMSTAMVPFIGIVYEGKWFLKGLGSQRQVLSEVYVPETDSWYPAFNGMVSGWRNPSVGL  353

Query  1655  NGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNM  1834
             +GRLY+LDC DGC+LRVYD AT+SWSKH+DS++HLG+S+ALEAAAL+PL+GKLCI+RNNM
Sbjct  354   DGRLYSLDCEDGCRLRVYDGATDSWSKHMDSKVHLGSSRALEAAALVPLNGKLCIVRNNM  413

Query  1835  SISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             SI++VDV     AG  + +H WETI G+GQ KT +TN  S++AGRSRLKSHIVHCQVLQ 
Sbjct  414   SITVVDV-----AGKDSGDHRWETIAGRGQLKTFLTNLWSNIAGRSRLKSHIVHCQVLQA  468



>ref|XP_009603913.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nicotiana tomentosiformis]
Length=445

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/423 (76%), Positives = 372/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +QPPLVD+ +C C+VD+GLKTVAGA+++VPG+K+C+QP I P  H T+    R+++R Q 
Sbjct  25    VQPPLVDSVSCYCKVDSGLKTVAGARKFVPGSKICIQPDINPRAHKTKNSR-RERSRVQP  83

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YV+K
Sbjct  84    PLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMK  143

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFD  YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  144   RDRDGRISWHAFDSTYQLWQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMRR  203

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  204   VIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  263

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG+HR+V+SE Y PE + W+ V +GMV GWRNPS
Sbjct  264   SFIADMSTAMVPFIGVVYDGKWFLKGLGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPS  323

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +++GRLYALDCRDGCKLRVYDEAT+SW++ IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  324   ISMDGRLYALDCRDGCKLRVYDEATHSWNRFIDSKLHLGSSRALEAAALVPLNGKLCIIR  383

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    T+ HLWE I GKG F+T+ TN  SS+AGR  LKSHIVHCQV
Sbjct  384   NNMSISIVDVSS-PDKQVETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQV  442

Query  2006  LQT  2014
             LQ 
Sbjct  443   LQA  445



>ref|XP_009603914.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nicotiana tomentosiformis]
Length=437

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/423 (76%), Positives = 372/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +QPPLVD+ +C C+VD+GLKTVAGA+++VPG+K+C+QP I P  H T+    R+++R Q 
Sbjct  17    VQPPLVDSVSCYCKVDSGLKTVAGARKFVPGSKICIQPDINPRAHKTKNSR-RERSRVQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YV+K
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFD  YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RDRDGRISWHAFDSTYQLWQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  196   VIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG+HR+V+SE Y PE + W+ V +GMV GWRNPS
Sbjct  256   SFIADMSTAMVPFIGVVYDGKWFLKGLGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +++GRLYALDCRDGCKLRVYDEAT+SW++ IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  316   ISMDGRLYALDCRDGCKLRVYDEATHSWNRFIDSKLHLGSSRALEAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    T+ HLWE I GKG F+T+ TN  SS+AGR  LKSHIVHCQV
Sbjct  376   NNMSISIVDVSS-PDKQVETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_009785251.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nicotiana sylvestris]
Length=445

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/423 (75%), Positives = 371/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +QPPLVD+ +C C+VD+GLKTV GA+++VPG+K+C+QP I P  H T+    R+++R Q 
Sbjct  25    VQPPLVDSVSCYCKVDSGLKTVVGARKFVPGSKICIQPDINPRAHKTKNSR-RERSRVQP  83

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YV+K
Sbjct  84    PLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMK  143

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFD  YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  144   RDRDGRISWHAFDSTYQLWQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMRR  203

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  204   VIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  263

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG+HR+V+SE Y PE + W+ V +GMV GWRNPS
Sbjct  264   SFIADMSTAMVPFIGVVYDGKWFLKGLGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPS  323

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +++GRLYALDCRDGCKLRVYDEAT+SW++ IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  324   ISMDGRLYALDCRDGCKLRVYDEATHSWNRFIDSKLHLGSSRALEAAALVPLNGKLCIIR  383

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    T+ HLWE I GKG F+T+ TN  SS+AGR  LKSHIVHCQV
Sbjct  384   NNMSISIVDVSN-PDKQVETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQV  442

Query  2006  LQT  2014
             LQ 
Sbjct  443   LQA  445



>ref|XP_009785252.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nicotiana sylvestris]
Length=437

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/423 (75%), Positives = 371/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +QPPLVD+ +C C+VD+GLKTV GA+++VPG+K+C+QP I P  H T+    R+++R Q 
Sbjct  17    VQPPLVDSVSCYCKVDSGLKTVVGARKFVPGSKICIQPDINPRAHKTKNSR-RERSRVQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YV+K
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFD  YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RDRDGRISWHAFDSTYQLWQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  196   VIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG+HR+V+SE Y PE + W+ V +GMV GWRNPS
Sbjct  256   SFIADMSTAMVPFIGVVYDGKWFLKGLGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +++GRLYALDCRDGCKLRVYDEAT+SW++ IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  316   ISMDGRLYALDCRDGCKLRVYDEATHSWNRFIDSKLHLGSSRALEAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    T+ HLWE I GKG F+T+ TN  SS+AGR  LKSHIVHCQV
Sbjct  376   NNMSISIVDVSN-PDKQVETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_007014726.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
 gb|EOY32345.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
Length=438

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/423 (76%), Positives = 372/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  18    VQAPLVDSVSCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKNSR-RERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRW RLLAGNF+YSLRK L +AEEW+YV K
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWCRLLAGNFFYSLRKSLGMAEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDPI+QLWQPLPPVP+EYSEALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNAFDPIHQLWQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  197   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I DMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET++W +V DGMV+GWRNPS
Sbjct  257   SFIQDMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETNSWTSVSDGMVSGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNGRLYALDCRDGCKLRVYD AT+SW+K IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  317   ISLNGRLYALDCRDGCKLRVYDGATDSWNKFIDSKLHLGSSRALEAAALVPLNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   D    ++ HLWE I GKG F+T+ TN  SS+AGRS L+SHIVHCQV
Sbjct  377   NNMSISLVDVSS-PDKQVESNPHLWENIAGKGHFRTLFTNIWSSIAGRSGLRSHIVHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQA  438



>ref|XP_004294988.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/423 (76%), Positives = 372/423 (88%), Gaps = 3/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAGLKTVAGA+++VPG+KLC+QP I P+ H  +Q+  R++ R Q 
Sbjct  14    VQAPLVDSVSCYCKVDAGLKTVAGARKFVPGSKLCIQPDINPNAHRGKQR--RERTRIQP  71

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR++H KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  72    PLLPGLPDDLAIACLIRVPRVDHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  131

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  132   RDRDGRISWHAFDPTYQLWQPLPPVPNEYSAALGFGCAVLSGCHLYLFGGKDPLKGSMRR  191

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAE+YDPNKNRW
Sbjct  192   VIFYSARTNKWHRAPDMLRKRHFFGACVINNCLYVAGGECEGIQRTLRSAEIYDPNKNRW  251

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TWN + DGMV GWRNPS
Sbjct  252   SFISDMSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYSPEANTWNPISDGMVAGWRNPS  311

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCK+RVYD  T+SW+K IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  312   ISLNGQLYALDCRDGCKVRVYDRVTDSWNKCIDSKLHLGSSRALEAAALVPLNGKLCIIR  371

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   D    ++ +LWE I GKG F+T+V+N  SS+AGR+ LKSHIVHCQV
Sbjct  372   NNMSISLVDVSS-PDKQVESNPNLWENIAGKGHFRTLVSNLWSSIAGRTGLKSHIVHCQV  430

Query  2006  LQT  2014
             LQ 
Sbjct  431   LQA  433



>gb|KDP26940.1| hypothetical protein JCGZ_21033 [Jatropha curcas]
Length=434

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/423 (76%), Positives = 371/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q+
Sbjct  14    VQAPLVDSVSCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKNLR-RERTRVQA  72

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWY LLAGNF+YSLRK L +AEEW+YVIK
Sbjct  73    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYHLLAGNFFYSLRKSLGMAEEWVYVIK  132

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDP+YQLWQPLPPVP+EYSEALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  133   RDRDGKISWNAFDPVYQLWQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMRR  192

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  193   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  252

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET++W  V DGMV GWRNPS
Sbjct  253   SFISDMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETNSWTPVSDGMVVGWRNPS  312

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNGRLYALDCRDGCK+RVYD AT+SW+K IDS++HLG+S A+EAAAL+PL+GKLCI+R
Sbjct  313   ISLNGRLYALDCRDGCKVRVYDGATDSWNKFIDSKLHLGSSHAMEAAALVPLNGKLCIVR  372

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV    D    ++ HLWE I G+G F+T+VTN  SS+AGR  LKSHIVHCQV
Sbjct  373   NNMSISLVDVCS-PDKQVESNPHLWENIAGRGHFRTLVTNLWSSIAGRGGLKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>ref|XP_002527061.1| Protein AFR, putative [Ricinus communis]
 gb|EEF35305.1| Protein AFR, putative [Ricinus communis]
Length=437

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/423 (76%), Positives = 371/423 (88%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  17    VQAPLVDSVSCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKNLR-RERTRVQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDPIYQLWQPLPPVP+EYSEALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  136   RDRDGKISWNAFDPIYQLWQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLG+HR+V+SE Y PET++W  + DGMV GWRNPS
Sbjct  256   SFISDMSTAMVPFIGVVYDGKWFLKGLGSHREVLSEAYDPETNSWTPISDGMVGGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLRVYD AT+SW+K IDS++HLG S ALEAAAL+PL+GKLCI+R
Sbjct  316   ISLNGQLYALDCRDGCKLRVYDGATDSWNKFIDSKLHLGNSHALEAAALVPLNGKLCIVR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   +    T+ HLWE I G+G F+T+VTN  SS+AGR  LKSHIVHCQV
Sbjct  376   NNMSISLVDVSS-PEKHVETNPHLWENIAGRGHFRTLVTNLWSSIAGRGGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_004228650.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Solanum lycopersicum]
Length=437

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/435 (73%), Positives = 375/435 (86%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             +E +  ++    +Q PLVD+ +C C+VD+G KTV GA+++V G+K+C+QP I P  H T+
Sbjct  5     IERSPNAQRGFRVQAPLVDSVSCYCKVDSGFKTVVGARKFVSGSKICIQPDINPHAHKTK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R+++R QSPLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK 
Sbjct  65    NSR-RERSRVQSPLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNFFYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPP+P EYSEALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPLPGEYSEALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+NRW+ ++DMSTAMVPFIGV+Y GKW+LKGLG+HR+V+SE Y PET+ W+ V
Sbjct  244   SAEVYDPNRNRWTFVADMSTAMVPFIGVIYDGKWFLKGLGSHREVLSEAYNPETNGWSPV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGMV GWRNPS ++NGRLYALDCRDGCKLRVYD A++SW++ IDS++HLG+S+ALEAAA
Sbjct  304   TDGMVAGWRNPSISMNGRLYALDCRDGCKLRVYDGASDSWNRFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS+VDV+   D    T+ HLWE I GKG F+T+ TN  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISMVDVSS-PDKQVETNPHLWENIAGKGHFRTLFTNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
               LKSHIVHCQVLQ 
Sbjct  423   GGLKSHIVHCQVLQA  437



>ref|XP_002283484.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Vitis vinifera]
 emb|CAN64353.1| hypothetical protein VITISV_013831 [Vitis vinifera]
Length=437

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/435 (73%), Positives = 376/435 (86%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             VE +  ++    +Q PLVD+ +C C+VD+GLKTVAGA+++VPG+KLC+QP I P  H ++
Sbjct  5     VEQSPNAQRGFRVQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKLCIQPDINPHAHKSK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRW+RLL+GNF+YSLRK 
Sbjct  65    NSR-RERTRFQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWHRLLSGNFFYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYSEALGFGCAVLSGC+LYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPVPVEYSEALGFGCAVLSGCNLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+K S+RRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPMKRSLRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+NRWS ISDMSTAMVPFIGV+Y GKW+LKGLG+HR+VMSE Y PET+TW  +
Sbjct  244   SAEVYDPNRNRWSFISDMSTAMVPFIGVIYNGKWFLKGLGSHREVMSEAYIPETNTWTPI  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGMV GWRNPS +LNG+LYALDCRDGCKLRVYD  T+SW+K IDS++HLG+S+ALEAAA
Sbjct  304   SDGMVAGWRNPSISLNGQLYALDCRDGCKLRVYDSDTDSWNKFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS+VDV+   D    ++ HLWE I GKG F+T+VTN  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISIVDVSS-PDKHVESNPHLWENIAGKGHFRTLVTNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + L+SHIVHCQVLQ 
Sbjct  423   NSLRSHIVHCQVLQA  437



>ref|XP_006354154.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Solanum 
tuberosum]
Length=437

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/423 (74%), Positives = 369/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+G KTV GA+++V G+K+C+QP I P  H T+    R+++R QS
Sbjct  17    VQAPLVDSVSCYCKVDSGFKTVVGARKFVAGSKICIQPDINPHAHKTKNSR-RERSRVQS  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDP YQLWQPLPP+P EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RDRDGRISWHAFDPTYQLWQPLPPLPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + I+DMSTAMVPFIGV+Y GKW+LKGLG+HR+V+SE Y PET+ W+ V DGMV GWRNPS
Sbjct  256   TFITDMSTAMVPFIGVIYDGKWFLKGLGSHREVLSEAYNPETNGWSPVTDGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              ++NG LYALDCRDGCKLRVYD A++SW++ IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  316   ISMNGCLYALDCRDGCKLRVYDGASDSWNRFIDSKLHLGSSRALEAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    T+ HLWE I GKG F+T+ TN  SS+AGR  LKSHIVHCQV
Sbjct  376   NNMSISMVDVSS-PDKQVETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_009364116.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=437

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/435 (73%), Positives = 371/435 (85%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
              E +  ++    +Q PLVD+ +C C+VDAGLKTVAGA+++VPG+K+C+QP I P+ H  +
Sbjct  5     TEQSSNAQRGFRVQAPLVDSVSCYCKVDAGLKTVAGARKFVPGSKICIQPDINPNAHRGK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK 
Sbjct  65    NLR-RERTRIQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPLKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAE+YDPNKNRWS ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TW  +
Sbjct  244   SAEIYDPNKNRWSFISDMSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYTPEANTWTPI  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGMV GWRNPS +LNG+LYALDCRDGCKLRVYD  ++SW K IDS++HLG+S+ALEAAA
Sbjct  304   SDGMVAGWRNPSISLNGQLYALDCRDGCKLRVYDRVSDSWIKFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSISLVDV+   D    ++  LWE I GKG F+T+V+N  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISLVDVSS-PDKHVESNPQLWENIAGKGHFRTLVSNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   TGLKSHIVHCQVLQA  437



>ref|XP_011089119.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Sesamum indicum]
Length=437

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/423 (75%), Positives = 364/423 (86%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTV GA ++VPG+KLC+QP I P  H  +    R++ R Q 
Sbjct  17    VQAPLVDSVSCYCKVDSGLKTVVGASKFVPGSKLCIQPNINPRAHKAKNSR-RERTRVQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPRIEH KLRLVCKRW++LLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRIEHNKLRLVCKRWFKLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RDRDGRISWHAFDPTYQLWQPLPPVPVEYSAALGFGCAVLSGCHLYLFGGKDPLKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  196   VIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLGTHR+V+SE Y PET+TW+ + DGMV GWRNPS
Sbjct  256   SFISDMSTAMVPFIGVVYDGKWFLKGLGTHREVLSEAYTPETNTWSPMNDGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              ++NG+LYALDCRDGCKLRVYDE T+SWS+ IDS++HLG S+ALEAAAL+PL+GKLCIIR
Sbjct  316   ISMNGKLYALDCRDGCKLRVYDEGTDSWSRFIDSKLHLGNSRALEAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D    ++  +WE I  KG  + + TN  SS+AGRS LKSHIVHCQV
Sbjct  376   NNMSISMVDVSN-PDKRVESNPQIWENIASKGHLRNLFTNLWSSIAGRSGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_011025173.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Populus euphratica]
Length=438

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/423 (75%), Positives = 369/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  18    VQAPLVDSVSCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDP++Q+WQPLPPVP+EYS ALGFGCAVLS CHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNAFDPVHQIWQPLPPVPREYSGALGFGCAVLSSCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS
Sbjct  257   SFISDMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPISDGMVAGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +L+GRLYALDCRDGCKLRVYDEA+++W+K IDS++HLG+S ALEAAAL+PL+GKLCI+R
Sbjct  317   ISLDGRLYALDCRDGCKLRVYDEASDTWNKFIDSKLHLGSSHALEAAALVPLNGKLCIVR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+   D    ++ HLWE I G+G  +T+VTN  SS+AGR  LKSHIVHCQV
Sbjct  377   NNMSVSLVDVSS-PDKHVESNPHLWENIAGRGHLRTLVTNLWSSIAGRGGLKSHIVHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQA  438



>ref|XP_004142161.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 ref|XP_004173631.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 gb|KGN54077.1| hypothetical protein Csa_4G280540 [Cucumis sativus]
Length=437

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/435 (73%), Positives = 373/435 (86%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             VE + R++    IQ PLVD+ +C C+VD+GLKTV GA+++VPG+K+C+QP I P+ H ++
Sbjct  5     VEPSSRAQRGIRIQAPLVDSVSCYCKVDSGLKTVVGARKFVPGSKICIQPDINPNAHRSK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNFYYSLRK 
Sbjct  65    ASR-RERTRVQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLMGNFYYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKR+RD ++SWHAFDP YQLWQ LPPVP EYSEALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRERDRRISWHAFDPTYQLWQSLPPVPVEYSEALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYSARTNKWHRAPDMLRKRHCFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPNKNRWS ISDMS+AMVPFIGVV+ G W+LKGLGT R+VMSE Y PET+TW TV
Sbjct  244   SAEVYDPNKNRWSFISDMSSAMVPFIGVVHDGLWFLKGLGTRREVMSEAYSPETNTWTTV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGMV+GWRNPS +LNG+LYALDC+DGCKLRVYD AT+SW++ IDS++H G+S+ALEAAA
Sbjct  304   SDGMVSGWRNPSISLNGQLYALDCQDGCKLRVYDSATDSWNRFIDSKLHFGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+ L+GKLCIIRNNMSISLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR
Sbjct  364   LVSLNGKLCIIRNNMSISLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNLLSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   NGLKSHIVHCQVLQA  437



>ref|XP_008449801.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Cucumis melo]
Length=437

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/435 (73%), Positives = 372/435 (86%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             VE + R++    IQ PLVD+ +C C+VD+GLKTV GA+++VPG+K+C+QP I P+ H ++
Sbjct  5     VEPSSRAQRGIRIQAPLVDSVSCYCKVDSGLKTVVGARKFVPGSKICIQPDINPNAHRSK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL GNFYYSLRK 
Sbjct  65    TSR-RERTRVQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLMGNFYYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKR+RD ++SWHAFDP YQLWQ LPPVP EYSEALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRERDRRISWHAFDPTYQLWQSLPPVPVEYSEALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYSARTNKWHRAPDMLRKRHCFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPNKNRWS ISDMS+AMVPFIGVV+ G W+LKGLGT R+VMSE Y PET+TW TV
Sbjct  244   SAEVYDPNKNRWSFISDMSSAMVPFIGVVHDGLWFLKGLGTRREVMSEAYSPETNTWTTV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGMV GWRNPS +LNG+LYALDC+DGCKLRVYD AT+SW++ IDS++H G+S+ALEAAA
Sbjct  304   SDGMVAGWRNPSISLNGQLYALDCQDGCKLRVYDSATDSWNRFIDSKLHFGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+ L+GKLCIIRNNMSISLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR
Sbjct  364   LVSLNGKLCIIRNNMSISLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNLLSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   NGLKSHIVHCQVLQA  437



>ref|XP_010101133.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXB87351.1| F-box/kelch-repeat protein [Morus notabilis]
Length=442

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/423 (74%), Positives = 368/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAGLKTVAGA+++VPG+KLC+QP I P+ H  +    R++ R Q 
Sbjct  22    VQAPLVDSVSCYCKVDAGLKTVAGARKFVPGSKLCIQPDINPNAHKGKNSR-RERTRIQP  80

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  81    PLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  140

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHA+DP Y +WQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  141   RDRDGRISWHAYDPTYHIWQPLPPVPAEYSEALGFGCAVLSGCHLYLFGGKDPLRGSMRR  200

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  201   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  260

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PET+TW  + DGMV GWRNP 
Sbjct  261   SFISDMSTAMVPFIGVVHNGMWFLKGLGSHREVMSESYSPETNTWTPISDGMVAGWRNPC  320

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              ++NG+LYALDCRDGCKLRVYD +T+SW+K IDS++HLG+S+ALEAAAL+PL+GKLCIIR
Sbjct  321   ISMNGQLYALDCRDGCKLRVYDRSTDSWNKFIDSKLHLGSSRALEAAALVPLNGKLCIIR  380

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   D    ++  +WE I G+G F+T+VTN   S+AGRS LKSHI+HCQV
Sbjct  381   NNMSISLVDVSS-PDIPVESNPQMWENIAGRGHFRTLVTNLWLSIAGRSGLKSHILHCQV  439

Query  2006  LQT  2014
             LQ 
Sbjct  440   LQA  442



>emb|CDP17358.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/423 (74%), Positives = 366/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAGLKTVAGA+++VPG+KLC+QP I P  H ++    R++ R Q 
Sbjct  17    VQAPLVDSVSCYCKVDAGLKTVAGARKFVPGSKLCIQPDINPRAHKSKNYR-RERTRVQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PL+PGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YVIK
Sbjct  76    PLIPGLPDDLAIACLIRVPRVEHNKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDP YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKD +KGSMRR
Sbjct  136   RDRDGRISWHAFDPTYQLWQPLPPVPVEYSEALGFGCAVLSGCHLYLFGGKDQLKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVPFIGVVY GKW+LKGLG+HR+V+SE Y PE++ W    DGMV GWRNPS
Sbjct  256   SFVADMSTAMVPFIGVVYDGKWFLKGLGSHREVLSEAYIPESNKWMPADDGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              ++NG+LYALDCRDGCKLRVYDE+TNSW + +DS++HLG+S+ALEAAAL+P++GKLCIIR
Sbjct  316   VSMNGKLYALDCRDGCKLRVYDESTNSWIRFMDSKLHLGSSRALEAAALVPVNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+   D     + HLWE I GKG  + + TN  SS+AGR+ LKSHIVHCQV
Sbjct  376   NNMSISMVDVSS-PDKQVENNPHLWENIAGKGHIRNIFTNLWSSIAGRTGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_002304010.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
 gb|EEE78989.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
Length=438

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/423 (74%), Positives = 368/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  18    VQAPLVDSVSCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDP++Q+WQPLPPVP+EYS ALGFGCAVLS CHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNAFDPVHQIWQPLPPVPREYSGALGFGCAVLSSCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS
Sbjct  257   SFISDMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPINDGMVAGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +L+G LYALDCRDGCKLRVYDEA+++W+K IDS++HLG+S ALEAAAL+PL+GKLCI+R
Sbjct  317   ISLDGCLYALDCRDGCKLRVYDEASDTWNKFIDSKLHLGSSHALEAAALVPLNGKLCIVR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+   D    ++ HLWE I G+G  +T+VTN  SS+AGR  LKSHIVHCQV
Sbjct  377   NNMSVSLVDVSS-PDKHVESNPHLWENIAGRGHLRTLVTNLWSSIAGRGGLKSHIVHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQA  438



>ref|XP_009375482.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=437

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/435 (73%), Positives = 369/435 (85%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
              E +  ++    +Q PLVD+ +C C+VDAG KTVAGA+++VPG+K+C+QP I P+ H  +
Sbjct  5     TEQSSNAQRGFRVQAPLVDSVSCYCKVDAGFKTVAGARKFVPGSKICIQPDINPNAHRGK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLR+VCKRWYRLLAGNF+YSLRK 
Sbjct  65    NLR-RERTRIQPPLLPGLPDDLAIACLIRVPRVEHRKLRIVCKRWYRLLAGNFFYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGK P+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKHPLKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAE+YDPNKNRWS ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TW  +
Sbjct  244   SAEIYDPNKNRWSFISDMSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYAPEANTWTPI  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGMV GWRNPS +LNG+LYALDC DGCKLRVYD  ++SWSK IDS++HLG+S ALEAAA
Sbjct  304   SDGMVDGWRNPSISLNGQLYALDCHDGCKLRVYDRVSDSWSKFIDSKVHLGSSCALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSISLVDV+   D    ++ HLWE I GKG F+T+V+N  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISLVDVSS-PDKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   NGLKSHIVHCQVLQA  437



>ref|XP_011010683.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Populus euphratica]
Length=437

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/423 (74%), Positives = 367/423 (87%), Gaps = 3/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  18    VQAPLVDSASCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YVIK
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDP+YQ+WQPLPPVP+EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMR 
Sbjct  137   RDRDGKISWNAFDPVYQIWQPLPPVPREYSGALGFGCAVLSGCHLYLFGGKDPLKGSMRL  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYS RTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYSVRTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS
Sbjct  257   SFISDMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPISDGMVAGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +L+G LYALDCRDGCKLRVYDEA+++W+K IDS++H G+S ALEAAAL+PL+GKLCI+R
Sbjct  317   ISLDGHLYALDCRDGCKLRVYDEASDTWNKFIDSKLHQGSSHALEAAALVPLNGKLCIVR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR  LKSHIVHCQV
Sbjct  377   NNMSVSLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNILSSIAGRG-LKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>gb|KHG22974.1| hypothetical protein F383_01277 [Gossypium arboreum]
Length=438

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/423 (74%), Positives = 367/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  18    VQAPLVDSVSCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKNSR-RERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLR+VCKRWYRLLAGNF+YSLRK L +AEEW+YV K
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRVVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDPI+QLWQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKD  +GSMRR
Sbjct  137   RDRDGKISWNAFDPIHQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDRQRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+H +LRSAEVYDPNKNRW
Sbjct  197   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIHRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S + DMSTAMVPFIGVVY GKW++KGLG+HR+VMSE Y PE+++W+    GM++GWRNPS
Sbjct  257   SFVQDMSTAMVPFIGVVYDGKWFVKGLGSHREVMSEAYDPESNSWSPASGGMISGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLRVYD AT+SW+K IDS++HLG S+ LEAA L+PL+GKLCIIR
Sbjct  317   ISLNGQLYALDCRDGCKLRVYDGATDSWNKFIDSKLHLGNSRVLEAAGLVPLNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   D    ++  LWE IGG+G F+T+ TN  SS+AGRS L+SHIVHCQV
Sbjct  377   NNMSISLVDVSS-PDKQVESNPQLWENIGGRGHFRTLFTNIWSSIAGRSGLRSHIVHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQA  438



>ref|XP_011048244.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Populus euphratica]
Length=437

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/423 (74%), Positives = 367/423 (87%), Gaps = 3/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q 
Sbjct  18    VQAPLVDSASCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YVIK
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDP+YQ+WQPLPPVP+EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMR 
Sbjct  137   RDRDGKISWNAFDPVYQIWQPLPPVPREYSGALGFGCAVLSGCHLYLFGGKDPLKGSMRL  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYS RTNKWHRAPDMLR+RHFFG CV+NNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYSVRTNKWHRAPDMLRKRHFFGSCVMNNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS
Sbjct  257   SFISDMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPISDGMVAGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +L+G LYALDCRDGCKLRVYDEA+++W+K IDS++H G+S ALEAAAL+PL+GKLCI+R
Sbjct  317   ISLDGHLYALDCRDGCKLRVYDEASDTWNKFIDSKLHQGSSHALEAAALVPLNGKLCIVR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR  LKSHIVHCQV
Sbjct  377   NNMSVSLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNILSSIAGRG-LKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_008344671.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=437

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/423 (74%), Positives = 364/423 (86%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAG KTVAGA+++VPG+K+C+QP I P+ H  +    R++ R Q 
Sbjct  17    VQAPLVDSVSCYCKVDAGFKTVAGARKFVPGSKICIQPDINPNAHXGKNLR-RERTRIQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLR+VCKRWY LLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHRKLRIVCKRWYHLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGK P++GSMRR
Sbjct  136   RDRDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLFGGKHPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAE+YDPNKNRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEIYDPNKNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
               ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TW  + DGMV GWRNPS
Sbjct  256   XFISDMSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYTPEANTWTPISDGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLRVYD  ++SW+K IDS++HLG+S ALEAAAL+PL+GKLCIIR
Sbjct  316   ISLNGQLYALDCRDGCKLRVYDRVSDSWNKFIDSKVHLGSSCALEAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   D    ++ HLWE I GKG F+T+V+N  SS+AGR+ LKSHIVHCQV
Sbjct  376   NNMSISLVDVSS-PDKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRTGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_008351710.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=437

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/423 (74%), Positives = 364/423 (86%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAG KTVAGA+++VPG+K+C+QP I P+ H  +    R++ R Q 
Sbjct  17    VQAPLVDSVSCYCKVDAGFKTVAGARKFVPGSKICIQPDINPNAHRGKNLR-RERTRIQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLR+VCKRWY LLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHRKLRIVCKRWYHLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGK P++GSMRR
Sbjct  136   RDRDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLFGGKHPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAE+YDPNKNRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEIYDPNKNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
               ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TW  + DGMV GWRNPS
Sbjct  256   XFISDMSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYTPEANTWTPISDGMVAGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLRVYD  ++SW+K IDS++HLG+S ALEAAAL+PL+GKLCIIR
Sbjct  316   ISLNGQLYALDCRDGCKLRVYDRVSDSWNKFIDSKVHLGSSCALEAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV+   D    ++ HLWE I GKG F+T+V+N  SS+AGR+ LKSHIVHCQV
Sbjct  376   NNMSISLVDVSS-PDKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRTGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_009388524.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/431 (74%), Positives = 365/431 (85%), Gaps = 3/431 (1%)
 Frame = +2

Query  725   RSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPR  904
             R  + R   PPLVD+ ACLCRVDAGLKTV GAK+YVP TKLC+QP I+ SIHP R  P  
Sbjct  9     RRDVARRNHPPLVDSRACLCRVDAGLKTVTGAKKYVPSTKLCVQPRIRTSIHPVRPNPAF  68

Query  905   DKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAE  1084
             D+NR QSPLLPGLPDDLAIACLIRVPR EH KLRLVCKRW RLLAGN++YSLRK L +AE
Sbjct  69    DRNRIQSPLLPGLPDDLAIACLIRVPRPEHRKLRLVCKRWQRLLAGNYFYSLRKSLSVAE  128

Query  1085  EWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP  1264
             EWIY+I+RDR+G++SW AFDP +QLW PLPPVPKEYS+A+GFGCAVL GCHLYLFGGKDP
Sbjct  129   EWIYIIRRDREGRISWDAFDPRFQLWHPLPPVPKEYSKAIGFGCAVLHGCHLYLFGGKDP  188

Query  1265  VKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVY  1444
              KGSMRRVI+Y+ARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE+EGVH  LRSAE Y
Sbjct  189   CKGSMRRVIYYNARTNKWHRAPDMLRRRHFFGACVINNCLYVAGGESEGVHRFLRSAEFY  248

Query  1445  DPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYD-GM  1621
             DP+KNRWS +S+MS AMVPFIGVVY+GKW+LKGLG  +Q++++VY PETDTW      GM
Sbjct  249   DPSKNRWSFVSEMSAAMVPFIGVVYEGKWFLKGLGPQQQLLTDVYFPETDTWCPASSGGM  308

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             V GWRNPS  LNGRL+ALDCRDGCKLRVYD    SWS+HIDS++HLG+S+A+EAAAL+PL
Sbjct  309   VAGWRNPSVCLNGRLFALDCRDGCKLRVYDAGAGSWSRHIDSKLHLGSSRAMEAAALVPL  368

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLK  1981
             +GKLCI+RNNMSI+LVDV   D  GA + +  WETI GKGQ KT VTN LS++AGR   +
Sbjct  369   NGKLCIVRNNMSITLVDVEARD--GAGSGDQRWETIAGKGQLKTFVTNLLSNIAGRRSNR  426

Query  1982  SHIVHCQVLQT  2014
             S+IVHCQVLQ 
Sbjct  427   SYIVHCQVLQA  437



>ref|XP_006341889.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341890.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006341891.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006341892.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X4 [Solanum tuberosum]
Length=437

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/435 (71%), Positives = 368/435 (85%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             +E +  +     +QPPLVD+ +C C VD+GLKTVAGA+++VPG+KLC+Q  I    H ++
Sbjct  5     IERSSNAHRGFRVQPPLVDSVSCYCNVDSGLKTVAGARKFVPGSKLCIQSDISSHAHKSK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R+++R Q PLLP LPDDLAIACL+RVPR+E  KLRLVCKRWYRLLAGNF+YS RK 
Sbjct  65    NSR-RERSRVQPPLLPSLPDDLAIACLVRVPRVELSKLRLVCKRWYRLLAGNFFYSQRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YV+KRDRDG++SWHAFDP YQLWQPLPPVP +YSEALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVVKRDRDGRISWHAFDPTYQLWQPLPPVPGDYSEALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFY+ARTN+WHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYNARTNRWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+ RWS I+DMSTAMVPFIGVVY GKW++KGLG+HR+V+SE Y P+T+ W+ V
Sbjct  244   SAEVYDPNRKRWSFIADMSTAMVPFIGVVYDGKWFIKGLGSHREVLSEAYNPDTNAWSPV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              + MV GWRNPS ++NGRLYALDCRDGCKLRVYDE+T SW + IDS++HLG+S+ALEAAA
Sbjct  304   NNRMVAGWRNPSISMNGRLYALDCRDGCKLRVYDESTQSWIRFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS++DV    D    T+ HLWE I GKG F+TM TN  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISIIDVLS-PDKRVETNPHLWENIAGKGHFRTMFTNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   AGLKSHIVHCQVLQV  437



>ref|XP_011089699.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
Length=437

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/435 (71%), Positives = 367/435 (84%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             VE +   +    +Q PLVD+ +C C+VD+GLKTVAGA+++VPG+K+C+QP I P  H  +
Sbjct  5     VERSPNGQRGFRVQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKICIQPDINPHAHKAK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R+++R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRW++LLAGNF+YSLRK 
Sbjct  65    SSR-RERSRVQPPLLPGLPDDLAIACLIRVPRVEHNKLRLVCKRWFKLLAGNFFYSLRKN  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPVPGEYSSALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFYSARTNKWHRAPDMLRRRHF G C++NNCLYVAGGE EG+  +L 
Sbjct  184   GGKDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFPGSCIMNNCLYVAGGECEGLQRTLS  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+NRWS I+DM+TAMVPFIGVVY GKW++KGLG HR+V+ E Y PET+ WN +
Sbjct  244   SAEVYDPNRNRWSFIADMTTAMVPFIGVVYDGKWFVKGLGAHREVLCEAYTPETNAWNPM  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              D +V+GWRNPS ++NG+LYALDCRDGCKLRVYDE T SW + IDS++HLG S+ALEAAA
Sbjct  304   NDTLVSGWRNPSISMNGKLYALDCRDGCKLRVYDEGTKSWKRFIDSKLHLGNSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS+VDV+   D    ++ H+WE I  KG FKT+ TN  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISMVDVSN-PDKQIESNPHIWENIANKGHFKTLFTNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             S LKSHIVHCQVLQ 
Sbjct  423   SGLKSHIVHCQVLQA  437



>ref|XP_011010684.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Populus euphratica]
Length=416

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/419 (74%), Positives = 364/419 (87%), Gaps = 3/419 (1%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +VD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q PLLP
Sbjct  1     MVDSASCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQPPLLP  59

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YVIKRDRD
Sbjct  60    GLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIKRDRD  119

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SW+AFDP+YQ+WQPLPPVP+EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMR VIFY
Sbjct  120   GKISWNAFDPVYQIWQPLPPVPREYSGALGFGCAVLSGCHLYLFGGKDPLKGSMRLVIFY  179

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             S RTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRWS IS
Sbjct  180   SVRTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRWSFIS  239

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             DMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS +L+
Sbjct  240   DMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPISDGMVAGWRNPSISLD  299

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             G LYALDCRDGCKLRVYDEA+++W+K IDS++H G+S ALEAAAL+PL+GKLCI+RNNMS
Sbjct  300   GHLYALDCRDGCKLRVYDEASDTWNKFIDSKLHQGSSHALEAAALVPLNGKLCIVRNNMS  359

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             +SLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR  LKSHIVHCQVLQ 
Sbjct  360   VSLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNILSSIAGRG-LKSHIVHCQVLQA  416



>ref|XP_011048245.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Populus euphratica]
Length=416

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/419 (74%), Positives = 364/419 (87%), Gaps = 3/419 (1%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +VD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q PLLP
Sbjct  1     MVDSASCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQPPLLP  59

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YVIKRDRD
Sbjct  60    GLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIKRDRD  119

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SW+AFDP+YQ+WQPLPPVP+EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMR VIFY
Sbjct  120   GKISWNAFDPVYQIWQPLPPVPREYSGALGFGCAVLSGCHLYLFGGKDPLKGSMRLVIFY  179

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             S RTNKWHRAPDMLR+RHFFG CV+NNCLYVAGGE EG+  +LRSAEVYDPNKNRWS IS
Sbjct  180   SVRTNKWHRAPDMLRKRHFFGSCVMNNCLYVAGGECEGIQRTLRSAEVYDPNKNRWSFIS  239

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             DMSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS +L+
Sbjct  240   DMSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPISDGMVAGWRNPSISLD  299

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             G LYALDCRDGCKLRVYDEA+++W+K IDS++H G+S ALEAAAL+PL+GKLCI+RNNMS
Sbjct  300   GHLYALDCRDGCKLRVYDEASDTWNKFIDSKLHQGSSHALEAAALVPLNGKLCIVRNNMS  359

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             +SLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR  LKSHIVHCQVLQ 
Sbjct  360   VSLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNILSSIAGRG-LKSHIVHCQVLQA  416



>emb|CCH50979.1| T4.18 [Malus x robusta]
Length=452

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/418 (75%), Positives = 361/418 (86%), Gaps = 2/418 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             VD+ +C C+VDAG KTVAGA+++VPG+K+C+QP I P+ H  +    R++ R Q PLLPG
Sbjct  37    VDSVSCYCKVDAGFKTVAGARKFVPGSKICIQPDINPNAHRGKNLR-RERTRIQPPLLPG  95

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAIACLIRVPR+EH KLR+VCKRWY LLAGNF+YSLRK L +AEEW+YVIKRDRDG
Sbjct  96    LPDDLAIACLIRVPRVEHRKLRIVCKRWYHLLAGNFFYSLRKSLGMAEEWVYVIKRDRDG  155

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             ++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGK P++GSMRRVIFYS
Sbjct  156   RISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLFGGKHPLRGSMRRVIFYS  215

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
             ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAE+YDPNKNRWS ISD
Sbjct  216   ARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEIYDPNKNRWSFISD  275

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             MSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TW  + DGMV GWRNPS +LNG
Sbjct  276   MSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYTPEANTWTPISDGMVAGWRNPSISLNG  335

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
             +LYALDCRDGCKLRVYD  T+SW+K IDS++HLG+S ALEAAAL+PL+GKLCIIRNNMSI
Sbjct  336   QLYALDCRDGCKLRVYDRVTDSWNKFIDSKVHLGSSCALEAAALVPLNGKLCIIRNNMSI  395

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             SLVDV+   D    ++ HLWE I GKG F+T+V+N  SS+AGR+ LKSHIVHCQVLQ 
Sbjct  396   SLVDVSS-PDKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRTGLKSHIVHCQVLQA  452



>ref|XP_002297645.2| hypothetical protein POPTR_0001s04530g [Populus trichocarpa]
 gb|EEE82450.2| hypothetical protein POPTR_0001s04530g [Populus trichocarpa]
Length=424

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/418 (74%), Positives = 363/418 (87%), Gaps = 3/418 (1%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             VD+ +C C+VD+GLKTVA A+++VPG+KLC+QP I P+ H ++    R++ R Q PLLPG
Sbjct  10    VDSASCYCKVDSGLKTVAEARKFVPGSKLCIQPDINPNAHKSKTSR-RERTRVQPPLLPG  68

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAIACLIRVPR EH KLRLVCKRWYRLLAGN++YSLRK L +AEEW+YVIKRDRDG
Sbjct  69    LPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIKRDRDG  128

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             K+SW+AFDP+YQ+WQPLPPVP+EYS ALGFGCAVLSGCHLYLFGGKDP++GSMR VIFYS
Sbjct  129   KISWNAFDPVYQIWQPLPPVPREYSGALGFGCAVLSGCHLYLFGGKDPLRGSMRLVIFYS  188

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
              RTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRWS ISD
Sbjct  189   VRTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRWSFISD  248

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             MSTAMVPFIGVVY GKW+LKGLG+HR+VMSE Y PET TW  + DGMV GWRNPS +L+G
Sbjct  249   MSTAMVPFIGVVYDGKWFLKGLGSHREVMSEAYDPETSTWTPISDGMVAGWRNPSISLDG  308

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
              LYALDCRDGCKLRVYDEA+++W+K IDS++H G+S ALEAAAL+PL+GKLCI+RNNMS+
Sbjct  309   HLYALDCRDGCKLRVYDEASDTWNKFIDSKLHQGSSHALEAAALVPLNGKLCIVRNNMSV  368

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             SLVDV+   D    ++ HLWE I G+G  +T+VTN LSS+AGR  LKSHIVHCQVLQ 
Sbjct  369   SLVDVSS-PDKRVESNPHLWENIAGRGHLRTLVTNILSSIAGRG-LKSHIVHCQVLQA  424



>gb|EYU39245.1| hypothetical protein MIMGU_mgv1a006629mg [Erythranthe guttata]
Length=437

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 364/423 (86%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTV GA+++VPG+K+C+QP I P  H ++    R++ R Q 
Sbjct  17    VQAPLVDSVSCYCKVDSGLKTVVGARKFVPGSKICIQPDINPRAHRSKNSR-RERTRIQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR++H KLRLV KRW++LLAGNF+YSLRK L +AEEW+YV+K
Sbjct  76    PLLPGLPDDLAIACLIRVPRVDHNKLRLVSKRWFKLLAGNFFYSLRKSLGMAEEWVYVVK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RD+D ++SWHAFDP YQLWQPLPPVP +YS ALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RDKDNRISWHAFDPTYQLWQPLPPVPVDYSSALGFGCAVLSGCHLYLFGGKDPLKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVPFIGVVY GKW+LKGLG HR+V+SE Y PE++ W+ + DGMV+GWRNPS
Sbjct  256   SFIADMSTAMVPFIGVVYDGKWFLKGLGAHREVLSEAYTPESNLWSPINDGMVSGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              ++NG+LYALDCRDGCKLRVYDE T+SWS+ IDS++HLG S+ALEAAAL+P++GKLCIIR
Sbjct  316   ISMNGKLYALDCRDGCKLRVYDEKTDSWSRFIDSKIHLGNSRALEAAALVPINGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSIS+VDV+  D   A  S  +WE I  KG F+ + TN  SS+AGRS LKSHIVHCQV
Sbjct  376   NNMSISMVDVSGTDKR-AEGSSGIWENIAIKGHFRNLFTNLWSSIAGRSGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_010535866.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Tarenaya 
hassleriana]
Length=431

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/434 (72%), Positives = 368/434 (85%), Gaps = 10/434 (2%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDK-  910
             MDR+IQPPLVDTT+CLCRVD G KTVAGAK+  PG + CL+P IK SIHPT  +P R + 
Sbjct  1     MDRMIQPPLVDTTSCLCRVDTGFKTVAGAKKGFPGARPCLRPDIKNSIHPTGSRPSRGER  60

Query  911   -NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEE  1087
              +R QSPLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRLL GNF+YSLRK L +AEE
Sbjct  61    SSRNQSPLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLLCGNFFYSLRKTLGMAEE  120

Query  1088  WIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPV  1267
             WIYVIKRDR+GK+SWHAFDP+YQLWQPLPP+P+EYS+ALGFGCAVLSGCHLYLFGGKDP+
Sbjct  121   WIYVIKRDREGKISWHAFDPLYQLWQPLPPIPREYSDALGFGCAVLSGCHLYLFGGKDPL  180

Query  1268  KGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYD  1447
             KGSMRRVIFY+ARTNKWHRAPDMLRRRH FG CVINNCLYVAGGENEGV+ SLRSAE+YD
Sbjct  181   KGSMRRVIFYNARTNKWHRAPDMLRRRHCFGSCVINNCLYVAGGENEGVNRSLRSAEMYD  240

Query  1448  PNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVY-DGMV  1624
             PNKNRW  I+DMS AM PF+G+VY+ +WYLKG+G+HRQV+S  Y+P TD+WN V+ D MV
Sbjct  241   PNKNRWMFIADMSNAMAPFLGIVYKQRWYLKGIGSHRQVLSVAYEPATDSWNPVFDDAMV  300

Query  1625  TGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLS  1804
             TGW+NP+  LN  LY LDC+DGC+LRVYDE + SW K IDS++HLG+S+A+EAAAL PL+
Sbjct  301   TGWKNPTAVLNENLYCLDCKDGCRLRVYDEISGSWGKLIDSKVHLGSSRAMEAAALFPLN  360

