BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24426_g1_i4 len=1604 path=[2420:0-606 3027:607-651 3072:652-654
3075:655-754 3175:755-756 3177:757-810 3231:811-892 3313:893-930
3351:931-982 3403:983-1008 3429:1009-1038 3459:1039-1169
3590:1170-1201 3622:1202-1603]

Length=1604
                                                                      Score     E

ref|XP_009790232.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    725   0.0      
ref|XP_011089709.1|  PREDICTED: ruBisCO large subunit-binding pro...    725   0.0      
ref|XP_009597827.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    724   0.0      
gb|KDP30625.1|  hypothetical protein JCGZ_16190                         721   0.0      
ref|NP_001275097.1|  chaperonin-60 beta subunit                         721   0.0      
ref|XP_004228946.1|  PREDICTED: ruBisCO large subunit-binding pro...    721   0.0      
gb|KHG01053.1|  RuBisCO large subunit-binding protein subunit bet...    721   0.0      
ref|XP_007014617.1|  TCP-1/cpn60 chaperonin family protein              720   0.0      
ref|XP_002285746.1|  PREDICTED: ruBisCO large subunit-binding pro...    719   0.0      Vitis vinifera
ref|XP_002523404.1|  rubisco subunit binding-protein beta subunit...    717   0.0      Ricinus communis
ref|XP_004144069.1|  PREDICTED: ruBisCO large subunit-binding pro...    717   0.0      
ref|XP_004159350.1|  PREDICTED: LOW QUALITY PROTEIN: ruBisCO larg...    717   0.0      
ref|XP_008451008.1|  PREDICTED: ruBisCO large subunit-binding pro...    717   0.0      
ref|XP_002303983.1|  chaperonin precursor family protein                717   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002297617.1|  hypothetical protein POPTR_0001s03980g             717   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP18583.1|  unnamed protein product                                716   0.0      
ref|XP_011025126.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    715   0.0      
ref|XP_010249575.1|  PREDICTED: ruBisCO large subunit-binding pro...    715   0.0      
ref|XP_003546771.1|  PREDICTED: ruBisCO large subunit-binding pro...    713   0.0      
gb|KHN23693.1|  RuBisCO large subunit-binding protein subunit bet...    711   0.0      
ref|XP_010044926.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    713   0.0      
ref|XP_008351333.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    713   0.0      
ref|XP_008221851.1|  PREDICTED: ruBisCO large subunit-binding pro...    712   0.0      
ref|XP_003531529.1|  PREDICTED: ruBisCO large subunit-binding pro...    712   0.0      
ref|XP_007208310.1|  hypothetical protein PRUPE_ppa003093mg             712   0.0      
ref|XP_009376036.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    712   0.0      
gb|KDO54474.1|  hypothetical protein CISIN_1g007313mg                   704   0.0      
gb|KHN26774.1|  RuBisCO large subunit-binding protein subunit bet...    709   0.0      
ref|XP_008384375.1|  PREDICTED: ruBisCO large subunit-binding pro...    710   0.0      
ref|XP_004498949.1|  PREDICTED: ruBisCO large subunit-binding pro...    709   0.0      
ref|XP_009376045.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    709   0.0      
gb|EYU32832.1|  hypothetical protein MIMGU_mgv1a003115mg                709   0.0      
ref|XP_009339195.1|  PREDICTED: LOW QUALITY PROTEIN: ruBisCO larg...    709   0.0      
ref|XP_011048163.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    709   0.0      
ref|XP_010942728.1|  PREDICTED: ruBisCO large subunit-binding pro...    708   0.0      
ref|XP_006445574.1|  hypothetical protein CICLE_v10014640mg             707   0.0      
ref|XP_010254011.1|  PREDICTED: ruBisCO large subunit-binding pro...    706   0.0      
ref|XP_002284134.1|  PREDICTED: ruBisCO large subunit-binding pro...    706   0.0      Vitis vinifera
sp|P08927.2|RUBB_PEA  RecName: Full=RuBisCO large subunit-binding...    705   0.0      Pisum sativum [garden pea]
ref|XP_008809220.1|  PREDICTED: ruBisCO large subunit-binding pro...    705   0.0      
ref|XP_004294947.1|  PREDICTED: ruBisCO large subunit-binding pro...    704   0.0      
ref|XP_010671843.1|  PREDICTED: ruBisCO large subunit-binding pro...    703   0.0      
ref|XP_008803228.1|  PREDICTED: ruBisCO large subunit-binding pro...    703   0.0      
ref|XP_009103725.1|  PREDICTED: ruBisCO large subunit-binding pro...    702   0.0      
ref|XP_010920048.1|  PREDICTED: ruBisCO large subunit-binding pro...    702   0.0      
ref|XP_007149220.1|  hypothetical protein PHAVU_005G051700g             701   0.0      
ref|XP_006838174.1|  hypothetical protein AMTR_s00106p00119930          701   0.0      
ref|XP_009392770.1|  PREDICTED: ruBisCO large subunit-binding pro...    701   0.0      
emb|CDY08245.1|  BnaA05g13740D                                          700   0.0      
ref|XP_006392634.1|  hypothetical protein EUTSA_v10011330mg             700   0.0      
emb|CAJ19275.1|  beta chaperonin 60                                     700   0.0      Solanum commersonii
ref|XP_010920050.1|  PREDICTED: ruBisCO large subunit-binding pro...    700   0.0      
ref|XP_009106876.1|  PREDICTED: ruBisCO large subunit-binding pro...    699   0.0      
ref|XP_006297271.1|  hypothetical protein CARUB_v10013285mg             698   0.0      
ref|XP_010552318.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    697   0.0      
ref|XP_006307049.1|  hypothetical protein CARUB_v10008637mg             696   0.0      
ref|XP_010500599.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    695   0.0      
ref|XP_002894506.1|  CPN60B                                             695   0.0      
ref|XP_010501159.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    695   0.0      
ref|NP_175945.1|  chaperonin 60 subunit beta 1                          695   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462399.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    695   0.0      
ref|XP_010487110.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    695   0.0      
ref|XP_010465189.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin 6...    695   0.0      
ref|XP_010480083.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    694   0.0      
ref|XP_009135307.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    694   0.0      
ref|XP_006407212.1|  hypothetical protein EUTSA_v10020346mg             694   0.0      
gb|ABK24483.1|  unknown                                                 695   0.0      Picea sitchensis
ref|NP_187956.1|  TCP-1/cpn60 chaperonin family protein                 694   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094358.1|  RuBisCO large subunit-binding protein subuni...    700   0.0      
emb|CDY26100.1|  BnaC06g10960D                                          694   0.0      
gb|KEH39992.1|  TCP-1/cpn60 chaperonin family protein                   692   0.0      
ref|XP_010909417.1|  PREDICTED: ruBisCO large subunit-binding pro...    692   0.0      
gb|KEH39991.1|  TCP-1/cpn60 chaperonin family protein                   691   0.0      
ref|XP_010103092.1|  Chaperonin 60 subunit beta 2                       691   0.0      
ref|XP_009418590.1|  PREDICTED: ruBisCO large subunit-binding pro...    691   0.0      
emb|CDY02438.1|  BnaA08g00450D                                          693   0.0      
ref|XP_008813152.1|  PREDICTED: ruBisCO large subunit-binding pro...    689   0.0      
ref|XP_010536825.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    690   0.0      
ref|XP_008813151.1|  PREDICTED: ruBisCO large subunit-binding pro...    689   0.0      
gb|AAT90346.1|  RuBisCo subunit binding-protein beta subunit            680   0.0      Zea mays [maize]
gb|KDO54472.1|  hypothetical protein CISIN_1g007313mg                   686   0.0      
ref|XP_009382612.1|  PREDICTED: ruBisCO large subunit-binding pro...    687   0.0      
emb|CDX82537.1|  BnaA03g32840D                                          685   0.0      
ref|XP_007024263.1|  TCP-1/cpn60 chaperonin family protein              685   0.0      
ref|XP_008659370.1|  PREDICTED: ruBisCO large subunit-binding pro...    684   0.0      
ref|XP_006655715.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    684   0.0      
ref|XP_008659369.1|  PREDICTED: ruBisCO large subunit-binding pro...    684   0.0      
emb|CDY10557.1|  BnaC03g70570D                                          692   0.0      
ref|XP_003557154.1|  PREDICTED: ruBisCO large subunit-binding pro...    683   0.0      
ref|XP_009793336.1|  PREDICTED: ruBisCO large subunit-binding pro...    683   0.0      
ref|XP_009628147.1|  PREDICTED: ruBisCO large subunit-binding pro...    683   0.0      
sp|Q43831.1|RUBB_SECCE  RecName: Full=RuBisCO large subunit-bindi...    678   0.0      Secale cereale
ref|XP_008648746.1|  PREDICTED: ruBisCO large subunit-binding pro...    683   0.0      
ref|XP_002437709.1|  hypothetical protein SORBIDRAFT_10g001120          681   0.0      Sorghum bicolor [broomcorn]
ref|XP_004964341.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    681   0.0      
ref|NP_001056601.1|  Os06g0114000                                       681   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006401314.1|  hypothetical protein EUTSA_v10013030mg             681   0.0      
ref|XP_002864459.1|  ATP binding protein                                681   0.0      
ref|NP_001032083.1|  chaperonin 60 subunit beta 3                       681   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX75713.1|  BnaC03g37960D                                          680   0.0      
ref|XP_004964340.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    680   0.0      
dbj|BAF00280.1|  RuBisCO subunit binding-protein beta subunit pre...    677   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY11918.1|  BnaC03g13440D                                          676   0.0      
ref|XP_004235655.1|  PREDICTED: ruBisCO large subunit-binding pro...    676   0.0      
sp|P21241.1|RUBB_BRANA  RecName: Full=RuBisCO large subunit-bindi...    674   0.0      Brassica napus [oilseed rape]
dbj|BAB11583.1|  RuBisCO subunit binding-protein beta subunit pre...    674   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280215.1|  hypothetical protein CARUB_v10026123mg             674   0.0      
ref|XP_009132296.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    674   0.0      
ref|XP_006343054.1|  PREDICTED: ruBisCO large subunit-binding pro...    674   0.0      
gb|KDO54471.1|  hypothetical protein CISIN_1g007313mg                   672   0.0      
ref|XP_003574065.1|  PREDICTED: ruBisCO large subunit-binding pro...    671   0.0      
ref|XP_010451233.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    669   0.0      
emb|CDY36809.1|  BnaA03g10770D                                          668   0.0      
gb|EMS68298.1|  RuBisCO large subunit-binding protein subunit bet...    674   0.0      
ref|XP_010443301.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    666   0.0      
ref|XP_010483125.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    666   0.0      
ref|NP_001045601.1|  Os02g0102900                                       665   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_001754999.1|  predicted protein                                  665   0.0      
emb|CDY32855.1|  BnaC09g33020D                                          664   0.0      
ref|XP_001780334.1|  predicted protein                                  664   0.0      
gb|EMT05406.1|  RuBisCO large subunit-binding protein subunit bet...    674   0.0      
gb|KCW87049.1|  hypothetical protein EUGRSUZ_B03593                     662   0.0      
emb|CDX75715.1|  BnaC03g37980D                                          657   0.0      
ref|XP_004951187.1|  PREDICTED: ruBisCO large subunit-binding pro...    652   0.0      
gb|EMT19476.1|  RuBisCO large subunit-binding protein subunit bet...    651   0.0      
gb|AFW66837.1|  putative TCP-1/cpn60 chaperonin family protein is...    645   0.0      
gb|ACG36615.1|  ruBisCO large subunit-binding protein subunit beta      642   0.0      Zea mays [maize]
gb|EMS63178.1|  RuBisCO large subunit-binding protein subunit bet...    640   0.0      
ref|NP_001146890.1|  ruBisCO large subunit-binding protein subuni...    641   0.0      Zea mays [maize]
ref|XP_001754571.1|  predicted protein                                  637   0.0      
ref|XP_002964742.1|  hypothetical protein SELMODRAFT_142800             638   0.0      
emb|CDX86994.1|  BnaC03g52640D                                          641   0.0      
ref|XP_002961675.1|  hypothetical protein SELMODRAFT_165043             631   0.0      
gb|EEE64974.1|  hypothetical protein OsJ_19883                          625   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002966190.1|  hypothetical protein SELMODRAFT_168153             623   0.0      
ref|XP_002982262.1|  hypothetical protein SELMODRAFT_271545             623   0.0      
gb|KDO54475.1|  hypothetical protein CISIN_1g007313mg                   621   0.0      
ref|XP_010691436.1|  PREDICTED: ruBisCO large subunit-binding pro...    620   0.0      
gb|EMT33855.1|  RuBisCO large subunit-binding protein subunit bet...    609   0.0      
dbj|BAK07904.1|  predicted protein                                      606   0.0      
gb|EMS56406.1|  RuBisCO large subunit-binding protein subunit bet...    604   0.0      
emb|CDO97994.1|  unnamed protein product                                587   0.0      
ref|XP_001418926.1|  chaperonin 60 beta chain, chloroplast              570   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_003057879.1|  predicted protein                                  567   0.0      
gb|AFW75264.1|  putative TCP-1/cpn60 chaperonin family protein          551   0.0      
ref|XP_007514774.1|  chaperonin GroEL                                   559   0.0      
gb|KDO54477.1|  hypothetical protein CISIN_1g007313mg                   555   0.0      
gb|KDO54476.1|  hypothetical protein CISIN_1g007313mg                   553   0.0      
emb|CEF98707.1|  Chaperonin Cpn60                                       555   0.0      
gb|AFW75263.1|  putative TCP-1/cpn60 chaperonin family protein          545   0.0      
ref|XP_003080325.1|  RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUN...    555   0.0      
ref|XP_005843554.1|  hypothetical protein CHLNCDRAFT_59809              552   0.0      
ref|XP_001692504.1|  chaperonin 60B2                                    546   0.0      Chlamydomonas reinhardtii
ref|XP_002951713.1|  hypothetical protein VOLCADRAFT_81582              545   0.0      
ref|XP_002500045.1|  chaperonin 60 beta                                 544   0.0      Micromonas commoda
ref|XP_010261583.1|  PREDICTED: ruBisCO large subunit-binding pro...    541   0.0      
gb|KFM24710.1|  RuBisCO large subunit-binding protein subunit bet...    538   0.0      
ref|XP_005647445.1|  chaperonin 60B2                                    532   1e-180   
sp|Q42693.1|RUBB_CHLRE  RecName: Full=RuBisCO large subunit-bindi...    525   1e-179   Chlamydomonas reinhardtii
ref|XP_001701113.1|  chaperonin 60B1                                    530   2e-179   Chlamydomonas reinhardtii
gb|KDP31429.1|  hypothetical protein JCGZ_11805                         529   5e-179   
ref|XP_006437814.1|  hypothetical protein CICLE_v10031053mg             528   1e-178   
ref|XP_002269341.2|  PREDICTED: chaperonin 60 subunit beta 4, chl...    528   2e-178   Vitis vinifera
emb|CBI27426.3|  unnamed protein product                                527   2e-178   
ref|XP_006484293.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    528   3e-178   
ref|XP_007227057.1|  hypothetical protein PRUPE_ppa020938mg             526   1e-177   
ref|XP_009611004.1|  PREDICTED: ruBisCO large subunit-binding pro...    526   1e-177   
ref|XP_009774325.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    523   2e-177   
ref|XP_002514548.1|  rubisco subunit binding-protein beta subunit...    525   2e-177   Ricinus communis
ref|XP_008243762.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    526   4e-177   
ref|XP_010320800.1|  PREDICTED: ruBisCO large subunit-binding pro...    523   9e-177   
ref|XP_008804418.1|  PREDICTED: ruBisCO large subunit-binding pro...    524   9e-177   
ref|XP_009774324.1|  PREDICTED: ruBisCO large subunit-binding pro...    524   1e-176   
ref|XP_010320799.1|  PREDICTED: ruBisCO large subunit-binding pro...    523   1e-176   
ref|XP_010320798.1|  PREDICTED: ruBisCO large subunit-binding pro...    523   1e-176   
ref|XP_009356483.1|  PREDICTED: ruBisCO large subunit-binding pro...    523   2e-176   
ref|XP_006307550.1|  hypothetical protein CARUB_v10009172mg             516   3e-176   
ref|XP_010320797.1|  PREDICTED: ruBisCO large subunit-binding pro...    523   3e-176   
ref|XP_010320795.1|  PREDICTED: ruBisCO large subunit-binding pro...    523   4e-176   
ref|XP_008389354.1|  PREDICTED: ruBisCO large subunit-binding pro...    522   6e-176   
ref|XP_006348604.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    521   1e-175   
ref|XP_010905780.1|  PREDICTED: ruBisCO large subunit-binding pro...    521   1e-175   
ref|XP_010066785.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    520   3e-175   
ref|XP_011077788.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    519   3e-175   
ref|XP_011009115.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    519   5e-175   
ref|XP_003516734.2|  PREDICTED: chaperonin 60 subunit beta 4, chl...    515   2e-173   
ref|XP_010460336.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    513   2e-173   
ref|NP_001185097.1|  chaperonin 60 subunit beta 4                       513   3e-173   
ref|XP_011009108.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    514   3e-173   
ref|NP_173947.1|  chaperonin 60 subunit beta 4                          514   6e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460335.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    515   7e-173   
ref|XP_004490321.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    513   7e-173   
ref|XP_004297181.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    514   8e-173   
dbj|BAD95277.1|  chaperonin precursor                                   514   1e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006574985.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    513   2e-172   
ref|XP_010477881.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    511   3e-172   
ref|XP_010499067.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    509   6e-172   
ref|XP_010477879.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    511   7e-172   
ref|XP_007045690.1|  TCP-1/cpn60 chaperonin family protein isoform 2    505   9e-172   
ref|XP_010499065.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    511   2e-171   
ref|XP_010499066.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    510   2e-171   
ref|XP_008446494.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    508   2e-171   
ref|XP_010552083.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    511   3e-171   
emb|CDY20555.1|  BnaC07g12220D                                          509   4e-171   
ref|XP_009103088.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    508   5e-171   
ref|XP_008446493.1|  PREDICTED: ruBisCO large subunit-binding pro...    509   7e-171   
ref|XP_009103087.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    509   1e-170   
ref|XP_009418029.1|  PREDICTED: ruBisCO large subunit-binding pro...    508   2e-170   
gb|EYU28916.1|  hypothetical protein MIMGU_mgv1a003338mg                507   2e-170   
ref|XP_006415907.1|  hypothetical protein EUTSA_v10007125mg             508   2e-170   
emb|CDY66193.1|  BnaA07g36980D                                          507   3e-170   
ref|XP_007146371.1|  hypothetical protein PHAVU_006G034900g             507   7e-170   
ref|XP_007045689.1|  TCP-1/cpn60 chaperonin family protein isoform 1    505   4e-169   
ref|XP_004135135.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    504   4e-169   
gb|KGN52011.1|  hypothetical protein Csa_5G607990                       504   6e-169   
emb|CDP00506.1|  unnamed protein product                                502   9e-169   
ref|XP_002315987.2|  hypothetical protein POPTR_0010s14520g             500   8e-168   Populus trichocarpa [western balsam poplar]
ref|XP_004155289.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin 6...    499   3e-167   
ref|XP_006653448.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    498   7e-167   
ref|XP_010696183.1|  PREDICTED: ruBisCO large subunit-binding pro...    493   4e-165   
gb|KDD74080.1|  TCP-1/cpn60 chaperonin                                  494   5e-165   
gb|EEE61069.1|  hypothetical protein OsJ_14927                          493   1e-164   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67866.1|  hypothetical protein OsI_35492                          491   3e-164   Oryza sativa Indica Group [Indian rice]
ref|XP_004975721.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    482   1e-160   
ref|XP_010320801.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    476   8e-159   
ref|XP_003579836.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    477   1e-158   
ref|XP_006844149.1|  hypothetical protein AMTR_s00006p00260480          473   1e-157   
ref|XP_006573191.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    469   1e-155   
gb|EMS68279.1|  RuBisCO large subunit-binding protein subunit bet...    468   1e-154   
ref|XP_008653444.1|  PREDICTED: ruBisCO large subunit-binding pro...    466   3e-154   
ref|XP_010091675.1|  Chaperonin 60 subunit beta 4                       462   3e-152   
ref|XP_011009123.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    454   5e-150   
ref|XP_010090495.1|  RuBisCO large subunit-binding protein subuni...    442   3e-146   
ref|WP_011433315.1|  molecular chaperone GroEL                          440   6e-145   
emb|CDN11427.1|  Heat shock protein 60 family chaperone GroEL           440   2e-144   
ref|WP_011610149.1|  molecular chaperone GroEL                          439   3e-144   
ref|WP_037217788.1|  molecular chaperone GroEL                          439   3e-144   
ref|WP_017296590.1|  molecular chaperone GroEL                          438   6e-144   
ref|WP_017711036.1|  molecular chaperone GroEL                          438   9e-144   
ref|WP_006099811.1|  molecular chaperone GroEL                          436   3e-143   
ref|WP_011429241.1|  molecular chaperone GroEL                          435   7e-143   
ref|WP_035984973.1|  molecular chaperone GroEL                          435   1e-142   