Query  1805  GKLCIIRNNMSISLVDVAKCDDAGAATSEHLW----ETIGGKGQFKTMVTNFLSSLAGRS  1972
             GKLCI+RNNMS+S VDV++  +      E LW     T+ GKGQ K +VTN  SS++GR+
Sbjct  361   GKLCIVRNNMSVSAVDVSRSSEENG---ESLWIAMATTMTGKGQLKNLVTNLWSSISGRN  417

Query  1973  RLKSHIVHCQVLQT  2014
             R+KS I+HCQVLQ 
Sbjct  418   RVKSWIIHCQVLQA  431



>gb|KHG22975.1| hypothetical protein F383_01278 [Gossypium arboreum]
Length=438

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 367/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTV  A+++VPG+KLC+QP I P+ H ++    ++++R Q 
Sbjct  18    VQAPLVDSVSCYCKVDSGLKTVVEARKFVPGSKLCIQPDINPNAHKSKSSR-KERSRVQH  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRWY LLAGNF++SLRK L +AEEW+YV+K
Sbjct  77    PLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYHLLAGNFFFSLRKSLGMAEEWVYVLK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFDPI+QLWQPLPPVP+EYSEALGFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNAFDPIHQLWQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAP MLR+RHFFG CVINN LYVAGGE +G+H +LRSAEVYDPNKNRW
Sbjct  197   VVFYNARTNKWHRAPGMLRKRHFFGSCVINNRLYVAGGECDGIHRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S + DMSTAMVPFIGVVY GKW++KGLG+HR+VMSE Y PE+++W+ V  GMV+GWRNPS
Sbjct  257   SFVQDMSTAMVPFIGVVYDGKWFVKGLGSHREVMSEAYDPESNSWSAVSGGMVSGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLRVYD AT+SW+K IDS++H G+S+ALEAA L+PL+GKLCIIR
Sbjct  317   ISLNGKLYALDCRDGCKLRVYDGATDSWNKFIDSKLHFGSSRALEAAGLVPLNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+   D    ++  LWE I  +G F+T+ TN  SS+AGRS L+SHI+HCQV
Sbjct  377   NNMSVSLVDVSS-PDKQVESNPQLWENIASRGHFRTLFTNIWSSIAGRSSLRSHIIHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQA  438



>ref|XP_004228331.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Solanum 
lycopersicum]
 ref|XP_010314935.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Solanum 
lycopersicum]
 ref|XP_010315084.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Solanum 
lycopersicum]
Length=437

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/435 (70%), Positives = 367/435 (84%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             +E +  +     +QPPLVD+ +C C VD+GLKTVAGA+++VPG+KLC+Q  I    H ++
Sbjct  5     IERSSNAHRGFRVQPPLVDSVSCYCNVDSGLKTVAGARKFVPGSKLCIQSDISSHAHKSK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R+++R Q PLLP LPDDLAIACL+RVPR+E  KLRLVCKRWYRLLAGNF+YS RK 
Sbjct  65    NSR-RERSRVQPPLLPSLPDDLAIACLVRVPRVELSKLRLVCKRWYRLLAGNFFYSQRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YV+KRDRDG+++WHAFDP YQLWQPLPPVP +Y EALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVVKRDRDGRITWHAFDPTYQLWQPLPPVPGDYGEALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFY+ARTN+WHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYNARTNRWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+ RWS I+DMSTAMVPFIGVVY GKW++KGLG+HR+V+SE Y P+T+ W+ V
Sbjct  244   SAEVYDPNRKRWSFIADMSTAMVPFIGVVYDGKWFIKGLGSHREVLSESYSPDTNAWSPV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              + MV GWRNPS ++NGRLYALDCRDGCKLRVYDE+T SW + IDS++HLG+S+ALEAAA
Sbjct  304   NNRMVAGWRNPSISMNGRLYALDCRDGCKLRVYDESTQSWIRFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS++DV+   D    T+  LWE I GKG F+TM TN  SS++GR
Sbjct  364   LVPLNGKLCIIRNNMSISIIDVSS-PDKRVETNPRLWENIAGKGHFRTMFTNLWSSISGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   AGLKSHIVHCQVLQV  437



>ref|XP_008243705.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Prunus mume]
Length=437

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/423 (73%), Positives = 359/423 (85%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDA LKTVAGA+++VPG+KLC+QP I P+ H  +    R+K R Q 
Sbjct  17    VQAPLVDSVSCYCKVDASLKTVAGARKFVPGSKLCIQPDINPNAHRAKNLR-REKTRIQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             R+RDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RERDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLFGGKDPLKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE +G+  +LRSAE+YDPNKNRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECDGIQRTLRSAEIYDPNKNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVV++G W+LKGLGT R+VMSE Y PE +TW  + DGMV  WRNPS
Sbjct  256   SFISDMSTAMVPFIGVVHEGMWFLKGLGTQREVMSEAYSPEANTWTPISDGMVADWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LY L C DGCKL+VYD  T+SWSK IDS++HLG S A +AAAL+PL+GKLCIIR
Sbjct  316   ISLNGQLYGLGCPDGCKLKVYDRVTDSWSKFIDSKLHLGRSFAFKAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVD++  D      + HLWE I GKG F+T+V+N  S++A R+ LKSHIVHCQV
Sbjct  376   NNMSISLVDISSPDKP-VEGNPHLWENIAGKGHFRTLVSNLWSTIAARTGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_009763739.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nicotiana 
sylvestris]
Length=437

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/435 (71%), Positives = 366/435 (84%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             +E T  ++    +Q PLVD+ +C C VD+GLKTVAGA+++VPG+KLC+Q  I    H T+
Sbjct  5     IERTSNAQRGFRVQAPLVDSVSCYCNVDSGLKTVAGARKFVPGSKLCIQSDISSHAHKTK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACL+RVPR EH KLRLVCKRWYRLLAGNF+YS RK 
Sbjct  65    NSR-RERARVQPPLLPGLPDDLAIACLVRVPRAEHSKLRLVCKRWYRLLAGNFFYSQRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YV+KRDRDG++SWHAFDP YQLWQPLPPVP +Y+EALGFGCAVLSGCHLYL 
Sbjct  124   LGMAEEWVYVVKRDRDGRISWHAFDPTYQLWQPLPPVPGDYNEALGFGCAVLSGCHLYLI  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGLQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+ RWS I+DMSTAMVPFIGVVY GKW++KGLG+ R+V+SE Y P+ + W+ V
Sbjct  244   SAEVYDPNRKRWSFIADMSTAMVPFIGVVYDGKWFVKGLGSRREVLSEAYNPDINAWSPV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              + M+ GWRNPS +++GRLYALDC DGCK+RVYDE+TNSW + IDS++HLG+S+ALEAAA
Sbjct  304   NNRMIAGWRNPSISMDGRLYALDCPDGCKIRVYDESTNSWIRFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS+VDV K  D    T+ HLWE I GKG F+T+ TN  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISIVDV-KNPDKRVETNPHLWENIAGKGHFRTLFTNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   AGLKSHIVHCQVLQA  437



>ref|XP_010673508.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/423 (75%), Positives = 368/423 (87%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAGLKTV GA+R+VPG+K+C+QP I P  H T+    R++ R Q 
Sbjct  17    LQAPLVDSVSCYCKVDAGLKTVVGARRFVPGSKICIQPDINPRAHKTKNSR-RERTRIQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRW+RLLAGN+YYSLRK L +AEEW+YV+K
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWHRLLAGNYYYSLRKNLGMAEEWVYVMK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SWHAFDP YQ+WQPLPPVP EYSEA GFGCAVLSGCHLYLFGG+DP++GSMRR
Sbjct  136   RDRDGKISWHAFDPTYQVWQPLPPVPVEYSEARGFGCAVLSGCHLYLFGGEDPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FYSARTNKWH AP MLRRRH FG CVI+NCLYVAGGE EG+  +LRSAE+YDPN+NRW
Sbjct  196   VVFYSARTNKWHPAPSMLRRRHCFGSCVIDNCLYVAGGECEGIQRALRSAEIYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMS+ MVPFIGVVY GKWYLKGLG+ RQVMSE Y PET+TWNTV DGMV  WRNPS
Sbjct  256   SSVTDMSSGMVPFIGVVYNGKWYLKGLGSQRQVMSEAYDPETNTWNTVNDGMVASWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             TT+NG+LY++DCRDGCKLRVYDE ++SW K IDS++HLG+S+ALEAAALLPL+GKLCIIR
Sbjct  316   TTINGQLYSIDCRDGCKLRVYDEPSDSWIKFIDSKVHLGSSRALEAAALLPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV   D     ++ HLWE +GGKG F+TMVTN LSS+AGRS LKSHIVHCQV
Sbjct  376   NNMSISLVDVTSPDKL-VESNPHLWENVGGKGHFRTMVTNLLSSIAGRSGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_007205219.1| hypothetical protein PRUPE_ppa005930mg [Prunus persica]
 gb|EMJ06418.1| hypothetical protein PRUPE_ppa005930mg [Prunus persica]
Length=437

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/423 (73%), Positives = 359/423 (85%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDA LKTVAGA+++VPG+KLC+QP I P+ H  +    R+K R Q 
Sbjct  17    VQAPLVDSVSCYCKVDASLKTVAGARKFVPGSKLCIQPDINPNAHRGKNLR-REKTRIQP  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK L +AEEW+YVIK
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             R+RDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  136   RERDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLFGGKDPLKGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE +G+  +LRSAE+YDPNKNRW
Sbjct  196   VIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECDGIQRTLRSAEIYDPNKNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ISDMSTAMVPFIGVV++G W+LKGLGT R+VMSE Y PE +TW  + +GMV  WRNPS
Sbjct  256   SFISDMSTAMVPFIGVVHEGMWFLKGLGTQREVMSEAYSPEANTWTPISEGMVADWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LY L C DGCKL+VYD  T+SW+K IDS++HLG S A +AAAL+PL+GKLCIIR
Sbjct  316   ISLNGQLYGLGCPDGCKLKVYDRVTDSWNKFIDSKLHLGRSFAFKAAALVPLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVD++  D      + HLWE I GKG F+T+V+N  S++A R+ LKSHIVHCQV
Sbjct  376   NNMSISLVDISSPDKP-VEGNPHLWENIAGKGHFRTLVSNLWSTIAARTGLKSHIVHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQA  437



>ref|XP_009626412.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nicotiana 
tomentosiformis]
Length=437

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/435 (70%), Positives = 365/435 (84%), Gaps = 2/435 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             +E +  ++    +Q PLVD+ +C C VD+GLKTVAGA+++VPG+KLC+Q  I    H T+
Sbjct  5     IERSSNAQRGFRVQAPLVDSVSCYCNVDSGLKTVAGARKFVPGSKLCIQSDISSHAHKTK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R+++R Q PLLPGLPDDLAIACL+RVPR EH KLRLVCKRWYRLLAGNF+YS RK 
Sbjct  65    NSR-RERSRVQPPLLPGLPDDLAIACLVRVPRAEHSKLRLVCKRWYRLLAGNFFYSQRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YV+KRDRDG++SWHAFDP YQLWQPLPPVP +YSEALGFGCAVLSGCHLYL 
Sbjct  124   LGMAEEWVYVVKRDRDGRISWHAFDPTYQLWQPLPPVPGDYSEALGFGCAVLSGCHLYLI  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFY+ARTN+WHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPIKGSMRRVIFYNARTNRWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+ RWS I+DMSTAMVPFIGVVY GKW++KGLG+ R+V+SE Y P+ + W+ V
Sbjct  244   SAEVYDPNRKRWSFIADMSTAMVPFIGVVYDGKWFVKGLGSRREVLSEAYNPDINAWSPV  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              + M  GWRNPS +++GRL ALDC DGCKLRVYDE+TNSW + IDS++HLG+S+ALEAAA
Sbjct  304   NNRMAAGWRNPSISMDGRLLALDCPDGCKLRVYDESTNSWIRFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS+VDV K  D    T+ HLWE I GKG F+T+ TN  SS+AGR
Sbjct  364   LVPLNGKLCIIRNNMSISIVDV-KNPDKRVETNPHLWENIAGKGHFRTLFTNLWSSIAGR  422

Query  1970  SRLKSHIVHCQVLQT  2014
             + LKSHIVHCQVLQ 
Sbjct  423   AGLKSHIVHCQVLQA  437



>ref|XP_009407660.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/431 (75%), Positives = 367/431 (85%), Gaps = 7/431 (2%)
 Frame = +2

Query  728   SRMD--RVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPP  901
             SRMD  R   PPLVD++ACLCRVD G KTV G K+YVPG+KLC+QP I+ SIHP R KP 
Sbjct  9     SRMDVERRNHPPLVDSSACLCRVDGGFKTVTGGKKYVPGSKLCVQPKIRTSIHPVRSKPA  68

Query  902   RDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIA  1081
             +++NR QSPLLPGLPDDLAIACLIRVPR EH KLRLVCKRW RLLAGN++YSLR+ L IA
Sbjct  69    QERNRCQSPLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWQRLLAGNYFYSLRRSLGIA  128

Query  1082  EEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKD  1261
             EEWIYVI+RDRDG++SW AFDP YQLW PLPP+PKEYSEA GFGCAVLSGCHLYL GGKD
Sbjct  129   EEWIYVIRRDRDGRISWDAFDPRYQLWHPLPPIPKEYSEATGFGCAVLSGCHLYLLGGKD  188

Query  1262  PVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEV  1441
               KGSMRRVI+YSARTNKWHRAPDMLRRRH FG CVINNCLYVAGGE+EGVH SLRSAE 
Sbjct  189   RRKGSMRRVIYYSARTNKWHRAPDMLRRRHLFGSCVINNCLYVAGGESEGVHRSLRSAEF  248

Query  1442  YDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGM  1621
             YDPNKNRW+ ISDMSTAMVPFIGVVY+GKW+LKGLG  RQV+ + Y P+TD W  V++GM
Sbjct  249   YDPNKNRWTYISDMSTAMVPFIGVVYEGKWFLKGLGAQRQVICDAYFPDTDRWCPVFNGM  308

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             VTGWRNPS  LNG+LYALDC+DGCKLR YD +T+SWS HIDS++HLG+S+ALEAAALLPL
Sbjct  309   VTGWRNPSVCLNGQLYALDCKDGCKLRSYDASTDSWSIHIDSKLHLGSSRALEAAALLPL  368

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLK  1981
              GKLCI+RNNMSI+LVDV   D     + +  WET+ G+GQ +T VTN LS++AGR  L+
Sbjct  369   RGKLCIVRNNMSITLVDVEAKD-----SGDLRWETVAGRGQLRTFVTNLLSNIAGRGGLR  423

Query  1982  SHIVHCQVLQT  2014
             SHIVHCQVLQ 
Sbjct  424   SHIVHCQVLQA  434



>ref|XP_010534884.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Tarenaya hassleriana]
Length=436

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/423 (72%), Positives = 368/423 (87%), Gaps = 4/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VDAGLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCKVDAGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSRRERTRVQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL++GNF+YS RK L +AEEW+YV+K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLVSGNFFYSQRKLLGMAEEWVYVLK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+AFD ++QLWQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNAFDTVHQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNK RW
Sbjct  197   VVFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKTRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S +SDMSTAMVP IGVVY GKW+LKGLG+H++VMSE Y PET++W+ + DGMV GWRNP 
Sbjct  257   SFVSDMSTAMVPLIGVVYDGKWFLKGLGSHQEVMSEAYDPETNSWSPMSDGMVAGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+L+GRLYALDCRDGCKLR+YDE+T+SW+K +DS++HLG+S+++EAAAL+PL GKLCIIR
Sbjct  317   TSLDGRLYALDCRDGCKLRIYDESTDSWNKFVDSKLHLGSSRSVEAAALVPLGGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      S H+WE I GKGQ K +++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSGPDKNN--NSPHVWENIVGKGQSKGILSNIWSSIAGRA-LKSHIVHCQV  433

Query  2006  LQT  2014
             LQ 
Sbjct  434   LQA  436



>ref|XP_003524946.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoformX1 [Glycine 
max]
 ref|XP_003524947.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoformX2 [Glycine 
max]
 ref|XP_006580153.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoform X3 [Glycine 
max]
 ref|XP_006580154.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoform X4 [Glycine 
max]
Length=437

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/432 (71%), Positives = 364/432 (84%), Gaps = 3/432 (1%)
 Frame = +2

Query  719   TDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKP  898
             T   R+ RV Q PLVD+ +C C+VD+GLKTV GA+++VPG+KLC+QP I P+ H ++   
Sbjct  9     TTTQRVSRV-QAPLVDSVSCYCKVDSGLKTVVGARKFVPGSKLCIQPDINPNAHRSKNSR  67

Query  899   PRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEI  1078
              R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLR+ L +
Sbjct  68    -RERTRVQPPLLPGLPDDLAIACLIRVPRVEHSKLRLVCKRWYRLLSGNFFYSLRRSLGM  126

Query  1079  AEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGK  1258
             AEEW+YVIKRDRDG++S HAFDPIYQLWQ LPPVP EYSEALGFGCAVLSGCHLYLFGG+
Sbjct  127   AEEWVYVIKRDRDGRISLHAFDPIYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYLFGGR  186

Query  1259  DPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAE  1438
             DP+KGSMRRVIFY+ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+  +LRSAE
Sbjct  187   DPLKGSMRRVIFYNARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTLRSAE  246

Query  1439  VYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDG  1618
             VYDPN+NRWS IS+M+TAMVPFIGVV+ G W+LKGLG++R V+ E Y  ETDTW  V +G
Sbjct  247   VYDPNRNRWSFISEMTTAMVPFIGVVHNGTWFLKGLGSNRNVICESYSQETDTWTPVSNG  306

Query  1619  MVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLP  1798
             MV GWRNPS +LNG+LYALDC+DGCKL+VYD AT+SW K IDS++HLG+S AL+AAAL+P
Sbjct  307   MVNGWRNPSISLNGQLYALDCQDGCKLKVYDRATDSWKKFIDSKLHLGSSHALDAAALVP  366

Query  1799  LSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRL  1978
             L+GKLCIIRNNMSISLVDV    +    ++  LWE I GKG  +++V N  S++AGR  L
Sbjct  367   LNGKLCIIRNNMSISLVDVLS-SNRRVESNPQLWENIAGKGHVRSLVRNLWSTIAGRGSL  425

Query  1979  KSHIVHCQVLQT  2014
             KSHIVHCQVLQ 
Sbjct  426   KSHIVHCQVLQA  437



>ref|XP_007159398.1| hypothetical protein PHAVU_002G235000g [Phaseolus vulgaris]
 gb|ESW31392.1| hypothetical protein PHAVU_002G235000g [Phaseolus vulgaris]
Length=437

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/432 (72%), Positives = 366/432 (85%), Gaps = 3/432 (1%)
 Frame = +2

Query  719   TDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKP  898
             T+  R+ RV Q PLVD+ +C C+VD+GLKTVAGA+++VPG+KLC+QP I P+ H ++   
Sbjct  9     TNAQRVSRV-QAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKLCIQPDINPNAHRSKNSR  67

Query  899   PRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEI  1078
              R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLR VCKRWYRLL+GNF+YSLR+ L +
Sbjct  68    -RERTRVQPPLLPGLPDDLAIACLIRVPRVEHGKLRSVCKRWYRLLSGNFFYSLRRSLGM  126

Query  1079  AEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGK  1258
             AEEW+YVIKRDRD ++S HAFDPIYQLWQ LPPVP EYSEALGFGCAVLSGCHLYLFGGK
Sbjct  127   AEEWVYVIKRDRDKRISLHAFDPIYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYLFGGK  186

Query  1259  DPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAE  1438
             DP+KGSMRRVIFY+ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+  +LRSAE
Sbjct  187   DPLKGSMRRVIFYNARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTLRSAE  246

Query  1439  VYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDG  1618
             VYDPN+NRWS IS+M+TAMVPFIGVV+ G W+LKGLG++R V+ E Y  ETDTW  V +G
Sbjct  247   VYDPNRNRWSFISEMTTAMVPFIGVVHNGTWFLKGLGSNRNVVCESYSQETDTWTPVSNG  306

Query  1619  MVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLP  1798
             MV GWRNPS +LN +LYALDC+DGCKL+VYD AT+SW K IDSR+HLGTS+AL+AAAL+P
Sbjct  307   MVDGWRNPSISLNEQLYALDCQDGCKLKVYDRATDSWKKFIDSRLHLGTSRALDAAALVP  366

Query  1799  LSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRL  1978
             L+GKLCIIRNNMSISLVDV+   +    ++ HLWE I GKG  +++V N  S++AGR  L
Sbjct  367   LNGKLCIIRNNMSISLVDVSS-PNRRVESNPHLWENIAGKGHVRSLVRNLWSTIAGRGSL  425

Query  1979  KSHIVHCQVLQT  2014
             KSHIVHCQVLQ 
Sbjct  426   KSHIVHCQVLQA  437



>ref|XP_010932959.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Elaeis guineensis]
Length=441

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 356/422 (84%), Gaps = 1/422 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVDAGLKTV GA+++VPG KLCLQP IKP+  P  +   R++ R Q+
Sbjct  20    LQAPLVDSVSCYCRVDAGLKTVVGARKFVPGAKLCLQPDIKPN-GPRMRNSRRERCRNQA  78

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH  LRLVCKRW RLL+GN++YSLRKKL + EEW+YVIK
Sbjct  79    PLLPGLPDDLAIACLIRVPRAEHPNLRLVCKRWNRLLSGNYFYSLRKKLGMVEEWVYVIK  138

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SWHAFDPIYQLW+PLPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  139   RDRDGKISWHAFDPIYQLWKPLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  198

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKW+RAPDMLR+RHFFG CVINNCLYVAGGE EG+H +LRSAEVYDPN+NRW
Sbjct  199   VVFYNARTNKWNRAPDMLRKRHFFGSCVINNCLYVAGGECEGIHRNLRSAEVYDPNRNRW  258

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + I +M+T MVP IGVV+ GKW+LKGL +HRQV+SEVY P T+ W+ V DGMVTGWRNPS
Sbjct  259   TFIGEMNTGMVPLIGVVFDGKWFLKGLDSHRQVVSEVYVPTTNAWSPVNDGMVTGWRNPS  318

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLYA DCRDGCKLRVYD AT+SW+K +DS+ HLG S+A EAAA + L+GKLCII 
Sbjct  319   ISFNGRLYASDCRDGCKLRVYDRATDSWNKFMDSKNHLGNSRAFEAAAFVSLNGKLCIIH  378

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI++ DV+         S HLWET+ GKG  KT V N  SS+AGRS LKSHIVHCQV
Sbjct  379   NNMSITVFDVSNPGKNIETISAHLWETVAGKGHLKTFVANLWSSIAGRSGLKSHIVHCQV  438

Query  2006  LQ  2011
             LQ
Sbjct  439   LQ  440



>ref|XP_004504335.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cicer arietinum]
Length=437

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/436 (70%), Positives = 367/436 (84%), Gaps = 2/436 (0%)
 Frame = +2

Query  707   FVEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPT  886
              VE +  ++    +Q PLVD+ +C C+VD+GLKTVAGA+++VPG+K+C+QP I P+ H  
Sbjct  4     LVESSANAQRVSRVQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKICIQPDINPNAHRN  63

Query  887   RQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRK  1066
             +    R+K R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLRK
Sbjct  64    KNLR-REKTRVQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRK  122

Query  1067  KLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYL  1246
              L +AEEW+YVIKRDRDG++S HAFDPIYQ+WQ LPPVP EYSEALGFGCAVLSGCHLYL
Sbjct  123   SLGMAEEWVYVIKRDRDGRISLHAFDPIYQIWQSLPPVPGEYSEALGFGCAVLSGCHLYL  182

Query  1247  FGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSL  1426
             FGG+DP+KGSMRRVIFY+ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE +G+  +L
Sbjct  183   FGGRDPLKGSMRRVIFYNARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECKGIQRTL  242

Query  1427  RSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNT  1606
             RSAEVYDPN+NRWS IS+M+TAMVPFIGV++ G W+LKGLG++R V+ E Y  ETDTW  
Sbjct  243   RSAEVYDPNRNRWSFISEMTTAMVPFIGVIHNGAWFLKGLGSNRNVICESYSQETDTWTP  302

Query  1607  VYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAA  1786
             + +GMV GWRNPS +LNG+LYALDC+DGCKL+VYD AT+SW K IDSR+HLG+S+AL+AA
Sbjct  303   ISNGMVNGWRNPSISLNGQLYALDCQDGCKLKVYDGATDSWKKFIDSRVHLGSSRALDAA  362

Query  1787  ALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAG  1966
             AL+ L+GKLCIIRNNMSISLVDV+   +    ++ HLWE I GKG  +++V N  S++AG
Sbjct  363   ALVSLNGKLCIIRNNMSISLVDVSS-PNKRVESNPHLWENIAGKGPARSLVRNLWSTIAG  421

Query  1967  RSRLKSHIVHCQVLQT  2014
             R  LKSHIVHCQVLQ 
Sbjct  422   RGGLKSHIVHCQVLQA  437



>ref|XP_003629702.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AET04178.1| galactose oxidase/kelch repeat protein [Medicago truncatula]
Length=437

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/436 (70%), Positives = 366/436 (84%), Gaps = 2/436 (0%)
 Frame = +2

Query  707   FVEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPT  886
              VE +  S+    IQ PLVD+ +C C+VD+GLKTVAGA+++VPG+K+C+QP I P+ H  
Sbjct  4     LVESSANSQRVSRIQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKICIQPDINPNAHRN  63

Query  887   RQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRK  1066
             +    ++K R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLRK
Sbjct  64    KNSR-KEKTRVQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRK  122

Query  1067  KLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYL  1246
              L +AEEW+YVIKRDR+GK+S HAFDPIYQ+WQ LPPVP EYSEALGFGCAVLSGCHLYL
Sbjct  123   SLGMAEEWVYVIKRDREGKISLHAFDPIYQIWQSLPPVPGEYSEALGFGCAVLSGCHLYL  182

Query  1247  FGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSL  1426
             FGG+DP+KGSMRRVIFY+ARTNKWHRAPDMLR+RH FG CV+NNCLYVAGGE +G+  +L
Sbjct  183   FGGRDPLKGSMRRVIFYNARTNKWHRAPDMLRKRHLFGSCVMNNCLYVAGGECKGIQRTL  242

Query  1427  RSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNT  1606
             RSAEVYDPN+NRWS IS+M+TAMVPFIGV++ G W+LKGLG++R V+ E Y  E+DTW  
Sbjct  243   RSAEVYDPNRNRWSFISEMTTAMVPFIGVIHNGTWFLKGLGSNRNVICEAYSQESDTWTP  302

Query  1607  VYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAA  1786
             V +GMV GWRNPS +LNG LYALDC+DGCKL+VYD AT+SW K IDSR+HLG+S+AL+AA
Sbjct  303   VNNGMVVGWRNPSISLNGELYALDCQDGCKLKVYDMATDSWKKFIDSRLHLGSSRALDAA  362

Query  1787  ALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAG  1966
             AL+ L+GKLCIIRNNMSISLVDV+   +    ++ HLWE I GKG  +++V N  S++AG
Sbjct  363   ALVSLNGKLCIIRNNMSISLVDVSS-PNRRVESNPHLWENIAGKGPVRSLVRNLWSTIAG  421

Query  1967  RSRLKSHIVHCQVLQT  2014
             R  LKSHIVHCQVLQ 
Sbjct  422   RGGLKSHIVHCQVLQA  437



>ref|XP_003531234.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
 gb|KHN47962.1| F-box/kelch-repeat protein [Glycine soja]
Length=437

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/436 (69%), Positives = 365/436 (84%), Gaps = 2/436 (0%)
 Frame = +2

Query  707   FVEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPT  886
              VE +  ++    +Q PLVD+ +C C+VD+GLKTV GA+++VPG+KLC+QP I P+ H +
Sbjct  4     LVESSMNTQRVSRVQAPLVDSVSCYCKVDSGLKTVVGARKFVPGSKLCIQPDINPNAHRS  63

Query  887   RQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRK  1066
             +    R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWY LL+GNF+YSLR+
Sbjct  64    KNSR-RERTRVQPPLLPGLPDDLAIACLIRVPRVEHGKLRLVCKRWYHLLSGNFFYSLRR  122

Query  1067  KLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYL  1246
              L +AEEW+YVIKRDRDG++S HAFDPIYQLWQ LPPVP EYSEALGFGCAVLSGCHLYL
Sbjct  123   SLGMAEEWVYVIKRDRDGRISLHAFDPIYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYL  182

Query  1247  FGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSL  1426
             FGG+DP+KGSMRRVIFY+ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+  +L
Sbjct  183   FGGRDPLKGSMRRVIFYNARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTL  242

Query  1427  RSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNT  1606
             RSAEVYDPN+NRWS IS+M+TAMVPFIGVV+ G W+LKGLG++R V+ E Y  ETDTW  
Sbjct  243   RSAEVYDPNRNRWSFISEMTTAMVPFIGVVHNGTWFLKGLGSNRNVICESYSQETDTWTP  302

Query  1607  VYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAA  1786
             V +GMV GWRNPS +LNG+LYALDC+DGCKL+VYD A++SW K IDS++HLG S+AL+AA
Sbjct  303   VSNGMVNGWRNPSISLNGQLYALDCQDGCKLKVYDRASDSWKKFIDSKLHLGRSRALDAA  362

Query  1787  ALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAG  1966
             AL+PL+GKLCIIRNNMSISLVDV+   +    ++  LWE I GKG  +++V N  S++AG
Sbjct  363   ALVPLNGKLCIIRNNMSISLVDVSS-PNRRVESNPQLWENIAGKGHVRSLVRNLWSTIAG  421

Query  1967  RSRLKSHIVHCQVLQT  2014
             R  LKSHIVHCQVLQ 
Sbjct  422   RGSLKSHIVHCQVLQA  437



>gb|AFK40250.1| unknown [Lotus japonicus]
Length=437

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/436 (70%), Positives = 366/436 (84%), Gaps = 2/436 (0%)
 Frame = +2

Query  707   FVEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPT  886
              VE +   +    +Q PLVD+ +C C+VD+GLKTVAGA+++VPG+K+C+QP I P+ H  
Sbjct  4     LVESSANGQRVTRVQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKICIQPDINPNAHRN  63

Query  887   RQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRK  1066
             +    R+K + Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLRK
Sbjct  64    KNLR-REKTKVQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRK  122

Query  1067  KLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYL  1246
              L +AEEW+YVIKRDR+G++S HAFDPIYQLWQ LPPVP EYSEALGFGCAVLSGCHLYL
Sbjct  123   SLGMAEEWVYVIKRDREGRISLHAFDPIYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYL  182

Query  1247  FGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSL  1426
             FGG+DP+KGSMRRVIFY+ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE +G+  +L
Sbjct  183   FGGRDPLKGSMRRVIFYNARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECKGIQRTL  242

Query  1427  RSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNT  1606
             RSAE+YDPN+NRWS IS+MSTAMVPFIGVV+   W+LKGLGT+R V+ E Y  ETDTW  
Sbjct  243   RSAEIYDPNRNRWSFISEMSTAMVPFIGVVHNETWFLKGLGTNRNVICESYAHETDTWTP  302

Query  1607  VYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAA  1786
             V +GMV GWRNPS +LNG+LYALDC+DGCKL+VYD AT+SW + IDS++HLG+S+AL+AA
Sbjct  303   VSNGMVNGWRNPSISLNGQLYALDCQDGCKLKVYDGATDSWKRFIDSKLHLGSSRALDAA  362

Query  1787  ALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAG  1966
             AL+PL+GKLCIIRNNMSISLVDV+   +    ++ HLWE I GKG  +++V N  S++AG
Sbjct  363   ALVPLNGKLCIIRNNMSISLVDVSS-PNKRVESNPHLWENIAGKGPVRSLVRNLWSTIAG  421

Query  1967  RSRLKSHIVHCQVLQT  2014
             R  LKSHIVHCQVLQ 
Sbjct  422   RGGLKSHIVHCQVLQA  437



>ref|XP_008803430.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Phoenix 
dactylifera]
Length=440

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 361/423 (85%), Gaps = 1/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVDAGLKTV GA+++VPGTKLCLQP IKP+  P  +K  +++ R ++
Sbjct  19    VQAPLVDSVSCYCRVDAGLKTVVGARKFVPGTKLCLQPDIKPN-GPKSRKSRKERCRNEA  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH  L+LVCKRW RLL GN++YSLRKKL + EEW+YVIK
Sbjct  78    PLLPGLPDDLAIACLIRVPRAEHPNLQLVCKRWNRLLTGNYFYSLRKKLGMVEEWVYVIK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SWHAFDP++QLW+ LPPVP EYSEA GFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWHAFDPVHQLWKSLPPVPPEYSEAFGFGCAVLSGCYLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKW+RAPDMLR+RHFFG CVINNCLYVAGGE EG+H +LRSAE+YDPNKNRW
Sbjct  198   VVFYNARTNKWNRAPDMLRKRHFFGSCVINNCLYVAGGECEGIHRNLRSAEIYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + I +M+T MVP IGVV++GKW+LKGL +HRQV+SEVY P T+TW+ V DGMVTGWRNPS
Sbjct  258   TFIGEMNTGMVPLIGVVFEGKWFLKGLDSHRQVVSEVYVPTTNTWSAVNDGMVTGWRNPS  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLYA DC+DGCKLRVYD AT+SW+K +DS+ HLG S+A+EAAAL+ L+GKLCIIR
Sbjct  318   ISFNGRLYASDCKDGCKLRVYDGATDSWNKFMDSKHHLGNSRAVEAAALVSLNGKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+++D++         S H WET+ GKG  KT+V N  SS+AGRS LKSHI++CQV
Sbjct  378   NNMSITVIDISNPGKNIEIISAHAWETLAGKGHLKTLVANLWSSIAGRSGLKSHIINCQV  437

Query  2006  LQT  2014
             LQ 
Sbjct  438   LQV  440



>ref|XP_008778886.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like, partial 
[Phoenix dactylifera]
Length=417

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/417 (73%), Positives = 353/417 (85%), Gaps = 1/417 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             VD+ +C CRVDAGLKTV GA+++VPGTKLCLQP IKP+  P  +   R++ R Q+PLLPG
Sbjct  1     VDSVSCYCRVDAGLKTVVGARKFVPGTKLCLQPDIKPN-GPRMRNSRRERCRNQAPLLPG  59

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAIACLIRVPR EH  LRLVCKRW RLL+GN++YSLRKKL + EEW+YVIKRDRDG
Sbjct  60    LPDDLAIACLIRVPRAEHPNLRLVCKRWNRLLSGNYFYSLRKKLGMVEEWVYVIKRDRDG  119

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             K+SWHAFDPIYQLW+PLPPVP EYSEALGFGCAVLSGC+LYLFGGKD ++GSMRRV+FY+
Sbjct  120   KISWHAFDPIYQLWKPLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDQLRGSMRRVVFYN  179

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
             ARTNKW+RAPDMLR+RHFFG CVINNCLYVAGGE EG+H +LRSAEVYDPNKNRW+ I +
Sbjct  180   ARTNKWNRAPDMLRKRHFFGSCVINNCLYVAGGECEGIHRNLRSAEVYDPNKNRWTFIGE  239

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             M+T MVP IGVV+ G W+LKGL +HRQV+SEVY P T+TW+ V DGMVTGWRNPS + NG
Sbjct  240   MNTGMVPLIGVVFDGNWFLKGLDSHRQVVSEVYVPTTNTWSPVNDGMVTGWRNPSISFNG  299

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
             RLYA DCRDGCKLRVYD AT+SW+K +DS+ HLG S+A EAAA + L+GKLCII NNMSI
Sbjct  300   RLYASDCRDGCKLRVYDGATDSWNKFMDSKHHLGNSRAFEAAAFVSLNGKLCIIHNNMSI  359

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQ  2011
             +++DV+         S HLWET+ GKG  KT V N  SS+AGRS LKSHIVHCQVLQ
Sbjct  360   TVIDVSNPGKNIETISAHLWETVAGKGHLKTFVANLWSSIAGRSGLKSHIVHCQVLQ  416



>ref|XP_002894497.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70756.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=434

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/423 (72%), Positives = 359/423 (85%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDPI QLWQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPISQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE+T+SW+K +DS+ HLG+SK+LEAAAL+PL  KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGSSKSLEAAALVPLHNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  LWE I  KGQ K++++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNNPRLWENIAVKGQSKSILSNIWSSIAGRA-LKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>ref|NP_564684.1| Galactose oxidase/kelch repeat superfamily protein [Arabidopsis 
thaliana]
 sp|Q93W93.1|FBK22_ARATH RecName: Full=F-box/kelch-repeat protein At1g55270 [Arabidopsis 
thaliana]
 gb|AAK43953.1|AF370138_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93746.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33217.1| Galactose oxidase/kelch repeat superfamily protein [Arabidopsis 
thaliana]
Length=434

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/423 (72%), Positives = 358/423 (85%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDPI QLWQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPISQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE+T+SW+K +DS+ HLG SK+LEAAAL+PL  KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGNSKSLEAAALVPLHNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  LWE I  KGQ K++++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNNPRLWENIAVKGQSKSILSNIWSSIAGRA-LKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>emb|CDY26117.1| BnaC06g10790D [Brassica napus]
Length=435

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 358/423 (85%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+ Q  QPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWNTFDPVSQHPQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PET++W  V DGMVTGWRNP 
Sbjct  258   SFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPETNSWRPVSDGMVTGWRNPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE T+SW+K +DS++HLG S+ALEAAAL+PL+ KLCIIR
Sbjct  318   TSLNGRLYGLDCRDGCKLRVFDETTDSWNKFMDSKVHLGNSRALEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDVA  D      +  +WE I  KGQ K++++N  SS+AGR+ +KSHIVHCQV
Sbjct  378   NNMSMSLVDVANPD----KNNPRVWENIAVKGQSKSILSNIWSSIAGRA-VKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>emb|CDY08233.1| BnaA05g13860D [Brassica napus]
Length=435

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 357/423 (84%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+ Q  QPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWNTFDPVSQHPQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PET++W  V DGMVTGWRNP 
Sbjct  258   SFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPETNSWRPVSDGMVTGWRNPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE T+SW+K +DSR+HLG S+ALEAAAL+PL+ KLCIIR
Sbjct  318   TSLNGRLYGLDCRDGCKLRVFDETTDSWTKFMDSRVHLGNSRALEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV   D      +  +WE I  KGQ K++++N  SS+AGR+ +KSHIVHCQV
Sbjct  378   NNMSMSLVDVTNPD----KNNPRVWENIAVKGQSKSILSNIWSSIAGRA-VKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_006392663.1| hypothetical protein EUTSA_v10011496mg [Eutrema salsugineum]
 gb|ESQ29949.1| hypothetical protein EUTSA_v10011496mg [Eutrema salsugineum]
Length=434

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 360/423 (85%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+  L QPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPVSHLGQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VVFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PET++W+ V DGMVTGWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPETNSWSPVSDGMVTGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE+T+SW+K +DS+ HLG SK+LEAAAL+PL+ KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGNSKSLEAAALVPLNNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  LWE I  KGQ K++++N  SS+AGR+ +KSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNNTRLWEHIAVKGQSKSILSNIWSSIAGRA-VKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>emb|CDY10574.1| BnaC03g70400D [Brassica napus]
Length=435

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 360/423 (85%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR +H KLRLVCKRWYRL +GNF+YS RK L+++EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRSDHRKLRLVCKRWYRLASGNFFYSQRKLLKMSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+ Q  QPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWNTFDPVSQYPQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PE+++W+ V DGMVTGWRNP 
Sbjct  258   SFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPESNSWSPVSDGMVTGWRNPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE+T+SW+K +DS++HLG SKALEAAAL+PL+ KLCIIR
Sbjct  318   TSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKVHLGNSKALEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  +WE I  KGQ K +++N  SS+AGR+ +KSHIVHCQV
Sbjct  378   NNMSMSLVDVSNPD----KNNSRVWENIAVKGQSKGILSNIWSSIAGRA-VKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>gb|EPS58278.1| hypothetical protein M569_16536 [Genlisea aurea]
Length=437

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/424 (71%), Positives = 354/424 (83%), Gaps = 4/424 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C C+VD+GLKTV GA ++VPG+KLC+QP I P  H ++          Q 
Sbjct  17    VQAPLVDSVSCYCKVDSGLKTVVGATKFVPGSKLCIQPDINPRAHKSKNSRRERIRVQQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR EH KLRLVCKRW++LL+GNF+YSLRK L +AEEW+YVIK
Sbjct  77    PLLPGLPDDLAIACLIRVPRFEHNKLRLVCKRWFKLLSGNFFYSLRKSLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDG++SWHAFD IYQ+WQPLPPVP EYS ALGFGCAVLSGCHLYLFGGKDP+KGSMRR
Sbjct  137   RDRDGQISWHAFDLIYQMWQPLPPVPVEYSGALGFGCAVLSGCHLYLFGGKDPLKGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             +IFY+ARTNKWHRAPDMLRRRHFFG CV+NNCLYVAGGE EG+  +LRSAEV+DPN+NRW
Sbjct  197   MIFYNARTNKWHRAPDMLRRRHFFGCCVVNNCLYVAGGECEGIQRTLRSAEVFDPNRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S IS+MSTAMVPFIGVVY GKW+LKGLGTHR+V+SE Y PET+ W+ V +GMV+GWRNPS
Sbjct  257   SFISEMSTAMVPFIGVVYDGKWFLKGLGTHREVLSEAYAPETNVWSRVNNGMVSGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG+LYALDCRDGCKLR+YDE+T+SW + +DS++H+G S+A EAA L+ L+GKLCIIR
Sbjct  317   VSLNGKLYALDCRDGCKLRMYDESTDSWIRFMDSKLHMGNSRAFEAAGLVALNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFK-TMVTNFLSSLAGRSRLKSHIVHCQ  2002
             NNMSIS+VDV+  D         +WE  GGK   +  +  N  SS+AGRS LKSHIVHCQ
Sbjct  377   NNMSISVVDVSNPDRRNPGG---VWENFGGKSHLRNNIFANLWSSIAGRSGLKSHIVHCQ  433

Query  2003  VLQT  2014
             VLQ 
Sbjct  434   VLQA  437



>ref|XP_007159399.1| hypothetical protein PHAVU_002G235000g [Phaseolus vulgaris]
 gb|ESW31393.1| hypothetical protein PHAVU_002G235000g [Phaseolus vulgaris]
Length=429

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/418 (72%), Positives = 357/418 (85%), Gaps = 2/418 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             VD+ +C C+VD+GLKTVAGA+++VPG+KLC+QP I P+ H ++    R++ R Q PLLPG
Sbjct  14    VDSVSCYCKVDSGLKTVAGARKFVPGSKLCIQPDINPNAHRSKNSR-RERTRVQPPLLPG  72

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAIACLIRVPR+EH KLR VCKRWYRLL+GNF+YSLR+ L +AEEW+YVIKRDRD 
Sbjct  73    LPDDLAIACLIRVPRVEHGKLRSVCKRWYRLLSGNFFYSLRRSLGMAEEWVYVIKRDRDK  132

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             ++S HAFDPIYQLWQ LPPVP EYSEALGFGCAVLSGCHLYLFGGKDP+KGSMRRVIFY+
Sbjct  133   RISLHAFDPIYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYN  192

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
             ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRWS IS+
Sbjct  193   ARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRWSFISE  252

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             M+TAMVPFIGVV+ G W+LKGLG++R V+ E Y  ETDTW  V +GMV GWRNPS +LN 
Sbjct  253   MTTAMVPFIGVVHNGTWFLKGLGSNRNVVCESYSQETDTWTPVSNGMVDGWRNPSISLNE  312

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
             +LYALDC+DGCKL+VYD AT+SW K IDSR+HLGTS+AL+AAAL+PL+GKLCIIRNNMSI
Sbjct  313   QLYALDCQDGCKLKVYDRATDSWKKFIDSRLHLGTSRALDAAALVPLNGKLCIIRNNMSI  372

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             SLVDV+   +    ++ HLWE I GKG  +++V N  S++AGR  LKSHIVHCQVLQ 
Sbjct  373   SLVDVSS-PNRRVESNPHLWENIAGKGHVRSLVRNLWSTIAGRGSLKSHIVHCQVLQA  429



>ref|XP_009103742.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Brassica 
rapa]
Length=435

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 357/423 (84%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+ Q  QPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWNTFDPVSQHPQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PET++W  V DGMVTGWRNP 
Sbjct  258   SFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPETNSWRPVSDGMVTGWRNPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE T+SW+K +DS++HLG S+ALEAAAL+PL+ KLCIIR
Sbjct  318   TSLNGRLYGLDCRDGCKLRVFDETTDSWNKFMDSKVHLGNSRALEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV   D      +  +WE I  KGQ K++++N  SS+AGR+ +KSHIVHCQV
Sbjct  378   NNMSMSLVDVTNPD----KNNPRVWENIAVKGQSKSILSNIWSSIAGRA-VKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_010462371.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Camelina 
sativa]
Length=434