ref|WP_015186725.1|  60 kDa chaperonin                                  434   2e-142   
ref|WP_009458011.1|  MULTISPECIES: molecular chaperone GroEL            434   3e-142   
ref|WP_008230076.1|  Heat shock protein 60 family chaperone GroEL       434   4e-142   
ref|WP_016865329.1|  molecular chaperone GroEL                          433   6e-142   
ref|WP_016859319.1|  molecular chaperone GroEL                          432   1e-141   
ref|WP_026722382.1|  molecular chaperone GroEL                          431   3e-141   
ref|WP_039715090.1|  molecular chaperone GroEL                          431   3e-141   
ref|WP_016873105.1|  molecular chaperone GroEL                          431   4e-141   
ref|WP_017746421.1|  molecular chaperone GroEL                          430   9e-141   
ref|WP_012407975.1|  molecular chaperone GroEL                          430   1e-140   
ref|WP_009554131.1|  chaperonin GroL                                    429   1e-140   
ref|WP_015219170.1|  60 kDa chaperonin                                  429   1e-140   
ref|WP_026733795.1|  molecular chaperone GroEL                          429   1e-140   
ref|WP_009343442.1|  molecular chaperone GroEL                          430   1e-140   
ref|WP_015136411.1|  chaperonin GroL                                    429   2e-140   
ref|WP_022608771.1|  chaperonin GroL                                    429   2e-140   
ref|WP_006625833.1|  MULTISPECIES: molecular chaperone GroEL            429   3e-140   
ref|WP_013191933.1|  molecular chaperone GroEL                          429   3e-140   
ref|WP_015185157.1|  chaperonin GroL                                    428   4e-140   
ref|WP_015207554.1|  chaperonin GroL                                    429   5e-140   
ref|WP_017311935.1|  molecular chaperone GroEL                          428   5e-140   
ref|WP_017321918.1|  molecular chaperone GroEL                          427   5e-140   
ref|XP_008389355.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    426   6e-140   
ref|WP_006278498.1|  molecular chaperone GroEL                          427   8e-140   
ref|XP_009356484.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    426   8e-140   
ref|WP_024124271.1|  60 kDa chaperonin protein GroEL2                   427   9e-140   
ref|WP_010472301.1|  MULTISPECIES: molecular chaperone GroEL            427   2e-139   
ref|WP_011243156.1|  molecular chaperone GroEL                          427   2e-139   
ref|WP_011057252.1|  molecular chaperone GroEL                          426   2e-139   
ref|WP_017652866.1|  molecular chaperone GroEL                          426   2e-139   
ref|WP_017288542.1|  molecular chaperone GroEL                          426   2e-139   
ref|WP_030006718.1|  molecular chaperone GroEL                          426   2e-139   
ref|WP_015152570.1|  chaperonin GroEL                                   426   2e-139   
ref|XP_006573192.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    425   2e-139   
emb|CDX72433.1|  BnaC07g44550D                                          417   3e-139   
ref|WP_017324774.1|  molecular chaperone GroEL                          426   3e-139   
ref|WP_008233163.1|  Heat shock protein 60 family chaperone GroEL       426   3e-139   
ref|WP_015127399.1|  60 kDa chaperonin                                  426   3e-139   
ref|WP_017316382.1|  molecular chaperone GroEL                          426   4e-139   
ref|WP_012305785.1|  molecular chaperone GroEL                          426   5e-139   
ref|WP_029634993.1|  molecular chaperone GroEL [                        426   5e-139   
ref|WP_006196357.1|  molecular chaperone GroEL                          426   5e-139   
ref|WP_015119171.1|  chaperonin GroL                                    425   7e-139   
ref|WP_035149954.1|  molecular chaperone GroEL                          425   7e-139   
ref|WP_015149515.1|  chaperonin GroL                                    425   1e-138   
ref|WP_015216715.1|  60 kDa chaperonin                                  425   2e-138   
ref|WP_015111848.1|  60 kDa chaperonin                                  424   2e-138   
ref|WP_011320465.1|  molecular chaperone GroEL                          424   2e-138   
gb|ABA23371.1|  Chaperonin Cpn60/TCP-1                                  424   2e-138   
ref|WP_038085521.1|  molecular chaperone GroEL                          424   2e-138   
ref|WP_027846784.1|  molecular chaperone GroEL                          423   3e-138   
ref|WP_014276880.1|  chaperonin GroEL                                   423   4e-138   
ref|WP_018399554.1|  molecular chaperone GroEL                          423   4e-138   
ref|WP_015134386.1|  60 kDa chaperonin                                  423   4e-138   
ref|WP_017303097.1|  molecular chaperone GroEL                          423   5e-138   
ref|WP_019488785.1|  molecular chaperone GroEL                          422   1e-137   
ref|WP_039737322.1|  molecular chaperone GroEL                          422   1e-137   
ref|WP_015195459.1|  60 kDa chaperonin                                  422   1e-137   
ref|WP_016949529.1|  molecular chaperone GroEL                          422   1e-137   
ref|WP_039729087.1|  molecular chaperone GroEL                          422   1e-137   
ref|WP_009545495.1|  MULTISPECIES: molecular chaperone GroEL            422   1e-137   
ref|WP_010996060.1|  molecular chaperone GroEL                          421   2e-137   
ref|WP_006528647.1|  chaperonin GroL                                    421   4e-137   
ref|WP_008273166.1|  molecular chaperone GroEL                          421   4e-137   
ref|WP_028085385.1|  molecular chaperone GroEL                          420   6e-137   
ref|WP_015197364.1|  60 kDa chaperonin                                  421   6e-137   
gb|KDO70206.1|  hypothetical protein CISIN_1g010494mg                   418   1e-136   
ref|WP_015221313.1|  chaperonin GroEL                                   419   2e-136   
ref|WP_006456066.1|  molecular chaperone GroEL                          419   2e-136   
ref|WP_013324620.1|  molecular chaperone GroEL                          419   2e-136   
ref|WP_024545682.1|  molecular chaperone GroEL                          419   2e-136   
ref|WP_015201979.1|  60 kDa chaperonin                                  418   4e-136   
ref|WP_015161862.1|  chaperonin GroL                                    418   4e-136   
ref|WP_015079668.1|  chaperonin GroEL                                   418   5e-136   
ref|WP_002759846.1|  molecular chaperone GroEL                          418   5e-136   
ref|WP_002802700.1|  molecular chaperone GroEL                          418   5e-136   
ref|WP_002784220.1|  60 kDa chaperonin (Protein Cpn60) (groEL pro...    418   5e-136   
ref|WP_002737038.1|  hypothetical protein                               417   7e-136   
ref|WP_002750554.1|  molecular chaperone GroEL                          417   7e-136   
ref|WP_016516009.1|  hypothetical protein                               417   7e-136   
ref|WP_002776160.1|  molecular chaperone GroEL                          417   7e-136   
ref|WP_008178217.1|  molecular chaperone GroEL                          417   7e-136   
ref|WP_002797729.1|  MULTISPECIES: molecular chaperone GroEL            417   7e-136   
ref|WP_002742506.1|  chaperonin GroL                                    417   8e-136   
ref|WP_024970482.1|  molecular chaperone GroEL                          417   8e-136   
ref|WP_028089933.1|  molecular chaperone GroEL                          417   9e-136   
ref|WP_009632953.1|  chaperonin GroL                                    417   9e-136   
ref|WP_039201828.1|  molecular chaperone GroEL                          417   9e-136   
ref|WP_012627767.1|  molecular chaperone GroEL                          417   1e-135   
ref|WP_002788225.1|  molecular chaperone GroEL                          417   1e-135   
ref|WP_026788053.1|  MULTISPECIES: molecular chaperone GroEL            417   2e-135   
ref|WP_026795295.1|  MULTISPECIES: molecular chaperone GroEL            417   2e-135   
ref|XP_008446496.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    415   2e-135   
ref|WP_036001242.1|  molecular chaperone GroEL                          416   2e-135   
ref|WP_012594532.1|  MULTISPECIES: molecular chaperone GroEL            415   4e-135   
ref|WP_027404027.1|  molecular chaperone GroEL                          415   5e-135   
ref|XP_008243763.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    413   6e-135   
ref|WP_004162218.1|  molecular chaperone GroEL                          415   9e-135   
ref|WP_002770556.1|  molecular chaperone GroEL                          415   9e-135   
gb|KEI67499.1|  hypothetical protein A19Y_2608                          414   1e-134   
ref|WP_026796686.1|  molecular chaperone GroEL                          414   1e-134   
ref|WP_006634424.1|  molecular chaperone GroEL                          414   1e-134   
ref|WP_007353288.1|  MULTISPECIES: molecular chaperone GroEL            413   5e-134   
ref|WP_015142786.1|  chaperonin GroL                                    412   6e-134   
ref|WP_015177119.1|  60 kDa chaperonin                                  412   9e-134   
sp|Q7WVY0.1|CH602_ANASL  RecName: Full=60 kDa chaperonin 2; AltNa...    411   2e-133   
gb|AIE73632.1|  Heat shock protein 60 family chaperone GroEL            411   2e-133   
ref|WP_010873466.1|  molecular chaperone GroEL                          410   3e-133   
ref|WP_015123389.1|  chaperonin GroL                                    410   3e-133   
gb|KDO70205.1|  hypothetical protein CISIN_1g010494mg                   409   3e-133   
ref|WP_017663465.1|  molecular chaperone GroEL                          411   3e-133   
ref|WP_015954854.1|  molecular chaperone GroEL                          410   4e-133   
ref|WP_015225564.1|  chaperonin GroEL                                   410   6e-133   
ref|WP_019500096.1|  molecular chaperone GroEL                          409   8e-133   
ref|WP_011142891.1|  molecular chaperone GroEL                          409   1e-132   
ref|WP_017295911.1|  hypothetical protein                               409   1e-132   
dbj|BAH20275.1|  AT1G55490                                              397   1e-132   
ref|WP_015230198.1|  chaperonin GroL                                    409   2e-132   
ref|WP_006510424.1|  chaperonin GroL                                    407   5e-132   
gb|ACH54109.1|  heat shock protein B                                    407   6e-132   
gb|ACH54112.1|  heat shock protein B                                    407   7e-132   
gb|AAA27284.1|  chaperonin 60                                           407   8e-132   
ref|WP_029519893.1|  MULTISPECIES: molecular chaperone GroEL            406   1e-131   
ref|XP_011077797.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    405   1e-131   
ref|WP_005770500.1|  molecular chaperone GroEL                          406   1e-131   
ref|WP_012220765.1|  molecular chaperone GroEL                          406   2e-131   
ref|WP_019491742.1|  molecular chaperone GroEL                          405   3e-131   
ref|WP_039669191.1|  molecular chaperone GroEL                          405   3e-131   
ref|WP_009626159.1|  60 kDa chaperonin                                  405   4e-131   
gb|AAP13856.1|  heat shock protein B                                    405   5e-131   
ref|WP_015169314.1|  chaperonin GroL                                    404   6e-131   
gb|ACH54111.1|  heat shock protein B                                    404   8e-131   
ref|WP_015130974.1|  60 kDa chaperonin                                  404   9e-131   
ref|WP_007303269.1|  molecular chaperone GroEL                          404   2e-130   
ref|WP_023175525.1|  chaperonin GroEL                                   403   2e-130   
ref|WP_023171298.1|  chaperonin GroEL                                   403   2e-130   
ref|WP_039726130.1|  molecular chaperone GroEL                          403   2e-130   
ref|WP_035986963.1|  molecular chaperone GroEL                          403   2e-130   
ref|WP_007546319.1|  molecular chaperone GroEL                          403   2e-130   
ref|WP_022603714.1|  chaperonin GroL                                    402   3e-130   
ref|WP_036480285.1|  molecular chaperone GroEL                          403   3e-130   
ref|WP_017294974.1|  molecular chaperone GroEL                          402   5e-130   
ref|WP_030006933.1|  molecular chaperone GroEL                          402   6e-130   
ref|WP_020402416.1|  molecular chaperone GroEL                          402   7e-130   
ref|WP_015200995.1|  60 kDa chaperonin                                  402   7e-130   
ref|WP_012675748.1|  molecular chaperone GroEL                          402   7e-130   
ref|WP_012407589.1|  molecular chaperone GroEL                          401   7e-130   
ref|WP_015186661.1|  60 kDa chaperonin                                  401   8e-130   
ref|WP_012674420.1|  molecular chaperone GroEL                          401   1e-129   
ref|WP_017306382.1|  molecular chaperone GroEL                          400   1e-129   
ref|WP_015170801.1|  chaperonin GroEL                                   401   1e-129   
dbj|BAF95909.1|  chaperonin GroEL                                       400   2e-129   
ref|WP_015184308.1|  chaperonin GroL                                    400   2e-129   
gb|AIE73931.1|  Heat shock protein 60 family chaperone GroEL            400   2e-129   
ref|WP_017652696.1|  molecular chaperone GroEL                          400   2e-129   
ref|WP_013191732.1|  molecular chaperone GroEL                          400   2e-129   
ref|WP_010872041.1|  molecular chaperone GroEL                          400   3e-129   
ref|WP_017715999.1|  molecular chaperone GroEL                          400   3e-129   
ref|WP_015225432.1|  chaperonin GroEL                                   400   3e-129   
gb|KFF42020.1|  chaperonin GroL                                         400   3e-129   
ref|WP_012308054.1|  molecular chaperone GroEL                          400   3e-129   
ref|WP_016867666.1|  molecular chaperone GroEL                          400   3e-129   
dbj|BAA02180.1|  GroEL                                                  400   4e-129   
ref|WP_015217475.1|  60 kDa chaperonin                                  400   4e-129   
ref|WP_006516273.1|  chaperonin GroL                                    399   4e-129   
ref|WP_012599165.1|  molecular chaperone GroEL                          399   4e-129   
ref|WP_009457507.1|  MULTISPECIES: molecular chaperone GroEL            399   5e-129   
ref|WP_009768317.1|  chaperonin GroL                                    399   5e-129   
ref|WP_028082733.1|  molecular chaperone GroEL                          399   6e-129   
ref|WP_013420429.1|  molecular chaperone GroEL                          399   7e-129   
ref|WP_037236039.1|  molecular chaperone GroEL                          399   8e-129   
ref|WP_025898344.1|  molecular chaperone GroEL                          399   8e-129   
ref|WP_019504182.1|  molecular chaperone GroEL                          399   8e-129   
ref|WP_016951427.1|  molecular chaperone GroEL                          399   9e-129   
ref|WP_016863379.1|  molecular chaperone GroEL                          399   9e-129   
ref|WP_012459304.1|  molecular chaperone GroEL                          399   9e-129   
ref|WP_026722402.1|  molecular chaperone GroEL                          399   1e-128   
ref|WP_015205865.1|  chaperonin GroL                                    399   1e-128   
ref|WP_015218965.1|  60 kDa chaperonin                                  398   1e-128   
ref|WP_018106662.1|  molecular chaperone GroEL                          398   2e-128   
ref|WP_005871709.1|  molecular chaperone GroEL                          398   2e-128   
ref|WP_026148478.1|  molecular chaperone GroEL                          398   2e-128   
ref|WP_028088633.1|  molecular chaperone GroEL                          398   2e-128   
ref|WP_021277982.1|  chaperonin GroL                                    398   2e-128   
ref|WP_017298742.1|  molecular chaperone GroEL                          397   2e-128   
ref|WP_028949755.1|  molecular chaperone GroEL                          397   2e-128   
ref|WP_006802540.1|  molecular chaperone GroEL                          397   3e-128   
ref|WP_017311910.1|  molecular chaperone GroEL                          397   3e-128   
ref|WP_016878546.1|  molecular chaperone GroEL                          397   3e-128   
ref|WP_025747015.1|  molecular chaperone GroEL                          397   3e-128   
ref|WP_036789926.1|  MULTISPECIES: molecular chaperone GroEL            397   3e-128   
ref|WP_002952845.1|  chaperonin GroEL                                   394   4e-128   
ref|WP_013887378.1|  molecular chaperone GroEL                          397   4e-128   
gb|EDX84910.1|  chaperonin GroL                                         396   4e-128   
ref|WP_023072996.1|  chaperonin                                         397   4e-128   
ref|WP_036004427.1|  molecular chaperone GroEL                          397   4e-128   
ref|WP_009787539.1|  molecular chaperone GroEL                          397   4e-128   
ref|WP_011141029.1|  molecular chaperone GroEL                          397   5e-128   
ref|WP_015266170.1|  chaperonin GroL                                    397   5e-128   
ref|WP_008312275.1|  chaperonin GroL                                    397   5e-128   
ref|WP_036486076.1|  molecular chaperone GroEL                          396   6e-128   
ref|WP_009633919.1|  chaperonin GroL                                    396   7e-128   
ref|WP_035987603.1|  molecular chaperone GroEL                          396   8e-128   
ref|WP_038063632.1|  molecular chaperone GroEL                          396   8e-128   
ref|WP_009544164.1|  MULTISPECIES: molecular chaperone GroEL            396   8e-128   
ref|WP_006194607.1|  molecular chaperone GroEL                          396   8e-128   
ref|WP_023068927.1|  chaperonin GroL                                    396   9e-128   
ref|WP_015083040.1|  chaperonin GroEL                                   396   9e-128   
ref|WP_011174077.1|  molecular chaperone GroEL                          396   1e-127   
ref|WP_038015768.1|  molecular chaperone GroEL                          396   1e-127   
gb|KFF41464.1|  chaperonin GroL                                         396   1e-127   
ref|WP_036536395.1|  molecular chaperone GroEL                          396   1e-127   
ref|WP_010881448.1|  molecular chaperone GroEL                          396   1e-127   
ref|WP_027269099.1|  molecular chaperone GroEL                          396   1e-127   
ref|WP_021268326.1|  chaperonin GroL                                    395   1e-127   
ref|WP_007308122.1|  molecular chaperone GroEL                          395   1e-127   
gb|KIA82252.1|  molecular chaperone GroEL                               395   1e-127   
ref|WP_011138260.1|  molecular chaperone GroEL                          395   2e-127   
ref|WP_015202370.1|  60 kDa chaperonin                                  395   2e-127   
ref|WP_009495158.1|  Heat shock protein 60 family chaperone GroEL       395   2e-127   
ref|WP_009629537.1|  60 kDa chaperonin                                  395   2e-127   
ref|WP_027846173.1|  molecular chaperone GroEL                          395   2e-127   
ref|WP_024545344.1|  molecular chaperone GroEL                          395   2e-127   
emb|CAB65482.1|  chaperonin-60                                          395   3e-127   
ref|WP_008278380.1|  molecular chaperone GroEL                          395   3e-127   
ref|WP_026735557.1|  molecular chaperone GroEL                          395   3e-127   
ref|WP_022845623.1|  molecular chaperone GroEL                          395   3e-127   
gb|AHE96440.1|  molecular chaperone GroEL                               395   3e-127   
ref|WP_004580251.1|  chaperonin GroL                                    395   3e-127   
ref|WP_011731919.1|  molecular chaperone GroEL                          395   3e-127   
ref|WP_013568730.1|  molecular chaperone GroEL                          395   4e-127   
ref|WP_019506109.1|  molecular chaperone GroEL                          394   4e-127   
dbj|BAP17900.1|  chaperonin GroEL                                       395   4e-127   
ref|WP_025803940.1|  molecular chaperone GroEL                          394   4e-127   
ref|WP_009786498.1|  molecular chaperone GroEL                          395   4e-127   
ref|WP_002946741.1|  molecular chaperone GroEL                          394   5e-127   
ref|WP_012953804.1|  molecular chaperone GroEL                          395   5e-127   
ref|WP_018398607.1|  molecular chaperone GroEL                          394   6e-127   
ref|WP_022727012.1|  molecular chaperone GroEL                          394   6e-127   
ref|WP_021931252.1|  60 kDa chaperonin                                  394   6e-127   
ref|WP_013320553.1|  molecular chaperone GroEL                          394   6e-127   
ref|WP_015165611.1|  60 kDa chaperonin                                  394   6e-127   
ref|WP_038454256.1|  molecular chaperone GroEL                          394   6e-127   
ref|WP_002997806.1|  molecular chaperone GroEL                          394   6e-127   
ref|WP_015799467.1|  molecular chaperone GroEL                          394   7e-127   
ref|WP_016328316.1|  chaperonin GroL                                    394   7e-127   
ref|WP_028070709.1|  molecular chaperone GroEL                          394   8e-127   
ref|WP_010855830.1|  Heat shock protein 60 family chaperone GroEL       394   8e-127   
ref|WP_011320337.1|  molecular chaperone GroEL                          394   9e-127   
ref|WP_026733542.1|  molecular chaperone GroEL                          394   9e-127   
ref|WP_015116771.1|  chaperonin GroL                                    394   9e-127   
emb|CBA07313.1|  60 kDa chaperonin                                      390   9e-127   
ref|WP_003008789.1|  molecular chaperone GroEL                          394   1e-126   
ref|WP_009750880.1|  chaperonin GroL                                    393   1e-126   
ref|WP_010997806.1|  molecular chaperone GroEL                          393   1e-126   
ref|WP_015152680.1|  chaperonin GroEL                                   394   1e-126   
ref|WP_012108443.1|  molecular chaperone GroEL                          393   1e-126   
ref|WP_035613614.1|  molecular chaperone GroEL                          394   1e-126   