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 356/423 (84%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERARIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP  Q+WQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPSSQIWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV+GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVSGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRVYDE  +SW+K +DS++HLG SK+LEAAAL+PL+ KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVYDETADSWNKFMDSKVHLGNSKSLEAAALVPLNNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D         LWE I  KGQ K +++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNDPRLWENIAVKGQSKNILSNIWSSIAGRA-LKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>ref|XP_010480054.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Camelina sativa]
Length=434

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 356/423 (84%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP  Q+WQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPSSQIWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV+GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVSGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRVYDE  +SW+K +DS++HLG SK+LEAAAL+PL+ KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVYDETADSWNKFMDSKVHLGNSKSLEAAALVPLNNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D         +WE I  KGQ K +++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNDPRVWENIAVKGQSKNILSNIWSSIAGRA-LKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>ref|XP_010501139.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Camelina 
sativa]
Length=434

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 355/423 (84%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP  Q+WQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPSSQIWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV+GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVSGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLR YDE  +SW+K +DS++HLG SK+LEAAAL+PL+ KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRAYDETADSWNKFMDSKVHLGNSKSLEAAALVPLNNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D         LWE I  KGQ K +++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNDPRLWENIAVKGQSKNILSNIWSSIAGRA-LKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>emb|CDY02451.1| BnaA08g00580D [Brassica napus]
Length=435

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 358/423 (85%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR +H KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRSDHRKLRLVCKRWYRLASGNFFYSQRKLLRMSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+ Q  QPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWNTFDPVSQHPQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PE+++W+ V DGMVTGWRNP 
Sbjct  258   SFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPESNSWSPVSDGMVTGWRNPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE T+SW+K +DS++HLG SKALEAAAL+PL+ KLCIIR
Sbjct  318   TSLNGRLYGLDCRDGCKLRVFDETTDSWNKFMDSKVHLGNSKALEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  +WE I  KGQ K +++N  SS+AGR+ +KSHIVHCQV
Sbjct  378   NNMSMSLVDVSNPD----KNNPRVWENIAVKGQSKGILSNIWSSIAGRA-VKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_009106890.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Brassica rapa]
Length=435

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/423 (70%), Positives = 357/423 (84%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR +H KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRSDHRKLRLVCKRWYRLASGNFFYSQRKLLRMSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP+ Q  QPLPPVP+EYSEA+GFGC VLSGCHLYLFGGKDP++GSMRR
Sbjct  138   RDRDGKISWNTFDPVSQHPQPLPPVPREYSEAVGFGCGVLSGCHLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DMSTAMVP IGVVY  KW+LKGLG+H+QVMSE Y PE+++W+ V DGMVTGWRNP 
Sbjct  258   SFVADMSTAMVPLIGVVYDKKWFLKGLGSHQQVMSEAYDPESNSWSPVSDGMVTGWRNPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE T+SW+K +DS++HLG SKALEAAAL+PL+ KLCIIR
Sbjct  318   TSLNGRLYGLDCRDGCKLRVFDETTDSWNKFMDSKVHLGNSKALEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  +WE I  KGQ K +++N  SS+AGR+ +KSHIVHCQV
Sbjct  378   NNMSMSLVDVSNPD----KNNPRVWENIAVKGQSKGILSNIWSSIAGRA-VKSHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_010032898.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Eucalyptus grandis]
 gb|KCW52391.1| hypothetical protein EUGRSUZ_J01801 [Eucalyptus grandis]
Length=438

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/420 (71%), Positives = 355/420 (85%), Gaps = 2/420 (0%)
 Frame = +2

Query  755   PLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLL  934
             PLVD+ +C CRVD+ LKTV GA+++VPG+K+C+QP I P+ H T+    R++ R Q PLL
Sbjct  21    PLVDSVSCYCRVDSSLKTVVGARKFVPGSKICIQPDINPNAHRTKNSR-RERTRVQPPLL  79

Query  935   PGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDR  1114
             PGLPDDLAI CLIRVPRIEH KLR VC+RW  ++  +++Y+LRK L +AEEW+YV+KRDR
Sbjct  80    PGLPDDLAILCLIRVPRIEHIKLRHVCQRWKNVVRSSYFYNLRKSLGLAEEWVYVMKRDR  139

Query  1115  DGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIF  1294
             DG++SWHAFDP YQLWQPLPPVP EYSEA+GFGCAVLSG  LYLFGGKDP++GSMRRV+F
Sbjct  140   DGRISWHAFDPTYQLWQPLPPVPSEYSEAVGFGCAVLSGHRLYLFGGKDPLRGSMRRVVF  199

Query  1295  YSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLI  1474
             Y+A TN+W +AP+MLR+RHFFGFCVINNCLYVAGGE EG   +LRS EV+DPNK RWS I
Sbjct  200   YNAWTNRWQKAPEMLRKRHFFGFCVINNCLYVAGGECEGTQRTLRSGEVFDPNKRRWSPI  259

Query  1475  SDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTL  1654
             +DMSTAMVPFIGVVY GKW+LKGLG+H++VMSE Y PET+TW  V DGM+ GWRNPS +L
Sbjct  260   TDMSTAMVPFIGVVYDGKWFLKGLGSHQEVMSEAYVPETNTWTAVSDGMIAGWRNPSISL  319

Query  1655  NGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNM  1834
             NG+LYALDCRDGCKLRVYD  T+SWS+ IDS++HLG+S+ALEAAAL+PL+GKLCIIRNNM
Sbjct  320   NGQLYALDCRDGCKLRVYDRDTDSWSRFIDSKLHLGSSRALEAAALVPLNGKLCIIRNNM  379

Query  1835  SISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             SISLVDV+   D    T+  LWE I  KG F+T+VTN  SS+AGRS LKSHIVHCQVLQ 
Sbjct  380   SISLVDVSS-PDKHVETNPQLWENIATKGHFRTLVTNLWSSIAGRSGLKSHIVHCQVLQA  438



>ref|XP_006307563.1| hypothetical protein CARUB_v10009185mg [Capsella rubella]
 gb|EOA40461.1| hypothetical protein CARUB_v10009185mg [Capsella rubella]
Length=434

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 355/423 (84%), Gaps = 6/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLR VCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRQVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDP  Q+WQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPSSQIWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE  +SW+K +DS++HLG SK+LEAAAL+PL+ KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVFDETADSWNKFMDSKVHLGNSKSLEAAALVPLNNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV+  D      +  LWE I  KGQ K +++N  SS+AGR+ LKSHIVHCQV
Sbjct  377   NNMSMSLVDVSNPD----KNNPRLWENIAVKGQSKNILSNIWSSIAGRA-LKSHIVHCQV  431

Query  2006  LQT  2014
             LQ 
Sbjct  432   LQA  434



>ref|XP_009394427.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/428 (71%), Positives = 354/428 (83%), Gaps = 3/428 (1%)
 Frame = +2

Query  737   DRVI--QPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDK  910
             DRV+  Q PLVD+ +C C+VDAGLKTVAGA+++VPG KLCLQP I P   P  +   R++
Sbjct  14    DRVVRVQAPLVDSVSCYCKVDAGLKTVAGARKFVPGAKLCLQPEIVPH-GPRIRNSRRER  72

Query  911   NRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             +RTQ+PLLPGLPDDLAIACLIRVPR+EH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW
Sbjct  73    SRTQAPLLPGLPDDLAIACLIRVPRVEHLNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEW  132

Query  1091  IYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVK  1270
             +YVIKR RDGK+SW+AFDP +QLW+PLPPVP +YSEALGFGCAVLSGC+LYLFGGKDP K
Sbjct  133   VYVIKRARDGKISWNAFDPNHQLWRPLPPVPADYSEALGFGCAVLSGCYLYLFGGKDPSK  192

Query  1271  GSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDP  1450
             GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CV+NNCLYVAGGE EG   +LRSAEVYDP
Sbjct  193   GSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVVNNCLYVAGGECEGNQRTLRSAEVYDP  252

Query  1451  NKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTG  1630
             NKNRW+ I++MST MVP IGVVY+G W+LKGL +  Q +SEVY P T+TW+TV  G+VTG
Sbjct  253   NKNRWTSIAEMSTGMVPLIGVVYEGNWFLKGLDSDGQDVSEVYAPTTNTWSTVSGGIVTG  312

Query  1631  WRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGK  1810
              RNPS +LNGRLYA DCRDGCKLRVY+ AT+SW+K +DS  HLG SKA EAA+ + L+GK
Sbjct  313   CRNPSISLNGRLYASDCRDGCKLRVYEGATDSWNKFMDSEHHLGNSKAFEAASFVSLNGK  372

Query  1811  LCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHI  1990
             L IIRNNMSISL+DV     +    S  +WE I GKGQ K  V++  SSLAGRS LK HI
Sbjct  373   LGIIRNNMSISLIDVTNPVSSIETNSARVWEAIAGKGQLKNFVSSLWSSLAGRSWLKDHI  432

Query  1991  VHCQVLQT  2014
             VHCQVLQ 
Sbjct  433   VHCQVLQA  440



>emb|CBI16496.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/435 (69%), Positives = 353/435 (81%), Gaps = 27/435 (6%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
             VE +  ++    +Q PLVD+ +C C+VD+GLKTVAGA+++VPG+KLC+QP I P  H ++
Sbjct  5     VEQSPNAQRGFRVQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKLCIQPDINPHAHKSK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRW+RLL+GNF+YSLRK 
Sbjct  65    NSR-RERTRFQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWHRLLSGNFFYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYSEALGFGCAVLSGC+LYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPVPVEYSEALGFGCAVLSGCNLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+K S+RRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPMKRSLRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAEVYDPN+NRWS ISDMSTAMVPFIGV+Y GKW+LKGLG+HR+VMSE Y PET+TW  +
Sbjct  244   SAEVYDPNRNRWSFISDMSTAMVPFIGVIYNGKWFLKGLGSHREVMSEAYIPETNTWTPI  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DGM                         LRVYD  T+SW+K IDS++HLG+S+ALEAAA
Sbjct  304   SDGM-------------------------LRVYDSDTDSWNKFIDSKLHLGSSRALEAAA  338

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             L+PL+GKLCIIRNNMSIS+VDV+   D    ++ HLWE I GKG F+T+VTN  SS+AGR
Sbjct  339   LVPLNGKLCIIRNNMSISIVDVSS-PDKHVESNPHLWENIAGKGHFRTLVTNLWSSIAGR  397

Query  1970  SRLKSHIVHCQVLQT  2014
             + L+SHIVHCQVLQ 
Sbjct  398   NSLRSHIVHCQVLQA  412



>ref|XP_009411264.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=438

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 352/423 (83%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVDAGLKTV GA+++VPG KLCLQP I P+  P  +   R+++R Q+
Sbjct  18    VQAPLVDSVSCYCRVDAGLKTVVGARKFVPGAKLCLQPEIIPN-GPRLRNSRRERSRNQA  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPRIEH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW+YVIK
Sbjct  77    PLLPGLPDDLAIACLIRVPRIEHQNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR GK+SWHAFDP ++LW+PLPPVP +YSEA GFGCAVLSGC+LYLFGGKDP KG MRR
Sbjct  137   RDR-GKISWHAFDPNHRLWRPLPPVPADYSEAFGFGCAVLSGCYLYLFGGKDPSKGPMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG   +LRSAE+YDPN+NRW
Sbjct  196   VVFYNARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGNQRTLRSAELYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
               I++MS  MVPFIGVVY+GKW+LKG+ +  QV+SEVY P T+TW+TV  G+VTGWRNPS
Sbjct  256   ISIAEMSIGMVPFIGVVYEGKWFLKGIDSRHQVVSEVYAPTTNTWSTVGGGIVTGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              ++NGRLYA DCRDGCKLRVY+ AT+SW+K +DS+ HLG SKA EAA+ +PL+GKL IIR
Sbjct  316   ISMNGRLYASDCRDGCKLRVYERATDSWNKFMDSKHHLGNSKAFEAASFVPLNGKLGIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV    ++    S H+WE I GK Q K+ V N  SS+AGRS LK HIVHCQV
Sbjct  376   NNMSISLVDVTNPVNSIETNSSHVWEAISGKNQLKSFVANLWSSIAGRSGLKGHIVHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQA  438



>ref|XP_004983160.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Setaria 
italica]
Length=437

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/423 (67%), Positives = 358/423 (85%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +K +   +R    +++ RTQ+
Sbjct  17    VRAPLVESVSCYCRLDTGLKTVVDARKFVPGAKMCMQPEVKQTKRKSRGSR-KERCRTQA  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH  LR+VCKRW RLL+GN++YSLRKK+ +AEEW+YV K
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHPNLRMVCKRWNRLLSGNYFYSLRKKIGVAEEWVYVFK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SWHAFDP++QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  136   RDREGKISWHAFDPLHQLWKSLPPVPSEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +L+SAEVYDPN+NRW
Sbjct  196   VVFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLQSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + I++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++ W+T+ D MVTGWRNPS
Sbjct  256   ACITEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNAWSTIDDEMVTGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLY++DCRDGCKLRVYD++T +W++ +DS+ HLG+S+A EAAAL+ L+GKLCIIR
Sbjct  316   ISFNGRLYSVDCRDGCKLRVYDDSTGTWTRFMDSKHHLGSSRAFEAAALVSLNGKLCIIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVDV+    +    S  +WET+  KGQ ++ V N  S++AGR+ LKSHI+HCQV
Sbjct  376   NNMSITLVDVSDPTMSVETDSARMWETVARKGQHRSFVANLWSTIAGRN-LKSHIIHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQV  437



>ref|XP_002464634.1| hypothetical protein SORBIDRAFT_01g022240 [Sorghum bicolor]
 gb|EER91632.1| hypothetical protein SORBIDRAFT_01g022240 [Sorghum bicolor]
Length=437

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/423 (66%), Positives = 358/423 (85%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +K +   +R    +++++TQ+
Sbjct  17    VRAPLVESVSCYCRLDTGLKTVVDARKFVPGAKMCMQPEVKQNKRKSRGSR-KERSKTQA  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH  LR+VC+RW RLL+GN++YSLRKK+ +AEEW+YV K
Sbjct  76    PLLPGLPDDLAIACLIRVPRVEHPNLRMVCRRWNRLLSGNYFYSLRKKIGVAEEWVYVFK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SWHAFDP++QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  136   RDREGKISWHAFDPLHQLWKSLPPVPHEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDM+R+RHFFG CVINNCLYVAGGE EG+  +L+SAEVYDPN+NRW
Sbjct  196   VVFYNARTNKWHRAPDMMRKRHFFGSCVINNCLYVAGGECEGIQRTLQSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + I++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++TW+ + D MVTGWRNPS
Sbjct  256   ACITEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNTWSVIDDEMVTGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLY+ DCRDGCKLRVYDE T +W++ +DS+ HLG+S+A EAAAL+ L+GKLC+IR
Sbjct  316   ISFNGRLYSADCRDGCKLRVYDENTGTWTRFMDSKHHLGSSRAFEAAALVSLNGKLCVIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVDV+    +   +S  +WET+  KGQ ++ V N  SS+AGR+ LKSHI+HCQV
Sbjct  376   NNMSITLVDVSDPTMSVETSSARMWETVARKGQHRSFVANLWSSIAGRN-LKSHIIHCQV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQV  437



>ref|XP_002978427.1| hypothetical protein SELMODRAFT_443893 [Selaginella moellendorffii]
 gb|EFJ20413.1| hypothetical protein SELMODRAFT_443893 [Selaginella moellendorffii]
Length=435

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/432 (73%), Positives = 354/432 (82%), Gaps = 6/432 (1%)
 Frame = +2

Query  728   SRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRD  907
             S M R I     ++  C C VDAGL TV  A+R+VPGT+ C+QP +KP+I   + +    
Sbjct  7     SAMHRGIHSMQAESALCYCGVDAGL-TVTNARRFVPGTRHCIQPDVKPTIVIPKARTRHS  65

Query  908   K-NRTQSP--LLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEI  1078
             + +RT+ P  L+PGLPDDLAIACL+RVPRI H  LR+VCKRWYRLLAGNF+YS RK L +
Sbjct  66    RGDRTKIPCQLIPGLPDDLAIACLVRVPRIHHRTLRVVCKRWYRLLAGNFFYSQRKALGM  125

Query  1079  AEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGK  1258
             AEEWIYVIKRDRDG +SWHAFDP YQ WQPLPPVP EY EALGFGCAVLSGCHLYLFGGK
Sbjct  126   AEEWIYVIKRDRDGHISWHAFDPRYQQWQPLPPVPLEYCEALGFGCAVLSGCHLYLFGGK  185

Query  1259  DPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAE  1438
             DP KGSMRRV++YSARTNKWHRAPDM RRRHFFG CVINNCLYVAGGE EGV  SLRSAE
Sbjct  186   DPAKGSMRRVVYYSARTNKWHRAPDMNRRRHFFGCCVINNCLYVAGGECEGVQRSLRSAE  245

Query  1439  VYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDG  1618
             VYDPNKNRWS I+DMSTAMVPFIGVVY G+W+LKGLG+HRQVMSEVY P TD W+ V DG
Sbjct  246   VYDPNKNRWSYIADMSTAMVPFIGVVYHGRWFLKGLGSHRQVMSEVYVPATDNWSPVLDG  305

Query  1619  MVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLP  1798
             MV+GWRNPS   NG+LYALDC DGCKLRVYD A +SW + +DSR HLG S+ALEAAALLP
Sbjct  306   MVSGWRNPSAIFNGQLYALDCPDGCKLRVYDGAADSWHRSVDSRTHLGNSRALEAAALLP  365

Query  1799  LSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRL  1978
             L G+LCIIRNNMSI++VDVA  +D  AA    LW+TI GKG FKT VTN  S++AGR+RL
Sbjct  366   LGGRLCIIRNNMSITMVDVANSED--AARRGALWDTIAGKGLFKTFVTNLWSNIAGRNRL  423

Query  1979  KSHIVHCQVLQT  2014
             KSHIVHCQVLQ 
Sbjct  424   KSHIVHCQVLQA  435



>ref|XP_001753278.1| predicted protein [Physcomitrella patens]
 gb|EDQ81907.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/431 (71%), Positives = 350/431 (81%), Gaps = 9/431 (2%)
 Frame = +2

Query  734   MDRVIQP-PLVDTTACLCR-VDAGLKTVAGAKRYVPGTKL--CLQPAIKPSIHPTRQKPP  901
             M R I P P V+T AC C  VDAGL    G +R+VPG  +  C++P IKP+I+   +KP 
Sbjct  1     MHRAIHPVPQVETAACYCGGVDAGLSV--GGRRFVPGRTVGHCVRPDIKPTIN-LPKKPA  57

Query  902   RDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIA  1081
             R + R    LLPGLPDDLAIACLIRVPR+ H KLR+VCKRW RLLAGNF+YSLR++L +A
Sbjct  58    RGERRNPPELLPGLPDDLAIACLIRVPRLHHRKLRVVCKRWDRLLAGNFFYSLRRRLGMA  117

Query  1082  EEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKD  1261
             EEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGGKD
Sbjct  118   EEWVYVIKRDRDGRISWHAFDPRYQLWQPLPPVPVEYSEALGFGCAVLSGCHLYLFGGKD  177

Query  1262  PVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEV  1441
             P+KGSMRRV++YSARTNKWHR+  M R+RHFFGFCVINNCLYVAGGE EG   SLRSAE+
Sbjct  178   PLKGSMRRVVYYSARTNKWHRSQPMQRKRHFFGFCVINNCLYVAGGECEGSQRSLRSAEM  237

Query  1442  YDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGM  1621
             YDPN+NRW  ISDMST MVPFIGVVY G+W+LKG G+HRQVMSEVY P T+ W  V DGM
Sbjct  238   YDPNRNRWYSISDMSTTMVPFIGVVYGGRWFLKGSGSHRQVMSEVYVPATNHWTPVMDGM  297

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             V GWRNP   L+G LYALDCRDGCKLR+YD  T++WS+ +DSR HLG S+A+EA AL+PL
Sbjct  298   VAGWRNPCVELHGNLYALDCRDGCKLRMYDRDTDAWSRSVDSRFHLGGSRAMEAVALVPL  357

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLK  1981
              GKLCIIRNNMSI+LVDVA  D         +WET+ GKGQFK+ VTN  S+LAGR+R+K
Sbjct  358   GGKLCIIRNNMSITLVDVASADI--PEKQGQIWETLSGKGQFKSFVTNLWSNLAGRNRIK  415

Query  1982  SHIVHCQVLQT  2014
             SHIVHCQVLQ 
Sbjct  416   SHIVHCQVLQA  426



>ref|XP_002970270.1| hypothetical protein SELMODRAFT_411144 [Selaginella moellendorffii]
 gb|EFJ28400.1| hypothetical protein SELMODRAFT_411144 [Selaginella moellendorffii]
Length=435

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/432 (73%), Positives = 354/432 (82%), Gaps = 6/432 (1%)
 Frame = +2

Query  728   SRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRD  907
             S M R I     ++  C C VDAGL TV  A+R+VPGT+ C+QP +KP+I   + +    
Sbjct  7     SAMHRGIHSMQAESALCYCGVDAGL-TVTNARRFVPGTRHCIQPDVKPTIVIPKARTRHS  65

Query  908   K-NRTQSP--LLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEI  1078
             + +RT+ P  L+PGLPDDLAIACL+RVPRI H  LR+VCKRWYRLLAGNF+YS RK L +
Sbjct  66    RGDRTKIPCQLIPGLPDDLAIACLVRVPRIHHRTLRVVCKRWYRLLAGNFFYSQRKALGM  125

Query  1079  AEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGK  1258
             AEEWIYVIKRDRDG +SWHAFDP YQ WQPLPPVP EY EALGFGCAVLSGCHLYLFGGK
Sbjct  126   AEEWIYVIKRDRDGHISWHAFDPRYQQWQPLPPVPLEYCEALGFGCAVLSGCHLYLFGGK  185

Query  1259  DPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAE  1438
             DP KGSMRRV++YSARTNKWHRAPDM RRRHFFG CVINNCLYVAGGE EGV  SLRSAE
Sbjct  186   DPAKGSMRRVVYYSARTNKWHRAPDMNRRRHFFGCCVINNCLYVAGGECEGVQRSLRSAE  245

Query  1439  VYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDG  1618
             VYDPNKNRWS I+DMSTAMVPFIGVVY G+W+LKGLG+HRQVMSEVY P TD W+ V DG
Sbjct  246   VYDPNKNRWSYIADMSTAMVPFIGVVYHGRWFLKGLGSHRQVMSEVYVPATDNWSPVLDG  305

Query  1619  MVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLP  1798
             MV+GWRNPS   NG+LYALDC DGCKLRVYD A +SW + +DSR HLG S+ALEAAALLP
Sbjct  306   MVSGWRNPSAIFNGQLYALDCPDGCKLRVYDGAADSWHRSVDSRTHLGNSRALEAAALLP  365

Query  1799  LSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRL  1978
             L G+LCIIRNNMSI++VDVA  +D  AA    LW+TI GKG FKT VTN  S++AGR+RL
Sbjct  366   LGGRLCIIRNNMSITMVDVANSED--AARRGALWDTIAGKGLFKTFVTNLWSNIAGRNRL  423

Query  1979  KSHIVHCQVLQT  2014
             KSHIVHCQVLQ 
Sbjct  424   KSHIVHCQVLQA  435



>ref|XP_008384436.1| PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-repeat protein At1g55270 
[Malus domestica]
Length=416

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/383 (75%), Positives = 333/383 (87%), Gaps = 1/383 (0%)
 Frame = +2

Query  710   VEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTR  889
              E +  ++    +Q PLVD+ +C C+VDAGLKTVAGA+++VPG+K+C+QP I P+ H  +
Sbjct  5     TEQSSNAQRGFRVQAPLVDSVSCYCKVDAGLKTVAGARKFVPGSKICIQPDINPNAHRGK  64

Query  890   QKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKK  1069
                 R++ R Q PLLPGLPDDLAIACLIRVPR+EH KLRLVCKRWYRLLAGNF+YSLRK 
Sbjct  65    NLR-RERTRIQPPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKS  123

Query  1070  LEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLF  1249
             L +AEEW+YVIKRDRDG++SWHAFDP YQLWQPLPPVP EYS ALGFGCAVLSGCHLYLF
Sbjct  124   LGMAEEWVYVIKRDRDGRISWHAFDPTYQLWQPLPPVPGEYSAALGFGCAVLSGCHLYLF  183

Query  1250  GGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLR  1429
             GGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LR
Sbjct  184   GGKDPLKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLR  243

Query  1430  SAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV  1609
             SAE+YDPNKNRWS ISDMSTAMVPFIGVV+ G W+LKGLG+HR+VMSE Y PE +TW  +
Sbjct  244   SAEIYDPNKNRWSFISDMSTAMVPFIGVVHDGMWFLKGLGSHREVMSEAYTPEANTWTPI  303

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              DG V GWRNPS +LNG+LYAL+CRDGCKLRVYD  ++SW K IDS++HLG+S+ALEAAA
Sbjct  304   SDGXVAGWRNPSISLNGQLYALECRDGCKLRVYDRVSDSWIKFIDSKLHLGSSRALEAAA  363

Query  1790  LLPLSGKLCIIRNNMSISLVDVA  1858
             L+PL+GKLCI RNNMSISLVDV+
Sbjct  364   LVPLNGKLCIXRNNMSISLVDVS  386



>gb|EEC66927.1| hypothetical protein OsI_33535 [Oryza sativa Indica Group]
Length=441

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/423 (66%), Positives = 355/423 (84%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +KP+   +R    ++++RTQ+
Sbjct  21    VRAPLVESVSCYCRLDTGLKTVVDARKFVPGAKMCMQPDVKPNKRKSRGSR-KERSRTQA  79

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH  LR+VCKRW RLL+GN+YYSLRK+  +AEEW+YV K
Sbjct  80    PLLPGLPDDLAIACLIRVPRVEHPNLRIVCKRWNRLLSGNYYYSLRKRNGMAEEWVYVFK  139

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SWHAFDP++QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  140   RDREGKISWHAFDPLHQLWKSLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  199

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +L SAEVYDPN+NRW
Sbjct  200   VVFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLPSAEVYDPNRNRW  259

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + +++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++ W+T+ D MVTGWRNPS
Sbjct  260   ACVAEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNLWSTIDDEMVTGWRNPS  319

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              T NG+LY+ DCRDGCKLRVYD  T +W+K +DS+ HLG+S+A EAAAL+ L+GKLCI+R
Sbjct  320   ITFNGKLYSSDCRDGCKLRVYDPNTGTWAKFMDSKHHLGSSRAFEAAALVTLNGKLCIVR  379

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVD++    +    S  +WET+  KGQ ++ V N  S++AGR+ LKSHI+HCQV
Sbjct  380   NNMSITLVDISDPTMSIETDSARMWETVARKGQHRSFVANLWSTIAGRN-LKSHIIHCQV  438

Query  2006  LQT  2014
             LQ 
Sbjct  439   LQV  441



>ref|XP_009411265.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=418

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/419 (71%), Positives = 349/419 (83%), Gaps = 2/419 (0%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +VD+ +C CRVDAGLKTV GA+++VPG KLCLQP I P+  P  +   R+++R Q+PLLP
Sbjct  2     IVDSVSCYCRVDAGLKTVVGARKFVPGAKLCLQPEIIPN-GPRLRNSRRERSRNQAPLLP  60

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPRIEH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW+YVIKRDR 
Sbjct  61    GLPDDLAIACLIRVPRIEHQNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEWVYVIKRDR-  119

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SWHAFDP ++LW+PLPPVP +YSEA GFGCAVLSGC+LYLFGGKDP KG MRRV+FY
Sbjct  120   GKISWHAFDPNHRLWRPLPPVPADYSEAFGFGCAVLSGCYLYLFGGKDPSKGPMRRVVFY  179

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             +ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG   +LRSAE+YDPN+NRW  I+
Sbjct  180   NARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGNQRTLRSAELYDPNRNRWISIA  239

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             +MS  MVPFIGVVY+GKW+LKG+ +  QV+SEVY P T+TW+TV  G+VTGWRNPS ++N
Sbjct  240   EMSIGMVPFIGVVYEGKWFLKGIDSRHQVVSEVYAPTTNTWSTVGGGIVTGWRNPSISMN  299

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             GRLYA DCRDGCKLRVY+ AT+SW+K +DS+ HLG SKA EAA+ +PL+GKL IIRNNMS
Sbjct  300   GRLYASDCRDGCKLRVYERATDSWNKFMDSKHHLGNSKAFEAASFVPLNGKLGIIRNNMS  359

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             ISLVDV    ++    S H+WE I GK Q K+ V N  SS+AGRS LK HIVHCQVLQ 
Sbjct  360   ISLVDVTNPVNSIETNSSHVWEAISGKNQLKSFVANLWSSIAGRSGLKGHIVHCQVLQA  418



>ref|NP_001131994.1| uncharacterized protein LOC100193397 [Zea mays]
 gb|ACG43376.1| kelch motif family protein [Zea mays]
Length=437

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +K +   +R    +++ RTQ+
Sbjct  17    VRAPLVESVSCYCRLDTGLKTVVEARKFVPGAKMCMQPEVKQNKRKSRGSK-KERCRTQA  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+E  KLR+VCKRW RLL+GN++YSLRKK+ +AEEW+YV K
Sbjct  76    PLLPGLPDDLAIACLIRVPRLEQPKLRMVCKRWNRLLSGNYFYSLRKKIGVAEEWVYVFK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SW+AFDP++QLW+ LPPVP+EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  136   RDREGKISWYAFDPLHQLWKSLPPVPQEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDM+R+RHFFG CVINNCLYVAGGE EG+  +L+SAEVYDPN+NRW
Sbjct  196   VVFYNARTNKWHRAPDMMRKRHFFGSCVINNCLYVAGGECEGIQRTLQSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + +++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++TW+ + D MVTGWRNPS
Sbjct  256   ACVTEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNTWSAIDDEMVTGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLY+ DCRDGCKLRVYDE T +W++ +DS+ HLG+S+A EAAAL+ L+GKLC+IR
Sbjct  316   ISFNGRLYSADCRDGCKLRVYDENTGTWTRFMDSKHHLGSSRAFEAAALVSLNGKLCVIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVDV+    +    S  +WET+  KGQ ++ V N  SS+AGR+ LKSHI+HC V
Sbjct  376   NNMSITLVDVSNPTMSVETDSARMWETVVRKGQHRSFVANLWSSIAGRN-LKSHIIHCHV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQV  437



>gb|ACN32130.1| unknown [Zea mays]
 tpg|DAA50022.1| TPA: kelch motif family protein [Zea mays]
Length=437

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +K +   +R    +++ RTQ+
Sbjct  17    VRAPLVESVSCYCRLDTGLKTVVEARKFVPGAKMCMQPEVKQNKRKSRGSK-KERCRTQA  75

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+E  KLR+VCKRW RLL+GN++YSLRKK+ +AEEW+YV K
Sbjct  76    PLLPGLPDDLAIACLIRVPRLEQPKLRMVCKRWNRLLSGNYFYSLRKKIGVAEEWVYVFK  135

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SW+AFDP++QLW+ LPPVP+EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  136   RDREGKISWYAFDPLHQLWKSLPPVPQEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  195

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDM+R+RHFFG CVINNCLYVAGGE EG+  +L+SAEVYDPN+NRW
Sbjct  196   VVFYNARTNKWHRAPDMMRKRHFFGSCVINNCLYVAGGECEGIQRTLQSAEVYDPNRNRW  255

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + +++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++TW+ + D MVTGWRNPS
Sbjct  256   ACVTEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNTWSAIDDEMVTGWRNPS  315

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLY+ DCRDGCKLRVYDE T +W++ +DS+ HLG+S+A EAAAL+ L+GKLC+IR
Sbjct  316   ISFNGRLYSADCRDGCKLRVYDENTGTWTRFMDSKHHLGSSRAFEAAALVSLNGKLCVIR  375

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVDV+    +    S  +WET+  KGQ ++ V N  SS+AGR+ LKSHI+HC V
Sbjct  376   NNMSITLVDVSNPTMSVETDSARMWETVVRKGQHRSFVANLWSSIAGRN-LKSHIIHCHV  434

Query  2006  LQT  2014
             LQ 
Sbjct  435   LQV  437



>ref|NP_001064574.1| Os10g0409900 [Oryza sativa Japonica Group]
 gb|AAP53716.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26488.1| Os10g0409900 [Oryza sativa Japonica Group]
 dbj|BAG91021.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/423 (66%), Positives = 355/423 (84%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +KP+   +R    ++++RTQ+
Sbjct  22    VRAPLVESVSCYCRLDTGLKTVVDARKFVPGAKMCMQPDVKPNKCKSRGSR-KERSRTQA  80

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH  LR+VCKRW RLL+GN+YYSLRK+  +AEEW+YV K
Sbjct  81    PLLPGLPDDLAIACLIRVPRVEHPNLRIVCKRWNRLLSGNYYYSLRKRNGMAEEWVYVFK  140

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SWHAFDP++QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  141   RDREGKISWHAFDPLHQLWKSLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  200

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +L SAEVYDPN+NRW
Sbjct  201   VVFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLPSAEVYDPNRNRW  260

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + +++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++ W+T+ D MVTGWRNPS
Sbjct  261   ACVAEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNLWSTIDDEMVTGWRNPS  320

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              T NG+LY+ DCRDGCKLRVYD  T +W+K +DS+ HLG+S+A EAAAL+ L+GKLCI+R
Sbjct  321   ITFNGKLYSSDCRDGCKLRVYDPNTGTWAKFMDSKHHLGSSRAFEAAALVTLNGKLCIVR  380

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVD++    +    S  +WET+  KGQ ++ V N  S++AGR+ LKSHI+HCQV
Sbjct  381   NNMSITLVDISDPTMSIETDSARMWETVARKGQHRSFVANLWSTIAGRN-LKSHIIHCQV  439

Query  2006  LQT  2014
             LQ 
Sbjct  440   LQV  442



>gb|EAZ16045.1| hypothetical protein OsJ_31487 [Oryza sativa Japonica Group]
Length=442

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/423 (66%), Positives = 355/423 (84%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CR+D GLKTV  A+++VPG K+C+QP +KP+   +R    ++++RTQ+
Sbjct  22    VRAPLVESVSCYCRLDTGLKTVVDARKFVPGAKMCMQPDVKPNKCKSRGSR-KERSRTQA  80

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAIACLIRVPR+EH  LR+VCKRW RLL+GN+YYSLRK+  +AEEW+YV K
Sbjct  81    PLLPGLPDDLAIACLIRVPRVEHPNLRIVCKRWNRLLSGNYYYSLRKRNGMAEEWVYVFK  140

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR+GK+SWHAFDP++QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRR
Sbjct  141   RDREGKISWHAFDPLHQLWKSLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRR  200

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +L SAEVYDPN+NRW
Sbjct  201   VVFYNARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLPSAEVYDPNRNRW  260

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + +++M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++ W+T+ D MVTGWRNPS
Sbjct  261   ACVAEMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNLWSTIDDEMVTGWRNPS  320

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              T NG+LY+ DCRDGCKLRVYD  T +W+K +DS+ HLG+S+A EAAAL+ L+GKLCI+R
Sbjct  321   ITFNGKLYSSDCRDGCKLRVYDPNTGTWAKFMDSKHHLGSSRAFEAAALVTLNGKLCIVR  380

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVD++    +    S  +WET+  KGQ ++ V N  S++AGR+ LKSHI+HCQV
Sbjct  381   NNMSITLVDISDPTMSIETDSARMWETVARKGQHRSFVANLWSTIAGRN-LKSHIIHCQV  439

Query  2006  LQT  2014
             LQ 
Sbjct  440   LQV  442



>ref|XP_006662347.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Oryza brachyantha]
Length=488

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/419 (67%), Positives = 350/419 (84%), Gaps = 2/419 (0%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +V++ +C CR+D GLKTV  A+++VPG K+C+QP +KP+   +R    +++ RTQ+PLLP
Sbjct  72    VVESVSCYCRLDTGLKTVVDARKFVPGAKMCMQPDVKPNKRKSRGSR-KERCRTQAPLLP  130

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR+EH  LR+VCKRW RLL+GN+YYSLRKK  +AEEW+YV KRDR+
Sbjct  131   GLPDDLAIACLIRVPRVEHPNLRMVCKRWNRLLSGNYYYSLRKKNGMAEEWVYVFKRDRE  190

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SWHAFDP++QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY
Sbjct  191   GKISWHAFDPLHQLWKSLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFY  250

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             +ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +L SAEVYDPN+NRW+ I+
Sbjct  251   NARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLPSAEVYDPNRNRWACIA  310

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             +M+  MVPFIGVVY GKW+LKGL +HRQV SEVY P ++ W+T+ D MVTGWRNPS T N
Sbjct  311   EMNNGMVPFIGVVYDGKWFLKGLDSHRQVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFN  370

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             G+LY+ DCRDGCKLRVYD  T +W+K +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMS
Sbjct  371   GKLYSSDCRDGCKLRVYDPNTGTWAKFMDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMS  430

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             I+LVD++    +    S  +WET+  K Q ++ V N  S++AGR+ LKSHI+HCQVLQ 
Sbjct  431   ITLVDISDPTMSIETDSARMWETVARKSQHRSFVANLWSTIAGRN-LKSHIIHCQVLQV  488



>gb|AAG51566.1|AC027034_12 unknown protein; 58496-60308 [Arabidopsis thaliana]
Length=478

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/389 (72%), Positives = 330/389 (85%), Gaps = 5/389 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+GLKTV  A+++VPG+KLC+QP I P+ H  R+   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAH-RRKNSKRERTRIQP  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR EH KLRLVCKRWYRL +GNF+YS RK L ++EEW+YV K
Sbjct  77    PLLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRDGK+SW+ FDPI QLWQPLPPVP+EYSEA+GFGCAVLSGCHLYLFGGKDP++GSMRR
Sbjct  137   RDRDGKISWNTFDPISQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVYDPNKNRW
Sbjct  197   VIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I+DMSTAMVP IGVVY  KW+LKGLG+H+ VMSE Y PE ++W+ V DGMV GWRNP 
Sbjct  257   SFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPC  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
             T+LNGRLY LDCRDGCKLRV+DE+T+SW+K +DS+ HLG SK+LEAAAL+PL  KLCIIR
Sbjct  317   TSLNGRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGNSKSLEAAALVPLHNKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIG  1912
             NNMS+SLVDV+  D      +  LWE I 
Sbjct  377   NNMSMSLVDVSNPD----KNNPRLWENIA  401



>ref|NP_001049085.1| Os03g0167800 [Oryza sativa Japonica Group]
 gb|ABF94176.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10999.1| Os03g0167800 [Oryza sativa Japonica Group]
 dbj|BAG92526.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00421.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/423 (65%), Positives = 343/423 (81%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CRVD GLKTV  A+++VPG KLC+QP IKP+   +R    +++ RTQ+
Sbjct  18    VRVPLVESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIKPNKRKSRSSH-KERCRTQA  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAI CL+RVPR+EH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW++V K
Sbjct  77    PLLPGLPDDLAITCLMRVPRLEHTNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEWVFVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRD K+SWHAFDP++Q+W+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKDPV+GSMRR
Sbjct  137   RDRDRKISWHAFDPVHQVWKSLPPVPAEYSEAVGFGCAVLSGCYLYLFGGKDPVRGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+AR NKW RAPDML++RH FG CVINN LYVAGGE EG+  +LRSAE YDPN+NRW
Sbjct  197   VVFYNARINKWLRAPDMLQKRHCFGSCVINNRLYVAGGECEGIQRTLRSAEFYDPNRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S IS+MST MVPFIGVVY GKW+LKGL +HRQV+SEVY P ++ W+   D MVTGWRNPS
Sbjct  257   SYISEMSTGMVPFIGVVYDGKWFLKGLDSHRQVVSEVYMPTSNVWSVTADEMVTGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
                NGRLY+ +CRDGCKLRVYD  T SW++ +DSR HLG S+A EAAAL+ L+GK+CIIR
Sbjct  317   ICFNGRLYSAECRDGCKLRVYDRDTRSWTRFMDSRRHLGNSRAFEAAALVSLNGKICIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVDV+         + H+W+    KGQ ++ + N   ++AGR+  K+HI+HCQV
Sbjct  377   NNMSITLVDVSNTPTVIEINNAHMWDVFARKGQHRSFIANLWFTIAGRN-FKTHIIHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQV  438



>ref|XP_006651075.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like, partial 
[Oryza brachyantha]
Length=429

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/423 (66%), Positives = 342/423 (81%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CRVD GLKTV  A+++VPG KLC+QP IKP+   +R    +++ RTQ+
Sbjct  9     VRVPLVESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIKPNKRKSRSSR-KERCRTQA  67

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLAI CL+RVPR+EH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW++V K
Sbjct  68    PLLPGLPDDLAINCLMRVPRVEHPNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEWVFVFK  127

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRD K+SWHAFDP++Q+W+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKDPV+GSMRR
Sbjct  128   RDRDRKISWHAFDPVHQVWKSLPPVPPEYSEAVGFGCAVLSGCYLYLFGGKDPVRGSMRR  187

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+AR NKW RAPDML +RH FG CVINN LYVAGGE EG+  +LRSAE YDPN+NRW
Sbjct  188   VVFYNARINKWLRAPDMLEKRHCFGSCVINNRLYVAGGECEGIQRTLRSAEFYDPNRNRW  247

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S IS+MST MVPFIGVVY GKW+LKGL +HRQV+SEVY P ++ W+   D MV GWRNPS
Sbjct  248   SKISEMSTGMVPFIGVVYDGKWFLKGLDSHRQVVSEVYMPTSNVWSISADEMVAGWRNPS  307

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLY+ DCRDGCKLRVYD  T SW++ IDSR HLG+S+A EAAAL+ L+GK+CIIR
Sbjct  308   ISFNGRLYSADCRDGCKLRVYDGDTRSWTRFIDSRRHLGSSRAFEAAALVSLNGKICIIR  367

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+LVDV+         S H+W+    KGQ ++ + N   +++GR   K+HI+HCQV
Sbjct  368   NNMSITLVDVSNTPTVIEINSAHMWDIFARKGQHRSFIANLWLTISGR-HFKTHIIHCQV  426

Query  2006  LQT  2014
             LQ 
Sbjct  427   LQV  429



>gb|EMT18179.1| hypothetical protein F775_31347 [Aegilops tauschii]
Length=417

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 341/418 (82%), Gaps = 2/418 (0%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +V++ +C CR+D GLKTV  A+++  G K+C+QP +K +   +R    +++ R Q+PLLP
Sbjct  1     MVESVSCYCRLDTGLKTVVDARKFASGAKMCMQPDVKQTKRKSRGSR-KERCRAQAPLLP  59

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAIACLIRVPR+EH  LR VCKRW RLL+GN+YYSLRKKL +AEEW+YV KRDR+
Sbjct  60    GLPDDLAIACLIRVPRVEHPNLRTVCKRWNRLLSGNYYYSLRKKLSMAEEWVYVFKRDRE  119

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
             GK+SWHAFDP+ QLW+ LPPVP EYSEALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY
Sbjct  120   GKISWHAFDPLNQLWKSLPPVPPEYSEALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFY  179

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             +ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +L+SAEVYDPN+NRW  I 
Sbjct  180   NARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLQSAEVYDPNRNRWVCIP  239

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             +M+  MVPFIGVVY  KW+LKGL +HRQV  EVY P ++ W+T+ D MVTGWRNPS + N
Sbjct  240   EMNNGMVPFIGVVYDDKWFLKGLDSHRQVTCEVYLPSSNLWSTIDDEMVTGWRNPSISFN  299

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             GRLY+ DCRDGCKLRVYD  T +W++ IDSR HLG+S+A EAA L+ L+GKLCIIRNNMS
Sbjct  300   GRLYSSDCRDGCKLRVYDANTGTWARFIDSRHHLGSSRAFEAAGLVSLNGKLCIIRNNMS  359

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQ  2011
             I+LVD+     +    S  +W+T+  KGQ K+ V N  S++AGR+ LKSHI+HCQVLQ
Sbjct  360   ITLVDILDPTMSIETDSACMWKTVARKGQHKSFVANLWSTIAGRN-LKSHIIHCQVLQ  416



>gb|EAZ25721.1| hypothetical protein OsJ_09555 [Oryza sativa Japonica Group]
Length=502

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/418 (66%), Positives = 339/418 (81%), Gaps = 2/418 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             V++ +C CRVD GLKTV  A+++VPG KLC+QP IKP+   +R    +++ RTQ+PLLPG
Sbjct  87    VESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIKPNKRKSRSSH-KERCRTQAPLLPG  145

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAI CL+RVPR+EH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW++V KRDRD 
Sbjct  146   LPDDLAITCLMRVPRLEHTNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEWVFVFKRDRDR  205

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             K+SWHAFDP++Q+W+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKDPV+GSMRRV+FY+
Sbjct  206   KISWHAFDPVHQVWKSLPPVPAEYSEAVGFGCAVLSGCYLYLFGGKDPVRGSMRRVVFYN  265

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
             AR NKW RAPDML++RH FG CVINN LYVAGGE EG+  +LRSAE YDPN+NRWS IS+
Sbjct  266   ARINKWLRAPDMLQKRHCFGSCVINNRLYVAGGECEGIQRTLRSAEFYDPNRNRWSYISE  325

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             MST MVPFIGVVY GKW+LKGL +HRQV+SEVY P ++ W+   D MVTGWRNPS   NG
Sbjct  326   MSTGMVPFIGVVYDGKWFLKGLDSHRQVVSEVYMPTSNVWSVTADEMVTGWRNPSICFNG  385

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
             RLY+ +CRDGCKLRVYD  T SW++ +DSR HLG S+A EAAAL+ L+GK+CIIRNNMSI
Sbjct  386   RLYSAECRDGCKLRVYDRDTRSWTRFMDSRRHLGNSRAFEAAALVSLNGKICIIRNNMSI  445

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             +LVDV+         + H+W+    KGQ ++ + N   ++AGR+  K+HI+HCQVLQ 
Sbjct  446   TLVDVSNTPTVIEINNAHMWDVFARKGQHRSFIANLWFTIAGRN-FKTHIIHCQVLQV  502



>gb|AAL84293.1|AC073556_10 putative Kelch motif containing protein [Oryza sativa Japonica 
Group]
Length=493

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/418 (66%), Positives = 339/418 (81%), Gaps = 2/418 (0%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             V++ +C CRVD GLKTV  A+++VPG KLC+QP IKP+   +R    +++ RTQ+PLLPG
Sbjct  78    VESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIKPNKRKSRSSH-KERCRTQAPLLPG  136

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAI CL+RVPR+EH  LRLVCKRW RLL+GN+YYSLRKKL +AEEW++V KRDRD 
Sbjct  137   LPDDLAITCLMRVPRLEHTNLRLVCKRWNRLLSGNYYYSLRKKLGMAEEWVFVFKRDRDR  196

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             K+SWHAFDP++Q+W+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKDPV+GSMRRV+FY+
Sbjct  197   KISWHAFDPVHQVWKSLPPVPAEYSEAVGFGCAVLSGCYLYLFGGKDPVRGSMRRVVFYN  256

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
             AR NKW RAPDML++RH FG CVINN LYVAGGE EG+  +LRSAE YDPN+NRWS IS+
Sbjct  257   ARINKWLRAPDMLQKRHCFGSCVINNRLYVAGGECEGIQRTLRSAEFYDPNRNRWSYISE  316

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             MST MVPFIGVVY GKW+LKGL +HRQV+SEVY P ++ W+   D MVTGWRNPS   NG
Sbjct  317   MSTGMVPFIGVVYDGKWFLKGLDSHRQVVSEVYMPTSNVWSVTADEMVTGWRNPSICFNG  376

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
             RLY+ +CRDGCKLRVYD  T SW++ +DSR HLG S+A EAAAL+ L+GK+CIIRNNMSI
Sbjct  377   RLYSAECRDGCKLRVYDRDTRSWTRFMDSRRHLGNSRAFEAAALVSLNGKICIIRNNMSI  436

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             +LVDV+         + H+W+    KGQ ++ + N   ++AGR+  K+HI+HCQVLQ 
Sbjct  437   TLVDVSNTPTVIEINNAHMWDVFARKGQHRSFIANLWFTIAGRN-FKTHIIHCQVLQV  493



>emb|CDY33062.1| BnaC06g07170D [Brassica napus]
Length=435

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/423 (66%), Positives = 340/423 (80%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+ LKTV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSSLKTVVEARKFVPGSKLCIQPNINPNAHRPSKNSNRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR +H KLRLVCK W+RL +GNF+YS RK L  +EEW+YV K
Sbjct  78    PLLPGLPDDLAVACLIRVPRADHRKLRLVCKSWHRLASGNFFYSERKLLGRSEEWVYVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             +DRDGK+SW+AFDP+  L QPL P+P+EYSEA+GFGCAVLSGC LYLFGGKDP++GSMRR
Sbjct  138   KDRDGKISWNAFDPVSHLPQPLTPLPREYSEAVGFGCAVLSGCRLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             VIFY+ARTNKWHRAPDMLR+RHFFG CV+NNCLYVAGGE EG+H +LRSAEVYDPNKNRW
Sbjct  198   VIFYNARTNKWHRAPDMLRKRHFFGSCVVNNCLYVAGGECEGIHRTLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DM  +MVP IGVVY  KW+LKGLG+H+QV+ E Y PE ++W+ V DGMVTGW +P 
Sbjct  258   SFVADMGASMVPLIGVVYDNKWFLKGLGSHQQVICEAYDPEANSWSLVSDGMVTGWIDPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
                NGRLY LDCRDGCKLRV+DE+ +SW K +D ++HLG S   EAAAL+PL+ KLCIIR
Sbjct  318   ACFNGRLYGLDCRDGCKLRVFDESRDSWIKFMDCKVHLGNSWPFEAAALVPLNNKLCIIR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV   D      S  LWE I  KG+ K++++N  SS+AGR+ +K  IVHCQV
Sbjct  378   NNMSMSLVDVTNPD----KNSTRLWENIAVKGESKSILSNIWSSIAGRA-VKCDIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_009394722.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/423 (64%), Positives = 339/423 (80%), Gaps = 1/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q P VD+ +C C+VD+GLKT+ GA+++VPG KLCLQP I P+  P  +   R+++R Q 
Sbjct  18    VQAPPVDSVSCYCKVDSGLKTIIGARKFVPGAKLCLQPEIMPN-GPRSRNSRRERSRNQE  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PL+PGLPDDLAIACL+RVPR++H  LR VCKRW RLL+GN++YSLRKKL +AEEW+YVIK
Sbjct  77    PLVPGLPDDLAIACLVRVPRVDHQNLRFVCKRWNRLLSGNYFYSLRKKLGMAEEWVYVIK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDR  ++SWHAFDPI+QLW+PLPPVP +YSEA+GFGCAVLSGC+LYLFGGKDP  GSMR 
Sbjct  137   RDRSRRISWHAFDPIHQLWRPLPPVPTDYSEAVGFGCAVLSGCYLYLFGGKDPSNGSMRH  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDM+R+RHFFG CVINNCLYVAGG+ EG   +L SAEVYDP++NRW
Sbjct  197   VVFYNARTNKWHRAPDMIRKRHFFGSCVINNCLYVAGGKCEGGQRTLHSAEVYDPSRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             + I++M+T MVPF GVVY GKW+LKGL +  Q++S+VY P  +TW+T    ++TGW  PS
Sbjct  257   TSIAEMNTGMVPFFGVVYDGKWFLKGLNSQCQLVSQVYIPTANTWSTANSRIITGWHIPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
               LNGRLYA DCRDGCKLRV++  T+SW+K +DS+ HLG S+  EAA+ + L+GKL IIR
Sbjct  317   ILLNGRLYASDCRDGCKLRVFERTTDSWNKFMDSKHHLGNSQVFEAASFVSLNGKLGIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSISLVDV    ++    S   WE++ GKG+ K +VT+  SS+AGRS  K  IVHCQV
Sbjct  377   NNMSISLVDVTDPGNSVETNSARAWESVVGKGKLKNIVTSLWSSIAGRSNFKGRIVHCQV  436

Query  2006  LQT  2014
             LQ 
Sbjct  437   LQA  439



>ref|XP_002468444.1| hypothetical protein SORBIDRAFT_01g046015 [Sorghum bicolor]
 gb|EER95442.1| hypothetical protein SORBIDRAFT_01g046015 [Sorghum bicolor]
Length=438

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/423 (63%), Positives = 339/423 (80%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CRVD GLKTV  A+++VPG KLC+QP I P+   +R    +++++TQS
Sbjct  18    VRAPLVESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIIPTKRKSRSSR-KERSQTQS  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPD+LAI+CL+R  R+EH  +RLVCKRW RLL+GN+YYSLRKK  +AEEWIYV K
Sbjct  77    PLLPGLPDELAISCLMRAARVEHPNMRLVCKRWNRLLSGNYYYSLRKKFGMAEEWIYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRD K+SW+AFDP+ QLW+ LPPVP EYSEA+GFG AVL+GC+LYLFGGKDPV GSMRR
Sbjct  137   RDRDQKLSWYAFDPVNQLWKSLPPVPPEYSEAVGFGSAVLNGCYLYLFGGKDPVHGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+AR NKW RAPDML++RHFFG CVINNCLYVAGGE  G+  SLRSAEVYDPN+NRW
Sbjct  197   VVFYNARINKWLRAPDMLQKRHFFGSCVINNCLYVAGGECVGIQRSLRSAEVYDPNRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I++MST MVP IGVV+ GKW+LKGL +HRQV+SEVY P +  W+T  + MVTG RNPS
Sbjct  257   SSIAEMSTGMVPSIGVVHDGKWFLKGLNSHRQVVSEVYLPASKMWSTTGNEMVTGLRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNGRLY+ DCRDGCKLRVY+    SW++ ID+R H+G+S++LEAAA + L+GKLCIIR
Sbjct  317   ISLNGRLYSADCRDGCKLRVYNRELGSWTRFIDTRHHMGSSRSLEAAAFVSLNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+++D++         S  +WE    KGQ ++ + N  S++ GR+ LK+ I+HCQV
Sbjct  377   NNMSITIIDMSDPTRVTEVDSARMWEAFARKGQHRSFMANLWSAITGRN-LKTDIMHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQV  438



>dbj|BAK06395.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/419 (64%), Positives = 338/419 (81%), Gaps = 2/419 (0%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +V++ +C CRVD GLKTV  A+++VPG +LC+QP +KPS   +R    +++ RTQ+PLLP
Sbjct  1     MVESVSCYCRVDGGLKTVVNARKFVPGARLCMQPDVKPSKRKSRSSR-KERCRTQAPLLP  59

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAI+CL+RVPR++H  LRLVCKRW RLL+GN+YYSLRKK  +AEEW+YV KRDRD
Sbjct  60    GLPDDLAISCLMRVPRVKHPNLRLVCKRWSRLLSGNYYYSLRKKFGMAEEWVYVFKRDRD  119

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
              K+SWHAFDP++QLW+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKD V+GSMRRV+FY
Sbjct  120   QKISWHAFDPVHQLWKSLPPVPPEYSEAVGFGCAVLSGCYLYLFGGKDSVRGSMRRVVFY  179

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             + RTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSAEVY+PN+NRWS I+
Sbjct  180   NTRTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSAEVYNPNRNRWSCIT  239

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             +MS  MVPFIGVVY GKW+LKG  +HRQ++SEVY P ++ W+T  + +V G RNPS + N
Sbjct  240   EMSIGMVPFIGVVYDGKWFLKGFDSHRQIVSEVYLPTSNMWSTTGNELVAGLRNPSISFN  299

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             GRLY+ DCRD CKLRVYD  T  W++ +DSR HLG+S++ EA AL+ L GK+C+IRNNMS
Sbjct  300   GRLYSADCRDACKLRVYDGDTGLWTRFMDSRRHLGSSRSFEAVALVSLDGKICVIRNNMS  359

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             I+LVDV          S  +WET   KGQ ++ + N  S++AGR  LK+HI+HCQVLQ 
Sbjct  360   ITLVDVCDPTAIIEIDSARIWETFARKGQHRSFIANLWSTIAGR-HLKTHIIHCQVLQV  417



>gb|KHN19693.1| F-box/kelch-repeat protein [Glycine soja]
Length=397

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/382 (73%), Positives = 312/382 (82%), Gaps = 31/382 (8%)
 Frame = +2

Query  878   HPTRQKPPR----DKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGN  1045
             HP  Q   +    D++R QSPLLPGLPDDLAIA LI+V R+EH                 
Sbjct  15    HPFTQLETKSAHGDRSRNQSPLLPGLPDDLAIAWLIQVTRVEH-----------------  57

Query  1046  FYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVL  1225
                       +AEEWIYVIKRD+DGK+SWHAFDP+Y LWQPLPPVPKEYS ALGFGCAVL
Sbjct  58    ----------LAEEWIYVIKRDQDGKISWHAFDPVYHLWQPLPPVPKEYSGALGFGCAVL  107

Query  1226  SGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGEN  1405
             +GCHLYLFGG+D +KGSMRRVIFYSARTNKWH APDMLRRRHFF  CVINNCLYVAGGEN
Sbjct  108   NGCHLYLFGGEDTLKGSMRRVIFYSARTNKWHCAPDMLRRRHFFSSCVINNCLYVAGGEN  167

Query  1406  EGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQP  1585
             EGVH SLRSAEVYDPNKNRWS ISDMSTAMVPFIGVVY GKW+LKGLG+HRQV+SEVYQP
Sbjct  168   EGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYDGKWFLKGLGSHRQVLSEVYQP  227

Query  1586  ETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGT  1765
             E D    +YDGMV+GWRNPS TLN +LYALDC+DGCK+RVYDE  +SWSKHIDS+MH G+
Sbjct  228   ENDNRYPIYDGMVSGWRNPSCTLNEKLYALDCKDGCKIRVYDEVADSWSKHIDSKMHSGS  287

Query  1766  SKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTN  1945
             S+ALE AAL+PL+GKLCIIRNNMSISLVDV+K +D   ++ E  WETI GKGQFKT+VTN
Sbjct  288   SRALEDAALVPLNGKLCIIRNNMSISLVDVSKLEDLKGSSPELFWETIAGKGQFKTLVTN  347

Query  1946  FLSSLAGRSRLKSHIVHCQVLQ  2011
               SSLAGR+RLKSHIVHCQ+ Q
Sbjct  348   LWSSLAGRNRLKSHIVHCQLGQ  369



>dbj|BAJ89199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/418 (64%), Positives = 334/418 (80%), Gaps = 3/418 (1%)
 Frame = +2

Query  764   DTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGL  943
             ++ +C CRVD GLKTV  A+++VPG +LC+QP +KP+   TR    +++ RTQ+PLLPGL
Sbjct  12    ESVSCYCRVDGGLKTVVNARKFVPGARLCMQPDVKPNKRKTRSSR-KERCRTQAPLLPGL  70

Query  944   PDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGK  1123
             PDDLAI+CL+RV R EH  LRLVC++W RLL+GN+YYSLRKK  +AEEW+YV KRDRD K
Sbjct  71    PDDLAISCLMRVSRAEHPNLRLVCRKWSRLLSGNYYYSLRKKFGMAEEWVYVFKRDRDQK  130

Query  1124  VSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSA  1303
             +SWHAFDP++QLW+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKDPV+GSMR V+FY+ 
Sbjct  131   LSWHAFDPVHQLWRSLPPVPPEYSEAVGFGCAVLSGCYLYLFGGKDPVRGSMRHVVFYNT  190

Query  1304  RTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDM  1483
             RTNKW+RAPDMLR+RH FG CVINNCLYVAGGE EG+  +LRSAEVY+PN+NRWS IS+M
Sbjct  191   RTNKWYRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTLRSAEVYNPNRNRWSCISEM  250

Query  1484  STAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGR  1663
             +T MVPF GVVY GKW+LKGL +HRQV+SEVY P ++TW+T  + +V G RNP+   NGR
Sbjct  251   NTGMVPFTGVVYDGKWFLKGLDSHRQVVSEVYLPTSNTWSTTGNALVAGLRNPTIPFNGR  310

Query  1664  LYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSIS  1843
             LY+ DCRD CKLRVYD     W++ +DSR HLG+S+A EA AL+ L+GK+C+IRNNM + 
Sbjct  311   LYSADCRDACKLRVYDGDIGLWTRFMDSRRHLGSSRAFEAVALVSLNGKICVIRNNMGMI  370

Query  1844  LVDVAKCDDAGAATSEHLWETIGGKG-QFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             LVDV          S  LWET   KG Q ++++ N  S++AGR+ LK+HI+HCQVLQ 
Sbjct  371   LVDVCDPTTVIEFESARLWETFARKGHQHRSLMANLWSAIAGRN-LKAHIIHCQVLQV  427



>ref|XP_004985575.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Setaria italica]
Length=438

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/423 (62%), Positives = 336/423 (79%), Gaps = 2/423 (0%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CRVD GLKTV  A+++VPG KLC+QP I P+   +R    +++++TQS
Sbjct  18    VRAPLVESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIIPNKRKSRSSR-KERSQTQS  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPD+LAI+CL+RV R+ H  +RLVCKRW RLL+ N+YYSLRKK  +AEEW+YV K
Sbjct  77    PLLPGLPDELAISCLMRVARVGHPNMRLVCKRWNRLLSANYYYSLRKKFGMAEEWVYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRD K+SW+AFDP+ QLW+ LPPVP EYSE +GFGCAVL+GC+LYLFGGKDPV GSMRR
Sbjct  137   RDRDQKLSWYAFDPVNQLWKSLPPVPPEYSEVVGFGCAVLNGCYLYLFGGKDPVHGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+AR NKW RAPDML++RH FG CVINNCLYVAGGE EG+  +LRSAEVYDPN+NRW
Sbjct  197   VVFYNARINKWLRAPDMLQKRHCFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I++MST MVP IGVV+ GKW+LKGL +HRQV+SEVY P +  W+   + MV GWRNPS
Sbjct  257   SCIAEMSTGMVPSIGVVHDGKWFLKGLNSHRQVVSEVYLPASKMWSATGNEMVAGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              + NGRLY+ DCRDGCKLRVY+    SW++ ID+R HLG+S+ALEAAA + L+GKLCIIR
Sbjct  317   ISFNGRLYSSDCRDGCKLRVYNREAGSWTRFIDTRHHLGSSRALEAAAFVSLNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMSI+L+D++         S  +W+    KGQ ++ + N  S++ GR+ LK+ I+HCQV
Sbjct  377   NNMSITLIDLSDPTTVIEVDSARMWDAFARKGQHRSFMANLWSTITGRN-LKTDIMHCQV  435

Query  2006  LQT  2014
             LQ 
Sbjct  436   LQV  438



>gb|EMT22353.1| hypothetical protein F775_26656 [Aegilops tauschii]
Length=418

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/418 (63%), Positives = 335/418 (80%), Gaps = 3/418 (1%)
 Frame = +2

Query  764   DTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGL  943
             ++ +C CRVD GLKTV  A+++VPG +LC+QP +KP+   TR    +++ RT +PLLPGL
Sbjct  3     ESVSCYCRVDGGLKTVVNARKFVPGARLCMQPDVKPNKRKTRSSR-KERCRTPAPLLPGL  61

Query  944   PDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGK  1123
             PDDLAI+CL+RV R EH  LRLVCK+W RLL+GN+YYSLRKK  +AEEW+YV KRDRD K
Sbjct  62    PDDLAISCLMRVSRAEHPNLRLVCKKWSRLLSGNYYYSLRKKFGMAEEWVYVFKRDRDQK  121

Query  1124  VSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSA  1303
             +SWHAFDP++QLW+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGK+PV+GSMR V++Y+ 
Sbjct  122   LSWHAFDPVHQLWRSLPPVPPEYSEAVGFGCAVLSGCYLYLFGGKNPVRGSMRHVVYYNT  181

Query  1304  RTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDM  1483
             RTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG   +LRSAEVY+PN+NRWS I++M
Sbjct  182   RTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGTQRTLRSAEVYNPNRNRWSCITEM  241

Query  1484  STAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGR  1663
             ST MVPF G+VY GKW+L+GL +HRQV+SEVY P ++TW+T  + +V G RNP+ + NGR
Sbjct  242   STGMVPFTGIVYDGKWFLRGLDSHRQVVSEVYLPTSNTWSTTGNALVAGLRNPTISFNGR  301

Query  1664  LYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSIS  1843
             LY+ DCRD CKLRVYD    SW++ +DSR HLG+S+A EA AL+ L+GK+C+IRNNM ++
Sbjct  302   LYSADCRDACKLRVYDGDIGSWTRFMDSRRHLGSSRAFEAVALVSLNGKICVIRNNMGMT  361

Query  1844  LVDVAKCDDAGAATSEHLWETIGGKG-QFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             LVDV          S  +WET   KG Q ++++ N  S++AGR+ LK+HI+HCQVLQ 
Sbjct  362   LVDVCDPTKVIEMESARVWETFARKGHQHRSLMANLWSAIAGRN-LKAHIIHCQVLQA  418



>emb|CDM81477.1| unnamed protein product [Triticum aestivum]
 emb|CDM87230.1| unnamed protein product [Triticum aestivum]
Length=427

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/418 (63%), Positives = 333/418 (80%), Gaps = 3/418 (1%)
 Frame = +2

Query  764   DTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGL  943
             ++ +C CRVD GLKTV  A+++VPG +LC+QP +KP+   TR    +++ R Q+PLLPGL
Sbjct  12    ESVSCYCRVDGGLKTVVNARKFVPGARLCMQPDVKPNKRKTRSSR-KERCRNQAPLLPGL  70

Query  944   PDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGK  1123
             PDDLAI+CL+RV R EH  LRLVCK+W RLL+GN+YYSLRKK  +AEEW+YV KRDRD K
Sbjct  71    PDDLAISCLMRVSRAEHPNLRLVCKKWSRLLSGNYYYSLRKKFGMAEEWVYVFKRDRDQK  130

Query  1124  VSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSA  1303
             +SWHAFDP +QLW+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGK+PV+GSMR V++Y+ 
Sbjct  131   LSWHAFDPAHQLWRSLPPVPPEYSEAVGFGCAVLSGCYLYLFGGKNPVRGSMRHVVYYNT  190

Query  1304  RTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDM  1483
             RTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG   +LRSAEVY+PN+NRWS I++M
Sbjct  191   RTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGTQRTLRSAEVYNPNRNRWSCITEM  250

Query  1484  STAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGR  1663
             +T MVPF GVVY GKW+LKGL +HRQV+SEVY P ++TW+T  + +V G RNP+ + NGR
Sbjct  251   NTGMVPFTGVVYDGKWFLKGLDSHRQVVSEVYLPTSNTWSTTGNALVAGLRNPTISFNGR  310

Query  1664  LYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSIS  1843
             LY+ DCRD CKLRVYD     W++ +DSR HLG+S+A EA AL+ L+GK+C+IRNNM ++
Sbjct  311   LYSADCRDACKLRVYDGDIGLWTRFMDSRHHLGSSRAFEAVALVSLNGKICVIRNNMGMT  370

Query  1844  LVDVAKCDDAGAATSEHLWETIGGKG-QFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             LVDV          S  +WET   KG Q ++++ N  S++AGR+ LK+HI+HCQVLQ 
Sbjct  371   LVDVCDPTTVIEFESARVWETFARKGHQHRSLMANLWSAIAGRN-LKAHIIHCQVLQA  427



>ref|NP_001147489.1| kelch motif family protein [Zea mays]
 gb|ACG27695.1| kelch motif family protein [Zea mays]
 tpg|DAA43581.1| TPA: LOW QUALITY PROTEIN: kelch motif family protein [Zea mays]
Length=439

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/424 (63%), Positives = 335/424 (79%), Gaps = 3/424 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             ++ PLV++ +C CRVD GLKTV  A+++VPG KLC+QP I P+   +R    +++++TQS
Sbjct  18    VRVPLVESVSCHCRVDGGLKTVVSARKFVPGAKLCMQPDIIPNKRKSRSSR-KERSKTQS  76

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPD+LAI+CL+R  RIEH  +RLVCKRW RLL+GN+YYSLRKK  +AEEWIYV K
Sbjct  77    PLLPGLPDELAISCLMRAARIEHPNMRLVCKRWNRLLSGNYYYSLRKKFGMAEEWIYVFK  136

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             RDRD K+SW+AFDP+ QLW+ LPPVP EYSEA+GFG AVL+GC+LYLFGGKDPV GSMRR
Sbjct  137   RDRDQKLSWYAFDPVNQLWKSLPPVPPEYSEAVGFGSAVLNGCYLYLFGGKDPVHGSMRR  196

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+AR NKW RAPDML++RHFFG CVINNCLYVAGGE  G+   LRSAEVYDPN+NRW
Sbjct  197   VVFYNARINKWLRAPDMLQKRHFFGSCVINNCLYVAGGECVGIQRILRSAEVYDPNRNRW  256

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S I++MST MVP IGVV+ GKWYLKGL +HRQV+SEVY P +  W+   + MVTGWRNPS
Sbjct  257   SSIAEMSTGMVPSIGVVHDGKWYLKGLNSHRQVVSEVYLPASKMWSATGNEMVTGWRNPS  316

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
              +LNG LY+ DCRDGCKLRVY+    SW++ ID+R H+G+S++LEAAA + L+GKLCIIR
Sbjct  317   ISLNGHLYSADCRDGCKLRVYNREMGSWTRFIDTRHHMGSSRSLEAAAFVSLNGKLCIIR  376

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFK-TMVTNFLSSLAGRSRLKSHIVHCQ  2002
             NNMSI++VD+     A    S  +WE    KGQ + + + N    + GR+ LK+ I+HCQ
Sbjct  377   NNMSITIVDILDPTTATEVDSARMWEAFARKGQHRSSFMANLWLIITGRN-LKTDIMHCQ  435

Query  2003  VLQT  2014
             VLQ 
Sbjct  436   VLQV  439



>emb|CDY24045.1| BnaA06g00430D [Brassica napus]
Length=435

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/423 (65%), Positives = 344/423 (81%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C CRVD+ L+TV  A+++VPG+KLC+QP I P+ H   +   R++ R Q 
Sbjct  18    LQAPLVDSVSCYCRVDSSLRTVVEARKFVPGSKLCIQPNINPNAHRPSKNSNRERTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR +H KLRLVCK W+RL +GNF+YS RK L  +EEW++V K
Sbjct  78    PLLPGLPDDLAVACLIRVPRADHRKLRLVCKSWHRLASGNFFYSERKLLGRSEEWVHVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             +DRDGK+SW+AFDP+  L QPLPP+P+EYSEA+GFGCAVLSGC LYLFGGKDP++GSMRR
Sbjct  138   KDRDGKISWNAFDPVTHLPQPLPPLPREYSEAVGFGCAVLSGCRLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHR PDMLR+RHFFG CVINNCLYVAGGE EG+   LRSAEVYDPNKNRW
Sbjct  198   VVFYNARTNKWHRGPDMLRKRHFFGCCVINNCLYVAGGECEGIQRRLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DM  +MVP +GVVY  KW+LKGLG+ +QV+ E Y PE ++W+ V DGMVTGWR+P 
Sbjct  258   SFVADMGASMVPLLGVVYDNKWFLKGLGSQQQVICEAYDPEANSWSLVSDGMVTGWRDPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
               L+GRLY LDCRDGCKLRV+D++T+SW+K +DS++HLG S A EAAAL+ L+ KLCI+R
Sbjct  318   ACLDGRLYGLDCRDGCKLRVFDKSTDSWNKFMDSKVHLGNSWAFEAAALVTLNNKLCIVR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV   D      S  LWE I  KGQ K++++N  SS+AGR+ +K+HIVHCQV
Sbjct  378   NNMSMSLVDVTNPD----KNSPRLWENIAVKGQSKSIISNIWSSIAGRA-VKTHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>ref|XP_003562030.2| PREDICTED: F-box/kelch-repeat protein At1g55270 [Brachypodium 
distachyon]
Length=417

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/419 (64%), Positives = 338/419 (81%), Gaps = 2/419 (0%)
 Frame = +2

Query  758   LVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLP  937
             +V++ +C CRVD GLK+V  A++ V G KLC+QP +KP+   +R    +++ RTQ+PLLP
Sbjct  1     MVESVSCYCRVDGGLKSVVNARKLVSGAKLCMQPDVKPNKRKSRSSR-KERCRTQAPLLP  59

Query  938   GLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRD  1117
             GLPDDLAI+CL+RVPR+EH  LRLVCKRW RLL+GN+YYSLRKK  +AEEW+YV KRDRD
Sbjct  60    GLPDDLAISCLMRVPRVEHPNLRLVCKRWSRLLSGNYYYSLRKKFGMAEEWVYVFKRDRD  119

Query  1118  GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFY  1297
              K+SWHAFDP++QLW+ LPPVP EYSEA GFGCAVLSGC+LYLFGGKDPV+GSMRRV+FY
Sbjct  120   QKMSWHAFDPVHQLWKSLPPVPPEYSEATGFGCAVLSGCYLYLFGGKDPVRGSMRRVVFY  179

Query  1298  SARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLIS  1477
             +ARTNKWHRAPDMLR+RH FG CVINNCLYVAGGE EG+H +LRSAEVY+PN+NRW+ I+
Sbjct  180   NARTNKWHRAPDMLRKRHCFGSCVINNCLYVAGGECEGIHRTLRSAEVYNPNRNRWACIT  239

Query  1478  DMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLN  1657
             +MST MVP + VVY GKW+LKG+ +H+QV+SEVY P  + W++    MV GWRNPS + N
Sbjct  240   EMSTGMVPLVSVVYDGKWFLKGVDSHQQVVSEVYLPTFNMWSSTGTEMVAGWRNPSISFN  299

Query  1658  GRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMS  1837
             GRLY++DCRDGCKLRVYD  T  W++ IDSR HL +S+A EAAAL+ L+GKLCIIRNNMS
Sbjct  300   GRLYSVDCRDGCKLRVYDGDTGLWTRVIDSRRHLSSSRASEAAALVSLNGKLCIIRNNMS  359

Query  1838  ISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             I+LVDV+         S  ++E+   +GQ ++ + N  S++AGR + K+HI+  QVLQ 
Sbjct  360   ITLVDVSDPTTVIEIDSARMFESFVRRGQHRSFIANLWSTIAGR-QWKAHIIQAQVLQV  417



>ref|XP_009147515.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Brassica 
rapa]
Length=435

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/423 (65%), Positives = 342/423 (81%), Gaps = 5/423 (1%)
 Frame = +2

Query  746   IQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQS  925
             +Q PLVD+ +C  RVD+ LKTV  A+++VPG+KLC+QP I P+ H   +   RD+ R Q 
Sbjct  18    LQAPLVDSVSCYSRVDSSLKTVVEARKFVPGSKLCIQPNINPNAHRPSKNSNRDRTRIQP  77

Query  926   PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIK  1105
             PLLPGLPDDLA+ACLIRVPR +H KLRLVCK W+RL +GNF+YS RK L  +EEW++V K
Sbjct  78    PLLPGLPDDLAVACLIRVPRADHRKLRLVCKSWHRLASGNFFYSERKLLGRSEEWVHVFK  137

Query  1106  RDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRR  1285
             +DRDGK+SW+AFDP+  L QPLPP+P+EYSEA+GFGCAVLSGC LYLFGGKDP++GSMRR
Sbjct  138   KDRDGKISWNAFDPVTHLPQPLPPLPREYSEAVGFGCAVLSGCRLYLFGGKDPLRGSMRR  197

Query  1286  VIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRW  1465
             V+FY+ARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+   LRSAEVYDPNKNRW
Sbjct  198   VVFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQRRLRSAEVYDPNKNRW  257

Query  1466  SLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPS  1645
             S ++DM  +M+P +GVVY  KW+LKGLG+H+QVM E Y PE ++W++V DGM TGWR+P 
Sbjct  258   SFVADMGASMLPLLGVVYDNKWFLKGLGSHQQVMCEAYDPEANSWSSVSDGMATGWRDPC  317

Query  1646  TTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIR  1825
                +GRLY LDCRDG KLRV+DE+T+SW+K +DS++HLG S A EAAAL+ L+ KLCI+R
Sbjct  318   ACPDGRLYGLDCRDGGKLRVFDESTDSWNKFMDSKVHLGNSWAFEAAALVTLNNKLCIVR  377

Query  1826  NNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQV  2005
             NNMS+SLVDV   D      S  LWE I  KGQ K++++N  SS+AGR+ +K HIVHCQV
Sbjct  378   NNMSMSLVDVTNPD----KNSPRLWENIAVKGQSKSIISNIWSSIAGRA-VKIHIVHCQV  432

Query  2006  LQT  2014
             LQ 
Sbjct  433   LQA  435



>gb|ABD16062.1| Kelch-motif containing protein [Oryza rufipogon]
Length=375

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/375 (67%), Positives = 317/375 (85%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QVMSEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVMSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTMA  375



>gb|ABD16065.1| Kelch-motif containing protein [Oryza rufipogon]
Length=375

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/375 (67%), Positives = 317/375 (85%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QVMSEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVMSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPKMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16060.1| Kelch-motif containing protein [Oryza sativa Indica Group]
Length=375

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/375 (67%), Positives = 317/375 (85%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QVMSEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVMSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16045.1| Kelch-motif containing protein [Oryza barthii]
Length=375

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/375 (68%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCIIRNNMSI+LVD++    +    S  +WETI  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIIRNNMSITLVDISDPKMSIETDSARMWETIARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16054.1| Kelch-motif containing protein [Oryza sativa Japonica Group]
Length=375

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTRSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16044.1| Kelch-motif containing protein [Oryza barthii]
Length=375

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCIIRNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIIRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16046.1| Kelch-motif containing protein [Oryza meridionalis]
 gb|ABD16048.1| Kelch-motif containing protein [Oryza longistaminata]
 gb|ABD16049.1| Kelch-motif containing protein [Oryza longistaminata]
 gb|ABD16050.1| Kelch-motif containing protein [Oryza glumipatula]
 gb|ABD16051.1| Kelch-motif containing protein [Oryza glumipatula]
 gb|ABD16052.1| Kelch-motif containing protein [Oryza nivara]
 gb|ABD16053.1| Kelch-motif containing protein [Oryza nivara]
 gb|ABD16063.1| Kelch-motif containing protein [Oryza rufipogon]
 gb|ABD16064.1| Kelch-motif containing protein [Oryza rufipogon]
 gb|ABD16066.1| Kelch-motif containing protein [Oryza rufipogon]
 gb|ABD16067.1| Kelch-motif containing protein [Oryza rufipogon]
 gb|ABD16069.1| Kelch-motif containing protein [Oryza rufipogon]
 gb|ABD16070.1| Kelch-motif containing protein [Oryza rufipogon]
Length=375

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16071.1| Kelch-motif containing protein [Oryza rufipogon]
Length=375

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPVEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16056.1| Kelch-motif containing protein [Oryza sativa Japonica Group]
Length=375

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKCKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WETI  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETIARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16061.1| Kelch-motif containing protein [Oryza sativa Indica Group]
Length=375

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 315/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV  EVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTKEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTRSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16058.1| Kelch-motif containing protein [Oryza sativa Indica Group]
Length=375

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKCKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTRSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16047.1| Kelch-motif containing protein [Oryza meridionalis]
 gb|ABD16055.1| Kelch-motif containing protein [Oryza sativa Japonica Group]
 gb|ABD16068.1| Kelch-motif containing protein [Oryza rufipogon]
Length=375

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKCKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|ABD16057.1| Kelch-motif containing protein [Oryza sativa Japonica Group]
Length=375

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 316/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLPGLPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKICMQPDVKPNKCKSRGSR-KERSRTQAPLLPGLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>gb|EEC74590.1| hypothetical protein OsI_10170 [Oryza sativa Indica Group]
Length=438

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 321/418 (77%), Gaps = 21/418 (5%)
 Frame = +2

Query  761   VDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPG  940
             V++ +C CRVD GLKTV  A+++VPG KLC+QP IKP+   +R    +++ RTQ+PLLPG
Sbjct  42    VESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIKPNKRKSRSSR-KERCRTQAPLLPG  100

Query  941   LPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDG  1120
             LPDDLAI CL+RVPR+EH  LRL                   KL +AEEW++V KRDRD 
Sbjct  101   LPDDLAITCLMRVPRLEHTNLRL-------------------KLGMAEEWVFVFKRDRDR  141

Query  1121  KVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYS  1300
             K+SWHAFDP++Q+W+ LPPVP EYSEA+GFGCAVLSGC+LYLFGGKDPV+GSMRRV+FY+
Sbjct  142   KISWHAFDPVHQVWKSLPPVPAEYSEAVGFGCAVLSGCYLYLFGGKDPVRGSMRRVVFYN  201

Query  1301  ARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISD  1480
             AR NKW RAPDML++RH FG CVINN LYVAGGE EG+  +LRSAE YDPN+NRWS IS+
Sbjct  202   ARINKWLRAPDMLQKRHCFGSCVINNRLYVAGGECEGIQRTLRSAEFYDPNRNRWSYISE  261

Query  1481  MSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNG  1660
             MST MVPFIGVVY GKW+LKGL +HRQV+SEVY P ++ W+   D MVTGWRNPS   NG
Sbjct  262   MSTGMVPFIGVVYDGKWFLKGLDSHRQVVSEVYMPTSNVWSVTADEMVTGWRNPSICFNG  321

Query  1661  RLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSI  1840
             RLY+ +CRDGCKLRVYD  T SW++ +DSR HLG S+A EAAAL+ L+GK+CIIRNNMSI
Sbjct  322   RLYSAECRDGCKLRVYDRDTRSWTRFMDSRRHLGNSRAFEAAALVSLNGKICIIRNNMSI  381

Query  1841  SLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             +LVDV+         S H+W+    KGQ ++ + N   ++AGR+  K+HI+HCQVLQ 
Sbjct  382   TLVDVSNTPTVIEINSAHMWDVFARKGQHRSFIANLWFTIAGRN-FKTHIIHCQVLQV  438



>ref|XP_002962792.1| hypothetical protein SELMODRAFT_438121 [Selaginella moellendorffii]
 gb|EFJ36255.1| hypothetical protein SELMODRAFT_438121 [Selaginella moellendorffii]
Length=469

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/441 (63%), Positives = 338/441 (77%), Gaps = 21/441 (5%)
 Frame = +2

Query  749   QPPLVDTTACLCRVDA-GLKTVAGAKRYVPGT-KLCL--QPAIKPSIHPTRQKPPRDKNR  916
              PP V++ +C CR +A    +   AK++VP T + C+  + AIKP   P  +   R ++ 
Sbjct  31    HPPQVESASCYCRAEAPNAISSHSAKKFVPATARHCVLQEEAIKPP--PAVRSRSRARSN  88

Query  917   TQSP-LLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWI  1093
               +P L+PGLPDDLAIACLIRVPR  H  LR+VCKRW+RLLAGNF+Y+ R+   +AEEW+
Sbjct  89    GSNPQLIPGLPDDLAIACLIRVPRFHHRALRIVCKRWHRLLAGNFFYTQRRIAGLAEEWV  148

Query  1094  YVIKRDRD---GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP  1264
             +VIKRD +   G++SWHAFDP +Q WQPLPP+P+E+ EALGFGCAVL GCHLYLFGGKDP
Sbjct  149   FVIKRDNEKEGGRISWHAFDPRFQQWQPLPPIPQEFCEALGFGCAVLGGCHLYLFGGKDP  208

Query  1265  VKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVY  1444
              KGSMRRV+FYSARTN+WHRAP+ML+RRHFFG  VI+NCL+VAGGE EGVH SLRSAEVY
Sbjct  209   AKGSMRRVVFYSARTNRWHRAPEMLKRRHFFGSGVIDNCLFVAGGECEGVHRSLRSAEVY  268

Query  1445  DPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMV  1624
             DP +NRWS ISDMSTAMVPFIGVVY G W++KGLG+HRQVMSEVY P  + W+ + DGMV
Sbjct  269   DPARNRWSYISDMSTAMVPFIGVVYGGNWFVKGLGSHRQVMSEVYIPGQNVWSPILDGMV  328

Query  1625  TGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLS  1804
             +GWRNPS  L G LYALDC DGCKLRVYD  +++W + +DS+ HLG S+ALEAAALLPL 
Sbjct  329   SGWRNPSVALGGTLYALDCPDGCKLRVYDPVSDTWKRSVDSKFHLGNSRALEAAALLPLD  388

Query  1805  GKLCIIRNNMSISLVDVAKCD-----------DAGAATSEHLWETIGGKGQFKTMVTNFL  1951
             GKLCI+RNNMSI++VDV                +  A    +WETI GKG FKT VTN L
Sbjct  389   GKLCIVRNNMSITVVDVGDGSYVGDGNDGSGGGSSNARISQVWETIAGKGHFKTFVTNLL  448

Query  1952  SSLAGRSRLKSHIVHCQVLQT  2014
             S++AGRSRLKSHIVHCQ L  
Sbjct  449   SNIAGRSRLKSHIVHCQALSA  469



>ref|XP_002962493.1| hypothetical protein SELMODRAFT_404324 [Selaginella moellendorffii]
 gb|EFJ35956.1| hypothetical protein SELMODRAFT_404324 [Selaginella moellendorffii]
Length=469

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/441 (64%), Positives = 339/441 (77%), Gaps = 21/441 (5%)
 Frame = +2

Query  749   QPPLVDTTACLCRVDA-GLKTVAGAKRYVPGT-KLCL--QPAIKPSIHPTRQKPPRDKNR  916
              PP V++ +C CR +A    +   AK++VP T + C+  + AIKP   P  +   R ++ 
Sbjct  31    HPPQVESASCYCRAEAPNAISSHSAKKFVPATARHCVLQEEAIKPP--PAVRSRSRARSN  88

Query  917   TQSP-LLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWI  1093
               +P L+PGLPDDLAIACLIRVPR  H  LR+VCKRW+RLLAGNF+Y+ R+   +AEEW+
Sbjct  89    GSNPQLIPGLPDDLAIACLIRVPRFHHRALRIVCKRWHRLLAGNFFYTQRRIAGLAEEWV  148

Query  1094  YVIKRDRD---GKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP  1264
             +VIKRD +   G++SWHAFDP +Q WQPLPP+P+E+ EALGFGCAVL GCHLYLFGGKDP
Sbjct  149   FVIKRDNEKEGGRISWHAFDPRFQQWQPLPPIPQEFCEALGFGCAVLGGCHLYLFGGKDP  208

Query  1265  VKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVY  1444
              KGSMRRV+FYSARTN+WHRAP+ML+RRHFFG  VI+NCL+VAGGE EGVH SLRSAEVY
Sbjct  209   AKGSMRRVVFYSARTNRWHRAPEMLKRRHFFGSGVIDNCLFVAGGECEGVHRSLRSAEVY  268

Query  1445  DPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMV  1624
             DP +NRWS ISDMSTAMVPFIGVVY G W++KGLG+HRQVMSEVY P  + W+ + DGMV
Sbjct  269   DPARNRWSYISDMSTAMVPFIGVVYGGNWFVKGLGSHRQVMSEVYIPGQNVWSPILDGMV  328

Query  1625  TGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLS  1804
             TGWRNPS  L G LYALDC DGCKLRVYD  +++W + +DS+ HLG S+ALEAAALLPL 
Sbjct  329   TGWRNPSVALGGTLYALDCPDGCKLRVYDPGSDTWKRSVDSKFHLGNSRALEAAALLPLD  388

Query  1805  GKLCIIRNNMSISLVDVAKCD-----------DAGAATSEHLWETIGGKGQFKTMVTNFL  1951
             GKLCI+RNNMSI++VDV                +G A    +WETI GKG FKT VTN L
Sbjct  389   GKLCIVRNNMSITVVDVGDGSYVGDGNDGSGGGSGNARISQVWETIAGKGHFKTFVTNLL  448

Query  1952  SSLAGRSRLKSHIVHCQVLQT  2014
             S++AGRSRLKSHIVHCQ L  
Sbjct  449   SNIAGRSRLKSHIVHCQALSA  469



>ref|XP_006842862.1| hypothetical protein AMTR_s00081p00156000 [Amborella trichopoda]
 gb|ERN04537.1| hypothetical protein AMTR_s00081p00156000 [Amborella trichopoda]
Length=311

 Score =   548 bits (1411),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 284/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  1076  IAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGG  1255
             +AEEWIYVIKRD++GK+SWHAFDP+YQLWQPLPPVP EYSEALGFGCAVLSGCHLYLFGG
Sbjct  1     MAEEWIYVIKRDKEGKISWHAFDPVYQLWQPLPPVPGEYSEALGFGCAVLSGCHLYLFGG  60

Query  1256  KDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSA  1435
             KDP+KGSMRRVIFYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGE EG   SLRSA
Sbjct  61    KDPLKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGNPRSLRSA  120

Query  1436  EVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYD  1615
             EVYDPNKNRWS I+DMSTAMVPFIGVVY+G+W+LKGLG+HRQVMSEVY PE++ WN VYD
Sbjct  121   EVYDPNKNRWSFIADMSTAMVPFIGVVYEGRWFLKGLGSHRQVMSEVYIPESNNWNPVYD  180

Query  1616  GMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALL  1795
             GMV GWRNPS ++NG LYALDC+DGCK+RVYD AT+SWS+HIDSR+HLG S+ALEAAAL+
Sbjct  181   GMVAGWRNPSVSINGELYALDCKDGCKIRVYDGATDSWSRHIDSRLHLGNSRALEAAALV  240

Query  1796  PLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSR  1975
             PL+GKLCIIRNNMSI+LVDV+K D++       LWETI GKG FKT VTN  SS+AGR+R
Sbjct  241   PLNGKLCIIRNNMSITLVDVSKSDESRRVG--QLWETIAGKGHFKTFVTNLWSSIAGRNR  298

Query  1976  LKSHIVHCQVLQT  2014
             LKSHIVHCQVLQ 
Sbjct  299   LKSHIVHCQVLQA  311



>gb|ACU23020.1| unknown [Glycine max]
Length=342

 Score =   535 bits (1379),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 244/340 (72%), Positives = 291/340 (86%), Gaps = 1/340 (0%)
 Frame = +2

Query  707   FVEMTDRSRMDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPT  886
              VE +  ++    +Q PLVD+ +C C+VD+GLKTV GA+++VPG+KLC+QP I P+ H +
Sbjct  4     LVESSTTTQRVSRVQAPLVDSVSCYCKVDSGLKTVVGARKFVPGSKLCIQPDINPNAHRS  63