>ref|XP_009790232.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Nicotiana 
sylvestris]
Length=599

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/396 (93%), Positives = 387/396 (98%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG+MIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK
Sbjct  204   SAGNNSEVGSMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  263

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDL+ VLE AIR+G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  264   MSVEYENCKLLLVDKKITNARDLVGVLEDAIRNGYPILIIAEDIEQEALATLVVNKLRGA  323

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIA LTGGTVIREE+GL+LDKAD +VLGHA+KVVLTKD+ 
Sbjct  324   LKVAALKAPGFGERKSQYLDDIATLTGGTVIREELGLTLDKADKEVLGHASKVVLTKDAT  383

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V+KRVAQIKNLIE ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  384   TIVGDGSTQDAVNKRVAQIKNLIEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  443

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LENDEEKVGADIVKRALS
Sbjct  444   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEEKVGADIVKRALS  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  504   YPLKLIAKNAGVNGSVVSEKVLSSDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  563

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP +AGNPMDNSGYGY
Sbjct  564   SSVAKTFLMSDCVVVEIKEPEPAVAGNPMDNSGYGY  599



>ref|XP_011089709.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Sesamum indicum]
Length=608

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/396 (93%), Positives = 384/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENFLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLIN+LE A+R G+P+LIIAEDIEQEAL TLVVNKLRGA
Sbjct  273   MSVEYENCKLLLVDKKITNARDLINILEDAVRGGYPVLIIAEDIEQEALGTLVVNKLRGA  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILTGGTVIREE+GL+LDKAD  VLGHAAKVVLTKDS 
Sbjct  333   LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEIGLTLDKADKGVLGHAAKVVLTKDST  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIRNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LENDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV+AG PMDNSGYGY
Sbjct  573   ASVAKTFLMSDCVVVEIKEPEPVVAGTPMDNSGYGY  608



>ref|XP_009597827.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=599

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/396 (93%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG MIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK
Sbjct  204   SAGNNSEVGIMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  263

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDL+ VLE AIR+G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  264   MSVEYENCKLLLVDKKITNARDLVGVLEDAIRNGYPILIIAEDIEQEALATLVVNKLRGA  323

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIA LTGGTVIREE+GL+LDKAD +VLGHA+KVVLTKD+ 
Sbjct  324   LKVAALKAPGFGERKSQYLDDIATLTGGTVIREELGLTLDKADKEVLGHASKVVLTKDAT  383

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  384   TIVGDGSTQEAVNKRVVQIKNLIEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  443

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LENDEEKVGADIVKRALS
Sbjct  444   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEEKVGADIVKRALS  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  504   YPLKLIAKNAGVNGSVVSEKVLSSDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  563

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP +AGNPMDNSGYGY
Sbjct  564   SSVAKTFLMSDCVVVEIKEPEPAVAGNPMDNSGYGY  599



>gb|KDP30625.1| hypothetical protein JCGZ_16190 [Jatropha curcas]
Length=605

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/396 (92%), Positives = 386/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  210   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  269

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLIN+LE AIRSG+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  270   MSVEYENCKLLLVDKKITNARDLINILEDAIRSGYPILIIAEDIEQEALATLVVNKLRGA  329

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLGHA+KVVLTKD  
Sbjct  330   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGHASKVVLTKDYT  389

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRVAQI+NLIE A+Q+YE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  390   TIVGDGSTQEAVSKRVAQIRNLIEAAEQEYEREKLNERIAKLSGGVAVIQVGAQTETELK  449

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  450   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  509

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  510   YPLKLIAKNAGVNGSVVSEKVLSSDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  569

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  570   SSVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  605



>ref|NP_001275097.1| chaperonin-60 beta subunit [Solanum tuberosum]
 gb|AAB39827.1| chaperonin-60 beta subunit [Solanum tuberosum]
Length=599

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG+MIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGY+SPYFVTDSEK
Sbjct  204   SAGNNLEVGSMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYVSPYFVTDSEK  263

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDL+NVLE AIR+G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  264   MSVEYENCKLLLVDKKITNARDLVNVLEDAIRNGYPILIIAEDIEQEALATLVVNKLRGA  323

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIA LTGGTVIREE+GL+LDKAD +VLGHAAKVVLTKD+ 
Sbjct  324   LKVAALKAPGFGERKSQYLDDIATLTGGTVIREELGLTLDKADKEVLGHAAKVVLTKDAT  383

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  384   TIVGDGSTQEAVNKRVAQIKNLIEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  443

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K +L NDEEKVGADIVKRALS
Sbjct  444   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKGTLANDEEKVGADIVKRALS  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  504   YPLKLIAKNAGVNGSVVSEKVLSSDDPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  563

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPE  +AGNPMDNSGYGY
Sbjct  564   ASVAKTFLMSDCVVVEIKEPEAAVAGNPMDNSGYGY  599



>ref|XP_004228946.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum lycopersicum]
Length=599

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG+MIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGY+SPYFVTDSEK
Sbjct  204   SAGNNLEVGSMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYVSPYFVTDSEK  263

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDL+NVLE AIR+G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  264   MSVEYENCKLLLVDKKITNARDLVNVLEDAIRNGYPILIIAEDIEQEALATLVVNKLRGA  323

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIA LTGGTVIREE+GL+LDKAD +VLGHAAKVVLTKD+ 
Sbjct  324   LKVAALKAPGFGERKSQYLDDIATLTGGTVIREELGLTLDKADKEVLGHAAKVVLTKDAT  383

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  384   TIVGDGSTQEAVNKRVAQIKNLIEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  443

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K +L NDEEKVGADIVKRALS
Sbjct  444   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKGTLANDEEKVGADIVKRALS  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  504   YPLKLIAKNAGVNGSVVSEKVLSSDDPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  563

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPE  +AGNPMDNSGYGY
Sbjct  564   ASVAKTFLMSDCVVVEIKEPEAAVAGNPMDNSGYGY  599



>gb|KHG01053.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Gossypium arboreum]
 gb|KHG01054.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Gossypium arboreum]
Length=607

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/396 (93%), Positives = 386/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIRSG+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINILEEAIRSGYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGLSLDKA  +VLGHA+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLSLDKASKEVLGHASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQEAVNKRVVQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SL+NDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNP++G+NAATGNYEDLM+AGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSNDNPRHGFNAATGNYEDLMSAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  572   ASVAKTFLMSDCVVVEIKEPETVPAGNPMDNSGYGY  607



>ref|XP_007014617.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
 gb|EOY32236.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
Length=607

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTD EK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDGEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AI+SG+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINILEDAIKSGYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGLSLDKA S+VLGHA+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLSLDKAGSEVLGHASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ  V+KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQGAVNKRVAQIRNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+S+VD++K+SL+NDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASEVDSIKDSLDNDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEPV AGNPMD SGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPEPVPAGNPMDTSGYGY  607



>ref|XP_002285746.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010651396.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI16557.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/396 (92%), Positives = 387/396 (98%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNHEVGNMIAEAMSKVGRKGVVTLEEGKSAENHLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVE++NCKLLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRG+
Sbjct  273   MAVEFENCKLLLVDKKITNARDLINVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDKA+ +VLGHAAKVVLTKD+ 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLTLDKAEKEVLGHAAKVVLTKDTT  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYG+NAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGFNAATGKYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEPV+AGNPMDNSGYGY
Sbjct  573   SSVAKTFLMSDCVVVEIKEPEPVVAGNPMDNSGYGY  608



>ref|XP_002523404.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF38983.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=605

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMS+VGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  210   SAGNNYEVGNMIAEAMSRVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  269

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+PIL+IAEDIEQEALATLVVNKLRGA
Sbjct  270   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPILVIAEDIEQEALATLVVNKLRGA  329

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+REEVGLSLDK   ++LG+A+KVVLTKD+ 
Sbjct  330   LKIAALKAPGFGERKSQYLDDIAILTGGTVVREEVGLSLDKVGKEILGNASKVVLTKDTT  389

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  390   TIVGDGSTQEAVTKRVAQIRNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  449

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SL+NDEEKVGADIVKRALS
Sbjct  450   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALS  509

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNP++GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  510   YPLKLIAKNAGVNGSVVSEKVLSSDNPRFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  569

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  570   SSVAKTFLMSDCVVVEIKEPEAVPAGNPMDNSGYGY  605



>ref|XP_004144069.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Cucumis sativus]
 gb|KGN66351.1| hypothetical protein Csa_1G599450 [Cucumis sativus]
Length=608

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEAMSKVGRKGVVTLEEG+SA+N L VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNHEVGNMIAEAMSKVGRKGVVTLEEGRSADNFLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++I+AEDIEQEALATLVVNKLRG+
Sbjct  273   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIMAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+K+VLTKD+ 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKIVLTKDTT  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRVAQIKNLIEVA+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVSKRVAQIKNLIEVAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+ ENDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETFENDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN +YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKVLSSDNYRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  608



>ref|XP_004159350.1| PREDICTED: LOW QUALITY PROTEIN: ruBisCO large subunit-binding 
protein subunit beta, chloroplastic-like [Cucumis sativus]
Length=608

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEAMSKVGRKGVVTLEEG+SA+N L VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNHEVGNMIAEAMSKVGRKGVVTLEEGRSADNFLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++I+AEDIEQEALATLVVNKLRG+
Sbjct  273   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIMAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+K+VLTKD+ 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKIVLTKDTT  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRVAQIKNLIEVA+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVSKRVAQIKNLIEVAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+ ENDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETFENDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN +YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKVLSSDNYRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  608



>ref|XP_008451008.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Cucumis melo]
Length=608

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/396 (92%), Positives = 384/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVG+MIAEAMSKVGRKGVVTLEEG+SA+N L VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNHEVGSMIAEAMSKVGRKGVVTLEEGRSADNFLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++I+AEDIEQEALATLVVNKLRG+
Sbjct  273   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIMAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+KVVLTKD+ 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKVVLTKDTT  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRVAQIKNLIE ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVSKRVAQIKNLIEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KES ENDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKESFENDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN +YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKVLSSDNYRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  608



>ref|XP_002303983.1| chaperonin precursor family protein [Populus trichocarpa]
 gb|EEE78962.1| chaperonin precursor family protein [Populus trichocarpa]
Length=607

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/396 (91%), Positives = 386/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLI++LE AIR+G+P+LIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MSVEYENCKLLLVDKKITNARDLISILEDAIRAGYPVLIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+REEVGL+LDK   +VLGHA+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVVREEVGLALDKVGKEVLGHASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQEAVNKRVAQIRNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SLENDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSTDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPESVPAGNPMDNSGYGY  607



>ref|XP_002297617.1| hypothetical protein POPTR_0001s03980g [Populus trichocarpa]
 gb|ABK95011.1| unknown [Populus trichocarpa]
 gb|EEE82422.1| hypothetical protein POPTR_0001s03980g [Populus trichocarpa]
Length=607

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/396 (92%), Positives = 384/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEYDNCKLLLVDKKITNARDLI +LE AI+ G+P++I+AEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYDNCKLLLVDKKITNARDLIAILEDAIKGGYPVVIVAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+REEVGL+LDK  S+VLGHA+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVVREEVGLALDKVGSEVLGHASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DGSTQE V+KRVAQIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVADGSTQEAVNKRVAQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SLENDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL+SDNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLASDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPESVPAGNPMDNSGYGY  607



>emb|CDP18583.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/396 (92%), Positives = 385/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKS+ENSLRVVEGMQFDRGYISPYFVTDSEK
Sbjct  214   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSSENSLRVVEGMQFDRGYISPYFVTDSEK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLV+KKITNARDL+N+LE AIRSGFP+LIIAEDIEQEALATLVVN+LRGA
Sbjct  274   MAVEYENCKLLLVEKKITNARDLVNILEDAIRSGFPVLIIAEDIEQEALATLVVNRLRGA  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LD+AD +VLGHAAKVVLTKD+ 
Sbjct  334   LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDRADKEVLGHAAKVVLTKDAT  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLI+ A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  394   TIVGDGSTQEAVNKRVAQIRNLIDAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGC LLRL+ KVD +KE+L+NDEEKVGADIVKRALS
Sbjct  454   EKKLRVEDALNATKAAVEEGIVVGGGCALLRLACKVDDIKETLDNDEEKVGADIVKRALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCC+EHA
Sbjct  514   YPLKLIAKNAGVNGSVVSEKVLSSDNLKYGYNAATGNYEDLMAAGIIDPTKVVRCCIEHA  573