Query  887   RQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRK  1066
             +    R++ R Q PLLPGLPD+LAIACLIRVPR+EH KLRLVCKRWYRLL+GNF+YSLR+
Sbjct  64    KNSR-RERTRVQPPLLPGLPDELAIACLIRVPRVEHSKLRLVCKRWYRLLSGNFFYSLRR  122

Query  1067  KLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYL  1246
              L +AEEW+YVIKRDRDG++S HAFDPIYQLWQ LPPVP EYSEALGFGCAVLSGCHLYL
Sbjct  123   SLGMAEEWVYVIKRDRDGRISLHAFDPIYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYL  182

Query  1247  FGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSL  1426
             FGG+DP+KGSMRRVIFY+ARTNKWHRAPDM R+RH FG CVINNCLYVAGGE EG+  +L
Sbjct  183   FGGRDPLKGSMRRVIFYNARTNKWHRAPDMPRKRHLFGSCVINNCLYVAGGECEGIQRTL  242

Query  1427  RSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNT  1606
             RSAEVYDPN+NRWS IS+M+TAMVPFIGVV+ G W+LKGLG++R V+ E Y  ETDTW  
Sbjct  243   RSAEVYDPNRNRWSFISEMTTAMVPFIGVVHNGTWFLKGLGSNRNVICESYSQETDTWTP  302

Query  1607  VYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNS  1726
             V +GMV GWRNPS +LNG+LYALDC+DGCKL+VYD AT+S
Sbjct  303   VSNGMVNGWRNPSISLNGQLYALDCQDGCKLKVYDRATDS  342



>gb|ABD16059.1| Kelch-motif containing protein [Oryza sativa Indica Group]
Length=375

 Score =   533 bits (1372),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 315/375 (84%), Gaps = 1/375 (0%)
 Frame = +2

Query  839   TKLCLQPAIKPSIHPTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCK  1018
             +K+C+QP +KP+   +R    ++++RTQ+PLLP LPDDLAIACLIRVPR+EH  LR+VCK
Sbjct  2     SKMCMQPDVKPNKRKSRGSR-KERSRTQAPLLPLLPDDLAIACLIRVPRVEHPNLRIVCK  60

Query  1019  RWYRLLAGNFYYSLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSE  1198
             RW RLL+GN+YYSLRK+  +AEEW+YV KRDR+GK+SWHAFDP++QLW+ LPPVP EYSE
Sbjct  61    RWNRLLSGNYYYSLRKRNGMAEEWVYVFKRDREGKISWHAFDPLHQLWKSLPPVPAEYSE  120

Query  1199  ALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINN  1378
             ALGFGCAVLSGC+LYLFGGKDP++GSMRRV+FY+ARTNKWHRAPDMLR+RHFFG CVINN
Sbjct  121   ALGFGCAVLSGCYLYLFGGKDPLRGSMRRVVFYNARTNKWHRAPDMLRKRHFFGSCVINN  180

Query  1379  CLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHR  1558
             CLYVAGGE EG+  +L SAEVYDPN+NRW+ +++M+  MVPFIGVVY GKW+LKGL +HR
Sbjct  181   CLYVAGGECEGIQRTLPSAEVYDPNRNRWACVAEMNNGMVPFIGVVYDGKWFLKGLDSHR  240

Query  1559  QVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKH  1738
             QV SEVY P ++ W+T+ D MVTGWRNPS T NG+LY+ DCRDGCKLRVYD  T +W+K 
Sbjct  241   QVTSEVYLPSSNLWSTIDDEMVTGWRNPSITFNGKLYSSDCRDGCKLRVYDPNTGTWAKF  300

Query  1739  IDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGK  1918
             +DS+ HLG+S+A EAAAL+ L+GKLCI+RNNMSI+LVD++    +    S  +WET+  K
Sbjct  301   MDSKHHLGSSRAFEAAALVTLNGKLCIVRNNMSITLVDISDPTMSIETDSARMWETVARK  360

Query  1919  GQFKTMVTNFLSSLA  1963
             GQ ++ V N  S++A
Sbjct  361   GQHRSFVANLWSTIA  375



>dbj|BAJ98018.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92787.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   532 bits (1371),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 256/435 (59%), Positives = 323/435 (74%), Gaps = 17/435 (4%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKN  913
             MDR IQ PLVD++ACLCR +     VA A R+VP ++ C+Q +++ SIHP   K     +
Sbjct  1     MDRRIQAPLVDSSACLCRAERA-AGVASAGRHVPRSRPCVQSSLRASIHPLSDKRSSRAD  59

Query  914   RT---QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAE  1084
             R    Q PLLPGLPDDLAIACLIRVPR +HCKL+LVC+RW RLLAGN++Y+LR +L +AE
Sbjct  60    RRSDGQRPLLPGLPDDLAIACLIRVPRGDHCKLKLVCRRWLRLLAGNYFYALRGRLGLAE  119

Query  1085  EWIYVIKRDRDGKVSWHAFDPIYQ---LWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGG  1255
             +W+Y  + D DG+VSW   DP  +    W+ +PPVP EY+ A GF CAVL GCHLYL GG
Sbjct  120   QWLYAFRSDGDGRVSWDVLDPAARGGAAWREMPPVPGEYASAAGFSCAVLGGCHLYLLGG  179

Query  1256  KDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSA  1435
             +DP +G+MRRV+FYSAR+N+WHRAPDMLRRRH FG CV+ N LYVA    E   G LRSA
Sbjct  180   RDPRRGAMRRVVFYSARSNRWHRAPDMLRRRHCFGTCVMGNRLYVA--GGESGGGGLRSA  237

Query  1436  EVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTV--  1609
             EV+DP KNRWSL+SDM+ A+VPF+ VV+ G+WY+KGLG  RQV+S+VY PE D W+TV  
Sbjct  238   EVFDPAKNRWSLVSDMARALVPFVSVVHGGRWYVKGLGAERQVLSQVYTPEMDKWSTVAT  297

Query  1610  YDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAA  1789
              D MVTGWR+PS  ++GRLYA DC+DGC+LR YDEA +SWS    S  HLG+S ALEA A
Sbjct  298   LDSMVTGWRSPSACIDGRLYAADCKDGCRLRAYDEAADSWSGCASSGNHLGSSHALEAVA  357

Query  1790  LLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGR  1969
             ++ L GKLC++RN+MS+ +VDVA      A      WET+ GKGQ K+ VTN L+S+AGR
Sbjct  358   MVTLRGKLCVVRNDMSVLVVDVA------AGAGNQRWETLAGKGQIKSFVTNLLASIAGR  411

Query  1970  SRLKSHIVHCQVLQT  2014
             SR K+ ++HCQVL+ 
Sbjct  412   SRAKNRVLHCQVLEA  426



>gb|EYU39246.1| hypothetical protein MIMGU_mgv1a006629mg [Erythranthe guttata]
Length=312

 Score =   517 bits (1332),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 236/313 (75%), Positives = 274/313 (88%), Gaps = 1/313 (0%)
 Frame = +2

Query  1076  IAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGG  1255
             +AEEW+YV+KRD+D ++SWHAFDP YQLWQPLPPVP +YS ALGFGCAVLSGCHLYLFGG
Sbjct  1     MAEEWVYVVKRDKDNRISWHAFDPTYQLWQPLPPVPVDYSSALGFGCAVLSGCHLYLFGG  60

Query  1256  KDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSA  1435
             KDP+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVINNCLYVAGGE EG+  +LRSA
Sbjct  61    KDPLKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVINNCLYVAGGECEGIQRTLRSA  120

Query  1436  EVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYD  1615
             EVYDPN+NRWS I+DMSTAMVPFIGVVY GKW+LKGLG HR+V+SE Y PE++ W+ + D
Sbjct  121   EVYDPNRNRWSFIADMSTAMVPFIGVVYDGKWFLKGLGAHREVLSEAYTPESNLWSPIND  180

Query  1616  GMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALL  1795
             GMV+GWRNPS ++NG+LYALDCRDGCKLRVYDE T+SWS+ IDS++HLG S+ALEAAAL+
Sbjct  181   GMVSGWRNPSISMNGKLYALDCRDGCKLRVYDEKTDSWSRFIDSKIHLGNSRALEAAALV  240

Query  1796  PLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSR  1975
             P++GKLCIIRNNMSIS+VDV+  D   A  S  +WE I  KG F+ + TN  SS+AGRS 
Sbjct  241   PINGKLCIIRNNMSISMVDVSGTDKR-AEGSSGIWENIAIKGHFRNLFTNLWSSIAGRSG  299

Query  1976  LKSHIVHCQVLQT  2014
             LKSHIVHCQVLQ 
Sbjct  300   LKSHIVHCQVLQA  312



>gb|EYU29783.1| hypothetical protein MIMGU_mgv1a010673mg [Erythranthe guttata]
Length=305

 Score =   516 bits (1329),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 236/306 (77%), Positives = 272/306 (89%), Gaps = 2/306 (1%)
 Frame = +2

Query  1100  IKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKGSM  1279
             +KRDRDGK+SWHA+DP++ LWQPLPP+P+EYSEAL FG AVLSGCHLYLFGGKDP+KGSM
Sbjct  1     MKRDRDGKLSWHAYDPMHHLWQPLPPLPREYSEALDFGSAVLSGCHLYLFGGKDPIKGSM  60

Query  1280  RRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNKN  1459
             RRV+FYSARTNKWHRAPDMLRRRHFFG CVINNCLYVAGGENEG H SL+SAEVYDPNKN
Sbjct  61    RRVVFYSARTNKWHRAPDMLRRRHFFGCCVINNCLYVAGGENEGTHRSLKSAEVYDPNKN  120

Query  1460  RWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWRN  1639
             RWS ISDM TAMVP+IGVVYQGKW+LKG+G+HRQV+SEVY+PETD WN VYDGMV GWR+
Sbjct  121   RWSFISDMKTAMVPYIGVVYQGKWFLKGIGSHRQVLSEVYEPETDRWNNVYDGMVAGWRH  180

Query  1640  PSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSR-MHLGTSKALEAAALLPLSGKLC  1816
             P  T++G LY LDC+DGCKLR+YDE + SW+KH++S+ MHLG SKA EAAA+LPL+GKLC
Sbjct  181   PCATIDGNLYGLDCKDGCKLRIYDETSGSWTKHLESKIMHLGNSKAFEAAAVLPLNGKLC  240

Query  1817  IIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVH  1996
             IIRNNMSISLVDV+K D  G A ++HLWE I  KG  KT+ TNFLS+LAGR+R K+ +VH
Sbjct  241   IIRNNMSISLVDVSKYDH-GNAAADHLWENISEKGHLKTLFTNFLSNLAGRNRFKNRVVH  299

Query  1997  CQVLQT  2014
             CQVLQ 
Sbjct  300   CQVLQA  305



>ref|NP_001046235.1| Os02g0202900 [Oryza sativa Japonica Group]
 dbj|BAF08149.1| Os02g0202900 [Oryza sativa Japonica Group]
Length=436

 Score =   516 bits (1330),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 319/447 (71%), Gaps = 31/447 (7%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAK--RYVPGTKLCLQPAIKPSIHPTRQK--PP  901
             MDR  Q P VD++ACLCRV+   ++VAGA   R +P  K C QP+++ SIHP + K  P 
Sbjct  1     MDRRNQAPPVDSSACLCRVE---RSVAGAAAARLMPRAKACAQPSLRASIHPLKPKRSPG  57

Query  902   RDKNRT---------QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYY  1054
             RD             Q PL+PGLPDDLA+ACLIRVPR +H KLRLVC+RW RLLAGN++Y
Sbjct  58    RDHRGGGGAGGGGGRQCPLIPGLPDDLAVACLIRVPRGDHWKLRLVCRRWSRLLAGNYFY  117

Query  1055  SLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGC  1234
              LR++L +AE+W+Y +KRD +G+VSW   DP    W+ LPPVP EY+ A GFGCAVL GC
Sbjct  118   GLRRRLGLAEQWVYAVKRDGEGRVSWDVLDPARLAWRALPPVPGEYAGAAGFGCAVLGGC  177

Query  1235  HLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVA----GGE  1402
             HLYL GG DP +G MRRV+FYSAR+N+WHRAPDMLRRRH FG CV+ N LYVA     G 
Sbjct  178   HLYLLGGSDPRRGPMRRVVFYSARSNRWHRAPDMLRRRHGFGCCVMGNRLYVAGGEGCGV  237

Query  1403  NEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQ  1582
               G  G LRS EV+DP KNRWS +SDM+ +++PF+  V+ G+WY+KGLG  RQVMS+VY 
Sbjct  238   GGGGGGGLRSVEVFDPAKNRWSFVSDMAASLMPFVSAVHGGRWYVKGLGAQRQVMSQVYS  297

Query  1583  PETDTWNTVY--DGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMH  1756
             PE D W+  +  D MVTGWR+PS +L GRLYA DC+DGC+LR YDEA  +WS  +D   H
Sbjct  298   PEADAWSAAHELDAMVTGWRSPSASLGGRLYAADCKDGCRLRAYDEAAGAWSGRVDGGQH  357

Query  1757  LGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTM  1936
              G+S A+EAAA++ L GKLC++RN+MS+S+VDV        A +   WET+ GKGQ K  
Sbjct  358   AGSSHAVEAAAMVALHGKLCVVRNDMSVSVVDV--------AAASPRWETVVGKGQMKAF  409

Query  1937  VTNFLSSLA-GRSRLKSHIVHCQVLQT  2014
             V N LS++A GR R K+ ++HCQVL+ 
Sbjct  410   VANLLSAIAGGRGRAKNRVLHCQVLEA  436



>gb|EAY84922.1| hypothetical protein OsI_06290 [Oryza sativa Indica Group]
Length=436

 Score =   516 bits (1328),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 320/447 (72%), Gaps = 31/447 (7%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAK--RYVPGTKLCLQPAIKPSIHPTRQK--PP  901
             MDR  Q P VD++ACLCRV+   ++VAGA   R +P  K C QP+++ SIHP + K  P 
Sbjct  1     MDRRNQAPPVDSSACLCRVE---RSVAGAAAARLMPRAKACAQPSLRASIHPLKPKRSPG  57

Query  902   RDKNRT---------QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYY  1054
             RD             Q PL+PGLPDDLA+ACLIRVPR +H KLRLVC+RW RLLAGN++Y
Sbjct  58    RDHRGGGGAGGGGGRQCPLIPGLPDDLAVACLIRVPRGDHWKLRLVCRRWSRLLAGNYFY  117

Query  1055  SLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGC  1234
              LR++L +AE+W+Y +KR+ +G+VSW   DP  + W+ LPPVP EY+ A GFGCAVL GC
Sbjct  118   GLRRRLGLAEQWVYAVKREGEGRVSWDVLDPARRAWRALPPVPGEYAGAAGFGCAVLGGC  177

Query  1235  HLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVA----GGE  1402
             HLYL GG DP +G MRRV+FYSAR+N+WHRAPDMLRRRH FG CV+ N LYVA     G 
Sbjct  178   HLYLLGGSDPRRGPMRRVVFYSARSNRWHRAPDMLRRRHGFGCCVMGNRLYVAGGEGCGV  237

Query  1403  NEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQ  1582
               G  G LRS EV+DP KNRWS +SDM+ +++PF+  V+ G+WY+KGLG  RQVMS+VY 
Sbjct  238   GGGGGGGLRSVEVFDPAKNRWSFVSDMAASLMPFVSAVHGGRWYVKGLGAQRQVMSQVYS  297

Query  1583  PETDTWNTVY--DGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMH  1756
             PE D W+  +  D MVTGWR+PS +L GRLYA DC+DGC+LR YDEA  +WS  +D   H
Sbjct  298   PEADEWSAAHELDAMVTGWRSPSASLGGRLYAADCKDGCRLRAYDEAAGAWSGRVDGGQH  357

Query  1757  LGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTM  1936
              G+S A+EAAA++ L GKLC++RN+MS+S+VDV        A +   WET+ GKGQ K  
Sbjct  358   AGSSHAVEAAAMVALHGKLCVVRNDMSVSVVDV--------AAASPRWETVVGKGQMKAF  409

Query  1937  VTNFLSSLA-GRSRLKSHIVHCQVLQT  2014
             V N LS++A GR R K+ ++HCQVL+ 
Sbjct  410   VANLLSAIAGGRGRAKNRVLHCQVLEA  436



>dbj|BAD15502.1| putative kelch repeat-containing F-box family protein [Oryza 
sativa Japonica Group]
Length=450

 Score =   516 bits (1328),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 319/447 (71%), Gaps = 31/447 (7%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAK--RYVPGTKLCLQPAIKPSIHPTRQK--PP  901
             MDR  Q P VD++ACLCRV+   ++VAGA   R +P  K C QP+++ SIHP + K  P 
Sbjct  15    MDRRNQAPPVDSSACLCRVE---RSVAGAAAARLMPRAKACAQPSLRASIHPLKPKRSPG  71

Query  902   RDKNRT---------QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYY  1054
             RD             Q PL+PGLPDDLA+ACLIRVPR +H KLRLVC+RW RLLAGN++Y
Sbjct  72    RDHRGGGGAGGGGGRQCPLIPGLPDDLAVACLIRVPRGDHWKLRLVCRRWSRLLAGNYFY  131

Query  1055  SLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGC  1234
              LR++L +AE+W+Y +KRD +G+VSW   DP    W+ LPPVP EY+ A GFGCAVL GC
Sbjct  132   GLRRRLGLAEQWVYAVKRDGEGRVSWDVLDPARLAWRALPPVPGEYAGAAGFGCAVLGGC  191

Query  1235  HLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVA----GGE  1402
             HLYL GG DP +G MRRV+FYSAR+N+WHRAPDMLRRRH FG CV+ N LYVA     G 
Sbjct  192   HLYLLGGSDPRRGPMRRVVFYSARSNRWHRAPDMLRRRHGFGCCVMGNRLYVAGGEGCGV  251

Query  1403  NEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQ  1582
               G  G LRS EV+DP KNRWS +SDM+ +++PF+  V+ G+WY+KGLG  RQVMS+VY 
Sbjct  252   GGGGGGGLRSVEVFDPAKNRWSFVSDMAASLMPFVSAVHGGRWYVKGLGAQRQVMSQVYS  311

Query  1583  PETDTWNTVY--DGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMH  1756
             PE D W+  +  D MVTGWR+PS +L GRLYA DC+DGC+LR YDEA  +WS  +D   H
Sbjct  312   PEADAWSAAHELDAMVTGWRSPSASLGGRLYAADCKDGCRLRAYDEAAGAWSGRVDGGQH  371

Query  1757  LGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTM  1936
              G+S A+EAAA++ L GKLC++RN+MS+S+VDV        A +   WET+ GKGQ K  
Sbjct  372   AGSSHAVEAAAMVALHGKLCVVRNDMSVSVVDV--------AAASPRWETVVGKGQMKAF  423

Query  1937  VTNFLSSLA-GRSRLKSHIVHCQVLQT  2014
             V N LS++A GR R K+ ++HCQVL+ 
Sbjct  424   VANLLSAIAGGRGRAKNRVLHCQVLEA  450



>ref|XP_004951526.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Setaria 
italica]
Length=426

 Score =   504 bits (1297),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 247/426 (58%), Positives = 322/426 (76%), Gaps = 14/426 (3%)
 Frame = +2

Query  755   PLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKP---PRDKNRT-Q  922
             PLVD++ACLCRV+      A  +     +K C+QP+++ SIHP + K    P D++R  Q
Sbjct  9     PLVDSSACLCRVNRSSAAAAARRLPA--SKACVQPSLRASIHPLKPKASPRPGDRSRGGQ  66

Query  923   SPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWIYVI  1102
              PLLPGLPDDLAIACLIRVPR +H KLRLVC+RW RLLAGN++Y LR++L +AE+W+Y +
Sbjct  67    CPLLPGLPDDLAIACLIRVPRADHWKLRLVCRRWCRLLAGNYFYGLRRRLGLAEQWVYAV  126

Query  1103  KRD-RDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKG-S  1276
             +RD +DG VSW   DP    W+ LPP+P+EY+ A GFGCAVL GCHLYL GG DP +G +
Sbjct  127   RRDGKDGHVSWDVLDPCRGAWRALPPLPQEYAGADGFGCAVLGGCHLYLLGGADPRRGGA  186

Query  1277  MRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYDPNK  1456
             MRRV+FYSAR+N+WHRAPDMLRRR  FG CVI N LYVAGGE+ G    LRSAEV+DP K
Sbjct  187   MRRVVFYSARSNRWHRAPDMLRRRQCFGTCVIGNRLYVAGGESGGGG-GLRSAEVFDPAK  245

Query  1457  NRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMVTGWR  1636
             NRWS +++M+ AMVPF+  V+ G+WY+KGLG  ++V+S+ Y PETD+W+ V DG VTGWR
Sbjct  246   NRWSFVAEMAAAMVPFLSAVHGGRWYVKGLGAQQEVLSQAYSPETDSWSVVLDGRVTGWR  305

Query  1637  NPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLSGKLC  1816
             +PS  L GR+YA DC+DGC+LR YD+A ++W+  +DS+ H G+S+A EAAA++ L G+LC
Sbjct  306   SPSACLGGRIYAADCKDGCRLRTYDDAADAWTTCVDSKQHRGSSQAAEAAAIVVLHGRLC  365

Query  1817  IIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKSHIVH  1996
             ++RN+MS+S VDVA    AGA   +  WET+ GK   K+ VT  LS+LAGR R K+HI+H
Sbjct  366   VVRNDMSVSAVDVA----AGAGNLQG-WETLAGKAHAKSFVTGLLSNLAGRGRAKNHILH  420

Query  1997  CQVLQT  2014
             CQVL+ 
Sbjct  421   CQVLEA  426



>ref|XP_008643766.1| PREDICTED: ring canal kelch isoform X1 [Zea mays]
 gb|AFW70653.1| ring canal kelch isoform 1 [Zea mays]
 gb|AFW70654.1| ring canal kelch isoform 2 [Zea mays]
Length=418

 Score =   499 bits (1285),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 245/431 (57%), Positives = 322/431 (75%), Gaps = 17/431 (4%)
 Frame = +2

Query  734   MDRVIQP-PLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDK  910
             MDR  +P PLVD++AC CRVD    + A A R +P +K C+QP+++ SIHP + +P  ++
Sbjct  1     MDRRNRPAPLVDSSACFCRVDR--SSAAAAARRIPVSKACVQPSLRASIHPLKPRPGAER  58

Query  911   NRTQS-PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEE  1087
             +R  + PLLPGLPDDLAIACLIRVPR +H KLRLVC++W RLLAGN++Y LR++L +AE+
Sbjct  59    SRGGACPLLPGLPDDLAIACLIRVPRADHWKLRLVCRKWCRLLAGNYFYGLRRRLGLAEQ  118

Query  1088  WIYVIKRD-RDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP  1264
             W+Y +KRD RDG+VSW   DP    W+ LPPVP EY+EA GFGCAVL GCHLYL GG+DP
Sbjct  119   WLYAVKRDGRDGRVSWDVLDPSRGEWRALPPVPGEYAEADGFGCAVLGGCHLYLLGGRDP  178

Query  1265  VKGS-MRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEV  1441
              +GS MRRV+FYSAR+N+WHRAPDMLRRR FF  CV+ N LYVA    EG  G LRSAEV
Sbjct  179   RRGSAMRRVVFYSARSNRWHRAPDMLRRRQFFDVCVMGNRLYVA--GGEGGGGGLRSAEV  236

Query  1442  YDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGM  1621
             +DP KNRWS +++M+  M PF+  V+ G+W++KG+G  +QV+S+ Y PE+D+W+ V DGM
Sbjct  237   FDPAKNRWSFVAEMAAPMAPFVSAVHGGRWFVKGIGAQQQVLSQAYSPESDSWSIVLDGM  296

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             VTGWR+ S  LNGRLYA +C DGC+LR YDEA ++WS   DS+ H G+S   +AAA++ L
Sbjct  297   VTGWRSASACLNGRLYAAECMDGCRLRAYDEAVDAWSTCADSKQHRGSS---QAAAIVAL  353

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLK  1981
              G+L ++RN+MS+S V VA      A   +  W+T+ GK   K+ VT  LS+LAGRSR K
Sbjct  354   HGRLFVVRNDMSVSAVQVA------AEAGKQRWQTLAGKAHTKSFVTGLLSNLAGRSRAK  407

Query  1982  SHIVHCQVLQT  2014
             ++I+HCQVL+ 
Sbjct  408   NNILHCQVLEV  418



>ref|NP_001150390.1| ring canal kelch [Zea mays]
 gb|ACG38914.1| ring canal kelch [Zea mays]
Length=418

 Score =   497 bits (1280),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/431 (57%), Positives = 322/431 (75%), Gaps = 17/431 (4%)
 Frame = +2

Query  734   MDRVIQP-PLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDK  910
             MDR  +P PLVD++AC CRVD    + A A R +P +K C+QP+++ SIHP + +P  ++
Sbjct  1     MDRRNRPAPLVDSSACFCRVDR--SSAAAAARRIPVSKACVQPSLRASIHPLKPRPGAER  58

Query  911   NRTQS-PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEE  1087
             +R  + PLLPGLPDDLAIACLIRVPR +H KLRLVC++W RLLAGN++Y LR++L +AE+
Sbjct  59    SRGGACPLLPGLPDDLAIACLIRVPRADHWKLRLVCRKWCRLLAGNYFYGLRRRLGLAEQ  118

Query  1088  WIYVIKRD-RDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDP  1264
             W+Y +KRD RDG+VSW   DP    W+ LPPVP EY+EA GFGCAVL GCHLYL GG+DP
Sbjct  119   WLYAVKRDGRDGRVSWDVLDPSRGEWRALPPVPGEYAEADGFGCAVLGGCHLYLLGGRDP  178

Query  1265  VKGS-MRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEV  1441
              +GS MRRV+FYSAR+N+WHRAPDMLRRR FF  CV+ N LYVA    EG  G LRSAEV
Sbjct  179   RRGSAMRRVVFYSARSNRWHRAPDMLRRRQFFDVCVMGNRLYVA--GGEGGGGGLRSAEV  236

Query  1442  YDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGM  1621
             +DP KNRWS +++M+  M PF+  V+ G+W++KG+G  +QV+S+ Y P +D+W+ V DGM
Sbjct  237   FDPAKNRWSFVAEMAAPMAPFVSAVHGGRWFVKGIGAQQQVLSQAYSPVSDSWSIVLDGM  296

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             VTGWR+PS  LNGRLYA +C DGC+LR YDEA ++WS   DS+ H G+S   +AAA++ L
Sbjct  297   VTGWRSPSACLNGRLYAAECMDGCRLRAYDEAVDAWSTCADSKQHRGSS---QAAAIVAL  353

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLK  1981
              G+L ++RN+MS+S V VA      A   +  W+T+ GK   K+ VT  LS+L+GRSR K
Sbjct  354   HGRLFVVRNDMSVSAVQVA------AEAGKQRWQTLAGKAHTKSFVTGLLSNLSGRSRAK  407

Query  1982  SHIVHCQVLQT  2014
             ++I+HCQVL+ 
Sbjct  408   NNILHCQVLEV  418



>ref|XP_008643767.1| PREDICTED: ring canal kelch isoform X2 [Zea mays]
Length=417

 Score =   493 bits (1268),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 241/430 (56%), Positives = 318/430 (74%), Gaps = 16/430 (4%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAKRYVPGTKLCLQPAIKPSIHPTRQKPPRDKN  913
             M   + P  VD++AC CRVD    + A A R +P +K C+QP+++ SIHP + +P  +++
Sbjct  1     MPSNLVPHKVDSSACFCRVDR--SSAAAAARRIPVSKACVQPSLRASIHPLKPRPGAERS  58

Query  914   RTQS-PLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEW  1090
             R  + PLLPGLPDDLAIACLIRVPR +H KLRLVC++W RLLAGN++Y LR++L +AE+W
Sbjct  59    RGGACPLLPGLPDDLAIACLIRVPRADHWKLRLVCRKWCRLLAGNYFYGLRRRLGLAEQW  118

Query  1091  IYVIKRD-RDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPV  1267
             +Y +KRD RDG+VSW   DP    W+ LPPVP EY+EA GFGCAVL GCHLYL GG+DP 
Sbjct  119   LYAVKRDGRDGRVSWDVLDPSRGEWRALPPVPGEYAEADGFGCAVLGGCHLYLLGGRDPR  178

Query  1268  KGS-MRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVY  1444
             +GS MRRV+FYSAR+N+WHRAPDMLRRR FF  CV+ N LYVA    EG  G LRSAEV+
Sbjct  179   RGSAMRRVVFYSARSNRWHRAPDMLRRRQFFDVCVMGNRLYVA--GGEGGGGGLRSAEVF  236

Query  1445  DPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYDGMV  1624
             DP KNRWS +++M+  M PF+  V+ G+W++KG+G  +QV+S+ Y PE+D+W+ V DGMV
Sbjct  237   DPAKNRWSFVAEMAAPMAPFVSAVHGGRWFVKGIGAQQQVLSQAYSPESDSWSIVLDGMV  296

Query  1625  TGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPLS  1804
             TGWR+ S  LNGRLYA +C DGC+LR YDEA ++WS   DS+ H G+S   +AAA++ L 
Sbjct  297   TGWRSASACLNGRLYAAECMDGCRLRAYDEAVDAWSTCADSKQHRGSS---QAAAIVALH  353

Query  1805  GKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVTNFLSSLAGRSRLKS  1984
             G+L ++RN+MS+S V VA      A   +  W+T+ GK   K+ VT  LS+LAGRSR K+
Sbjct  354   GRLFVVRNDMSVSAVQVA------AEAGKQRWQTLAGKAHTKSFVTGLLSNLAGRSRAKN  407

Query  1985  HIVHCQVLQT  2014
             +I+HCQVL+ 
Sbjct  408   NILHCQVLEV  417



>gb|EEE56522.1| hypothetical protein OsJ_05806 [Oryza sativa Japonica Group]
Length=406

 Score =   463 bits (1192),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 234/445 (53%), Positives = 296/445 (67%), Gaps = 57/445 (13%)
 Frame = +2

Query  734   MDRVIQPPLVDTTACLCRVDAGLKTVAGAK--RYVPGTKLCLQPAIKPSIHPTRQK--PP  901
             MDR  Q P VD++ACLCRV+   ++VAGA   R +P  K C QP+++ SIHP + K  P 
Sbjct  1     MDRRNQAPPVDSSACLCRVE---RSVAGAAAARLMPRAKACAQPSLRASIHPLKPKRSPG  57

Query  902   RDKNRT---------QSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYY  1054
             RD             Q PL+PGLPDDLA+ACLIRVPR +H KLRLVC+RW RLLAGN++Y
Sbjct  58    RDHRGGGGAGGGGARQCPLIPGLPDDLAVACLIRVPRGDHWKLRLVCRRWSRLLAGNYFY  117

Query  1055  SLRKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGC  1234
              LR++L +AE+W+Y +KRD +G+VSW   DP    W+ LPPVP EY+ A GFGCAVL GC
Sbjct  118   GLRRRLGLAEQWVYAVKRDGEGRVSWDVLDPARLAWRALPPVPGEYAGAAGFGCAVLGGC  177

Query  1235  HLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVA----GGE  1402
             HLYL GG DP +G MRRV+FYSAR+N+WHRAPDMLRRRH FG CV+ N LYVA     G 
Sbjct  178   HLYLLGGSDPRRGPMRRVVFYSARSNRWHRAPDMLRRRHGFGCCVMGNRLYVAGGEGCGV  237

Query  1403  NEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQ  1582
               G  G LRS EV+DP KNRWS +SDM+ +++PF+  V+ G+WY+KGLG  RQVMS+VY 
Sbjct  238   GGGGGGGLRSVEVFDPAKNRWSFVSDMAASLMPFVSAVHGGRWYVKGLGAQRQVMSQVYS  297

Query  1583  PETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLG  1762
             PE D W                             GC+LR YDEA  +WS  +D   H G
Sbjct  298   PEADAWT----------------------------GCRLRAYDEAAGAWSGRVDGGQHAG  329

Query  1763  TSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFKTMVT  1942
             +S A+EAAA++ L GKLC++RN+MS+S+VDV        A +   WET+ GKGQ K  V 
Sbjct  330   SSHAVEAAAMVALHGKLCVVRNDMSVSVVDV--------AAASPRWETVVGKGQMKAFVA  381

Query  1943  NFLSSLA-GRSRLKSHIVHCQVLQT  2014
             N LS++A GR R K+ ++HCQVL+ 
Sbjct  382   NLLSAIAGGRGRAKNRVLHCQVLEA  406



>ref|XP_006598348.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
Length=687

 Score =   467 bits (1201),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 287/384 (75%), Gaps = 9/384 (2%)
 Frame = +2

Query  881   PTRQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSL  1060
             P R+  PR+  R Q PLLPGLPDDLA+ CLIRVPRIEH KL LVCKRW RLL+ +F+YSL
Sbjct  307   PLRENSPREMTRVQLPLLPGLPDDLAVTCLIRVPRIEHRKLHLVCKRWRRLLSEDFFYSL  366

Query  1061  RKKLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHL  1240
             RK L +AEEW+YVIK DR G++S HAFDPIYQLWQPLPPVP ++ EA+ FG AVLSG HL
Sbjct  367   RKSLGMAEEWLYVIKADRAGRISVHAFDPIYQLWQPLPPVPGDFPEAMWFGSAVLSGFHL  426

Query  1241  YLFGGKDPVKG--SMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGV  1414
             YLFGG D ++G  S+R VIFY+A TNKWHRAPDML++R+ F  CVINNCLYV+GGE EG+
Sbjct  427   YLFGGVD-LEGSRSIRCVIFYNACTNKWHRAPDMLQKRNLFRSCVINNCLYVSGGELEGI  485

Query  1415  HGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKG--LGTHRQVMSEVYQPE  1588
               + RSAEVYDP++NRW+LIS+MST+MVP  GVV+ G W+ KG  +G+    M E Y PE
Sbjct  486   QMT-RSAEVYDPSQNRWNLISEMSTSMVPLFGVVHNGTWFFKGNAIGSGNS-MCEAYSPE  543

Query  1589  TDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTS  1768
             TDTW  V +GMV GW     +LNG+LYAL C DGCKL VYD AT+SW K IDS++H+G  
Sbjct  544   TDTWTVVTNGMVNGWDKDCISLNGQLYALGCPDGCKLTVYDRATDSWRKFIDSKLHVGKF  603

Query  1769  KALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQF--KTMVT  1942
               L AAA + L+GKLCIIR+NM+ISLVDV+  ++   +    LWE I GKG    +++V 
Sbjct  604   PTLVAAAPVSLNGKLCIIRHNMNISLVDVSSPNNQVESNPRDLWENIAGKGHHIRRSLVR  663

Query  1943  NFLSSLAGRSRLKSHIVHCQVLQT  2014
                S++A R   KS IV CQVLQ 
Sbjct  664   KLWSTIARRGCSKSCIVCCQVLQA  687



>gb|KHN14372.1| F-box/kelch-repeat protein [Glycine soja]
Length=372

 Score =   453 bits (1166),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 231/373 (62%), Positives = 281/373 (75%), Gaps = 9/373 (2%)
 Frame = +2

Query  914   RTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRKKLEIAEEWI  1093
             R Q PLLPGLPDDLA+ CLIRVPRIEH KL LVCKRW RLL+ +F+YSLRK L +AEEW+
Sbjct  3     RVQLPLLPGLPDDLAVTCLIRVPRIEHRKLHLVCKRWRRLLSEDFFYSLRKSLGMAEEWL  62

Query  1094  YVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPVKG  1273
             YVIK DR G++S HAFDPIYQLWQPLPPVP ++ EA+ FG AVLSG HLYLFGG D ++G
Sbjct  63    YVIKADRAGRISVHAFDPIYQLWQPLPPVPGDFPEAMWFGSAVLSGFHLYLFGGVD-LEG  121

Query  1274  --SMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSAEVYD  1447
               S+R VIFY+A TNKWHRAPDML++R+ F  CVINNCLYV+GGE EG+  + RSAEVYD
Sbjct  122   SRSIRCVIFYNACTNKWHRAPDMLQKRNLFRSCVINNCLYVSGGELEGIQMT-RSAEVYD  180

Query  1448  PNKNRWSLISDMSTAMVPFIGVVYQGKWYLKG--LGTHRQVMSEVYQPETDTWNTVYDGM  1621
             P++NRW+LIS+MST+MVP  GVV+ G W+ KG  +G+    M E Y PETDTW  V +GM
Sbjct  181   PSQNRWNLISEMSTSMVPLFGVVHNGTWFFKGNAIGSGNS-MCEAYSPETDTWTVVTNGM  239

Query  1622  VTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALLPL  1801
             V GW     +LNG+LYAL C DGCKL VYD AT+SW K IDS++H+G    L AAA + L
Sbjct  240   VNGWDKDCISLNGQLYALGCPDGCKLTVYDRATDSWRKFIDSKLHVGKFPTLVAAAPVSL  299

Query  1802  SGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQF--KTMVTNFLSSLAGRSR  1975
             +GKLCIIR+NM+ISLVDV+  ++   +    LWE I GKG    +++V    S++A R  
Sbjct  300   NGKLCIIRHNMNISLVDVSSPNNQVESNPRDLWENIAGKGHHIRRSLVRKLWSTIARRGC  359

Query  1976  LKSHIVHCQVLQT  2014
              KS IV CQVLQ 
Sbjct  360   SKSCIVCCQVLQA  372



>gb|EYU24437.1| hypothetical protein MIMGU_mgv1a024107mg, partial [Erythranthe 
guttata]
Length=272

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 237/273 (87%), Gaps = 1/273 (0%)
 Frame = +2

Query  1196  EALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVIN  1375
              ALGFGCAVLSGCHLYLFGGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVIN
Sbjct  1     SALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVIN  60

Query  1376  NCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTH  1555
             NCLYVAGGE EG+  +LRSAEVYDPN+NRWS I+DMSTAMVPFIGVVY GKW+LKGLG H
Sbjct  61    NCLYVAGGECEGIQRTLRSAEVYDPNRNRWSFIADMSTAMVPFIGVVYDGKWFLKGLGAH  120

Query  1556  RQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSK  1735
             R+V+SE Y PE++ W+ + DGMV+GWRNPS ++NG+LYALDCRDGCKLRVYDE T+SWS+
Sbjct  121   REVLSEAYTPESNLWSPINDGMVSGWRNPSISMNGKLYALDCRDGCKLRVYDEKTDSWSR  180

Query  1736  HIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGG  1915
              IDS++HLG S+ALEAAAL+P++GKLCIIRNNMSIS+VDV+  D   A  S  +WE I  
Sbjct  181   FIDSKIHLGNSRALEAAALVPINGKLCIIRNNMSISMVDVSGTDKR-AEGSSGIWENIAI  239

Query  1916  KGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             KG F+ + TN  SS+AGRS LKSHIVHCQVLQ 
Sbjct  240   KGHFRNLFTNLWSSIAGRSGLKSHIVHCQVLQV  272



>ref|XP_009795061.1| PREDICTED: probable ethanolamine kinase [Nicotiana sylvestris]
Length=377

 Score =   447 bits (1150),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 231/260 (89%), Gaps = 0/260 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             QYLSAAGFGAKL GVF NGMVQSFI ARTL PSDMR PKLAAEIAK+L +FHQVEIPG K
Sbjct  114   QYLSAAGFGAKLLGVFGNGMVQSFIDARTLTPSDMRNPKLAAEIAKQLRKFHQVEIPGSK  173

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+++KFFRKASTLQFDD E + KY T+ F+EVHNEIT LKELT  LNAPVVFAHN
Sbjct  174   EPQLWNDVLKFFRKASTLQFDDGEKKSKYETILFQEVHNEITSLKELTNRLNAPVVFAHN  233

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NED+GKLYFIDFEYGSYNYRGFD+GNHFNEYAGY+CDYSLYP+K EQ+HFF
Sbjct  234   DLLSGNLMLNEDKGKLYFIDFEYGSYNYRGFDLGNHFNEYAGYDCDYSLYPSKDEQFHFF  293

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL P QPNEVS++DLEALY ET++YMLASHL W LW LIQAK+SPIDFDY+ YFF RY
Sbjct  294   KHYLDPDQPNEVSDKDLEALYAETSSYMLASHLYWALWALIQAKMSPIDFDYISYFFLRY  353

Query  2654  TEYKKQKEKCFTTAKAYLAK  2595
              EYKKQKE CF+ AK+YL+K
Sbjct  354   NEYKKQKENCFSLAKSYLSK  373


 Score =   169 bits (427),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG A +I NA EVAEGA    +S IPSS LTVDH+LSIP MKP +VELCKDLF +W +LD
Sbjct  1     MG-AAKIWNAMEVAEGARHSVSSKIPSSRLTVDHSLSIPLMKPKIVELCKDLFNQWLDLD  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DSHFSVET+SGGITNLLLKVSVRE+ G+  N+T+RLYGPNT+YVI+RERELQ 
Sbjct  60    DSHFSVETVSGGITNLLLKVSVREDKGKNGNMTIRLYGPNTEYVINRERELQA  112



>gb|EYU24438.1| hypothetical protein MIMGU_mgv1a026698mg, partial [Erythranthe 
guttata]
Length=272

 Score =   442 bits (1136),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 236/273 (86%), Gaps = 1/273 (0%)
 Frame = +2

Query  1196  EALGFGCAVLSGCHLYLFGGKDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVIN  1375
              ALGFGCAVLSGCHLYLFGGKDP+KGSMRRVIFYSARTNKWHRAPDMLR+RHFFG CVIN
Sbjct  1     SALGFGCAVLSGCHLYLFGGKDPLKGSMRRVIFYSARTNKWHRAPDMLRKRHFFGSCVIN  60

Query  1376  NCLYVAGGENEGVHGSLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTH  1555
             NCLYVAGGE EG+  +LRSAEVYDPN+NRWS I+DMSTAMVPFIGVVY GKW+LKGLG H
Sbjct  61    NCLYVAGGECEGIQRTLRSAEVYDPNRNRWSFIADMSTAMVPFIGVVYDGKWFLKGLGAH  120

Query  1556  RQVMSEVYQPETDTWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSK  1735
             R+V+SE Y PE++ W+ + DGMV GWRNPS ++NG+LYALDCRDGCKLRVYDE T+SWS+
Sbjct  121   REVLSEAYTPESNLWSPINDGMVYGWRNPSISMNGKLYALDCRDGCKLRVYDEKTDSWSR  180

Query  1736  HIDSRMHLGTSKALEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGG  1915
              IDS++HLG S+ALEAAAL+P++GKLCIIRNNMSIS+VDV+  D   A  S  +WE I  
Sbjct  181   FIDSKIHLGNSRALEAAALVPINGKLCIIRNNMSISMVDVSGTDKR-AEGSSGIWENIAI  239

Query  1916  KGQFKTMVTNFLSSLAGRSRLKSHIVHCQVLQT  2014
             KG F+ + TN  SS+AGRS LKSHIVHCQVLQ 
Sbjct  240   KGHFRNLFTNLWSSIAGRSGLKSHIVHCQVLQA  272



>gb|KHN22962.1| F-box/kelch-repeat protein [Glycine soja]
Length=562

 Score =   449 bits (1154),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 266/350 (76%), Gaps = 7/350 (2%)
 Frame = +2

Query  887   RQKPPRDKNRTQSPLLPGLPDDLAIACLIRVPRIEHCKLRLVCKRWYRLLAGNFYYSLRK  1066
             R+  PR+  R Q PLL GLPDDLAIACLIRVPRIEH KL LVCKRW+RLL+ +F+YSLRK
Sbjct  2     RENTPRETTRVQPPLLSGLPDDLAIACLIRVPRIEHRKLHLVCKRWHRLLSEDFFYSLRK  61

Query  1067  KLEIAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYL  1246
              L +AEEW+YVIK DR G++S HAFDPIYQLWQPLPPVP ++ EA+  G AVLSGCHLYL
Sbjct  62    SLGMAEEWLYVIKADRAGRISVHAFDPIYQLWQPLPPVPGDFPEAMWVGSAVLSGCHLYL  121

Query  1247  FGGKDPVKG--SMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHG  1420
             FGG D ++G  S+RRVIFY+A TNKWHRAPDML++R+ F  CVINNCL+VAGGE EG+  
Sbjct  122   FGGVD-LEGSRSIRRVIFYNACTNKWHRAPDMLQKRNLFRSCVINNCLFVAGGELEGIQM  180

Query  1421  SLRSAEVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKG--LGTHRQVMSEVYQPETD  1594
             + RSAEVYDP++NRWS IS+M T+MVP  G V+ G W+ KG  +G+    M E Y PETD
Sbjct  181   T-RSAEVYDPSQNRWSFISEMRTSMVPLFGFVHNGTWFFKGNEIGSGNS-MCEAYSPETD  238

Query  1595  TWNTVYDGMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKA  1774
             TW  V +GMV G  N   +LNG+LYAL C DGCKL VYD AT+SW K IDS++H+    +
Sbjct  239   TWTPVTNGMVNGRGNDCISLNGQLYALGCPDGCKLTVYDRATDSWKKLIDSKLHVDKFPS  298

Query  1775  LEAAALLPLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQ  1924
             L A A + L+GKLCIIR+NMSISLVDV+  +    +  + LWE I GK Q
Sbjct  299   LVAVAPVSLNGKLCIIRHNMSISLVDVSSPNQQLESNPQDLWENIAGKAQ  348