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIK PEPV AGNPMDNSGYGY
Sbjct  574   ASVAKTFLMSDCVVVEIKVPEPVAAGNPMDNSGYGY  609



>ref|XP_011025126.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Populus 
euphratica]
Length=607

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/396 (91%), Positives = 386/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLI++LE AIR+G+P++IIAEDIEQEALATLVVNKLRGA
Sbjct  272   MSVEYENCKLLLVDKKITNARDLISILEDAIRAGYPVVIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+REEVGL+LDK   +VLGHA+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVVREEVGLALDKVGKEVLGHASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQEAVNKRVAQIRNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SLENDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSNDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPESVPAGNPMDNSGYGY  607



>ref|XP_010249575.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=609

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/396 (92%), Positives = 383/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  214   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  274   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGA  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGLSLDKA+ +VLGHAAKVVLTKD+ 
Sbjct  334   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLSLDKAEKEVLGHAAKVVLTKDAT  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  394   TIVGDGSTQEAVNKRVAQIRNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K+SLENDE+KVGADIVKRALS
Sbjct  454   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDSLENDEQKVGADIVKRALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  514   YPLKLIAKNAGVNGSVVVEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  573

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  574   ASVARTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  609



>ref|XP_003546771.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Glycine max]
Length=591

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/395 (91%), Positives = 385/395 (97%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+S+VGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  196   SAGNNYEVGNMIAEALSRVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  255

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIRSG+PILIIAEDIEQEALATLVVNKLRG+
Sbjct  256   MAVEYENCKLLLVDKKITNARDLINILEDAIRSGYPILIIAEDIEQEALATLVVNKLRGS  315

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD+ 
Sbjct  316   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGYASKVVLTKDTT  375

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  376   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  435

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVD +K+SL+NDEEKVGADIVKRALS
Sbjct  436   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDTIKDSLDNDEEKVGADIVKRALS  495

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNP+YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  496   YPLKLIAKNAGVNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  555

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYG
Sbjct  556   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYG  590



>gb|KHN23693.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Glycine soja]
Length=546

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/395 (91%), Positives = 385/395 (97%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+S+VGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  151   SAGNNYEVGNMIAEALSRVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIRSG+PILIIAEDIEQEALATLVVNKLRG+
Sbjct  211   MAVEYENCKLLLVDKKITNARDLINILEDAIRSGYPILIIAEDIEQEALATLVVNKLRGS  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD+ 
Sbjct  271   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGYASKVVLTKDTT  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  331   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVD +K+SL+NDEEKVGADIVKRALS
Sbjct  391   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDTIKDSLDNDEEKVGADIVKRALS  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNP+YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  451   YPLKLIAKNAGVNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  510

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYG
Sbjct  511   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYG  545



>ref|XP_010044926.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87050.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=608

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/396 (92%), Positives = 386/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR G+P+LI+AEDIEQEALATLVVNKLRGA
Sbjct  273   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPVLIVAEDIEQEALATLVVNKLRGA  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD++
Sbjct  333   LKIAAIKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGNASKVVLTKDTS  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEVVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++LENDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEK+LS+DNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKILSNDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  573   ASVAKTFLMSDCVVVEIKEPEAVPAGNPMDNSGYGY  608



>ref|XP_008351333.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Malus 
domestica]
 ref|XP_008351340.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Malus 
domestica]
Length=604

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/397 (91%), Positives = 386/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  208   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  267

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++IIAEDIEQEALATLVVNKLRGA
Sbjct  268   MAVEYENCKLLLVDKKITNARDLINILEXAIRGGYPVVIIAEDIEQEALATLVVNKLRGA  327

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+L+    +VLGHA+KVVLTKD++
Sbjct  328   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLENVGKEVLGHASKVVLTKDTS  387

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  388   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  447

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  448   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  507

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  508   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  567

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP V AGNPMDNSGYGY
Sbjct  568   SSVAKTFLMSDCVVVEIKEPEPAVPAGNPMDNSGYGY  604



>ref|XP_008221851.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Prunus mume]
Length=605

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/397 (91%), Positives = 385/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  209   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++IIAEDIEQEALATLVVNKLRGA
Sbjct  269   MAVEYENCKLLLVDKKITNARDLINILEEAIRGGYPVIIIAEDIEQEALATLVVNKLRGA  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+L+    +VLGHA+KVVLTKD++
Sbjct  329   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLENVGKEVLGHASKVVLTKDTS  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  389   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPE-PVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE  V AGNPMDNSGYGY
Sbjct  569   SSVAKTFLMSDCVVVEIKEPEAAVPAGNPMDNSGYGY  605



>ref|XP_003531529.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Glycine max]
Length=592

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/395 (91%), Positives = 384/395 (97%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+S+VGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  197   SAGNNYEVGNMIAEALSRVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  256

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIRSG PILIIAEDIEQEALATLVVNKLRG+
Sbjct  257   MAVEYENCKLLLVDKKITNARDLINILEDAIRSGHPILIIAEDIEQEALATLVVNKLRGS  316

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD+ 
Sbjct  317   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGYASKVVLTKDTT  376

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  377   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  436

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SL+NDEEKVGADIVKRALS
Sbjct  437   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALS  496

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNP+YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  497   YPLKLIAKNAGVNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  556

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPE + AGNPMDNSGYG
Sbjct  557   ASVAKTFLMSDCVVVEIKEPEAIPAGNPMDNSGYG  591



>ref|XP_007208310.1| hypothetical protein PRUPE_ppa003093mg [Prunus persica]
 gb|EMJ09509.1| hypothetical protein PRUPE_ppa003093mg [Prunus persica]
Length=605

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/397 (91%), Positives = 384/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  209   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++IIAEDIEQEALATLVVNKLRGA
Sbjct  269   MAVEYENCKLLLVDKKITNARDLINILEEAIRGGYPVIIIAEDIEQEALATLVVNKLRGA  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LD    +VLGHA+KVVLTKD++
Sbjct  329   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDNVGKEVLGHASKVVLTKDTS  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  389   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMA GIIDPTKVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAVGIIDPTKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPE-PVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE  V AGNPMDNSGYGY
Sbjct  569   SSVAKTFLMSDCVVVEIKEPEAAVPAGNPMDNSGYGY  605



>ref|XP_009376036.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=605

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/397 (91%), Positives = 386/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  209   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++I+AEDIEQEALATLVVNKLRGA
Sbjct  269   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIVAEDIEQEALATLVVNKLRGA  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+L+    +VLGHA+KVVLTKD++
Sbjct  329   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLENVGKEVLGHASKVVLTKDTS  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  389   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP V AGNPMDNSGYGY
Sbjct  569   SSVAKTFLMSDCVVVEIKEPEPAVPAGNPMDNSGYGY  605



>gb|KDO54474.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=413

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/397 (92%), Positives = 381/397 (96%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  17    SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  76

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  77    MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  136

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  137   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  196

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  197   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  256

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  257   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  316

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  317   YPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  376

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP M AGNPMDNSGYGY
Sbjct  377   SSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYGY  413



>gb|KHN26774.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Glycine soja]
Length=546

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/395 (91%), Positives = 384/395 (97%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+S+VGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  151   SAGNNYEVGNMIAEALSRVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIRSG PILIIAEDIEQEALATLVVNKLRG+
Sbjct  211   MAVEYENCKLLLVDKKITNARDLINILEDAIRSGHPILIIAEDIEQEALATLVVNKLRGS  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD+ 
Sbjct  271   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGYASKVVLTKDTT  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  331   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SL+NDEEKVGADIVKRALS
Sbjct  391   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALS  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNP+YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  451   YPLKLIAKNAGVNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  510

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPE + AGNPMDNSGYG
Sbjct  511   ASVAKTFLMSDCVVVEIKEPEAIPAGNPMDNSGYG  545



>ref|XP_008384375.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Malus domestica]
 ref|XP_008384376.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Malus domestica]
Length=605

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/397 (91%), Positives = 385/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  209   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++IIAEDIEQEALATLVVNKLRGA
Sbjct  269   MAVEYENCKLLLVDKKITNARDLINILEEAIRGGYPVVIIAEDIEQEALATLVVNKLRGA  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+L+ A  +VLGH +KVVLTKDS+
Sbjct  329   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLENAGKEVLGHXSKVVLTKDSS  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  389   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVD +K++L+NDEEKVGADIVKRALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDTIKDTLDNDEEKVGADIVKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVSEKVLSNDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP V AGNPMDNSGYGY
Sbjct  569   SSVAKTFLMSDCVVVEIKEPEPAVPAGNPMDNSGYGY  605



>ref|XP_004498949.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Cicer arietinum]
Length=592

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/395 (91%), Positives = 384/395 (97%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  197   SAGNNHEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  256

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLIN+LE AIRSGFPILIIAEDIEQEALATLVVNKLRG+
Sbjct  257   MSVEYENCKLLLVDKKITNARDLINILEDAIRSGFPILIIAEDIEQEALATLVVNKLRGS  316

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+KVVLTKD+ 
Sbjct  317   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKVVLTKDTT  376

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV+QIKN IE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  377   TIVGDGSTQEAVTKRVSQIKNQIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  436

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L NDEEKVGADIVKRALS
Sbjct  437   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLANDEEKVGADIVKRALS  496

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN +YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  497   YPLKLIAKNAGVNGSVVSEKVLSNDNTRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  556

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPEPV+AGNPMDNSGYG
Sbjct  557   ASVAKTFLMSDCVVVEIKEPEPVVAGNPMDNSGYG  591



>ref|XP_009376045.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=605

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/397 (91%), Positives = 385/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVV LEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  209   SAGNNYEVGNMIAEALSKVGRKGVVPLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++I+AEDIEQEALATLVVNKLRGA
Sbjct  269   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIVAEDIEQEALATLVVNKLRGA  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+L+    +VLGHA+KVVLTKD++
Sbjct  329   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLENVGKEVLGHASKVVLTKDTS  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  389   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIVKRALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP V AGNPMDNSGYGY
Sbjct  569   SSVAKTFLMSDCVVVEIKEPEPAVPAGNPMDNSGYGY  605



>gb|EYU32832.1| hypothetical protein MIMGU_mgv1a003115mg [Erythranthe guttata]
Length=607

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/396 (91%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVG MIAEA++KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTD+EK
Sbjct  212   SAGNNYEVGRMIAEALAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDTEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++NCKLLLVDKKITNARDLINVLE AIR  +P+LIIAEDIEQEAL TLVVNKLRGA
Sbjct  272   MTVEFENCKLLLVDKKITNARDLINVLEDAIRGSYPVLIIAEDIEQEALGTLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKAD DVLGHAAKVVLTKD+ 
Sbjct  332   LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKADKDVLGHAAKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVG+GS+QE V++RVAQIKNLIEVADQ+YEKEKL+ERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGNGSSQEAVNRRVAQIKNLIEVADQEYEKEKLSERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L NDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLANDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGVYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP + G PMDNSGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPEPAVTGTPMDNSGYGY  607



>ref|XP_009339195.1| PREDICTED: LOW QUALITY PROTEIN: ruBisCO large subunit-binding 
protein subunit beta, chloroplastic-like [Pyrus x bretschneideri]
Length=607

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/397 (91%), Positives = 386/397 (97%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLE GKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  211   SAGNNYEVGNMIAEALSKVGRKGVVTLEGGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  270

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++IIAEDIEQEALATLVVNKLRGA
Sbjct  271   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIIAEDIEQEALATLVVNKLRGA  330

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+L+ A  +VLGHA+KVVLTKDS+
Sbjct  331   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLENAGKEVLGHASKVVLTKDSS  390

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  391   TIVGDGSTQEAVNKRVAQIKNLIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  450

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L+NDEEKVGADIV+RALS
Sbjct  451   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVRRALS  510

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  511   YPLKLIAKNAGVNGSVVSEKVLSNDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  570

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP V AGNPMDNSGYGY
Sbjct  571   SSVAKTFLMSDCVVVEIKEPEPAVPAGNPMDNSGYGY  607



>ref|XP_011048163.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Populus 
euphratica]
Length=607

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 383/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEYDNCKLLLVDKKITNARDLI +LE AI+ G+P++I+AEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYDNCKLLLVDKKITNARDLIAILEDAIKGGYPVVIVAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+REEVGL+LDK  ++VLGHA+K VLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVVREEVGLALDKVGNEVLGHASKEVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DGSTQE V+KRVAQI+NLIE A+QDYEKEKL+ERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVADGSTQEAVNKRVAQIRNLIEAAEQDYEKEKLSERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K+SLENDEEKVGADIVKRALS
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALS  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL+SDNPK+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLASDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE V AGNPMDNSGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPESVPAGNPMDNSGYGY  607



>ref|XP_010942728.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Elaeis guineensis]
Length=608

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/396 (91%), Positives = 382/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE AIR G+PIL+IAEDIEQEALATLVVN+LRGA
Sbjct  273   MSVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPILVIAEDIEQEALATLVVNRLRGA  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGL+LDKAD +VLG AAKVVLTKDS 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLTLDKADKEVLGTAAKVVLTKDST  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+KE+LENDE+KVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKETLENDEQKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL+SDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVIEKVLASDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV++KEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLTSDVVVVDVKEPEPVPAGNPMDNSGYGY  608



>ref|XP_006445574.1| hypothetical protein CICLE_v10014640mg [Citrus clementina]
 ref|XP_006488950.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR58814.1| hypothetical protein CICLE_v10014640mg [Citrus clementina]
 gb|KDO54473.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=608

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/397 (92%), Positives = 381/397 (96%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP M AGNPMDNSGYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYGY  608



>ref|XP_010254011.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nelumbo nucifera]
Length=608

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 383/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRG+
Sbjct  273   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGL+LDKA+ +VLGHAAKVVLTKD+ 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLALDKAEKEVLGHAAKVVLTKDAT  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIQNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVD++K++L++DE+KVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDSIKDTLDDDEQKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVIEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEP+ AGNPMDNSGYGY
Sbjct  573   ASVARTFLTSDVVVVDIKEPEPMPAGNPMDNSGYGY  608



>ref|XP_002284134.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010654639.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI36094.3| unnamed protein product [Vitis vinifera]
Length=609

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/396 (90%), Positives = 382/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVG MIAEAM +VGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  214   SAGNNYEVGYMIAEAMGQVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AI+ G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  274   MAVEYENCKLLLVDKKITNARDLINVLEDAIKGGYPILIIAEDIEQEALATLVVNKLRGA  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA+ +VLGHAAKVVLTKD+ 
Sbjct  334   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAEKEVLGHAAKVVLTKDTT  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NL+E ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  394   TIVGDGSTQEAVNKRVAQIRNLVEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++L++DE+KVGADIVKRALS
Sbjct  454   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLDSDEQKVGADIVKRALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  514   YPMKLIAKNAGVNGSVVIEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  573

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEP+ AGNPMDNSGYGY
Sbjct  574   ASVARTFLTSDAVVVDIKEPEPIPAGNPMDNSGYGY  609



>sp|P08927.2|RUBB_PEA RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta; Flags: Precursor [Pisum sativum]
 gb|AAA66365.1| chaperonin precursor [Pisum sativum]
Length=595

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/395 (91%), Positives = 381/395 (96%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  199   SAGNNHEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  258

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++NCKLLLVDKKITNARDLIN+LE AIRSGFPI+IIAEDIEQEALATLVVNKLRG+
Sbjct  259   MTVEFENCKLLLVDKKITNARDLINILEDAIRSGFPIVIIAEDIEQEALATLVVNKLRGS  318

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKAD +VLG+AAKVVLTKD+ 
Sbjct  319   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKADKEVLGNAAKVVLTKDTT  378

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV+QIKN IE A+Q+YEKEKL+ERIAKLSGGVAVIQVGAQTETELK
Sbjct  379   TIVGDGSTQEAVNKRVSQIKNQIEAAEQEYEKEKLSERIAKLSGGVAVIQVGAQTETELK  438

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++L NDEEKVGADIVKRALS
Sbjct  439   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLANDEEKVGADIVKRALS  498

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  499   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  558

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             +SVAKTFLMSDCVVVEIKEPE    GNPMDNSGYG
Sbjct  559   SSVAKTFLMSDCVVVEIKEPESAPVGNPMDNSGYG  593



>ref|XP_008809220.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=612

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/396 (91%), Positives = 382/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIA+AMSKVGRKGVV LEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  217   SAGNNYEIGNMIADAMSKVGRKGVVALEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  276

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  277   MSVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGA  336

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGLSLDKAD +VLG AAKVVLTKDS 
Sbjct  337   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLSLDKADKEVLGTAAKVVLTKDST  396

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  397   TIVGDGSTQEEVTKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  456

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGADIVKRALS
Sbjct  457   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGADIVKRALS  516

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLSSDN K+GYNAATGNYEDLMA+GIIDPTKVVRCCLEHA
Sbjct  517   YPLKLIAKNAGVNGSVVIEKVLSSDNFKFGYNAATGNYEDLMASGIIDPTKVVRCCLEHA  576

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  577   ASVARTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  612



>ref|XP_004294947.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=601

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/396 (91%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVG MIAEA+SKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  206   SAGNNYEVGQMIAEALSKVGRKGVVTLEEGKSAENFLYVVEGMQFDRGYISPYFVTDSEK  265

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLIN+LE AIR G+P++IIAEDIEQEALATLVVNKLRG+
Sbjct  266   MAVEYENCKLLLVDKKITNARDLINILEDAIRGGYPVVIIAEDIEQEALATLVVNKLRGS  325

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL+LD    +VLG AAKVVLTKDS+
Sbjct  326   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLTLDNVGKEVLGQAAKVVLTKDSS  385

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE A+Q+YEKEKL+ERIAKL+GGVAVIQVGAQTETELK
Sbjct  386   TIVGDGSTQEAVNKRVAQIKNLIEAAEQEYEKEKLSERIAKLAGGVAVIQVGAQTETELK  445

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K SL+NDEEKVGADIVKRAL 
Sbjct  446   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKNSLDNDEEKVGADIVKRALC  505

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  506   YPLKLIAKNAGVNGSVVSEKVLSSDNFKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  565

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  566   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  601



>ref|XP_010671843.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=606

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/396 (90%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEAM KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTD+EK
Sbjct  211   SAGNNHEVGNMIAEAMRKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDAEK  270

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKITNARDL+N+LE AIR G+P+LIIAEDIEQEALATLVVN+LRG+
Sbjct  271   MTVEYENCKLLLVDKKITNARDLVNILEDAIRGGYPVLIIAEDIEQEALATLVVNRLRGS  330

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLGHAAK+VLTKDS+
Sbjct  331   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGHAAKIVLTKDSS  390

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRV QIKN IEVA+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  391   TIVGDGSTQEAVSKRVGQIKNQIEVAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  450

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+K+ LEN EEKVGADIVKRALS
Sbjct  451   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKDQLENVEEKVGADIVKRALS  510

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN +YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  511   YPLKLIAKNAGVNGSVVSEKVLSNDNTRYGYNAATGQYEDLMSAGIIDPTKVVRCCLEHA  570

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKE EP+ AGNPMDNSG+GY
Sbjct  571   SSVAKTFLMSDCVVVEIKEAEPMPAGNPMDNSGFGY  606



>ref|XP_008803228.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Phoenix dactylifera]
Length=608

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE +IR G+ ILIIAEDIEQEALATLVVNKLRGA
Sbjct  273   MSVEYENCKLLLVDKKITNARDLINVLEDSIRGGYSILIIAEDIEQEALATLVVNKLRGA  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGL+LDKAD +VLG AAKVVLTKDS 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLTLDKADKEVLGTAAKVVLTKDST  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+++VDA+KE+LENDE+KVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAARVDAIKETLENDEQKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL+SDNPKYGYNAATG YEDLMA GIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVIEKVLASDNPKYGYNAATGKYEDLMAVGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  608



>ref|XP_009103725.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brassica rapa]
Length=600

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQEAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +LENDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLENDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS++N KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNENVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  600



>ref|XP_010920048.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Elaeis guineensis]
 ref|XP_010920049.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=611

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/396 (91%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIA+AMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGY+SPYFVTDSEK
Sbjct  216   SAGNNYEIGNMIADAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYLSPYFVTDSEK  275

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE AIR GFPILIIAEDIEQEALATLVVNKLRGA
Sbjct  276   MSVEYENCKLLLVDKKITNARDLINVLEDAIRGGFPILIIAEDIEQEALATLVVNKLRGA  335

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTKDS 
Sbjct  336   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLSLDKADKVVLGTAAKVVLTKDST  395

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  396   TIVGDGSTQEEVTKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  455

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGADIVKRALS
Sbjct  456   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGADIVKRALS  515

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  516   YPLKLIAKNAGVNGSVVIEKVLSSDNFKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  575

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEP  AGN MDNSGYGY
Sbjct  576   ASVARTFLTSDVVVVDIKEPEPAPAGNLMDNSGYGY  611



>ref|XP_007149220.1| hypothetical protein PHAVU_005G051700g [Phaseolus vulgaris]
 gb|ESW21214.1| hypothetical protein PHAVU_005G051700g [Phaseolus vulgaris]
Length=593

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/395 (90%), Positives = 381/395 (96%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  198   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  257

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDL N+LE AIRSG+PIL+IAEDIEQEALATLVVN+LRG+
Sbjct  258   MAVEYENCKLLLVDKKITNARDLFNILEDAIRSGYPILVIAEDIEQEALATLVVNRLRGS  317

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD+ 
Sbjct  318   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGYASKVVLTKDTT  377

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIK  IE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  378   TIVGDGSTQEAVNKRVAQIKIQIEAAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  437