>ref|XP_009611033.1| PREDICTED: probable ethanolamine kinase [Nicotiana tomentosiformis]
Length=376

 Score =   440 bits (1132),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/258 (79%), Positives = 227/258 (88%), Gaps = 0/258 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             QYLSAAGFGAKL GVF NGMVQSFI ARTL PSDMR PKLAAEIAK+L +FHQVEIPG K
Sbjct  114   QYLSAAGFGAKLLGVFGNGMVQSFIDARTLTPSDMRNPKLAAEIAKQLRKFHQVEIPGSK  173

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+++KFFRKASTLQFDD E + KY T+ F+EVHNEIT LKELT  LNAPVVFAHN
Sbjct  174   EPQLWNDVLKFFRKASTLQFDDGEKKSKYETILFQEVHNEITALKELTNRLNAPVVFAHN  233

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NED GKLYFIDFEYGSYNYRGFD+GNHFNEYAGY+CDYSLYP+K EQ+HFF
Sbjct  234   DLLSGNLMLNEDTGKLYFIDFEYGSYNYRGFDLGNHFNEYAGYDCDYSLYPSKDEQFHFF  293

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P Q NE+SE+DLEALY ET++YMLASHL W LW LIQAK+SPIDFDY+ YFF RY
Sbjct  294   RHYLEPDQSNELSEKDLEALYAETSSYMLASHLYWALWALIQAKMSPIDFDYISYFFLRY  353

Query  2654  TEYKKQKEKCFTTAKAYL  2601
              EYKKQKE CF+ AK+ L
Sbjct  354   NEYKKQKENCFSLAKSSL  371


 Score =   171 bits (432),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG A +I NA EVAEGA    +S IPSS LTVDH+LSIP MKP +VELCKDLF +W +LD
Sbjct  1     MG-AAKIWNAMEVAEGARHSVSSKIPSSLLTVDHSLSIPLMKPKIVELCKDLFNQWLDLD  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DSHFSVET+SGGITNLLLKVSVRE+ G+ VN+T+RLYGPNT+YVI+RERELQ 
Sbjct  60    DSHFSVETVSGGITNLLLKVSVREDEGKNVNMTIRLYGPNTEYVINRERELQA  112



>ref|XP_002285099.1| PREDICTED: probable ethanolamine kinase isoform X1 [Vitis vinifera]
Length=377

 Score =   437 bits (1124),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/261 (78%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI+ARTL PSDM+ PKLAAEIAK+L +FHQVEIPG KE
Sbjct  115   YLSAAGFGAKLLGVFGNGMVQSFINARTLTPSDMKMPKLAAEIAKQLRKFHQVEIPGSKE  174

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW +I KFF KASTL+FDD E Q+KY  +SFEEVHNE+ ELKELT  LN+PVVFAHND
Sbjct  175   PQLWIDIFKFFEKASTLKFDDIEKQKKYKEISFEEVHNEVVELKELTDCLNSPVVFAHND  234

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DEGKLYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYSLYPTK EQYHFFR
Sbjct  235   LLSGNLMLNDDEGKLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSLYPTKNEQYHFFR  294

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL P +PNEVS++DLE LYVE NT+MLASHL W LW LIQAK+SPIDFDYLGY+F RY 
Sbjct  295   HYLAPDKPNEVSDKDLETLYVEANTFMLASHLYWALWALIQAKMSPIDFDYLGYYFLRYE  354

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EY KQKEKC + A++YL+ S+
Sbjct  355   EYTKQKEKCLSLARSYLSASR  375


 Score =   162 bits (409),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG AV+I +A EVAE A ++  S I SSH TVD +LS P+M P ++ELCKDLFKKWSNLD
Sbjct  1     MG-AVKIWDAMEVAEEARENCCSEIHSSHTTVDTSLSFPQMTPKIIELCKDLFKKWSNLD  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DS FSVET+SGGITNLLLKVSV+EENG +  +TVRLYGPNT+YVI+RERELQ 
Sbjct  60    DSQFSVETISGGITNLLLKVSVKEENGNSTCMTVRLYGPNTEYVINRERELQA  112



>ref|XP_010656415.1| PREDICTED: probable ethanolamine kinase isoform X2 [Vitis vinifera]
 emb|CBI28178.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   434 bits (1117),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/261 (78%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI+ARTL PSDM+ PKLAAEIAK+L +FHQVEIPG KE
Sbjct  46    YLSAAGFGAKLLGVFGNGMVQSFINARTLTPSDMKMPKLAAEIAKQLRKFHQVEIPGSKE  105

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW +I KFF KASTL+FDD E Q+KY  +SFEEVHNE+ ELKELT  LN+PVVFAHND
Sbjct  106   PQLWIDIFKFFEKASTLKFDDIEKQKKYKEISFEEVHNEVVELKELTDCLNSPVVFAHND  165

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DEGKLYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYSLYPTK EQYHFFR
Sbjct  166   LLSGNLMLNDDEGKLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSLYPTKNEQYHFFR  225

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL P +PNEVS++DLE LYVE NT+MLASHL W LW LIQAK+SPIDFDYLGY+F RY 
Sbjct  226   HYLAPDKPNEVSDKDLETLYVEANTFMLASHLYWALWALIQAKMSPIDFDYLGYYFLRYE  285

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EY KQKEKC + A++YL+ S+
Sbjct  286   EYTKQKEKCLSLARSYLSASR  306



>emb|CAN63497.1| hypothetical protein VITISV_011672 [Vitis vinifera]
Length=377

 Score =   437 bits (1123),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/261 (78%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI+ARTL PSDM+ PKLAAEIAK+L +FHQVEIPG KE
Sbjct  115   YLSAAGFGAKLLGVFGNGMVQSFINARTLTPSDMKMPKLAAEIAKQLRKFHQVEIPGSKE  174

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW +I KFF KASTL+FDD E Q+KY  +SFEEVHNE+ ELKELT  LN+PVVFAHND
Sbjct  175   PQLWIDIFKFFEKASTLKFDDIEKQKKYKEISFEEVHNEVVELKELTDCLNSPVVFAHND  234

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DEGKLYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYSLYPTK EQYHFFR
Sbjct  235   LLSGNLMLNDDEGKLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSLYPTKNEQYHFFR  294

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL P +PNEVS++DLE LYVE NT+MLASHL W LW LIQAK+SPIDFDYLGY+F RY 
Sbjct  295   HYLAPDKPNEVSDKDLETLYVEANTFMLASHLYWALWALIQAKMSPIDFDYLGYYFLRYE  354

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EY KQKEKC + A++YL+ S+
Sbjct  355   EYTKQKEKCLSLARSYLSASR  375


 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG AV+I +A EVAE A ++  S I SSH TVD +LS P M P ++ELCKDLFKKWSNLD
Sbjct  1     MG-AVKIWDAMEVAEEARENCCSEIHSSHTTVDTSLSFPHMTPKIIELCKDLFKKWSNLD  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DS FSVET+SGGITNLLLKVSV+EENG +  +TVRLYGPNT+YVI+RERELQ 
Sbjct  60    DSQFSVETISGGITNLLLKVSVKEENGNSTCMTVRLYGPNTEYVINRERELQA  112



>tpg|DAA43582.1| TPA: kelch motif family protein, mRNA isoform 1 [Zea mays]
 tpg|DAA43583.1| TPA: hypothetical protein ZEAMMB73_125643 [Zea mays]
Length=313

 Score =   434 bits (1116),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 248/314 (79%), Gaps = 2/314 (1%)
 Frame = +2

Query  1076  IAEEWIYVIKRDRDGKVSWHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGG  1255
             +AEEWIYV KRDRD K+SW+AFDP+ QLW+ LPPVP EYSEA+GFG AVL+GC+LYLFGG
Sbjct  1     MAEEWIYVFKRDRDQKLSWYAFDPVNQLWKSLPPVPPEYSEAVGFGSAVLNGCYLYLFGG  60

Query  1256  KDPVKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGFCVINNCLYVAGGENEGVHGSLRSA  1435
             KDPV GSMRRV+FY+AR NKW RAPDML++RHFFG CVINNCLYVAGGE  G+   LRSA
Sbjct  61    KDPVHGSMRRVVFYNARINKWLRAPDMLQKRHFFGSCVINNCLYVAGGECVGIQRILRSA  120

Query  1436  EVYDPNKNRWSLISDMSTAMVPFIGVVYQGKWYLKGLGTHRQVMSEVYQPETDTWNTVYD  1615
             EVYDPN+NRWS I++MST MVP IGVV+ GKWYLKGL +HRQV+SEVY P +  W+   +
Sbjct  121   EVYDPNRNRWSSIAEMSTGMVPSIGVVHDGKWYLKGLNSHRQVVSEVYLPASKMWSATGN  180

Query  1616  GMVTGWRNPSTTLNGRLYALDCRDGCKLRVYDEATNSWSKHIDSRMHLGTSKALEAAALL  1795
              MVTGWRNPS +LNG LY+ DCRDGCKLRVY+    SW++ ID+R H+G+S++LEAAA +
Sbjct  181   EMVTGWRNPSISLNGHLYSADCRDGCKLRVYNREMGSWTRFIDTRHHMGSSRSLEAAAFV  240

Query  1796  PLSGKLCIIRNNMSISLVDVAKCDDAGAATSEHLWETIGGKGQFK-TMVTNFLSSLAGRS  1972
              L+GKLCIIRNNMSI++VD+     A    S  +WE    KGQ + + + N    + GR+
Sbjct  241   SLNGKLCIIRNNMSITIVDILDPTTATEVDSARMWEAFARKGQHRSSFMANLWLIITGRN  300

Query  1973  RLKSHIVHCQVLQT  2014
              LK+ I+HCQVLQ 
Sbjct  301   -LKTDIMHCQVLQV  313



>gb|KCW79807.1| hypothetical protein EUGRSUZ_C01140 [Eucalyptus grandis]
Length=280

 Score =   430 bits (1105),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL  VF NGMVQSFI+ARTL P DMRKPKL AEIAK+LH+FHQVEIPG K
Sbjct  20    KYLSAAGFGAKLLAVFGNGMVQSFINARTLTPEDMRKPKLVAEIAKQLHKFHQVEIPGSK  79

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I KFF KAS L+FDD+E +RKY T+SF+E+H+E+ ELKELTG LNAPVVF HN
Sbjct  80    EPQLWNDIFKFFEKASDLKFDDNEKRRKYETISFKEIHDELLELKELTGLLNAPVVFGHN  139

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLLCGN+M N++EGKLYFIDFEYGSYNYRG+DIGNHFNE+AGYECDYSLYP+K EQYHFF
Sbjct  140   DLLCGNIMVNDEEGKLYFIDFEYGSYNYRGYDIGNHFNEFAGYECDYSLYPSKDEQYHFF  199

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL P +P EVS++DLEALY+ETNTYMLASHL W LWGLIQAK+SPI+FDY+ YFF RY
Sbjct  200   RHYLMPDKPQEVSDKDLEALYIETNTYMLASHLLWALWGLIQAKMSPINFDYMEYFFLRY  259

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              E+K+QK+   + AK YL  S
Sbjct  260   NEFKRQKQSAISLAKRYLTGS  280



>ref|XP_010047817.1| PREDICTED: LOW QUALITY PROTEIN: probable ethanolamine kinase 
[Eucalyptus grandis]
Length=378

 Score =   432 bits (1111),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL  VF NGMVQSFI+ARTL P DMRKPKL AEIAK+LH+FHQVEIPG K
Sbjct  118   KYLSAAGFGAKLLAVFGNGMVQSFINARTLTPEDMRKPKLVAEIAKQLHKFHQVEIPGSK  177

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I KFF KAS L+FDD+E +RKY T+SF+E+H+E+ ELKELTG LNAPVVF HN
Sbjct  178   EPQLWNDIFKFFEKASDLKFDDNEKRRKYETISFKEIHDELLELKELTGLLNAPVVFGHN  237

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLLCGN+M N++EGKLYFIDFEYGSYNYRG+DIGNHFNE+AGYECDYSLYP+K EQYHFF
Sbjct  238   DLLCGNIMVNDEEGKLYFIDFEYGSYNYRGYDIGNHFNEFAGYECDYSLYPSKDEQYHFF  297

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL P +P EVS++DLEALY+ETNTYMLASHL W LWGLIQAK+SPI+FDY+ YFF RY
Sbjct  298   RHYLMPDKPQEVSDKDLEALYIETNTYMLASHLLWALWGLIQAKMSPINFDYMEYFFLRY  357

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              E+K+QK+   + AK YL  S
Sbjct  358   NEFKRQKQSAISLAKRYLTGS  378


 Score =   142 bits (357),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -2

Query  4292  AVEILNAEEVAEGAPDDRTSG----IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNL  4125
             A +I NA EVA  A  D   G    I SS L VD +LS+PEM P VVELCKDLF +WS L
Sbjct  3     AAKIWNAMEVAGEANCDNGGGRGPAIRSSALAVDTSLSLPEMSPRVVELCKDLFAEWSKL  62

Query  4124  DDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERE  3972
             DDS F+VET+SGGITNLLLKVSV+EE+G   ++TVR YGPNT+YVIDRERE
Sbjct  63    DDSRFAVETVSGGITNLLLKVSVKEESGNEESITVRXYGPNTEYVIDRERE  113



>ref|XP_006367512.1| PREDICTED: probable ethanolamine kinase-like [Solanum tuberosum]
Length=372

 Score =   431 bits (1108),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 227/260 (87%), Gaps = 0/260 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             Q+LSAAGFGAKL  VF NGMVQSFI ARTL P DM+ PKLAAEIAK+L  FHQVEIPG K
Sbjct  105   QHLSAAGFGAKLLAVFGNGMVQSFIDARTLTPPDMKNPKLAAEIAKQLRNFHQVEIPGSK  164

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQ+WN+++KFF+KASTLQFDD E ++KY T+ F+EVHNEI ELKELT  LN+PVVFAHN
Sbjct  165   EPQVWNDVLKFFKKASTLQFDDGEKKKKYETILFQEVHNEIIELKELTDRLNSPVVFAHN  224

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NED+ KLYFIDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQ+HFF
Sbjct  225   DLLSGNLMLNEDKEKLYFIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKDEQFHFF  284

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL   QPNEVS++DLEALYVET++YMLASHL W LW LIQAK+SPIDFDY+ YFF RY
Sbjct  285   RHYLDSDQPNEVSDKDLEALYVETSSYMLASHLYWALWALIQAKMSPIDFDYISYFFLRY  344

Query  2654  TEYKKQKEKCFTTAKAYLAK  2595
              EYKKQKEK  + AK+YL+K
Sbjct  345   NEYKKQKEKVLSLAKSYLSK  364


 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -2

Query  4268  EVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSG  4089
             EVAEGA    T+ IP S LTVDH+LSI  +KP +VELCKDLF +WSNLD SHFSVET+SG
Sbjct  2     EVAEGARHSVTAKIPYSSLTVDHSLSITHLKPKIVELCKDLFNQWSNLDGSHFSVETVSG  61

Query  4088  GITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             GITNLLLKVSVRE++G+  N+TVRLYGPNT+YVI+RERE+Q 
Sbjct  62    GITNLLLKVSVREDDGKHENMTVRLYGPNTEYVINREREMQA  103



>gb|KHG13777.1| putative ethanolamine kinase A [Gossypium arboreum]
Length=384

 Score =   430 bits (1105),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF NGMVQSFI+ARTL P+DMRKPKL +EIAK+L  FHQVEIPG K
Sbjct  121   KYLSAAGFGAKLLGVFGNGMVQSFINARTLTPADMRKPKLVSEIAKQLRRFHQVEIPGSK  180

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I KFF KASTLQF+D++ QR Y T+SF+EVH E+ ELKELT  LN+PVVFAHN
Sbjct  181   EPQLWVDIFKFFEKASTLQFEDTDKQRTYETISFKEVHKEVKELKELTTLLNSPVVFAHN  240

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLMHN+++ KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  241   DLLSGNLMHNDEQEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKDEQYHFF  300

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVSE+DLEALYVETNT+MLASHL W LW LIQA++SPIDFDYLGYFF RY
Sbjct  301   RHYLEPEKPCEVSEKDLEALYVETNTFMLASHLYWALWALIQARMSPIDFDYLGYFFLRY  360

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK  CF+ AK++++ S
Sbjct  361   NEYKKQKRMCFSLAKSHISGS  381


 Score =   133 bits (334),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -2

Query  4292  AVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSH  4113
             A+E  +A++   G        I  S+L+VD  L  P M P V+ LCKDLF+KW+ L+DS 
Sbjct  10    AMEANHAKQSHNGNSTFDDHSILHSNLSVDTALPFPLMVPRVIALCKDLFRKWAKLNDSC  69

Query  4112  FSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             FSV+T+SGGITNLLLKVSV+EENGE V++TVRLYGPNT+YVI+RERELQ 
Sbjct  70    FSVDTVSGGITNLLLKVSVKEENGEYVSVTVRLYGPNTEYVINRERELQA  119



>ref|XP_002524470.1| choline/ethanolamine kinase, putative [Ricinus communis]
 gb|EEF37910.1| choline/ethanolamine kinase, putative [Ricinus communis]
Length=326

 Score =   426 bits (1095),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 230/261 (88%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF NGMVQSFI ARTL P+DMRKPKLAAEIAK+LH+FH+VEIPG K
Sbjct  63    KYLSAAGFGAKLLGVFGNGMVQSFIDARTLTPADMRKPKLAAEIAKQLHKFHEVEIPGSK  122

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWNEI KF+  AS LQFDD E Q+KY T+SF+EV++E+ E+K+LT  L APVVFAHN
Sbjct  123   EPQLWNEIFKFYENASILQFDDIEKQKKYKTISFKEVYDEVVEIKDLTDPLKAPVVFAHN  182

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NED+ KLYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  183   DLLSGNLMLNEDKDKLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSLYPSKDEQYHFF  242

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVS++DLEALY+ETNT+MLASHL W LW LIQAK+SPI+FDYLGYFF RY
Sbjct  243   RHYLQPDKPYEVSDKDLEALYIETNTFMLASHLFWALWALIQAKMSPIEFDYLGYFFLRY  302

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYK+QKEK  + A++YL+ S
Sbjct  303   NEYKRQKEKSCSLARSYLSGS  323


 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = -2

Query  4160  LCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDR  3981
             +  DLFK WS LD+S FSVET+SG     +LKVSV+EENG  V +TVRLYGPNTDYVI+R
Sbjct  1     MGADLFKNWSKLDESRFSVETVSG-----VLKVSVKEENGNEVAITVRLYGPNTDYVINR  55

Query  3980  ERELQV  3963
             ERELQ 
Sbjct  56    ERELQA  61



>ref|XP_007202147.1| hypothetical protein PRUPE_ppa007064mg [Prunus persica]
 gb|EMJ03346.1| hypothetical protein PRUPE_ppa007064mg [Prunus persica]
Length=384

 Score =   428 bits (1101),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/264 (75%), Positives = 229/264 (87%), Gaps = 0/264 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGA L GVF NGMVQSFI+ARTL PSDMR PKLAAEIAK+L  FHQVEIPG K
Sbjct  115   KYLSAAGFGANLLGVFGNGMVQSFINARTLIPSDMRNPKLAAEIAKQLCRFHQVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+++KFF KAS L+FDD+E Q+ Y T+SF EVHNEI ELKELTG LN+PVVFAHN
Sbjct  175   EPQLWNDLLKFFEKASALEFDDNEKQKLYKTISFSEVHNEIIELKELTGLLNSPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLY IDFEYGSYNYRGFDIGNHFNEYAGYECD++L P K EQYHF 
Sbjct  235   DLLSGNIMVNDEEDKLYLIDFEYGSYNYRGFDIGNHFNEYAGYECDFTLCPNKDEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P  P+EVSE+DLEALYVE NTY LASHL W LWGLIQAK SPI+FDYLGYFF RY
Sbjct  295   RHYLQPENPHEVSEKDLEALYVEENTYTLASHLYWALWGLIQAKFSPINFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSKGI  2583
              E+K+QKEKCF+ A+++L++S+ +
Sbjct  355   NEFKRQKEKCFSLARSFLSRSQTL  378


 Score =   147 bits (370),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA EVA+   D  TS I SS L+VD +L +  + P ++ELCKDLFKKWSNL+
Sbjct  1     MGGVKNIWNAMEVAKQTSDCSTSQIHSSSLSVDPSLPLSHITPLIIELCKDLFKKWSNLE  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             +S FSV T+SGGITNLLLKV+V+EENG  V++TVRLYGPNT+YVI+RERELQ
Sbjct  61    NSRFSVGTVSGGITNLLLKVTVKEENGNDVSVTVRLYGPNTEYVINRERELQ  112



>ref|XP_008242753.1| PREDICTED: probable ethanolamine kinase [Prunus mume]
Length=384

 Score =   428 bits (1100),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 198/264 (75%), Positives = 229/264 (87%), Gaps = 0/264 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGA L GVF NGMVQSFI+ARTL PSDMR PKLAAEIAK+L  FHQVEIPG K
Sbjct  115   KYLSAAGFGANLLGVFGNGMVQSFINARTLIPSDMRNPKLAAEIAKQLCRFHQVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+++KFF KAS L+FDD+E Q+ Y T+SF EVHNEI ELKELTG LN+PVVFAHN
Sbjct  175   EPQLWNDLLKFFEKASALEFDDNEKQKLYKTISFSEVHNEIIELKELTGLLNSPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLY IDFEYGSYNYRGFDIGNHFNEYAGYECD++L P K EQYHF 
Sbjct  235   DLLSGNIMVNDEEDKLYLIDFEYGSYNYRGFDIGNHFNEYAGYECDFTLCPNKDEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P  P+EVSE+DLEALYVE NTY LASHL W LWGLIQAK SPI+FDYLGYFF RY
Sbjct  295   RHYLQPDNPHEVSEKDLEALYVEENTYTLASHLYWALWGLIQAKFSPINFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSKGI  2583
              E+K+QKEKCF+ A+++L++S+ +
Sbjct  355   NEFKRQKEKCFSLARSFLSRSQTL  378


 Score =   146 bits (369),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA EVAE   D  TS I SS L+VD +L +  + P ++ELCKDLFKKWSNL+
Sbjct  1     MGGVKNIWNAMEVAEQTSDCSTSQIHSSSLSVDPSLPLSHITPLIIELCKDLFKKWSNLE  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDREREL  3969
             +S FSV T+SGGITNLLLKV+V+EENG  V++TVRLYGPNT+YVI+REREL
Sbjct  61    NSRFSVGTVSGGITNLLLKVTVKEENGNDVSVTVRLYGPNTEYVINREREL  111



>ref|XP_008463048.1| PREDICTED: probable ethanolamine kinase isoform X1 [Cucumis melo]
Length=386

 Score =   427 bits (1098),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVFKNGMVQSFIHARTL PSD+RKP+LAAEIAK+L++FH+V IPG  
Sbjct  119   KYLSAAGFGAKLLGVFKNGMVQSFIHARTLEPSDLRKPELAAEIAKQLNKFHKVYIPGSN  178

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWNE++KF+ KASTLQFDD+  Q  Y T+SF+E+HNEI E+KELT  LNAPVVFAHN
Sbjct  179   EPQLWNEVLKFYEKASTLQFDDTGKQSIYDTISFQEIHNEILEIKELTSLLNAPVVFAHN  238

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+EG+LYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYS YP+K EQYHFF
Sbjct  239   DLLSGNLMLNEEEGRLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSCYPSKEEQYHFF  298

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P+EVS++DLEALYVE+NT+MLASHL W LW LIQA++SPIDFDYL YFF RY
Sbjct  299   RHYLQPEKPDEVSQKDLEALYVESNTFMLASHLYWALWALIQARMSPIDFDYLSYFFLRY  358

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQKEK  + A+++LA S
Sbjct  359   GEYKKQKEKYCSLARSFLAGS  379


 Score =   129 bits (323),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 4/106 (4%)
 Frame = -2

Query  4268  EVAEGAPDDRTSGIP--SSHLTVDHTLSIPEMKPHVV--ELCKDLFKKWSNLDDSHFSVE  4101
             +V E   D  ++  P   S L+VD +L +P M P ++  ELCKDLFK+WS LD S FSVE
Sbjct  12    DVVEAVEDGHSNAEPYQLSTLSVDLSLPLPAMTPRIISRELCKDLFKEWSELDASRFSVE  71

Query  4100  TLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             T+SGGITN LLKV+V+EE+G +V++TVRLYGPNTDYVI+R+RELQ 
Sbjct  72    TVSGGITNQLLKVTVKEESGTSVSVTVRLYGPNTDYVINRDRELQA  117



>ref|XP_008463050.1| PREDICTED: probable ethanolamine kinase isoform X2 [Cucumis melo]
Length=384

 Score =   427 bits (1097),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVFKNGMVQSFIHARTL PSD+RKP+LAAEIAK+L++FH+V IPG  
Sbjct  117   KYLSAAGFGAKLLGVFKNGMVQSFIHARTLEPSDLRKPELAAEIAKQLNKFHKVYIPGSN  176

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWNE++KF+ KASTLQFDD+  Q  Y T+SF+E+HNEI E+KELT  LNAPVVFAHN
Sbjct  177   EPQLWNEVLKFYEKASTLQFDDTGKQSIYDTISFQEIHNEILEIKELTSLLNAPVVFAHN  236

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+EG+LYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYS YP+K EQYHFF
Sbjct  237   DLLSGNLMLNEEEGRLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSCYPSKEEQYHFF  296

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P+EVS++DLEALYVE+NT+MLASHL W LW LIQA++SPIDFDYL YFF RY
Sbjct  297   RHYLQPEKPDEVSQKDLEALYVESNTFMLASHLYWALWALIQARMSPIDFDYLSYFFLRY  356

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQKEK  + A+++LA S
Sbjct  357   GEYKKQKEKYCSLARSFLAGS  377


 Score =   134 bits (336),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = -2

Query  4268  EVAEGAPDDRTSGIP--SSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETL  4095
             +V E   D  ++  P   S L+VD +L +P M P ++ELCKDLFK+WS LD S FSVET+
Sbjct  12    DVVEAVEDGHSNAEPYQLSTLSVDLSLPLPAMTPRIIELCKDLFKEWSELDASRFSVETV  71

Query  4094  SGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             SGGITN LLKV+V+EE+G +V++TVRLYGPNTDYVI+R+RELQ 
Sbjct  72    SGGITNQLLKVTVKEESGTSVSVTVRLYGPNTDYVINRDRELQA  115



>ref|XP_004138363.1| PREDICTED: probable ethanolamine kinase A-like isoform 1 [Cucumis 
sativus]
 ref|XP_004170454.1| PREDICTED: probable ethanolamine kinase A-like isoform 1 [Cucumis 
sativus]
Length=386

 Score =   426 bits (1096),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVFKNGMVQSFIHARTL PSD+RKP+LAAEIAK+L++FH+V IPG  
Sbjct  119   KYLSAAGFGAKLLGVFKNGMVQSFIHARTLEPSDLRKPELAAEIAKQLNKFHKVYIPGSN  178

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWNEI+ F+ KASTLQFDD+  Q  Y T+SF+E+HNEI E+KELT  LNAP+VFAHN
Sbjct  179   EPQLWNEILNFYDKASTLQFDDTGKQSIYDTISFQEIHNEILEIKELTSLLNAPIVFAHN  238

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+EG+LYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYS YP+K EQYHFF
Sbjct  239   DLLSGNLMLNEEEGRLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSCYPSKEEQYHFF  298

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P+EVS++DLEALYVE+NT+MLASHL W LW LIQA++SPIDFDYL YFF RY
Sbjct  299   RHYLQPEKPDEVSQKDLEALYVESNTFMLASHLYWALWALIQARMSPIDFDYLSYFFLRY  358

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQKEK  + A+++LA+S
Sbjct  359   GEYKKQKEKYCSLARSFLARS  379


 Score =   130 bits (327),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 6/118 (5%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPS---SHLTVDHTLSIPEMKPHVV--ELCKDLFKK  4137
             MG A +I N +     A +D  S   S   S+L+VDH+L +P + P ++  ELCKDLFK+
Sbjct  1     MG-AKKIYNGDVDVVEAVEDGDSNAESYQLSYLSVDHSLPLPAITPRIISRELCKDLFKE  59

Query  4136  WSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             WS LD S FSVET+SGGITN LLKV+V+EE+G +V++TVRLYGPNTDYVI+R+RELQ 
Sbjct  60    WSELDASRFSVETVSGGITNQLLKVTVKEESGTSVSVTVRLYGPNTDYVINRDRELQA  117



>ref|XP_004138364.1| PREDICTED: probable ethanolamine kinase A-like isoform 2 [Cucumis 
sativus]
 ref|XP_004170455.1| PREDICTED: probable ethanolamine kinase A-like isoform 2 [Cucumis 
sativus]
 gb|KGN45896.1| hypothetical protein Csa_6G018610 [Cucumis sativus]
Length=384

 Score =   426 bits (1095),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVFKNGMVQSFIHARTL PSD+RKP+LAAEIAK+L++FH+V IPG  
Sbjct  117   KYLSAAGFGAKLLGVFKNGMVQSFIHARTLEPSDLRKPELAAEIAKQLNKFHKVYIPGSN  176

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWNEI+ F+ KASTLQFDD+  Q  Y T+SF+E+HNEI E+KELT  LNAP+VFAHN
Sbjct  177   EPQLWNEILNFYDKASTLQFDDTGKQSIYDTISFQEIHNEILEIKELTSLLNAPIVFAHN  236

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+EG+LYFIDFEYGSY+YRGFDIGNHFNEYAGY+CDYS YP+K EQYHFF
Sbjct  237   DLLSGNLMLNEEEGRLYFIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSCYPSKEEQYHFF  296

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P+EVS++DLEALYVE+NT+MLASHL W LW LIQA++SPIDFDYL YFF RY
Sbjct  297   RHYLQPEKPDEVSQKDLEALYVESNTFMLASHLYWALWALIQARMSPIDFDYLSYFFLRY  356

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQKEK  + A+++LA+S
Sbjct  357   GEYKKQKEKYCSLARSFLARS  377


 Score =   135 bits (340),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 4/116 (3%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPS---SHLTVDHTLSIPEMKPHVVELCKDLFKKWS  4131
             MG A +I N +     A +D  S   S   S+L+VDH+L +P + P ++ELCKDLFK+WS
Sbjct  1     MG-AKKIYNGDVDVVEAVEDGDSNAESYQLSYLSVDHSLPLPAITPRIIELCKDLFKEWS  59

Query  4130  NLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
              LD S FSVET+SGGITN LLKV+V+EE+G +V++TVRLYGPNTDYVI+R+RELQ 
Sbjct  60    ELDASRFSVETVSGGITNQLLKVTVKEESGTSVSVTVRLYGPNTDYVINRDRELQA  115



>gb|KHG00049.1| putative ethanolamine kinase A [Gossypium arboreum]
Length=385

 Score =   422 bits (1086),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 197/264 (75%), Positives = 226/264 (86%), Gaps = 0/264 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF NGMVQSFI+ARTL P DMRKPKLAAEIAK+L  FHQVEIPGPK
Sbjct  122   KYLSAAGFGAKLLGVFGNGMVQSFINARTLTPLDMRKPKLAAEIAKQLCRFHQVEIPGPK  181

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW ++ KFF KAS L+F+D + QR Y T+ F+EVH E T+LKELT   + PVVFAHN
Sbjct  182   EPQLWVDMFKFFEKASALRFEDPDKQRIYETILFKEVHKEATQLKELTELFSGPVVFAHN  241

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N+++ KLY IDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYP+K EQYHF 
Sbjct  242   DLLSGNLMLNDEQDKLYIIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPSKEEQYHFL  301

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVSE+DLE LYVE NT+ LASHL W LWGLIQA+ISPIDFDYLGYFFWRY
Sbjct  302   RHYLQPEKPYEVSEKDLEDLYVEANTFRLASHLIWALWGLIQARISPIDFDYLGYFFWRY  361

Query  2654  TEYKKQKEKCFTTAKAYLAKSKGI  2583
              EYKKQKEKCF+ A+++L+ S+ +
Sbjct  362   NEYKKQKEKCFSLAQSHLSGSRTV  385


 Score =   141 bits (356),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 9/121 (7%)
 Frame = -2

Query  4307  VQMGKAVEILN------AEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDL  4146
             V+  KA +I+N      A+  +    DD    IP S L+VD  L  P M P ++ELCKDL
Sbjct  3     VEANKAKQIINDNNNDCAKVNSNSTIDD---SIPHSSLSVDTALPFPLMSPRIIELCKDL  59

Query  4145  FKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             F+KW+ LDDS FSVET+SGGITNLLLKVSV+EE+G+ V +TVRLYGPNT+YVIDRERELQ
Sbjct  60    FRKWAKLDDSCFSVETVSGGITNLLLKVSVKEESGDNVAVTVRLYGPNTEYVIDRERELQ  119

Query  3965  V  3963
              
Sbjct  120   A  120



>ref|XP_004287343.1| PREDICTED: probable ethanolamine kinase A-like [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   422 bits (1084),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 195/263 (74%), Positives = 221/263 (84%), Gaps = 0/263 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGA L  VF NGMVQSFI+ARTL P DMR PKLAA+IAK+L  FHQVEIPG K
Sbjct  114   KYLSAAGFGASLLAVFGNGMVQSFINARTLVPLDMRDPKLAADIAKELRRFHQVEIPGSK  173

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I KF+ KAS L+FDD+E Q+ Y T+SF EVHNE+ E+KELT H NAPVVF HN
Sbjct  174   EPQLWTDIFKFYEKASALEFDDNEKQKIYETISFSEVHNELVEVKELTSHFNAPVVFCHN  233

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTK EQYHFF
Sbjct  234   DLLSGNIMVNDEEEKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKEEQYHFF  293

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL P +P  VS++DLEALY+E NTYMLASHL W LWGLIQAK SPI+FDYL YFF RY
Sbjct  294   RHYLGPEKPQAVSDKDLEALYIEANTYMLASHLYWALWGLIQAKFSPIEFDYLSYFFLRY  353

Query  2654  TEYKKQKEKCFTTAKAYLAKSKG  2586
              EYKKQKEKC   A+++L++S  
Sbjct  354   NEYKKQKEKCLLLARSFLSRSNA  376


 Score =   145 bits (367),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA+EVAE APD+    I  S  +VD +L +P++ P V +LCKDLFK+WS+LD
Sbjct  1     MGAVNNIWNAKEVAE-APDNSAIQIRFSSQSVDPSLPLPQITPLVTKLCKDLFKEWSDLD  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DS FSVET+SGGITNLLLK +V+E++G  V++TVRLYGPNTDYVI+RERELQ 
Sbjct  60    DSRFSVETVSGGITNLLLKATVKEDDGNEVSVTVRLYGPNTDYVINRERELQA  112



>emb|CDP10387.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   421 bits (1083),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 196/260 (75%), Positives = 226/260 (87%), Gaps = 0/260 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL G+F NGMVQSFI ARTLAP DMR+PKLAAEIAK+L +FHQV+IPG KE
Sbjct  111   YLSAAGFGAKLLGIFANGMVQSFIDARTLAPPDMREPKLAAEIAKQLRKFHQVDIPGSKE  170

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF+ KAS L FDD E Q+KY T+SF+E+ +EI ELKELTG L+APVV+AHND
Sbjct  171   PQLWNDIFKFYGKASNLNFDDFEEQKKYETISFKEIISEIIELKELTGCLDAPVVYAHND  230

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DE +LY IDFEYGSY+YRGFDIGNHFNEYAGY+CDYSL P K EQYHFFR
Sbjct  231   LLSGNLMLNDDEERLYIIDFEYGSYSYRGFDIGNHFNEYAGYDCDYSLCPNKDEQYHFFR  290

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL P +P EVS++DLEALY+ETN YMLASHL W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  291   HYLDPERPEEVSDKDLEALYIETNMYMLASHLYWALWALIQAKMSPIDFDYLGYFFLRYG  350

Query  2651  EYKKQKEKCFTTAKAYLAKS  2592
             E+++QKE CF+ AKAYL++S
Sbjct  351   EFRRQKETCFSLAKAYLSRS  370


 Score =   162 bits (410),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 5/113 (4%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG AV I NA EVAE      TS IPSS LT+DH+LS  +MKP +VELCKDLFKKWSNLD
Sbjct  1     MG-AVSIWNAIEVAES----HTSDIPSSSLTIDHSLSPSDMKPRIVELCKDLFKKWSNLD  55

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +SHFSVE +SGGITNLLLKVSV E+NG  VN+TVRLYGPNT+YVI+RERELQ 
Sbjct  56    ESHFSVERVSGGITNLLLKVSVVEKNGNIVNITVRLYGPNTEYVINRERELQA  108



>ref|XP_007013403.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007013404.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007013405.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31022.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31023.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31024.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=384

 Score =   421 bits (1083),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/259 (76%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF+NGMVQSFI+ARTL  SDMRKPKL AEIAK+L  FHQVEIPG K
Sbjct  121   KYLSAAGFGAKLLGVFENGMVQSFINARTLTSSDMRKPKLVAEIAKQLRRFHQVEIPGSK  180

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KAS LQF+D + Q  Y T+ FEEVH E+T+LKELTG LNAPVVFAHN
Sbjct  181   EPQLWVDILKFFEKASALQFEDIDKQMIYETILFEEVHKEVTQLKELTGLLNAPVVFAHN  240

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N++  KLYFIDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQY FF
Sbjct  241   DLLSGNLMLNDEHDKLYFIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKDEQYLFF  300

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVSE+DLEALYVETNT+MLASHL W LW +IQA++SPIDFDYLGYFF RY
Sbjct  301   RHYLQPEKPYEVSEKDLEALYVETNTFMLASHLYWALWAIIQARMSPIDFDYLGYFFLRY  360

Query  2654  TEYKKQKEKCFTTAKAYLA  2598
              EYK+QKE CF+ A+++L+
Sbjct  361   NEYKRQKEMCFSLAQSHLS  379


 Score =   134 bits (338),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -2

Query  4232  GIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVR  4053
              IP S L+VD  LS P M   V+ELCKDLF KW+ LDDS FSVET+SGGITNLLLKVSV+
Sbjct  30    SIPHSALSVDTALSFPLMVSCVIELCKDLFGKWAKLDDSCFSVETVSGGITNLLLKVSVK  89

Query  4052  EENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             EENG+ V +TVRLYGPNT+YVI+RERELQ
Sbjct  90    EENGDDVYVTVRLYGPNTEYVINRERELQ  118



>ref|XP_010254375.1| PREDICTED: probable ethanolamine kinase [Nelumbo nucifera]
Length=376

 Score =   420 bits (1080),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/262 (75%), Positives = 227/262 (87%), Gaps = 0/262 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF NGMVQSFI+ARTL+PSDMR PKLAAEIA++L +FHQVEIPG +
Sbjct  113   RYLSAAGFGAKLLGVFGNGMVQSFINARTLSPSDMRNPKLAAEIARQLCKFHQVEIPGSR  172

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I+KF  KAS L+FDDSE QRKY T+SF+EV + I ELK+LT  L+APVVFAHN
Sbjct  173   EPQLWNDILKFLEKASALEFDDSEKQRKYETISFKEVQDAIFELKDLTDLLDAPVVFAHN  232

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N+DE KLYFIDFEYGSY+YRG+DIGNHFNEYAG++CDYSLYP K  QYHFF
Sbjct  233   DLLSGNLMLNDDEEKLYFIDFEYGSYSYRGYDIGNHFNEYAGFDCDYSLYPDKDAQYHFF  292

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVS EDLEALYVETN++MLASHL W LW LIQAK+SPIDFDYL YFF RY
Sbjct  293   RHYLQPEKPQEVSVEDLEALYVETNSFMLASHLYWALWALIQAKMSPIDFDYLSYFFLRY  352

Query  2654  TEYKKQKEKCFTTAKAYLAKSK  2589
              EYK QK+K F  A++Y+A SK
Sbjct  353   NEYKTQKDKYFLLARSYVAGSK  374


 Score =   149 bits (377),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG  V+I +A EVAE   +   S IPSS LTVD +L +P+MKP ++ELCKD+FKKWS LD
Sbjct  1     MG-GVKIWSAIEVAEEVGESCNSDIPSSSLTVDISLPLPQMKPRIIELCKDMFKKWSQLD  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +SHFS+ET+SGGITNLLLKVSVRE +G+   +TVRLYGP+T+YVIDREREL+ 
Sbjct  60    ESHFSIETVSGGITNLLLKVSVREYSGDD-TVTVRLYGPSTEYVIDRERELKA  111



>ref|XP_004245179.1| PREDICTED: probable ethanolamine kinase [Solanum lycopersicum]
Length=372

 Score =   420 bits (1079),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/260 (75%), Positives = 223/260 (86%), Gaps = 0/260 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             Q+LSAAGFGAKL  VF NGMVQSFI ARTL P DM  PKLAAEIAK+L +FHQVEIPG K
Sbjct  105   QHLSAAGFGAKLLAVFGNGMVQSFIDARTLTPPDMSNPKLAAEIAKQLRKFHQVEIPGSK  164

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQ+WN+++KF++ ASTLQFDD E + KY T+ F EVHNEI ELKELT  LNAPVVFAHN
Sbjct  165   EPQVWNDVLKFYKNASTLQFDDGEKKIKYETILFPEVHNEIIELKELTDRLNAPVVFAHN  224

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE++ KLYFIDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP K +Q+HFF
Sbjct  225   DLLSGNLMLNEEKEKLYFIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPNKDQQFHFF  284

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL   QPN+VS++DLEALYVET++YMLASHL W LW LIQAK+SPIDFDY+ YFF RY
Sbjct  285   RHYLDSDQPNKVSDKDLEALYVETSSYMLASHLYWALWALIQAKMSPIDFDYISYFFLRY  344

Query  2654  TEYKKQKEKCFTTAKAYLAK  2595
              EYKKQKEK  + AK+YL+K
Sbjct  345   NEYKKQKEKVLSLAKSYLSK  364


 Score =   155 bits (392),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  4268  EVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSG  4089
             EV EGA    T+ IP S LTVDH+LSI  +KP +VELCKDLF +WSNLD SHFSVET+SG
Sbjct  2     EVTEGARHSLTANIPYSSLTVDHSLSITHLKPKIVELCKDLFNQWSNLDGSHFSVETVSG  61

Query  4088  GITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             GITNLLLKVSVRE++G+  N+TVRLYGPNT+YVI+RERE+Q 
Sbjct  62    GITNLLLKVSVREDDGKHENMTVRLYGPNTEYVINREREMQA  103



>ref|XP_006450957.1| hypothetical protein CICLE_v10008632mg [Citrus clementina]
 ref|XP_006475821.1| PREDICTED: probable ethanolamine kinase-like [Citrus sinensis]
 gb|ESR64197.1| hypothetical protein CICLE_v10008632mg [Citrus clementina]
 gb|KDO80282.1| hypothetical protein CISIN_1g016788mg [Citrus sinensis]
Length=382

 Score =   419 bits (1078),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 195/275 (71%), Positives = 226/275 (82%), Gaps = 7/275 (3%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL  VF NGMVQSFI+ARTL P+DMR PKLAAEIAK+L  FHQVEIPG K
Sbjct  115   KYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN++ KFF KAS+L+FD+ E Q  Y T+SF+EV  EI ELKEL GHLNAPVVF+HN
Sbjct  175   EPQLWNDVSKFFEKASSLKFDEIEKQSMYETISFKEVQKEIVELKELAGHLNAPVVFSHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N+++ KLY IDFEYGSYNYRG+DIGNHF+EYAGY+CDYSLYP K EQ HFF
Sbjct  235   DLLSGNIMVNDEQEKLYLIDFEYGSYNYRGYDIGNHFSEYAGYDCDYSLYPNKDEQNHFF  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVS++DLE LYVE NT+MLASHL W LW LIQAK+SPIDFDYLGYFF RY
Sbjct  295   RHYLRPDKPEEVSDQDLEVLYVEANTFMLASHLFWALWALIQAKMSPIDFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSKGIFH*VPCTLKCC  2550
              EYKKQKE C + A++YL++S    H       CC
Sbjct  355   NEYKKQKEMCVSLAQSYLSRSGRGGH-------CC  382


 Score =   145 bits (365),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG A +I N  EVA  A ++ ++   SS L VD +LS+P M P V+ LCKDLFK+WS LD
Sbjct  1     MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDLFKQWSKLD  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             DS FSV+T+SGGITNLLLKV+V+EE+G  V++TVRLYGPNTD VI+R+RELQ
Sbjct  61    DSRFSVDTVSGGITNLLLKVTVKEESGNDVSVTVRLYGPNTDIVINRQRELQ  112



>ref|XP_006381367.1| choline/ethanolamine kinase family protein [Populus trichocarpa]
 gb|ERP59164.1| choline/ethanolamine kinase family protein [Populus trichocarpa]
Length=386

 Score =   419 bits (1077),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 229/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF+NGMVQSFI+ARTL P DMR+PKLAAEIAK+LH+FH+V+IPG K
Sbjct  123   KYLSAAGFGAKLLGVFQNGMVQSFINARTLIPQDMREPKLAAEIAKQLHKFHRVDIPGSK  182

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I KF+  ASTL FDD E ++KY T+ F+EV+NE+ E+KELT  LNAPVVFAHN
Sbjct  183   EPQLWNDIFKFYENASTLHFDDIEKRKKYETILFKEVYNEVVEIKELTDLLNAPVVFAHN  242

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N+DE KLY IDFEYGSY+YRG+DIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  243   DLLSGNLMLNDDEEKLYIIDFEYGSYSYRGYDIGNHFNEYAGYDCDYSLYPSKDEQYHFF  302

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P+EVS++DLEALYVE+NTYML SHL W LW LIQAK+SPIDFDYLGYFF RY
Sbjct  303   RHYLQPDKPHEVSDKDLEALYVESNTYMLVSHLFWALWALIQAKMSPIDFDYLGYFFLRY  362

Query  2654  TEYKKQKEKCFTTAKAYLA  2598
              E+K++KEK  + A++YL+
Sbjct  363   DEFKRRKEKACSLARSYLS  381


 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = -2

Query  4286  EILNAEEVAEGAPDDRTSG--IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSH  4113
             EI  A EVAEGA  D +S   + S+ LT+D +LS+P++ P ++ELCKDLFKKWS LDDS 
Sbjct  12    EIWKAMEVAEGARGDNSSSHVLQSASLTLDTSLSLPDLTPPLIELCKDLFKKWSRLDDSS  71

Query  4112  FSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             FSVET+SGGITNLLLKVSV+EE+G  V +TVRLYGPNTDYVI+RERELQ 
Sbjct  72    FSVETVSGGITNLLLKVSVKEEDGNEVPVTVRLYGPNTDYVINRERELQA  121



>ref|XP_011018823.1| PREDICTED: probable ethanolamine kinase isoform X2 [Populus euphratica]
Length=370

 Score =   418 bits (1074),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 228/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF+NGMVQSFI+ARTL P DMR PKLAAEIAK+LH+FH+V+IPG K
Sbjct  107   KYLSAAGFGAKLLGVFQNGMVQSFINARTLIPQDMRVPKLAAEIAKQLHKFHRVDIPGSK  166

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I KF+  AS L FDD E ++KY T+SF+EV+NE+ E+KELT  LNAPVVFAHN
Sbjct  167   EPQLWNDIFKFYENASILHFDDIEKRKKYETISFKEVYNEVVEIKELTDLLNAPVVFAHN  226

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N+DE KLY IDFEYGSY+YRG+DIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  227   DLLSGNLMLNDDEEKLYIIDFEYGSYSYRGYDIGNHFNEYAGYDCDYSLYPSKDEQYHFF  286

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P++VS++DLEALYVETNTYML SHL W LW LIQAK+SPIDFDYLGYFF RY
Sbjct  287   RHYLQPDKPHQVSDKDLEALYVETNTYMLVSHLFWALWALIQAKMSPIDFDYLGYFFLRY  346

Query  2654  TEYKKQKEKCFTTAKAYLA  2598
              E+K+QKE+  + A++YL+
Sbjct  347   NEFKRQKEQACSLARSYLS  365


 Score =   141 bits (355),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  4268  EVAEGAPDDRTSGIPSSH--LTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETL  4095
             EVAEGA  D +S        LT+D +LS+P++ P ++ELCKDLFKKWS LDDS FSVET+
Sbjct  2     EVAEGARGDNSSSHVLQSSSLTLDTSLSLPDLTPPLIELCKDLFKKWSRLDDSSFSVETV  61

Query  4094  SGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             SGGITNLLLKVSV+EE+G  V +TVRLYGPNTDYVI+RERELQ
Sbjct  62    SGGITNLLLKVSVKEEDGNEVPVTVRLYGPNTDYVINRERELQ  104



>ref|XP_008337310.1| PREDICTED: probable ethanolamine kinase [Malus domestica]
Length=384

 Score =   419 bits (1076),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 221/262 (84%), Gaps = 0/262 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLS AGFGA L GVF NGMVQSFI+ARTL PSDMR PKLAA+IAK+L  FHQVEIPG K
Sbjct  115   KYLSVAGFGANLLGVFXNGMVQSFINARTLVPSDMRNPKLAADIAKELRRFHQVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW ++ KFF KAS L+FDD+E Q+ Y T+SF EVHNE+  LKELT   NAPVVFAHN
Sbjct  175   EPQLWIDMFKFFEKASALEFDDNEKQKVYKTISFSEVHNEMIXLKELTDRFNAPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYP K EQYHF 
Sbjct  235   DLLSGNIMVNDEEDKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPNKDEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R Y++P    EVS+++LEALYVE NTYMLASHL W LWG+IQAK SPI+FDYLGYFF RY
Sbjct  295   RXYIQPENXQEVSDKELEALYVEANTYMLASHLYWALWGIIQAKFSPINFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSK  2589
              EYK QKE+CF+ A+++LA+S+
Sbjct  355   NEYKXQKERCFSMARSHLAQSE  376


 Score =   150 bits (380),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA EVA  A D  TS I SS L+VD +L +  + P ++ LCKDLFKKWSNL+
Sbjct  1     MGAVKNIWNAMEVAAQASDCSTSQIHSSSLSVDPSLPLXPVSPLIIXLCKDLFKKWSNLE  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             +S FSVET+SGGITN LLKV+V+EENG TV++TVRLYGPNTDYVI+RERELQ
Sbjct  61    NSRFSVETVSGGITNQLLKVTVKEENGNTVSVTVRLYGPNTDYVINRERELQ  112



>ref|XP_010093730.1| putative ethanolamine kinase A [Morus notabilis]
 gb|EXB54536.1| putative ethanolamine kinase A [Morus notabilis]
Length=384

 Score =   418 bits (1075),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/271 (73%), Positives = 225/271 (83%), Gaps = 7/271 (3%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLS AGFGA L  VF NGMVQSFI+ARTL P DM+KPKLAAEIAK+L EFHQVEIPG K
Sbjct  114   KYLSTAGFGANLLAVFGNGMVQSFINARTLTPLDMKKPKLAAEIAKQLREFHQVEIPGSK  173

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN++ KFF KAS L+FDD E QR Y T+SF+E+ NEI ELKELTG  NAPVVF+HN
Sbjct  174   EPQLWNDMFKFFEKASALEFDDGEKQRIYETISFKEIKNEIIELKELTGLFNAPVVFSHN  233

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLY-------PTK  2856
             DLL GN+M NE+E KLYFIDFEYGSYNYRG+DIGNHFNEYAGY+CD+SL        P+K
Sbjct  234   DLLSGNIMLNEEEDKLYFIDFEYGSYNYRGYDIGNHFNEYAGYDCDFSLLSGCEYRCPSK  293

Query  2855  TEQYHFFRYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYL  2676
              EQYHFFR+YL+P  P EVSE+DLEALYVE NTYMLAS L W LWG+IQAKISPIDFDY+
Sbjct  294   DEQYHFFRHYLQPDNPQEVSEKDLEALYVEANTYMLASQLYWALWGIIQAKISPIDFDYV  353

Query  2675  GYFFWRYTEYKKQKEKCFTTAKAYLAKSKGI  2583
             GYFF RY EYKKQKEK F+ A++YL+ S  +
Sbjct  354   GYFFLRYNEYKKQKEKSFSLARSYLSGSGTV  384


 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG A+ I NA EVA  A ++  S I  S L++D +LS+P++ PHV+ELCKDLFKKWS L+
Sbjct  1     MG-ALNIWNAMEVASEASENSISQIAFSPLSIDPSLSLPQITPHVIELCKDLFKKWSKLE  59

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DS FSVET+SGGITNLLLKVSV+E+NG  V++TVRLYGPNTDYVI+RERELQ 
Sbjct  60    DSRFSVETVSGGITNLLLKVSVKEDNGNNVSVTVRLYGPNTDYVINRERELQA  112



>ref|XP_011018821.1| PREDICTED: probable ethanolamine kinase isoform X1 [Populus euphratica]
 ref|XP_011018822.1| PREDICTED: probable ethanolamine kinase isoform X1 [Populus euphratica]
Length=386

 Score =   418 bits (1075),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 228/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF+NGMVQSFI+ARTL P DMR PKLAAEIAK+LH+FH+V+IPG K
Sbjct  123   KYLSAAGFGAKLLGVFQNGMVQSFINARTLIPQDMRVPKLAAEIAKQLHKFHRVDIPGSK  182

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I KF+  AS L FDD E ++KY T+SF+EV+NE+ E+KELT  LNAPVVFAHN
Sbjct  183   EPQLWNDIFKFYENASILHFDDIEKRKKYETISFKEVYNEVVEIKELTDLLNAPVVFAHN  242

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N+DE KLY IDFEYGSY+YRG+DIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  243   DLLSGNLMLNDDEEKLYIIDFEYGSYSYRGYDIGNHFNEYAGYDCDYSLYPSKDEQYHFF  302

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P++VS++DLEALYVETNTYML SHL W LW LIQAK+SPIDFDYLGYFF RY
Sbjct  303   RHYLQPDKPHQVSDKDLEALYVETNTYMLVSHLFWALWALIQAKMSPIDFDYLGYFFLRY  362

Query  2654  TEYKKQKEKCFTTAKAYLA  2598
              E+K+QKE+  + A++YL+
Sbjct  363   NEFKRQKEQACSLARSYLS  381


 Score =   145 bits (365),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = -2

Query  4286  EILNAEEVAEGAPDDRTSGIPSSH--LTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSH  4113
             EI  A EVAEGA  D +S        LT+D +LS+P++ P ++ELCKDLFKKWS LDDS 
Sbjct  12    EIWKAMEVAEGARGDNSSSHVLQSSSLTLDTSLSLPDLTPPLIELCKDLFKKWSRLDDSS  71

Query  4112  FSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             FSVET+SGGITNLLLKVSV+EE+G  V +TVRLYGPNTDYVI+RERELQ 
Sbjct  72    FSVETVSGGITNLLLKVSVKEEDGNEVPVTVRLYGPNTDYVINRERELQA  121



>gb|EYU29782.1| hypothetical protein MIMGU_mgv1a008431mg [Erythranthe guttata]
Length=374

 Score =   416 bits (1069),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 226/261 (87%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             +LS AGFGAKL GVF NGMVQSFI+ARTL PSD+RKPKL AEIAK+L +FH+VEIPG KE
Sbjct  112   HLSDAGFGAKLLGVFGNGMVQSFINARTLTPSDLRKPKLVAEIAKQLRKFHEVEIPGSKE  171

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW +I KFF +ASTL+FD+ E Q+KY  VSF E++ +IT LK +T   NAP+V++HND
Sbjct  172   PQLWIDIFKFFGRASTLKFDNDEKQKKYEMVSFGEINKDITNLKVMTDRFNAPIVYSHND  231

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQY+FFR
Sbjct  232   LLSGNLMMNDDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKDEQYYFFR  291

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YLKP +P+EVS+EDL+ALY ETNTYMLASHL W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  292   HYLKPDRPHEVSDEDLKALYAETNTYMLASHLYWALWALIQAKMSPIDFDYLGYFFLRYN  351

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQK+KCF  A++ L+ S+
Sbjct  352   EYKKQKDKCFLLAESCLSNSQ  372


 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG   +I NA EVAE      +S IPSS LTV+H+LS+P+MKP +VELCKDLFK+WSNLD
Sbjct  1     MGATEKIWNATEVAESH----SSEIPSSSLTVNHSLSLPDMKPRIVELCKDLFKQWSNLD  56

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +S FS+ET+SGGITNLLLKVSV E NG  V++TVRLYGPNT+YVI+RERELQ 
Sbjct  57    ESDFSLETVSGGITNLLLKVSVNENNGNVVSMTVRLYGPNTEYVINRERELQA  109



>ref|XP_008344084.1| PREDICTED: probable ethanolamine kinase [Malus domestica]
Length=384

 Score =   416 bits (1070),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 192/262 (73%), Positives = 221/262 (84%), Gaps = 0/262 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLS AGFGA L GVF NGMVQSFI+ARTL PSDMR PKLAA IAK+L  FH+VEIPG K
Sbjct  115   KYLSVAGFGANLLGVFANGMVQSFINARTLVPSDMRNPKLAANIAKELRRFHEVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW ++ KFF KAS  +FDD+E Q+ Y T+SF  VHNE+ ELKELT  LNAPVVFAHN
Sbjct  175   EPQLWIDMFKFFEKASAXEFDDNEKQKVYNTISFSVVHNEMIELKELTSLLNAPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSL P K EQYHF 
Sbjct  235   DLLSGNIMVNDEEXKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLLPNKDEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+Y++P  P+EVS++DLEALYVE NTYMLASHL W LWG+IQAK SPI+FDYLGYFF RY
Sbjct  295   RHYIQPTNPHEVSDKDLEALYVEANTYMLASHLYWALWGIIQAKFSPINFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSK  2589
              EYK QKE+CF  A+++L++S+
Sbjct  355   NEYKTQKERCFXMARSHLSQSE  376


 Score =   156 bits (394),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA EVAE A    TS IPSS L++D +L + ++ P ++E CKDLF KWSNL+
Sbjct  1     MGAGKNIWNAMEVAEQASHCSTSQIPSSSLSIDPSLPLSDISPLIIEXCKDLFSKWSNLE  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             +S FSVET+SGGITNLLLKV+V+EENG TV++TVRLYGPNTDYVI+RERELQ
Sbjct  61    NSRFSVETISGGITNLLLKVTVKEENGNTVSVTVRLYGPNTDYVINRERELQ  112



>ref|XP_008385729.1| PREDICTED: probable ethanolamine kinase [Malus domestica]
Length=384

 Score =   416 bits (1069),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/262 (73%), Positives = 221/262 (84%), Gaps = 0/262 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLS AGFGA L GVF NGMVQSFI+ARTL PSDMR PKLAA IAK+L  FH+VEIPG K
Sbjct  115   KYLSVAGFGANLLGVFANGMVQSFINARTLVPSDMRNPKLAANIAKELRRFHEVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW ++ KFF KAS  +FDD+E Q+ Y T+SF  VHNE+ ELKELT  LNAPVVFAHN
Sbjct  175   EPQLWIDMFKFFEKASAXEFDDNEKQKVYNTISFSVVHNEMIELKELTSLLNAPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSL P K EQYHF 
Sbjct  235   DLLSGNIMVNDEEXKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLLPNKDEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+Y++P  P+EVS++DLEALYVE NTYMLASHL W LWG+IQAK SPI+FDYLGYFF RY
Sbjct  295   RHYIQPTNPHEVSDKDLEALYVEANTYMLASHLYWALWGIIQAKFSPINFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSK  2589
              EYK QKE+CF  A+++L++S+
Sbjct  355   NEYKTQKERCFXMARSHLSQSE  376


 Score =   158 bits (399),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA EVAE A    TS IPSS L++D +L + ++ P ++ELCKDLF KWSNL+
Sbjct  1     MGAGKNIWNAMEVAEQASHCSTSQIPSSSLSIDPSLPLSDISPLIIELCKDLFSKWSNLE  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             +S FSVET+SGGITNLLLKV+V+EENG TV++TVRLYGPNTDYVI+RERELQ
Sbjct  61    NSRFSVETISGGITNLLLKVTVKEENGNTVSVTVRLYGPNTDYVINRERELQ  112



>ref|XP_010250053.1| PREDICTED: probable ethanolamine kinase isoform X3 [Nelumbo nucifera]
Length=348

 Score =   413 bits (1061),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 225/261 (86%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI+ARTL+PSDMRKPKLAAEIA++L +FH+VEIPG KE
Sbjct  86    YLSAAGFGAKLHGVFGNGMVQSFINARTLSPSDMRKPKLAAEIARQLRKFHEVEIPGSKE  145

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KFF KAS L+FD+ E QR+Y T+SF+EVH+ I ELK LT  L+APVVFAHND
Sbjct  146   PQLWNDIFKFFEKASVLKFDEIEKQRQYDTISFKEVHDAIVELKGLTDVLDAPVVFAHND  205

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DE KLYFIDFEYGSY+YRG+DIGNHFNEYAG++CDY+LYP K EQYHFFR
Sbjct  206   LLSGNLMLNDDEEKLYFIDFEYGSYSYRGYDIGNHFNEYAGFDCDYNLYPDKDEQYHFFR  265

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL+P  P EVS + LE LYVET ++ LASHL W LW LIQAK+SP+DFDYLGYFF RY 
Sbjct  266   HYLQPENPEEVSVKYLEVLYVETTSFALASHLYWALWALIQAKVSPVDFDYLGYFFLRYN  325

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQKEK F+ A++YLA SK
Sbjct  326   EYKKQKEKYFSLARSYLAGSK  346


 Score =   112 bits (279),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 3/71 (4%)
 Frame = -2

Query  4175  PHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTD  3996
             PH   L  DLFKKWS+LD+S FSVET+SGGITNLLLK+SVRE+NG  V LTVRLYGPNT+
Sbjct  16    PH---LYLDLFKKWSHLDESRFSVETVSGGITNLLLKISVREDNGSDVPLTVRLYGPNTE  72

Query  3995  YVIDRERELQV  3963
             YVIDRERELQ 
Sbjct  73    YVIDRERELQA  83



>ref|XP_009368829.1| PREDICTED: probable ethanolamine kinase [Pyrus x bretschneideri]
Length=384

 Score =   414 bits (1064),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 221/262 (84%), Gaps = 0/262 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLS AGFGA L GVF NGMVQSFI+ARTL PSDMR PKLAA+IAK+L  FHQVEIPG K
Sbjct  115   KYLSVAGFGANLLGVFANGMVQSFINARTLVPSDMRNPKLAADIAKELRRFHQVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW ++ KFF KAS L+FDD+E Q+ Y T+SF EVHNE+ ELKELT   NAPVVFAHN
Sbjct  175   EPQLWIDLFKFFEKASALEFDDNEKQKVYKTISFSEVHNEMIELKELTDRFNAPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N++E KLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYS  P K EQY F 
Sbjct  235   DLLSGNIMVNDEEDKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSSCPNKDEQYFFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P  P EVS+++LEALYVETNTYMLASHL W +WG+IQAK S I+FDYLGYFF RY
Sbjct  295   RHYLQPENPLEVSDKELEALYVETNTYMLASHLYWAVWGIIQAKFSLINFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSK  2589
              EYKKQKE+CFT A+++L +S+
Sbjct  355   NEYKKQKERCFTMARSHLVQSE  376


 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG    I NA EVAE A D  TS I SS  TVD +L +  + P ++ELCKDLFKKWSNL+
Sbjct  1     MGAVKNIWNAMEVAEQASDCSTSQIHSSSFTVDPSLPLSHISPLIIELCKDLFKKWSNLE  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             +S FSVET+SGGITN LLKV+V+EENG TV++TVRLYGPNTDYVI+RERELQ
Sbjct  61    NSLFSVETISGGITNQLLKVTVKEENGNTVSVTVRLYGPNTDYVINRERELQ  112



>gb|KDP32383.1| hypothetical protein JCGZ_13308 [Jatropha curcas]
Length=379

 Score =   414 bits (1063),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G + NGMVQSFI+ARTL P+DMRKPKLAAEIA++LHEFH+VEIPG K
Sbjct  116   KYLSAAGFGAKLLGTYGNGMVQSFINARTLTPADMRKPKLAAEIARQLHEFHKVEIPGSK  175

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWNEI KF+  AS LQFDD E QR Y T+SF+EV+NEI E+K LT  LNAPVVFAHN
Sbjct  176   EPQLWNEIFKFYENASILQFDDIEKQRIYETISFKEVYNEIVEIKGLTDRLNAPVVFAHN  235

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N+DE KLYFIDFEYGSY+YRG+DI NHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  236   DLLSGNLMLNDDENKLYFIDFEYGSYSYRGYDIANHFNEYAGYDCDYSLYPSKDEQYHFF  295

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P+EVS+ DLEALY+E NT+MLASH  W LW LIQAK+SPIDFDYLGYFF RY
Sbjct  296   RHYLQPDKPHEVSDRDLEALYIEANTFMLASHFFWALWALIQAKMSPIDFDYLGYFFLRY  355

Query  2654  TEYKKQKE  2631
              EYKKQKE
Sbjct  356   NEYKKQKE  363


 Score =   151 bits (381),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  4268  EVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSG  4089
             EVAE A  + TS I SS+LTVD +LS+P+M P VVELCKDLFKKWS LDDS FSVE +SG
Sbjct  13    EVAEEARGNCTSDILSSNLTVDCSLSLPQMAPRVVELCKDLFKKWSKLDDSLFSVERVSG  72

Query  4088  GITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             GITNLLLKV+V+EE+G  V++TVR+YGPNTDYVI RERELQ 
Sbjct  73    GITNLLLKVTVKEEDGNEVSVTVRIYGPNTDYVIHRERELQA  114



>ref|XP_010250052.1| PREDICTED: probable ethanolamine kinase isoform X2 [Nelumbo nucifera]
Length=356

 Score =   412 bits (1060),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 225/261 (86%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI+ARTL+PSDMRKPKLAAEIA++L +FH+VEIPG KE
Sbjct  94    YLSAAGFGAKLHGVFGNGMVQSFINARTLSPSDMRKPKLAAEIARQLRKFHEVEIPGSKE  153

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KFF KAS L+FD+ E QR+Y T+SF+EVH+ I ELK LT  L+APVVFAHND
Sbjct  154   PQLWNDIFKFFEKASVLKFDEIEKQRQYDTISFKEVHDAIVELKGLTDVLDAPVVFAHND  213

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DE KLYFIDFEYGSY+YRG+DIGNHFNEYAG++CDY+LYP K EQYHFFR
Sbjct  214   LLSGNLMLNDDEEKLYFIDFEYGSYSYRGYDIGNHFNEYAGFDCDYNLYPDKDEQYHFFR  273

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL+P  P EVS + LE LYVET ++ LASHL W LW LIQAK+SP+DFDYLGYFF RY 
Sbjct  274   HYLQPENPEEVSVKYLEVLYVETTSFALASHLYWALWALIQAKVSPVDFDYLGYFFLRYN  333

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQKEK F+ A++YLA SK
Sbjct  334   EYKKQKEKYFSLARSYLAGSK  354


 Score =   118 bits (296),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  4160  LCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDR  3981
             LCKDLFKKWS+LD+S FSVET+SGGITNLLLK+SVRE+NG  V LTVRLYGPNT+YVIDR
Sbjct  26    LCKDLFKKWSHLDESRFSVETVSGGITNLLLKISVREDNGSDVPLTVRLYGPNTEYVIDR  85

Query  3980  ERELQ  3966
             ERELQ
Sbjct  86    ERELQ  90



>ref|XP_010250050.1| PREDICTED: probable ethanolamine kinase isoform X1 [Nelumbo nucifera]
Length=365

 Score =   411 bits (1057),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 225/261 (86%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI+ARTL+PSDMRKPKLAAEIA++L +FH+VEIPG KE
Sbjct  103   YLSAAGFGAKLHGVFGNGMVQSFINARTLSPSDMRKPKLAAEIARQLRKFHEVEIPGSKE  162

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KFF KAS L+FD+ E QR+Y T+SF+EVH+ I ELK LT  L+APVVFAHND
Sbjct  163   PQLWNDIFKFFEKASVLKFDEIEKQRQYDTISFKEVHDAIVELKGLTDVLDAPVVFAHND  222

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DE KLYFIDFEYGSY+YRG+DIGNHFNEYAG++CDY+LYP K EQYHFFR
Sbjct  223   LLSGNLMLNDDEEKLYFIDFEYGSYSYRGYDIGNHFNEYAGFDCDYNLYPDKDEQYHFFR  282

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL+P  P EVS + LE LYVET ++ LASHL W LW LIQAK+SP+DFDYLGYFF RY 
Sbjct  283   HYLQPENPEEVSVKYLEVLYVETTSFALASHLYWALWALIQAKVSPVDFDYLGYFFLRYN  342

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQKEK F+ A++YLA SK
Sbjct  343   EYKKQKEKYFSLARSYLAGSK  363


 Score =   111 bits (278),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 3/70 (4%)
 Frame = -2

Query  4175  PHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTD  3996
             PH   L  DLFKKWS+LD+S FSVET+SGGITNLLLK+SVRE+NG  V LTVRLYGPNT+
Sbjct  33    PH---LYLDLFKKWSHLDESRFSVETVSGGITNLLLKISVREDNGSDVPLTVRLYGPNTE  89

Query  3995  YVIDRERELQ  3966
             YVIDRERELQ
Sbjct  90    YVIDRERELQ  99



>ref|XP_011084093.1| PREDICTED: probable ethanolamine kinase [Sesamum indicum]
Length=374

 Score =   409 bits (1051),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/258 (73%), Positives = 219/258 (85%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             +LS AGFGAKL GVF NGMVQSFI+ARTL PSDMRKPKL  EIAK+L  FH+VEIPG KE
Sbjct  112   HLSDAGFGAKLLGVFGNGMVQSFINARTLTPSDMRKPKLMTEIAKQLRRFHEVEIPGSKE  171

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF  KAS L+FDD E Q+KY  +SF E++ E+T+LK +T   +APVV+ HND
Sbjct  172   PQLWNDIFKFLDKASRLKFDDGEKQKKYEMISFGEINEELTDLKVITDRFSAPVVYCHND  231

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DE KLYFIDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQYHFFR
Sbjct  232   LLSGNLMLNDDEDKLYFIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKDEQYHFFR  291

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL+P +P+EV++++LEALY ETNTYMLASHL W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  292   HYLRPDRPHEVTDKELEALYAETNTYMLASHLYWALWALIQAKMSPIDFDYLGYFFLRYN  351

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQKE+C   A++YL 
Sbjct  352   EYKKQKEECLLLAQSYLT  369


 Score =   139 bits (350),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG A +I NA EVAE      +S IPSS LTVDH LS+P+MKP +VEL KDLFK+WS LD
Sbjct  1     MGAADKIWNATEVAESH----SSDIPSSSLTVDHALSLPDMKPRIVELFKDLFKQWSKLD  56

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +S FS+ET+SGGITNLLLKVSVRE     V++TVRL+GPNT+YVI+RERELQ 
Sbjct  57    ESDFSLETVSGGITNLLLKVSVRENEESVVSMTVRLFGPNTEYVINRERELQA  109



>ref|XP_008784349.1| PREDICTED: probable ethanolamine kinase [Phoenix dactylifera]
Length=393

 Score =   405 bits (1042),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 186/260 (72%), Positives = 222/260 (85%), Gaps = 0/260 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL G+FKNG++QSFI+ARTL+PSDM  PK+AAEIAK+L++FHQV+IPG  E
Sbjct  131   YLSAAGFGAKLLGIFKNGIIQSFINARTLSPSDMSNPKIAAEIAKELYKFHQVDIPGSSE  190

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
              QLWN++ KF  KA+ LQFDD+E Q KY T+SF+E+ NEI  LKELT  LNAPVVFAHND
Sbjct  191   AQLWNDVFKFLEKAAVLQFDDNEKQAKYETISFKEICNEIIALKELTDLLNAPVVFAHND  250

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N++EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CDYSLYP K  QYHFFR
Sbjct  251   LLSGNLMLNDEEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYSLYPEKNAQYHFFR  310

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL+P +P+EV ++DLEALY+ETNT+ LASH+ W LW LIQA++SPIDFDYL YFF RY 
Sbjct  311   NYLRPDRPHEVPDKDLEALYIETNTFRLASHIYWALWALIQAQVSPIDFDYLDYFFLRYN  370

Query  2651  EYKKQKEKCFTTAKAYLAKS  2592
             EYKKQKE CF+ A+ YL+ S
Sbjct  371   EYKKQKEACFSLAQKYLSGS  390


 Score =   142 bits (357),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 8/108 (7%)
 Frame = -2

Query  4268  EVAEGAPDDR--------TSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSH  4113
             EV  GAP++R           IPSS   +D +L +PEMKP +++LCKDLF+KWS+LD+S 
Sbjct  19    EVGGGAPEERRKEKEKNGVPSIPSSTKEIDISLPLPEMKPLIIDLCKDLFRKWSSLDNSC  78

Query  4112  FSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDREREL  3969
             FS+ET+SGGITNLLLKVSV+EE+G  V+LTVRLYGPNTD VIDR+REL
Sbjct  79    FSMETVSGGITNLLLKVSVKEESGNDVSLTVRLYGPNTDLVIDRKREL  126



>ref|XP_010688024.1| PREDICTED: probable ethanolamine kinase [Beta vulgaris subsp. 
vulgaris]
Length=368

 Score =   403 bits (1035),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/261 (71%), Positives = 219/261 (84%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL  +F NGMVQSFI ARTL P DMR+PKLAA IA++L  FH+VEIPG K
Sbjct  108   RYLSAAGFGAKLLALFGNGMVQSFIFARTLTPPDMREPKLAAVIAEELRRFHEVEIPGSK  167

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             E QLW ++ KFF KAS L+FDD E Q KY T+SF+E+ +E+++LK LT  L+APVVF+HN
Sbjct  168   ESQLWIDLSKFFEKASNLKFDDVEKQEKYQTISFKEIQSEVSDLKALTDRLDAPVVFSHN  227

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+EGKLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  228   DLLSGNLMLNEEEGKLYIIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKDEQYHFF  287

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL P  P EV ++DLEALYVETN++ML SH+ W LW LIQAK+SPIDFDYLGYFF RY
Sbjct  288   RHYLLPDAPQEVLDDDLEALYVETNSFMLVSHVYWALWALIQAKMSPIDFDYLGYFFMRY  347

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYK+QK   F++AK+Y +KS
Sbjct  348   NEYKRQKGDVFSSAKSYFSKS  368


 Score =   131 bits (330),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -2

Query  4208  VDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVN  4029
             VD +L +P MKP ++ELCKD+F+KW+NLDDS FSV+T+SGGITNLLLKV+V+EE G  V+
Sbjct  25    VDTSLPLPAMKPRIIELCKDIFEKWANLDDSCFSVKTVSGGITNLLLKVTVKEEAGNEVS  84

Query  4028  LTVRLYGPNTDYVIDREREL  3969
             +TVRLYGPNTDYVI+REREL
Sbjct  85    ITVRLYGPNTDYVINREREL  104



>ref|XP_010533172.1| PREDICTED: probable ethanolamine kinase [Tarenaya hassleriana]
Length=373

 Score =   403 bits (1035),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 222/259 (86%), Gaps = 0/259 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F+NGMVQSFI+ARTL PSD+RKP +AAEIAK+L +FH+V+IPG K
Sbjct  115   KYLSAAGFGAKLLGGFENGMVQSFINARTLEPSDIRKPMIAAEIAKQLRKFHEVDIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I KFF KASTL FDDS+ Q+ Y T+SFEE+  EI EL++ TG LNAPVVFAHN
Sbjct  175   EPQLWIDIFKFFEKASTLSFDDSDKQKLYETISFEELRKEIVELRDFTGRLNAPVVFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+E KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQYHF 
Sbjct  235   DLLSGNLMLNEEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKEEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P++P+EVSE +L++LYVE + Y LASHL W +W +IQA++SPI+FDYLGYFF RY
Sbjct  295   RHYLRPNKPHEVSEAELDSLYVEADVYKLASHLYWAVWAIIQARMSPIEFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLA  2598
              EYKKQ+ + F+ A +YL+
Sbjct  355   NEYKKQRSESFSLATSYLS  373


 Score =   136 bits (343),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = -2

Query  4301  MGKAVEILNAEEVA-EGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNL  4125
             MG AV+ L A+ VA +GA  D     PSS   VD +LS+  M PH++ LCKD+FKKW  L
Sbjct  1     MG-AVKNLWAKMVAGDGANGDHGPDFPSSSRAVDTSLSLSVMTPHIIALCKDIFKKWKAL  59

Query  4124  DDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DDS FSVE +SGGITNLLLKVSV EE G+ V++TVRLYGPNT+YVI+RERE+Q 
Sbjct  60    DDSLFSVERVSGGITNLLLKVSVMEETGKEVSVTVRLYGPNTEYVINREREVQA  113



>ref|XP_010917426.1| PREDICTED: probable ethanolamine kinase isoform X2 [Elaeis guineensis]
Length=393

 Score =   403 bits (1035),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/260 (72%), Positives = 221/260 (85%), Gaps = 0/260 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+FKNGMVQSFI ARTL+PSDMR PK+AAEIAK+LH+FHQVEIP P+E
Sbjct  131   YLSAAGFGAELLGIFKNGMVQSFISARTLSPSDMRNPKIAAEIAKQLHKFHQVEIPSPQE  190

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN++ KF  KA+ L FDDSE+Q KY  +SF+E+ +EI  LK+LT  LNAPVVFAHND
Sbjct  191   PQLWNDMFKFLEKAAVLTFDDSETQAKYEKISFKEIRDEIYVLKDLTELLNAPVVFAHND  250

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N++E +LYFIDFEYGSY+YRG+DI NHFNEYAG++CDYSLYP K  QYHFFR
Sbjct  251   LLSGNLMLNDEEERLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYSLYPDKNAQYHFFR  310

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL+P++P+EV ++DLEALYVETNT+ LASH+ W LW LIQAK+SPIDFDYL YFF R  
Sbjct  311   SYLQPNKPHEVHDKDLEALYVETNTFRLASHIYWALWALIQAKVSPIDFDYLSYFFLRCN  370

Query  2651  EYKKQKEKCFTTAKAYLAKS  2592
             EYKKQKE C + A+ YL+ S
Sbjct  371   EYKKQKEGCLSMAQKYLSGS  390


 Score =   142 bits (359),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 8/110 (7%)
 Frame = -2

Query  4268  EVAEGAP--------DDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSH  4113
             EV  GAP        +D    IPSS   +D +L +PEMKP +++LCKD F+KWS+LD+S 
Sbjct  19    EVGGGAPEVRWKEKQNDGVPAIPSSTKEIDISLPLPEMKPRIIDLCKDFFRKWSSLDNSC  78

Query  4112  FSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             FS+ET+SGGITNLLLKVSV EE+G +V+LTVRLYGPNTD VIDR+RELQ 
Sbjct  79    FSIETVSGGITNLLLKVSVTEESGSSVSLTVRLYGPNTDLVIDRKRELQA  128



>ref|XP_004956895.1| PREDICTED: probable ethanolamine kinase A-like [Setaria italica]
Length=393

 Score =   400 bits (1029),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 177/259 (68%), Positives = 224/259 (86%), Gaps = 0/259 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DMR+P++AAEIAK+LH FHQV+IPGPKE
Sbjct  131   YLSAAGFGARLLGIFENGVVQSFINARTLSPADMREPRIAAEIAKELHRFHQVDIPGPKE  190

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW++I KF +KAS L+F D+E Q++Y T+SF E+ +E+ ELK+L+  L+AP+VFAHND
Sbjct  191   PQLWDDIFKFLKKASALKFKDNEKQKRYETISFTEIQDEVQELKDLSDLLHAPLVFAHND  250

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CDY++YP K  QYHFFR
Sbjct  251   LLSGNLMLNDSEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYNMYPDKDVQYHFFR  310

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL+P +P+EV  +DLEALYVETNT+ LASH+ W LW LIQA +SPIDFDYLGYFF RY 
Sbjct  311   NYLQPDKPSEVRAQDLEALYVETNTFRLASHIYWALWALIQANVSPIDFDYLGYFFLRYG  370

Query  2651  EYKKQKEKCFTTAKAYLAK  2595
             EYKKQ+E C + A+ +L++
Sbjct  371   EYKKQRESCISLAQGFLSE  389


 Score =   124 bits (311),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             +P+S  +VD TL +PEM P ++ LCK+L K WS+LD S FS+ET+SGGITNLLLKVSV+E
Sbjct  40    VPTSAASVDITLPLPEMTPRIIGLCKELVKGWSSLDSSCFSIETVSGGITNLLLKVSVKE  99

Query  4049  ENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +     ++TVRLYGPNTD VIDR+RELQ 
Sbjct  100   DTDNEFSVTVRLYGPNTDLVIDRKRELQA  128



>ref|XP_006842861.1| hypothetical protein AMTR_s00081p00154850 [Amborella trichopoda]
 gb|ERN04536.1| hypothetical protein AMTR_s00081p00154850 [Amborella trichopoda]
Length=383

 Score =   398 bits (1023),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/261 (70%), Positives = 216/261 (83%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGAKL GVF NGMVQSFI ARTL+PSDM +PK+AAEIA++L  FHQVE+PG KE
Sbjct  121   YLSAAGFGAKLLGVFGNGMVQSFIDARTLSPSDMSQPKIAAEIARQLCTFHQVEVPGSKE  180

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW++I KF  +AS ++FDDSE Q++Y T+SF+E+ +E+ ELK LT  L + VVFAHND
Sbjct  181   PQLWDDIYKFLERASGIKFDDSEKQKRYDTISFQEIQDEVMELKALTNSLKSDVVFAHND  240

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM NE EGKLY IDFEYGSY+YRG+DI NHFNEYAG++CDYSL P K  Q HFFR
Sbjct  241   LLSGNLMLNEKEGKLYLIDFEYGSYSYRGYDIANHFNEYAGFDCDYSLCPDKETQCHFFR  300

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
             +YL P +P EVS+EDLEALYVETN +MLASH+ W LW LIQAK+SPIDFDYL YFF RY 
Sbjct  301   HYLNPEKPEEVSDEDLEALYVETNCFMLASHIYWALWALIQAKMSPIDFDYLEYFFLRYN  360

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             E+K QKEKCF  A+ YL+ SK
Sbjct  361   EHKNQKEKCFALARTYLSGSK  381


 Score =   132 bits (331),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 9/106 (8%)
 Frame = -2

Query  4271  EEVAEGA----PDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSV  4104
             EE++E A    PD     +P+S +T+  +L +P+MKP +V+LCK LFKKWS L+DS FS+
Sbjct  17    EEISEAAEHTFPD-----LPASPITIYISLPLPQMKPKIVDLCKSLFKKWSCLEDSRFSI  71

Query  4103  ETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             ET+SGGITNLLLKVSV+E+NG+   +TVRL+GPNT+YVI+R+RELQ
Sbjct  72    ETVSGGITNLLLKVSVKEDNGKVSLVTVRLFGPNTEYVINRQRELQ  117



>ref|XP_006661274.1| PREDICTED: probable ethanolamine kinase-like [Oryza brachyantha]
Length=367

 Score =   396 bits (1018),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 220/263 (84%), Gaps = 0/263 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             +LSAAGFGA+L G F+NGMVQSFI+ARTL PSDM++P++AAEIAK+L  FHQV IPG KE
Sbjct  105   HLSAAGFGAQLLGTFENGMVQSFIYARTLTPSDMKEPRIAAEIAKELRRFHQVHIPGSKE  164

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW++I KF +KAS L+F+D E Q++Y T+SF E+ +E+ ELK+L+  L+APVVF+HND
Sbjct  165   PQLWDDIFKFLKKASVLEFEDKEKQKRYETISFREIQDEVKELKDLSDLLHAPVVFSHND  224

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ E KLYFIDFEYGSY+YRG+DI NHFNEYAGY+CDYSLYP K  QYHFFR
Sbjct  225   LLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIANHFNEYAGYDCDYSLYPDKDSQYHFFR  284

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL+P +P+EV  +DL+ALYVETNTY LASH+ W LW LIQAK+SPIDF+YLGYFF RY 
Sbjct  285   NYLQPDRPSEVQAQDLDALYVETNTYRLASHIYWALWALIQAKVSPIDFEYLGYFFLRYD  344

Query  2651  EYKKQKEKCFTTAKAYLAKSKGI  2583
             EYKKQ+E C + A++ LA  K +
Sbjct  345   EYKKQRESCLSLAESSLAALKNV  367


 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  4160  LCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDR  3981
             +CK+L + WS+LD S FS+E +SGGITNLLLKVS  +  G   ++TVRLYGPNTD VIDR
Sbjct  37    ICKELVRGWSSLDSSRFSIERVSGGITNLLLKVSAEDGKGNKSSVTVRLYGPNTDMVIDR  96

Query  3980  ERELQV  3963
             +RELQ 
Sbjct  97    KRELQA  102



>ref|XP_002460268.1| hypothetical protein SORBIDRAFT_02g025680 [Sorghum bicolor]
 gb|EER96789.1| hypothetical protein SORBIDRAFT_02g025680 [Sorghum bicolor]
Length=391

 Score =   395 bits (1015),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 223/263 (85%), Gaps = 0/263 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F NG+VQSFI+ARTL+P+DMR PK+AAEIAK+LH+FHQV+IPG K+
Sbjct  129   YLSAAGFGAQLLGIFGNGVVQSFIYARTLSPADMRDPKIAAEIAKELHKFHQVDIPGSKQ  188

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++Y  +SF E+ +E+ ELK+L   ++APVV+AHND
Sbjct  189   PQLWNDIFKFLKKAAALKFEDNEQQKRYEKISFREIQDEVQELKDLLDTMHAPVVYAHND  248

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG +CDY+LYP K  QY+FFR
Sbjct  249   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGLDCDYNLYPDKDAQYNFFR  308

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL+P +P+E   +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  309   NYLRPDRPSEAQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  368

Query  2651  EYKKQKEKCFTTAKAYLAKSKGI  2583
             EYKKQ+E CF+ A+++L+K + +
Sbjct  369   EYKKQREPCFSLAQSFLSKPRNV  391


 Score =   116 bits (291),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             +P   ++VD +L +PEM P ++ LCK L   W  +D S FS+ET+SGGITNLLLKVSV+E
Sbjct  38    VPRMAVSVDISLPLPEMSPDIIYLCKQLVIGWCKIDSSRFSIETVSGGITNLLLKVSVKE  97

Query  4049  ENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             ++G    +TVRLYGPNTD VIDR+REL+ 
Sbjct  98    DDGNESAVTVRLYGPNTDLVIDRKRELKA  126



>ref|XP_009103553.1| PREDICTED: probable ethanolamine kinase [Brassica rapa]
Length=382

 Score =   395 bits (1014),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 181/261 (69%), Positives = 221/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTLAPSDMR+PK+AAEIAK+L +FH+V IPGPK
Sbjct  121   KYLSAAGFGAKLLGGFGNGMVQSFINARTLAPSDMRQPKIAAEIAKELGKFHKVNIPGPK  180

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KASTL F++ + Q+ Y T+SFEE++ EI EL+E TG LNAPVVFAHN
Sbjct  181   EPQLWVDILKFFEKASTLTFEEPDRQKLYETISFEELYKEIIELREFTGLLNAPVVFAHN  240

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+E +LY IDFEYGSYNYRGFDIGNHFNEYAGY+CDY+ YPTK EQYHF 
Sbjct  241   DLLSGNLMLNEEEERLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYTFYPTKEEQYHFI  300

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P +P+EVS  ++E++++ET+ Y LASHL W +W +IQA++SPIDFDYLGYFF RY
Sbjct  301   KHYLQPDKPDEVSVGEVESVFIETDAYKLASHLYWAVWAIIQARMSPIDFDYLGYFFLRY  360

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+   +YL+ S
Sbjct  361   NEYKKQKPLTFSLVTSYLSAS  381


 Score =   118 bits (296),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -2

Query  4211  TVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETV  4032
              VD +L +P M P ++ELCKDLF  W  LDDS FSVE +SGGITNLLLKVSV++E+ E+ 
Sbjct  38    VVDTSLPLPLMIPRIIELCKDLFSNWRELDDSLFSVERVSGGITNLLLKVSVKKEDKES-  96

Query  4031  NLTVRLYGPNTDYVIDRERELQ  3966
             ++TVRLYGPNTDYVI+R+RELQ
Sbjct  97    SITVRLYGPNTDYVINRQRELQ  118



>gb|ACG37870.1| choline/ethanolamine kinase [Zea mays]
Length=388

 Score =   394 bits (1012),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 222/258 (86%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  126   YLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  185

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++YV +SF E+ +E+ ELK+L   L+APVV+AHND
Sbjct  186   PQLWNDIFKFLKKAAALKFEDNEQQKRYVKISFREIQDEVKELKDLLDILHAPVVYAHND  245

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CDY+LYP K  QYHFFR
Sbjct  246   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYNLYPDKDAQYHFFR  305

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  306   NYLHPDRPSEVQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  365

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ++ CF  A+++L+
Sbjct  366   EYKKQRDSCFALAQSFLS  383


 Score =   130 bits (326),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEG----------APDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCK  4152
             MG    + N   VA G          A     + +P+S  +VD +L +PEM PH++ LCK
Sbjct  1     MGSEGRVWNGAGVAAGSGYGGIVEAKATTAAPADVPTSAASVDISLPLPEMSPHIIGLCK  60

Query  4151  DLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERE  3972
             +L K WS++D S FS+ET+SGGITNLLLKVSV+  NG   ++TVRLYGPNTD VIDR+RE
Sbjct  61    ELVKGWSSIDSSRFSIETVSGGITNLLLKVSVKGNNGNESSVTVRLYGPNTDLVIDRKRE  120

Query  3971  LQV  3963
             LQ 
Sbjct  121   LQA  123



>emb|CDY04460.1| BnaA07g12860D [Brassica napus]
Length=382

 Score =   393 bits (1009),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/261 (69%), Positives = 221/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTLAPSDMR+PK+AAEIAK+L +FH+V IPGPK
Sbjct  121   KYLSAAGFGAKLLGGFGNGMVQSFINARTLAPSDMRQPKIAAEIAKELGKFHKVNIPGPK  180

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KASTL F++ + Q+ Y T+SFEE++ EI EL+E TG LNAPVVFAHN
Sbjct  181   EPQLWVDILKFFEKASTLAFEEPDRQKLYETISFEELYKEIIELREFTGLLNAPVVFAHN  240

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+E +LY IDFEYGSYNYRGFDIGNHFNEYAGY+CDY+ YPTK EQYHF 
Sbjct  241   DLLSGNLMLNEEEERLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYTFYPTKEEQYHFI  300

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P +P+EVS  ++E++++ET+ Y LASHL W +W +IQA++SPI+FDYLGYFF RY
Sbjct  301   KHYLQPDKPDEVSVGEVESVFIETDAYKLASHLYWAVWAIIQARMSPIEFDYLGYFFLRY  360

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+   +YL+ S
Sbjct  361   NEYKKQKPLTFSLVTSYLSAS  381


 Score =   117 bits (294),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -2

Query  4211  TVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETV  4032
              VD +L +P M P ++ELCKD+F  W  LDDS FSVE +SGGITNLLLKVSV++E+ E+ 
Sbjct  38    VVDTSLPLPLMIPRIIELCKDMFSNWRELDDSLFSVERVSGGITNLLLKVSVKKEDKES-  96

Query  4031  NLTVRLYGPNTDYVIDRERELQ  3966
             ++TVRLYGPNTDYVI+R+RELQ
Sbjct  97    SITVRLYGPNTDYVINRQRELQ  118



>ref|NP_001132180.1| uncharacterized protein LOC100193605 [Zea mays]
 gb|ACF80922.1| unknown [Zea mays]
Length=351

 Score =   391 bits (1005),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 222/258 (86%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  89    YLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  148

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++YV +SF E+ +E+ ELK+L   L+APVV+AHND
Sbjct  149   PQLWNDIFKFLKKAAALKFEDNEQQKRYVKISFTEIQDEVKELKDLLDILHAPVVYAHND  208

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CD++LYP K  QYHFFR
Sbjct  209   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDFNLYPDKDAQYHFFR  268

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  269   NYLHPDRPSEVQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  328

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ++ CF  A+++L+
Sbjct  329   EYKKQRDSCFALAQSFLS  346


 Score =   101 bits (252),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  4160  LCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDR  3981
             LCK+L K WS++D S FS+ET+SGGITNLLLKVSV+  NG   ++TVRLYGPNTD VIDR
Sbjct  21    LCKELVKGWSSIDSSRFSIETVSGGITNLLLKVSVKGNNGNDSSVTVRLYGPNTDLVIDR  80

Query  3980  ERELQV  3963
             +RELQ 
Sbjct  81    KRELQA  86



>ref|XP_010541898.1| PREDICTED: probable ethanolamine kinase isoform X2 [Tarenaya 
hassleriana]
Length=375

 Score =   392 bits (1007),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/256 (70%), Positives = 215/256 (84%), Gaps = 0/256 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL GVF NGMVQSFI+ARTL PSDMRKPK+AAEIAK+L +FH+V+IPG +
Sbjct  115   KYLSAAGFGAKLLGVFGNGMVQSFINARTLEPSDMRKPKIAAEIAKQLRKFHEVKIPGSE  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I KFF KASTL FDD++ Q+ Y T+SFE++  EI EL++ T  LNAPVVF+HN
Sbjct  175   EPQLWIDIFKFFEKASTLTFDDADKQKLYETISFEDLQKEILELRDFTVQLNAPVVFSHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N++E +LY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQYHFF
Sbjct  235   DLLSGNLMLNDEEERLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKEEQYHFF  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P+ P+EV E +LE+L++E   Y LASHL W  W LIQA++SPI+FDYLGYFF RY
Sbjct  295   RHYLRPNNPHEVPEAELESLHIEAEVYKLASHLYWATWALIQARMSPIEFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKA  2607
              EYKKQK   F+ A A
Sbjct  355   NEYKKQKSSSFSLATA  370


 Score =   140 bits (352),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG A  I    E  +    D +S IPSS L VD +L +  M P ++ LCKD+FKKW  LD
Sbjct  1     MGAAKNIWAKMEAGDECNGDHSSAIPSSSLAVDTSLPLSVMAPRIIALCKDVFKKWEELD  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             DS FSVE +SGGITNLLLKVSV EE G+ V++TVRLYGPNT+YVI+RERELQ 
Sbjct  61    DSLFSVERVSGGITNLLLKVSVSEEAGKEVSITVRLYGPNTEYVINRERELQA  113



>gb|ACF82580.1| unknown [Zea mays]
Length=338

 Score =   390 bits (1003),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 221/258 (86%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  76    YLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  135

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++YV +SF E+ +E+ ELK+L   L+APVV+AHND
Sbjct  136   PQLWNDIFKFLKKAAALKFEDNEQQKRYVKISFTEIQDEVKELKDLLDILHAPVVYAHND  195

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG +CD++LYP K  QYHFFR
Sbjct  196   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGLDCDFNLYPDKDAQYHFFR  255

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  256   NYLHPDRPSEVQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  315

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ++ CF  A+++L+
Sbjct  316   EYKKQRDSCFALAQSFLS  333


 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  4181  MKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPN  4002
             M PH++ LCK+L K WS++D S FS+ET+SGGITNLLLKVSV+  NG   ++TVRLYGPN
Sbjct  1     MSPHIIGLCKELVKGWSSIDSSRFSIETVSGGITNLLLKVSVKGNNGNDSSVTVRLYGPN  60

Query  4001  TDYVIDRERELQV  3963
             TD VIDR+RELQ 
Sbjct  61    TDLVIDRKRELQA  73



>tpg|DAA61638.1| TPA: choline/ethanolamine kinase [Zea mays]
Length=388

 Score =   392 bits (1008),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 222/258 (86%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  126   YLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  185

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++YV +SF E+ +E+ ELK+L   L+APVV+AHND
Sbjct  186   PQLWNDIFKFLKKAAALKFEDNEQQKRYVKISFTEIQDEVKELKDLLDILHAPVVYAHND  245

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CD++LYP K  QYHFFR
Sbjct  246   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDFNLYPDKDAQYHFFR  305

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  306   NYLHPDRPSEVQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  365

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ++ CF  A+++L+
Sbjct  366   EYKKQRDSCFALAQSFLS  383


 Score =   130 bits (326),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEG----------APDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCK  4152
             MG    + N   VA G          A     + +P+S  +VD +L +PEM PH++ LCK
Sbjct  1     MGSEGRVWNGAGVAAGSGYGGSVEAKATTAAPADVPTSAASVDISLPLPEMSPHIIGLCK  60

Query  4151  DLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERE  3972
             +L K WS++D S FS+ET+SGGITNLLLKVSV+  NG   ++TVRLYGPNTD VIDR+RE
Sbjct  61    ELVKGWSSIDSSRFSIETVSGGITNLLLKVSVKGNNGNDSSVTVRLYGPNTDLVIDRKRE  120

Query  3971  LQV  3963
             LQ 
Sbjct  121   LQA  123



>gb|EPS66866.1| hypothetical protein M569_07911, partial [Genlisea aurea]
Length=351

 Score =   390 bits (1002),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/259 (69%), Positives = 210/259 (81%), Gaps = 0/259 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA L GVF NGMVQSFI ARTL PSDMR PKLAA+IAK L  FH V++PG KE
Sbjct  93    YLSAAGFGAVLLGVFGNGMVQSFIDARTLTPSDMRSPKLAAQIAKHLRRFHSVQVPGSKE  152

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KFF +ASTL+FDD+E Q+   ++SF E+  EI +LK+LT   +APVV+AHND
Sbjct  153   PQLWNDISKFFGRASTLKFDDAEKQKTLESISFTEIDQEIDQLKQLTSRFDAPVVYAHND  212

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+DE KLY IDFEYGSYNYRGFDIGNHF EYAGYECDY LYP + EQY FFR
Sbjct  213   LLSGNLMLNDDEEKLYLIDFEYGSYNYRGFDIGNHFCEYAGYECDYGLYPNEDEQYLFFR  272

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P  P +VS+ +LEAL+VETNT+ML +HL W LW +IQAK+SPIDFDYLGYF  RY 
Sbjct  273   NYLNPDNPTQVSDSELEALHVETNTFMLVAHLYWALWAVIQAKVSPIDFDYLGYFILRYN  332

Query  2651  EYKKQKEKCFTTAKAYLAK  2595
             EYK++K +CF++A+ Y +K
Sbjct  333   EYKRRKAQCFSSAQVYFSK  351


 Score =   136 bits (343),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  4232  GIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVR  4053
              IPSS  TVDH+L +P++KP + E+C+DLF KW NLDDS FS+ET+SGGITNLLLKVS+R
Sbjct  1     SIPSSDRTVDHSLPLPDLKPRIAEVCRDLFNKWRNLDDSDFSLETVSGGITNLLLKVSIR  60

Query  4052  EENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             E+   T  +TVRL+GPNT+YV++RERELQ 
Sbjct  61    EKQDSTAVITVRLFGPNTEYVVNRERELQA  90



>ref|XP_006578442.1| PREDICTED: probable ethanolamine kinase [Glycine max]
Length=378

 Score =   391 bits (1004),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/263 (69%), Positives = 218/263 (83%), Gaps = 0/263 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +Y++AAGFGAK  G+F NGMVQSFI+A+TL+PSDMR+PKLA++IAK+L  FH VEIPG K
Sbjct  115   KYITAAGFGAKWLGIFGNGMVQSFINAQTLSPSDMREPKLASKIAKQLQRFHHVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN++ KFF KAS L+FDDS+ Q+ Y T+SF+EVH+EI ELK L   L +PV+FAHN
Sbjct  175   EPQLWNDVWKFFEKASVLEFDDSKMQKTYETISFKEVHDEIVELKGLCDLLKSPVIFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N +E KLYFID+EY SYNYRG+DIGNHF EYAG+ECDY LYP   EQYHF 
Sbjct  235   DLLSGNIMINYEEDKLYFIDYEYASYNYRGYDIGNHFAEYAGFECDYDLYPNMNEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YLKP +P EVSE+DLE LYVE NT+ LASH+ W LWGLIQAK+SPI+FDYLGYFF RY
Sbjct  295   RHYLKPERPQEVSEKDLETLYVEANTFSLASHVFWALWGLIQAKMSPIEFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSKG  2586
              EYK+QKEK F  A++YL+  K 
Sbjct  355   HEYKRQKEKYFLLARSYLSGCKN  377


 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG  V+I N  EVAE A  D  S I SSHLT+D +L +P M P V++LCKD+FK WSNLD
Sbjct  1     MGAEVKIWNPVEVAEQARHDYASQIHSSHLTIDPSLELPLMAPLVLKLCKDMFKAWSNLD  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQVS  3960
             DS F VE +SGGITNLLLKVSV++EN     +TVRLYGPNT+Y+IDR+RELQ +
Sbjct  61    DSRFVVEKISGGITNLLLKVSVKQENCIEETITVRLYGPNTEYIIDRQRELQAT  114



>tpg|DAA61639.1| TPA: hypothetical protein ZEAMMB73_138989 [Zea mays]
Length=441

 Score =   393 bits (1009),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 222/258 (86%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  179   YLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  238

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++YV +SF E+ +E+ ELK+L   L+APVV+AHND
Sbjct  239   PQLWNDIFKFLKKAAALKFEDNEQQKRYVKISFTEIQDEVKELKDLLDILHAPVVYAHND  298

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CD++LYP K  QYHFFR
Sbjct  299   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDFNLYPDKDAQYHFFR  358

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  359   NYLHPDRPSEVQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  418

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ++ CF  A+++L+
Sbjct  419   EYKKQRDSCFALAQSFLS  436


 Score =   106 bits (264),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 82/176 (47%), Gaps = 63/176 (36%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEG----------APDDRTSGIPSSHLTVDHTLSIPEMKPHVVE---  4161
             MG    + N   VA G          A     + +P+S  +VD +L +PEM PH+++   
Sbjct  1     MGSEGRVWNGAGVAAGSGYGGSVEAKATTAAPADVPTSAASVDISLPLPEMSPHIMQVPP  60

Query  4160  --------------------------------------------------LCKDLFKKWS  4131
                                                               LCK+L K WS
Sbjct  61    PTLLSLFDPLASARTSGWSRAAVRLSAARVMFEHSRARGASYPCPRTSRGLCKELVKGWS  120

Query  4130  NLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             ++D S FS+ET+SGGITNLLLKVSV+  NG   ++TVRLYGPNTD VIDR+RELQ 
Sbjct  121   SIDSSRFSIETVSGGITNLLLKVSVKGNNGNDSSVTVRLYGPNTDLVIDRKRELQA  176



>ref|XP_006450962.1| hypothetical protein CICLE_v10008632mg [Citrus clementina]
 gb|ESR64202.1| hypothetical protein CICLE_v10008632mg [Citrus clementina]
Length=249

 Score =   385 bits (989),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  3317  MVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKEPQLWNEIIKFFRKASTLQ  3138
             MVQSFI+ARTL P+DMR PKLAAEIAK+L  FHQVEIPG KEPQLWN++ KFF KAS+L+
Sbjct  1     MVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSKEPQLWNDVSKFFEKASSLK  60

Query  3137  FDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHNDLLCGNLMHNEDEGKLYFI  2958
             FD+ E Q  Y T+SF+EV  EI ELKEL GHLNAPVVF+HNDLL GN+M N+++ KLY I
Sbjct  61    FDEIEKQSMYETISFKEVQKEIVELKELAGHLNAPVVFSHNDLLSGNIMVNDEQEKLYLI  120

Query  2957  DFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFRYYLKPHQPNEVSEEDLEA  2778
             DFEYGSYNYRG+DIGNHF+EYAGY+CDYSLYP K EQ HFFR+YL+P +P EVS++DLE 
Sbjct  121   DFEYGSYNYRGYDIGNHFSEYAGYDCDYSLYPNKDEQNHFFRHYLRPDKPEEVSDQDLEV  180

Query  2777  LYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYTEYKKQKEKCFTTAKAYLA  2598
             LYVE NT+MLASHL W LW LIQAK+SPIDFDYLGYFF RY EYKKQKE C + A++YL+
Sbjct  181   LYVEANTFMLASHLFWALWALIQAKMSPIDFDYLGYFFLRYNEYKKQKEMCVSLAQSYLS  240

Query  2597  KS  2592
             +S
Sbjct  241   RS  242



>dbj|BAD36072.1| putative ethanolamine kinase 1 [Oryza sativa Japonica Group]
Length=381

 Score =   390 bits (1002),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/263 (68%), Positives = 221/263 (84%), Gaps = 2/263 (1%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             +LSAAGFGA+L G F+NGMVQSFI+ARTL PSDM++P++AAEIAK++  FHQV+IPG KE
Sbjct  117   HLSAAGFGAQLLGTFENGMVQSFIYARTLTPSDMKEPRIAAEIAKEIRRFHQVDIPGSKE  176

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLW++I KF +KAS L+F+D E Q++Y T+SF ++ +E+ ELK+L+  L+APVVF+HND
Sbjct  177   PQLWDDIFKFMKKASILEFEDKEKQKRYETISFRKIQDEVKELKDLSDLLHAPVVFSHND  236

Query  3011  LLCGNLMHNEDEGK--LYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHF  2838
             LL GNLM N+ EGK  LYFIDFEYGSY+YRG+DI NHFNEYAGY+CDYSLYP K  QYHF
Sbjct  237   LLSGNLMLNDLEGKHRLYFIDFEYGSYSYRGYDIANHFNEYAGYDCDYSLYPDKNSQYHF  296

Query  2837  FRYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWR  2658
             FR YL+P +P+EV  +DL+ALYVETNTY LASH+ W LW LIQAK+SPIDFDYLGYFF R
Sbjct  297   FRNYLQPDRPSEVQLQDLDALYVETNTYRLASHIYWALWALIQAKVSPIDFDYLGYFFLR  356

Query  2657  YTEYKKQKEKCFTTAKAYLAKSK  2589
             Y EYKKQ+E C + A++ L+  K
Sbjct  357   YDEYKKQRESCLSLAESSLSALK  379


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  4160  LCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDR  3981
             +CK+L + WS+LD S FS+ET+SGGITN+LLKVS  +  G   ++TVRLYGPNTD VIDR
Sbjct  49    ICKELVRGWSSLDSSRFSIETVSGGITNMLLKVSAEDGKGNKSSVTVRLYGPNTDLVIDR  108

Query  3980  ERELQV  3963
             +RELQ 
Sbjct  109   KRELQA  114



>ref|XP_006296073.1| hypothetical protein CARUB_v10025223mg [Capsella rubella]
 gb|EOA28971.1| hypothetical protein CARUB_v10025223mg [Capsella rubella]
Length=385

 Score =   390 bits (1002),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/261 (69%), Positives = 221/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTL PSDMR+PK+AAEIAK+L  FH+VEIPG K
Sbjct  123   KYLSAAGFGAKLLGGFGNGMVQSFINARTLEPSDMRQPKVAAEIAKELGRFHKVEIPGSK  182

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KASTL+F+D + Q+ + T+SFEE+  EI EL+E TG LN+PVVFAHN
Sbjct  183   EPQLWFDILKFFEKASTLRFEDPDKQKLFETISFEELRKEIIELREFTGLLNSPVVFAHN  242

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+E KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDY+LYP+K EQYHF 
Sbjct  243   DLLSGNLMLNEEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYTLYPSKEEQYHFI  302

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P +PNEVS  ++E+++VET+ Y LASHL W +W +IQA++SPI+F+YLGYFF RY
Sbjct  303   KHYLQPDKPNEVSIAEVESVFVETDAYKLASHLYWAIWAIIQARMSPIEFEYLGYFFLRY  362

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+  K++++ S
Sbjct  363   NEYKKQKPLTFSLVKSHMSAS  383


 Score =   124 bits (312),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             IP S   VD +L +P M P ++ELCKDLFK W +LDDS FSVE +SGGITNLLLKVSV+E
Sbjct  33    IPYSSSVVDTSLPLPLMIPRIIELCKDLFKNWRDLDDSVFSVERVSGGITNLLLKVSVKE  92

Query  4049  ENGETVNLTVRLYGPNTDYVIDREREL  3969
             +    V++TVRLYGPNT+YVI+RERE+
Sbjct  93    DTDREVSVTVRLYGPNTEYVINREREI  119



>gb|KHN24262.1| Putative ethanolamine kinase A [Glycine soja]
Length=378

 Score =   390 bits (1001),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 218/263 (83%), Gaps = 0/263 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +Y++AAGFGAK  G+F NGMVQSFI+A+TL+PSDMR+PKLA++IAK+L  FH VEIPG K
Sbjct  115   KYITAAGFGAKWLGIFGNGMVQSFINAQTLSPSDMREPKLASKIAKQLQRFHHVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN++ KFF KAS L+FDDS+ Q+ Y T+SF+EVH+EI ELK L   L +PV+FAHN
Sbjct  175   EPQLWNDVWKFFEKASVLEFDDSKMQKTYETISFKEVHDEIVELKGLCDLLKSPVIFAHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N +E KLYFID+EY SYNYRG+DIG+HF EYAG+ECDY LYP   EQYHF 
Sbjct  235   DLLSGNIMINYEEDKLYFIDYEYASYNYRGYDIGDHFAEYAGFECDYDLYPNMNEQYHFL  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YLKP +P EVSE+DLE LYVE NT+ LASH+ W LWGLIQAK+SPI+FDYLGYFF RY
Sbjct  295   RHYLKPERPQEVSEKDLETLYVEANTFSLASHVFWALWGLIQAKMSPIEFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYLAKSKG  2586
              EYK+QKEK F  A++YL+  K 
Sbjct  355   HEYKRQKEKYFLVARSYLSGCKN  377


 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG  V+I N  EVAE A  D  S I SSHLT+D +L +P M P V++LCKD+FK WSNLD
Sbjct  1     MGAEVKIWNPVEVAEQARHDYASQIHSSHLTIDPSLELPLMAPLVLKLCKDMFKAWSNLD  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQVS  3960
             DS F VE +SGGITNLLLKVSV++EN     +TVRLYGPNT+Y+IDR+RELQ +
Sbjct  61    DSRFVVEKISGGITNLLLKVSVKQENCIEETITVRLYGPNTEYIIDRQRELQAT  114



>emb|CDX71494.1| BnaC04g17290D [Brassica napus]
Length=380

 Score =   390 bits (1001),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/261 (68%), Positives = 220/261 (84%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI ARTLAPSDMR+PK+AAE+AK+L +FH+V IPGPK
Sbjct  119   KYLSAAGFGAKLLGGFGNGMVQSFIKARTLAPSDMRQPKIAAEVAKELGKFHKVNIPGPK  178

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KASTL F++ + Q+ + T+SFEE++ EI EL+E TG LNAPVVFAHN
Sbjct  179   EPQLWVDILKFFEKASTLAFEEPDRQKLFDTISFEELYKEIIELREFTGLLNAPVVFAHN  238

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NEDE +LY IDFEYGSYNYRGFDIGNHFNEYAGY+CDY+ YPTK EQYHF 
Sbjct  239   DLLSGNLMLNEDEERLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYTFYPTKEEQYHFI  298

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P +P+EVS  ++E++++ET+ Y LASHL W +W +IQA++SPI+FDYLGYFF RY
Sbjct  299   KHYLQPDKPDEVSVGEVESVFIETDAYKLASHLYWAVWAIIQARMSPIEFDYLGYFFLRY  358

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+   ++L+ S
Sbjct  359   NEYKKQKPLTFSLVTSHLSAS  379


 Score =   109 bits (273),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = -2

Query  4283  ILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSV  4104
             IL AE    G  D  +S IP S   VD +L +P M P ++ELCKDLF  W  LDDS FSV
Sbjct  11    ILEAEG-GRGNDDASSSQIPYSSSVVDTSLPLPLMIPRIIELCKDLFSNWRELDDSLFSV  69

Query  4103  ETLSGGITNLLLKVSV-REENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             E +SGGITNLLLKVSV  EE  +  ++TVRLYGPNTDYVI+R+RELQ
Sbjct  70    ERVSGGITNLLLKVSVKEEEEDKESSITVRLYGPNTDYVINRQRELQ  116



>ref|XP_006408728.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum]
 gb|ESQ50181.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum]
Length=378

 Score =   390 bits (1001),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/261 (68%), Positives = 219/261 (84%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTL PSDMR+PK+AAEIAK+L +FH+VEIPG K
Sbjct  117   KYLSAAGFGAKLLGGFGNGMVQSFINARTLDPSDMRQPKIAAEIAKELGKFHKVEIPGSK  176

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KASTL+F++ + Q+ + T+SFEE+H EI EL+E TG LNAPVVFAHN
Sbjct  177   EPQLWVDIVKFFEKASTLRFEEPDRQKLFETISFEELHKEIIELREFTGVLNAPVVFAHN  236

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+E KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYS YP+K +QYHF 
Sbjct  237   DLLSGNLMLNEEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSFYPSKEQQYHFI  296

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P  P+EV   ++E++++ET+ Y LASHL W +W +IQA++SPI+FDYLGYFF RY
Sbjct  297   KHYLQPDNPDEVGIAEVESVFIETDAYKLASHLYWAVWAIIQARMSPIEFDYLGYFFLRY  356

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+   +YL+ S
Sbjct  357   NEYKKQKPVTFSLVTSYLSAS  377


 Score =   127 bits (319),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -2

Query  4283  ILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSV  4104
             IL AE+ A G  ++ +S IP S + V+ +L +P M P ++ELCKDLFK W  +DD+ FSV
Sbjct  10    ILEAEDDASGN-NNASSQIPYSSIIVNTSLPLPVMIPRIIELCKDLFKNWREIDDALFSV  68

Query  4103  ETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             E +SGGITNLLLKV V+E+    +++TVRLYGPNT+YVI+RERELQ
Sbjct  69    ERVSGGITNLLLKVFVKEDTDRELSVTVRLYGPNTEYVINRERELQ  114



>ref|XP_006408727.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum]
 gb|ESQ50180.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum]
Length=361

 Score =   389 bits (999),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/261 (68%), Positives = 219/261 (84%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTL PSDMR+PK+AAEIAK+L +FH+VEIPG K
Sbjct  100   KYLSAAGFGAKLLGGFGNGMVQSFINARTLDPSDMRQPKIAAEIAKELGKFHKVEIPGSK  159

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KFF KASTL+F++ + Q+ + T+SFEE+H EI EL+E TG LNAPVVFAHN
Sbjct  160   EPQLWVDIVKFFEKASTLRFEEPDRQKLFETISFEELHKEIIELREFTGVLNAPVVFAHN  219

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM NE+E KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYS YP+K +QYHF 
Sbjct  220   DLLSGNLMLNEEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSFYPSKEQQYHFI  279

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P  P+EV   ++E++++ET+ Y LASHL W +W +IQA++SPI+FDYLGYFF RY
Sbjct  280   KHYLQPDNPDEVGIAEVESVFIETDAYKLASHLYWAVWAIIQARMSPIEFDYLGYFFLRY  339

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+   +YL+ S
Sbjct  340   NEYKKQKPVTFSLVTSYLSAS  360


 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 18/106 (17%)
 Frame = -2

Query  4283  ILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSV  4104
             IL AE+ A G  ++ +S IP S + V+ +L +P M P ++ELCKDLFK W  +DD+ FSV
Sbjct  10    ILEAEDDASGN-NNASSQIPYSSIIVNTSLPLPVMIPRIIELCKDLFKNWREIDDALFSV  68

Query  4103  ETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             E +SGGITNLL                 RLYGPNT+YVI+RERELQ
Sbjct  69    ERVSGGITNLL-----------------RLYGPNTEYVINRERELQ  97



>ref|NP_001146697.1| choline/ethanolamine kinase [Zea mays]
 gb|ACL52565.1| unknown [Zea mays]
 gb|ACL54569.1| unknown [Zea mays]
 gb|ACN33836.1| unknown [Zea mays]
 tpg|DAA40142.1| TPA: choline/ethanolamine kinase [Zea mays]
Length=393

 Score =   390 bits (1001),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/261 (67%), Positives = 221/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  131   YLSAAGFGARLLGIFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  190

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+  Q++Y  +SF E+ +E+ ELK+L   L APVV+AHND
Sbjct  191   PQLWNDIFKFLKKAAALKFEDNMKQKRYEKISFREIQDEVQELKDLLDILRAPVVYAHND  250

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CDY+LYP K  QYHFFR
Sbjct  251   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYNLYPDKDAQYHFFR  310

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL   +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  311   NYLHTDRPSEVDAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  370

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQ+E CF+ A+++L++ K
Sbjct  371   EYKKQRESCFSLAQSFLSELK  391


 Score =   121 bits (303),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             +P+S  +VD +L + +M P ++ LCK+L + WS++D S FS+ET+SGGITNLLLKVSV+E
Sbjct  40    VPTSAASVDISLPLLKMSPRIIALCKELVEGWSSIDSSLFSIETVSGGITNLLLKVSVKE  99

Query  4049  ENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +NG   ++TVRLYGPNTD VIDR+RELQ 
Sbjct  100   DNGNESSVTVRLYGPNTDLVIDRKRELQA  128



>ref|XP_008650912.1| PREDICTED: uncharacterized protein LOC100193605 isoform X1 [Zea 
mays]
Length=487

 Score =   393 bits (1010),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 222/258 (86%), Gaps = 0/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  225   YLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  284

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+E Q++YV +SF E+ +E+ ELK+L   L+APVV+AHND
Sbjct  285   PQLWNDIFKFLKKAAALKFEDNEQQKRYVKISFTEIQDEVKELKDLLDILHAPVVYAHND  344

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CD++LYP K  QYHFFR
Sbjct  345   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDFNLYPDKDAQYHFFR  404

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL P +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  405   NYLHPDRPSEVQAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  464

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ++ CF  A+++L+
Sbjct  465   EYKKQRDSCFALAQSFLS  482


 Score =   132 bits (331),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 18/129 (14%)
 Frame = -2

Query  4307  VQMGKAVEILNAEEVAEG--------------APDDRTSGIPSSHLTVDHTLSIPEMKPH  4170
             V MG    + N   VA G              AP D    +P+S  +VD +L +PEM PH
Sbjct  98    VGMGSEGRVWNGAGVAAGSGYGGSVEAKATTAAPAD----VPTSAASVDISLPLPEMSPH  153

Query  4169  VVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYV  3990
             ++ LCK+L K WS++D S FS+ET+SGGITNLLLKVSV+  NG   ++TVRLYGPNTD V
Sbjct  154   IIGLCKELVKGWSSIDSSRFSIETVSGGITNLLLKVSVKGNNGNDSSVTVRLYGPNTDLV  213

Query  3989  IDRERELQV  3963
             IDR+RELQ 
Sbjct  214   IDRKRELQA  222



>gb|ACG32241.1| choline/ethanolamine kinase [Zea mays]
Length=393

 Score =   390 bits (1001),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/261 (67%), Positives = 221/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+F+NG+VQSFI+ARTL+P+DM++PK+AAEIAK+L +FHQV+IPG KE
Sbjct  131   YLSAAGFGARLLGIFENGVVQSFIYARTLSPADMKEPKIAAEIAKELRKFHQVDIPGSKE  190

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KA+ L+F+D+  Q++Y  +SF E+ +E+ ELK+L   L APVV+AHND
Sbjct  191   PQLWNDIFKFLKKAAALKFEDNMKQKRYEKISFREIQDEVQELKDLLDILRAPVVYAHND  250

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ EGKLYFIDFEYGSY+YRG+DI NHFNEYAG++CDY+LYP K  QYHFFR
Sbjct  251   LLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYNLYPDKDAQYHFFR  310

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL   +P+EV  +D+E LYVETNT+ LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  311   NYLHTDRPSEVDAQDMEVLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  370

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQ+E CF+ A+++L++ K
Sbjct  371   EYKKQRESCFSLAQSFLSELK  391


 Score =   120 bits (300),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             +P+S  +VD +L + +M P ++ LCK+L + WS++D S FS+ET+SGGITNLLLKVSV+E
Sbjct  40    VPTSAASVDISLPLLKMSPPIIALCKELVEGWSSIDSSLFSIETVSGGITNLLLKVSVKE  99

Query  4049  ENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             +NG   ++TVRLYGPNTD VIDR+RELQ 
Sbjct  100   DNGNESSVTVRLYGPNTDLVIDRKRELQA  128



>gb|KEH37939.1| choline/ethanolamine kinase [Medicago truncatula]
Length=377

 Score =   389 bits (998),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 181/258 (70%), Positives = 215/258 (83%), Gaps = 0/258 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +Y++AAGFGA+  G+F NG+VQSFI+A TLAPSDMR+PKL A+IAK+L +FH VEIPG K
Sbjct  115   KYITAAGFGAEWLGIFGNGIVQSFINAHTLAPSDMREPKLVAKIAKQLQKFHGVEIPGSK  174

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLWN+I KFF KAS L+F DSE Q+ Y TVSF+EVH+EI EL+ L+  L +PV+F+HN
Sbjct  175   EPQLWNDIWKFFEKASVLEFGDSEKQKTYKTVSFKEVHDEIYELQVLSDRLKSPVIFSHN  234

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GN+M N +E KLYFID+EY SYNYRG+DIGNHF EYAG+ECDYSLYP   EQYHFF
Sbjct  235   DLLSGNIMINHEEDKLYFIDYEYASYNYRGYDIGNHFAEYAGFECDYSLYPNMNEQYHFF  294

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             R+YL+P +P EVSE DL+ LYVE NTY LASHL W LWGLIQAK+SPIDFDYLGYFF RY
Sbjct  295   RHYLQPDRPQEVSENDLKTLYVEVNTYALASHLFWSLWGLIQAKMSPIDFDYLGYFFLRY  354

Query  2654  TEYKKQKEKCFTTAKAYL  2601
              EYK+QKEK  + A +YL
Sbjct  355   NEYKRQKEKLVSMALSYL  372


 Score =   130 bits (328),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  4301  MGKAVEILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLD  4122
             MG  V+I N  E+AE A +D  S I  S L++D +LS+P+M P V+ LCKD+FK WS+L 
Sbjct  1     MGGKVKIWNPVEIAEQAKNDYASQIFPSLLSIDPSLSLPQMTPLVINLCKDMFKTWSSLG  60

Query  4121  DSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQ  3966
             DS F VE +SGGITNLLLKVSV++ +     +TVRLYGPNT+++IDR RELQ
Sbjct  61    DSCFKVEKISGGITNLLLKVSVKQGDSIDDIITVRLYGPNTEHIIDRFRELQ  112



>ref|XP_008803395.1| PREDICTED: probable ethanolamine kinase isoform X1 [Phoenix dactylifera]
Length=398

 Score =   389 bits (999),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 213/255 (84%), Gaps = 0/255 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L G+FKNGMVQSFI+ARTL+PSDM  PK+AA IAK+L +FHQVEIP  +E
Sbjct  131   YLSAAGFGAELLGIFKNGMVQSFINARTLSPSDMSNPKIAAGIAKQLQKFHQVEIPSSRE  190

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF  KA+ L FDDSE Q KY  +SF+E+H+EI  LK+LT  L+APVVFAHND
Sbjct  191   PQLWNDIFKFLEKAAVLTFDDSEKQAKYEKISFKEIHDEIYVLKDLTDLLSAPVVFAHND  250

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N++E KLYFIDFEYGSY+YRG+DI NHFNEYAG++CDYSLYP K  QYHFFR
Sbjct  251   LLSGNLMLNDEEEKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYSLYPDKNAQYHFFR  310

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL+P++P+EV ++DLE LY+ETNT+ LASH+ W LW LIQAK+SPIDFDYL YFF RY 
Sbjct  311   SYLQPNKPHEVHDKDLETLYIETNTFRLASHIYWALWALIQAKVSPIDFDYLWYFFLRYN  370

Query  2651  EYKKQKEKCFTTAKA  2607
             EYKKQKE C +  K 
Sbjct  371   EYKKQKEGCLSMLKG  385


 Score =   150 bits (378),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 8/118 (7%)
 Frame = -2

Query  4292  AVEILNAEEVAEGAPDDR--------TSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKK  4137
             A  +    EV  GAP+ R         + IPSS   +D +L +PEMKP +++LCKDLF+K
Sbjct  11    AAAMAEEREVGGGAPEGRRKEKEKDGVTAIPSSTKEIDISLPLPEMKPRIIDLCKDLFRK  70

Query  4136  WSNLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             WS+LD+S FS+ET+SGGITNLLLKVSVREE+G +V LTVRLYGPNTD+VIDRERELQ 
Sbjct  71    WSSLDNSCFSIETVSGGITNLLLKVSVREESGNSVYLTVRLYGPNTDFVIDRERELQA  128



>ref|XP_002879014.1| EMB1187 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55273.1| EMB1187 [Arabidopsis lyrata subsp. lyrata]
Length=374

 Score =   386 bits (992),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/261 (68%), Positives = 221/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTL PSDMR+PK+AAEIAK+L +FH+V+IPG K
Sbjct  113   KYLSAAGFGAKLLGGFGNGMVQSFIYARTLEPSDMREPKIAAEIAKELGKFHKVDIPGSK  172

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I KF+ KASTL+F++ + Q+ + T+SFEE+H EI EL+E TG LNAPVVFAHN
Sbjct  173   EPQLWVDIFKFYEKASTLRFEEPDKQKLFETISFEELHKEIIELREFTGLLNAPVVFAHN  232

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N++E KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYS+YPTK EQYHF 
Sbjct  233   DLLSGNLMLNDEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSMYPTKEEQYHFI  292

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P +P+EVS  ++E+++VET+ Y LASHL W +W +IQA++SPI+F+YLGYFF RY
Sbjct  293   KHYLQPDKPDEVSIAEVESVFVETDAYKLASHLYWAIWAIIQARMSPIEFEYLGYFFLRY  352

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+   ++L+ S
Sbjct  353   NEYKKQKPLTFSLVTSHLSAS  373


 Score =   127 bits (319),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 8/114 (7%)
 Frame = -2

Query  4301  MGKAVEI---LNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWS  4131
             MG A  I    NAE+ A  A       IP S   VD +L +P M P ++ELCKDLFK W 
Sbjct  1     MGAAKNIWALANAEDEANVA-----EQIPYSSFVVDTSLPLPLMIPRIIELCKDLFKNWR  55

Query  4130  NLDDSHFSVETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDREREL  3969
             +LDDS FSVE +SGGITNLLLKVSV+E+  + V++TVRLYGPNT+YVI+RERE+
Sbjct  56    DLDDSLFSVERVSGGITNLLLKVSVKEDTDKQVSVTVRLYGPNTEYVINREREI  109



>ref|XP_010510853.1| PREDICTED: probable ethanolamine kinase isoform X1 [Camelina 
sativa]
 ref|XP_010510854.1| PREDICTED: probable ethanolamine kinase isoform X2 [Camelina 
sativa]
Length=381

 Score =   387 bits (993),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/261 (67%), Positives = 222/261 (85%), Gaps = 0/261 (0%)
 Frame = -2

Query  3374  QYLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPK  3195
             +YLSAAGFGAKL G F NGMVQSFI+ARTL PSDMR+PK+A EIAK+L +FH+V+IPG K
Sbjct  120   KYLSAAGFGAKLLGGFGNGMVQSFINARTLEPSDMREPKIAGEIAKELGKFHKVDIPGSK  179

Query  3194  EPQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHN  3015
             EPQLW +I+KF+ KASTL+F++ + Q+ + T+SF+E+H EI EL+E TG LNAPVVFAHN
Sbjct  180   EPQLWVDILKFYEKASTLRFEEPDKQKLFETISFQELHKEIIELREFTGLLNAPVVFAHN  239

Query  3014  DLLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFF  2835
             DLL GNLM N++E KLY IDFEYGSYNYRGFDIGNHFNEYAGY+CDYSLYP+K EQYHF 
Sbjct  240   DLLSGNLMLNDEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAGYDCDYSLYPSKEEQYHFI  299

Query  2834  RYYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRY  2655
             ++YL+P +P+EVS  ++E+++VET+ Y LASHL W +W +IQA++SPI+F+YLGYFF RY
Sbjct  300   KHYLQPDKPDEVSVAEVESVFVETDAYKLASHLYWAIWAIIQARMSPIEFEYLGYFFLRY  359

Query  2654  TEYKKQKEKCFTTAKAYLAKS  2592
              EYKKQK   F+  ++Y++ S
Sbjct  360   NEYKKQKPLTFSLVRSYMSAS  380


 Score =   125 bits (314),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -2

Query  4283  ILNAEEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSV  4104
             + NAE+      +D    IP S   VD +L +P M P ++ELCKDLFK W  L+DS FSV
Sbjct  13    LANAEDGGANG-NDNAEQIPYSSFVVDTSLPLPLMIPRIIELCKDLFKNWRELNDSLFSV  71

Query  4103  ETLSGGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDREREL  3969
             E +SGGITNLLLKVSV+E+    V++TVRLYGPNT+YVI+RERE+
Sbjct  72    ERVSGGITNLLLKVSVKEDTDRQVSVTVRLYGPNTEYVINREREI  116



>dbj|BAK04334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   386 bits (992),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 219/258 (85%), Gaps = 1/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L GVF+NG+V SFIHARTL PSDM++P++AAEIAK+L +FHQV+IPG KE
Sbjct  121   YLSAAGFGARLLGVFENGVVSSFIHARTLTPSDMKEPRIAAEIAKQLQKFHQVDIPGSKE  180

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KAS L+F+D+E Q++Y T+SF E+ +E+ ELK+L+  L+APVVFAHND
Sbjct  181   PQLWNDIFKFLKKASVLKFEDNEKQKRYETISFREIQDEVKELKDLSDLLHAPVVFAHND  240

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ E KLYFIDFEYGSY+YRG+DI NHFNEYAG++CDY+LYP K  QYHFFR
Sbjct  241   LLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYNLYPDKDAQYHFFR  300

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL   +P+EV E++L+ALY ETNT+ LASH+ W LW LIQA++SPIDFDYLGYFF RY 
Sbjct  301   NYLS-DRPSEVQEQNLDALYTETNTFRLASHVYWALWALIQARVSPIDFDYLGYFFLRYG  359

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ+E CF+  + +L+
Sbjct  360   EYKKQREFCFSLTQGFLS  377


 Score =   124 bits (311),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = -2

Query  4271  EEVAEGAPDDRTSGIPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLS  4092
             EE    AP +    +P+S   VD +L +PEM P V++LCK+L K WS+LD S FS+ T+S
Sbjct  20    EEKTRAAPAE----VPTSAAAVDISLPLPEMTPRVIDLCKELVKGWSSLDSSCFSISTVS  75

Query  4091  GGITNLLLKVSVREENGETVNLTVRLYGPNTDYVIDRERELQV  3963
             GGITNLLLKVSV+E      ++TVRLYGPNTD VIDRERELQ 
Sbjct  76    GGITNLLLKVSVKEGTDSQSSVTVRLYGPNTDLVIDRERELQA  118



>dbj|BAJ95686.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   386 bits (992),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 219/258 (85%), Gaps = 1/258 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA+L GVF+NG+V SFIHARTL PSDM++P++AAEIAK+L +FHQV+IPG KE
Sbjct  121   YLSAAGFGARLLGVFENGVVSSFIHARTLTPSDMKEPRIAAEIAKQLQKFHQVDIPGSKE  180

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KAS L+F+D+E Q++Y T+SF E+ +E+ ELK+L+  L+APVVFAHND
Sbjct  181   PQLWNDIFKFLKKASVLKFEDNEKQKRYETISFREIQDEVKELKDLSDLLHAPVVFAHND  240

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ E KLYFIDFEYGSY+YRG+DI NHFNEYAG++CDY+LYP K  QYHFFR
Sbjct  241   LLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYNLYPDKDAQYHFFR  300

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL   +P+EV E++L+ALY ETNT+ LASH+ W LW LIQA++SPIDFDYLGYFF RY 
Sbjct  301   NYLS-DRPSEVQEQNLDALYTETNTFRLASHVYWALWALIQARVSPIDFDYLGYFFLRYG  359

Query  2651  EYKKQKEKCFTTAKAYLA  2598
             EYKKQ+E CF+  + +L+
Sbjct  360   EYKKQREFCFSLTQGFLS  377


 Score =   123 bits (308),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             +P+S   VD +L +PEM P V++LCK+L K WS+LD S FS+ T+SGGITNLLLKVSV+E
Sbjct  30    VPTSAAAVDISLPLPEMTPRVIDLCKELVKGWSSLDSSCFSISTVSGGITNLLLKVSVKE  89

Query  4049  ENGETVNLTVRLYGPNTDYVIDRERELQV  3963
                   ++TVRLYGPNTD VIDRERELQ 
Sbjct  90    GTDSQSSVTVRLYGPNTDLVIDRERELQA  118



>ref|XP_003578170.1| PREDICTED: probable ethanolamine kinase isoform X1 [Brachypodium 
distachyon]
Length=386

 Score =   386 bits (992),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 222/261 (85%), Gaps = 1/261 (0%)
 Frame = -2

Query  3371  YLSAAGFGAKLFGVFKNGMVQSFIHARTLAPSDMRKPKLAAEIAKKLHEFHQVEIPGPKE  3192
             YLSAAGFGA L G+F+NG++QSFI+ARTL+PSDM++P++AAEIAK+L +FHQV+IPG KE
Sbjct  125   YLSAAGFGALLLGIFENGVIQSFINARTLSPSDMKEPRIAAEIAKQLQKFHQVDIPGSKE  184

Query  3191  PQLWNEIIKFFRKASTLQFDDSESQRKYVTVSFEEVHNEITELKELTGHLNAPVVFAHND  3012
             PQLWN+I KF +KASTL+F+D++  ++Y T+SF E+ +E+ ELK+L+  L+APVVF+HND
Sbjct  185   PQLWNDIFKFLKKASTLKFEDNDKHKRYDTISFREIQDEVKELKDLSDLLHAPVVFSHND  244

Query  3011  LLCGNLMHNEDEGKLYFIDFEYGSYNYRGFDIGNHFNEYAGYECDYSLYPTKTEQYHFFR  2832
             LL GNLM N+ E KLYFIDFEYGSY+YRG+DI NHFNEYAG++CDYSLYP K  QYHFFR
Sbjct  245   LLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIANHFNEYAGFDCDYSLYPDKDVQYHFFR  304

Query  2831  YYLKPHQPNEVSEEDLEALYVETNTYMLASHLCWGLWGLIQAKISPIDFDYLGYFFWRYT  2652
              YL   +P+EV  +DLEALY+ETNTY LASH+ W LW LIQAK+SPIDFDYLGYFF RY 
Sbjct  305   NYLA-DRPSEVQMQDLEALYIETNTYRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYG  363

Query  2651  EYKKQKEKCFTTAKAYLAKSK  2589
             EYKKQ+E CF+ A+ +L+  +
Sbjct  364   EYKKQREFCFSLAQGFLSAPR  384


 Score =   122 bits (306),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -2

Query  4229  IPSSHLTVDHTLSIPEMKPHVVELCKDLFKKWSNLDDSHFSVETLSGGITNLLLKVSVRE  4050
             +P+S   VD +L +PEM PH++ LCK+L K WS++D S FSVET+SGGITNLLLKVSV+E
Sbjct  34    VPTSSAAVDISLPLPEMTPHIIGLCKELVKGWSSVDSSCFSVETVSGGITNLLLKVSVKE  93

Query  4049  ENGETVNLTVRLYGPNTDYVIDREREL  3969
                   ++TVRLYGPNTD VIDREREL
Sbjct  94    GTCSESSVTVRLYGPNTDLVIDREREL  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14721737912280