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+++SL+NDEEKVGADIVKRALS
Sbjct  438   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIRDSLDNDEEKVGADIVKRALS  497

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN +YGYNAATGNYEDLM+AGIIDPTKVVRCCLEHA
Sbjct  498   YPLKLIAKNAGVNGSVVSEKVLSSDNARYGYNAATGNYEDLMSAGIIDPTKVVRCCLEHA  557

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPE V AGNPMD SGYG
Sbjct  558   ASVAKTFLMSDCVVVEIKEPEAVPAGNPMDASGYG  592



>ref|XP_006838174.1| hypothetical protein AMTR_s00106p00119930 [Amborella trichopoda]
 gb|ERN00743.1| hypothetical protein AMTR_s00106p00119930 [Amborella trichopoda]
Length=613

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/396 (90%), Positives = 381/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEA+SKVGR+GVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  218   SAGNNYEIGNMIAEALSKVGRRGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  277

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  278   MSVEYENCKLLLVDKKITNARDLINVLEDAIRGSYPILIIAEDIEQEALATLVVNKLRGA  337

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGL+LDKA  +VLG+AAKVVLTKD+ 
Sbjct  338   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLALDKAGKEVLGNAAKVVLTKDAT  397

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE ++QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  398   TIVGDGSTQEVVNKRVLQIKNLIEASEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  457

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +LENDE+K+GADIVKRALS
Sbjct  458   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKGTLENDEQKIGADIVKRALS  517

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  518   YPLKLIAKNAGVNGSVVTEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  577

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  578   ASVARTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  613



>ref|XP_009392770.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=612

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 383/396 (97%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  217   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  276

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKITNARDLINVLE AIR G+P++IIAEDIEQEALATLVVNKLRG+
Sbjct  277   MTVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPVVIIAEDIEQEALATLVVNKLRGS  336

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTG TVIR+EVGLSLDKA  +VLG AAKVVLTKDSA
Sbjct  337   LKIAALKAPGFGDRKSQYLDDIAILTGATVIRDEVGLSLDKAGKEVLGTAAKVVLTKDSA  396

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIEVA+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  397   TIVGDGSTQEEVTKRVAQIKNLIEVAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  456

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L+NDE+KVGADIVKRALS
Sbjct  457   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLDNDEQKVGADIVKRALS  516

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL++D+ KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  517   YPLKLIAKNAGVNGSVVTEKVLANDSFKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  576

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  577   ASVAKTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  612



>emb|CDY08245.1| BnaA05g13740D [Brassica napus]
Length=600

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/396 (90%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +LENDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLENDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS++N KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNENVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  600



>ref|XP_006392634.1| hypothetical protein EUTSA_v10011330mg [Eutrema salsugineum]
 gb|ESQ29920.1| hypothetical protein EUTSA_v10011330mg [Eutrema salsugineum]
Length=600

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+AAKVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNAAKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K SLENDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKASLENDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  600



>emb|CAJ19275.1| beta chaperonin 60 [Solanum commersonii]
Length=600

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/397 (90%), Positives = 379/397 (95%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG+MIAE MS VGRKGVVTLEEGKSAENSLRVVEGMQFDRGY +PYFVTDSEK
Sbjct  204   SAGNNLEVGSMIAEPMSTVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYFAPYFVTDSEK  263

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKKITNA+DL+NVL+ AIR+G P LIIAE+I+QEALATLVVNKLRGA
Sbjct  264   MSVEYDNCKLLLVDKKITNAKDLVNVLKDAIRNGSPTLIIAENIDQEALATLVVNKLRGA  323

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIA LTGGTVIREE+GL+LDKAD +VLGHAAKVVLTKD+ 
Sbjct  324   LKVAALKAPGFGERKSQYLDDIATLTGGTVIREELGLTLDKADKEVLGHAAKVVLTKDAT  383

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNLIE ADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  384   TIVGDGSTQEAVNKRVAQIKNLIEAADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  443

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVE GIVVGGGCTLLRL++KVDA+K +L NDEEKVGADIV+RALS
Sbjct  444   EKKLRVEDALNATKAAVERGIVVGGGCTLLRLAAKVDAIKGTLANDEEKVGADIVQRALS  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDL-MAAGIIDPTKVVRCCLEH  527
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATGNYEDL MAAGIIDPTKVVRCCLEH
Sbjct  504   YPLKLIAKNAGVNGSVVSEKVLSSDDPKFGYNAATGNYEDLIMAAGIIDPTKVVRCCLEH  563

Query  526   AASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             AASVAKTFLMSDCVVVEIKEPE  +AGNPMDNSGYGY
Sbjct  564   AASVAKTFLMSDCVVVEIKEPEAAVAGNPMDNSGYGY  600



>ref|XP_010920050.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=604

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/396 (91%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIA+AMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGY+SPYFVTDSEK
Sbjct  209   SAGNNYEIGNMIADAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYLSPYFVTDSEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE AIR GFPILIIAEDIEQEALATLVVNKLRGA
Sbjct  269   MSVEYENCKLLLVDKKITNARDLINVLEDAIRGGFPILIIAEDIEQEALATLVVNKLRGA  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTKDS 
Sbjct  329   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLSLDKADKVVLGTAAKVVLTKDST  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  389   TIVGDGSTQEEVTKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGADIVKRALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGADIVKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVIEKVLSSDNFKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPEP  AGN MDNSGYGY
Sbjct  569   ASVARTFLTSDVVVVDIKEPEPAPAGNLMDNSGYGY  604



>ref|XP_009106876.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Brassica rapa]
Length=600

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGY+SPYFVTDSEK
Sbjct  205   SAGNNAEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYVSPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  325   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|XP_006297271.1| hypothetical protein CARUB_v10013285mg [Capsella rubella]
 gb|EOA30169.1| hypothetical protein CARUB_v10013285mg [Capsella rubella]
Length=596

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/396 (91%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVG+MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNHEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEYDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTQEAVNKRVVQIRNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++LENDEEKVGA+IVKRALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGAEIVKRALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEI EPEPV AGNPMDNSGYGY
Sbjct  561   ASVAKTFLMSDCVVVEIPEPEPVPAGNPMDNSGYGY  596



>ref|XP_010552318.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic [Tarenaya 
hassleriana]
Length=595

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEAMSKVGRKGVVTLEEG+SA+N+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  200   SAGNNHEVGNMIAEAMSKVGRKGVVTLEEGRSADNNLYVVEGMQFDRGYISPYFVTDSEK  259

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDL+ VLE AIR  +PILIIAEDIEQEALATLVVNKLRG 
Sbjct  260   MSAEYENCKLLLVDKKITNARDLVGVLEDAIRGSYPILIIAEDIEQEALATLVVNKLRGT  319

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+S 
Sbjct  320   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKEST  379

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  380   TIVGDGSTQDAVSKRVVQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  439

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+K++LENDEEKVGADIVKRALS
Sbjct  440   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKDTLENDEEKVGADIVKRALS  499

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNP++GYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  500   YPLKLIAKNAGVNGSVVSEKVLSNDNPRFGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  559

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGY Y
Sbjct  560   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYPY  595



>ref|XP_006307049.1| hypothetical protein CARUB_v10008637mg [Capsella rubella]
 gb|EOA39947.1| hypothetical protein CARUB_v10008637mg [Capsella rubella]
Length=600

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|XP_010500599.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Camelina 
sativa]
Length=596

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVG+MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNHEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKKITNARDL+ VLE AIR G+PIL+IAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEYDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILVIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQE V+KRV QI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGTTQEAVNKRVVQIRNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +LENDEEKVGA+IVKRALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKNTLENDEEKVGAEIVKRALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNMKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEI EPEPV AGNPMDNSGYGY
Sbjct  561   ASVAKTFLMSDCVVVEIPEPEPVPAGNPMDNSGYGY  596



>ref|XP_002894506.1| CPN60B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70765.1| CPN60B [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNDEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVKKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|XP_010501159.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Camelina 
sativa]
Length=600

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVLKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|NP_175945.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 ref|NP_849811.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 sp|P21240.3|CPNB1_ARATH RecName: Full=Chaperonin 60 subunit beta 1, chloroplastic; Short=CPN-60 
beta 1; AltName: Full=60 kDa chaperonin subunit beta 
1; AltName: Full=RuBisCO large subunit-binding protein subunit 
beta, chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK62390.1|AF386945_1 Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 gb|AAD10647.1| Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 gb|AAM10063.1| Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 dbj|BAH19596.1| AT1G55490 [Arabidopsis thaliana]
 gb|AEE33251.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 gb|AEE33252.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
Length=600

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNDEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVKKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|XP_010462399.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic [Camelina 
sativa]
Length=600

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVLKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|XP_010487110.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Camelina 
sativa]
Length=596

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/396 (90%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVG+MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNHEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKKITNARDL+ +LE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEYDNCKLLLVDKKITNARDLVGILEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQE V+KRV QI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGTTQEAVNKRVVQIRNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTL+RL+SKVDA+K +LENDEEKVGA+IVKRALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLIRLASKVDAIKNTLENDEEKVGAEIVKRALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEI EPEPV AGNPMDNSGYGY
Sbjct  561   ASVAKTFLMSDCVVVEIPEPEPVPAGNPMDNSGYGY  596



>ref|XP_010465189.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin 60 subunit beta 2, 
chloroplastic [Camelina sativa]
Length=596

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVG+MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNHEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQE V+KRV QI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGTTQEAVNKRVVQIRNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +LENDEEKVGA+IVKRALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKSTLENDEEKVGAEIVKRALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEI EPEPV AGNPMDNSGYGY
Sbjct  561   ASVAKTFLMSDCVVVEIPEPEPVPAGNPMDNSGYGY  596



>ref|XP_010480083.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Camelina 
sativa]
Length=600

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVLKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSGYGY
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY  600



>ref|XP_009135307.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Brassica 
rapa]
Length=590

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/396 (90%), Positives = 376/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  195   SAGNNPEVGNMIAEAMSKVGRKGVVTLEEGKSAENHLYVVEGMQFDRGYISPYFVTDSEK  254

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKK+TNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  255   MSVEYDNCKLLLVDKKVTNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  314

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  315   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  374

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  375   TIVGDGSTQEAVNKRVVQIKNLIEQAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  434

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAV EGIVVGGGCTLLRL++KVDA+K++LENDEEKVGA+IVKRALS
Sbjct  435   EKKLRVEDALNATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALS  494

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLM AGIIDPTKVVRCCLEHA
Sbjct  495   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMVAGIIDPTKVVRCCLEHA  554

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  555   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  590



>ref|XP_006407212.1| hypothetical protein EUTSA_v10020346mg [Eutrema salsugineum]
 gb|ESQ48665.1| hypothetical protein EUTSA_v10020346mg [Eutrema salsugineum]
Length=596

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 378/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG+MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNPEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKK+TNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEYDNCKLLLVDKKVTNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTQEAVNKRVVQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAV EGIVVGGGCTLLRL++KVDA+K++LENDEEKVGA+IVKRALS
Sbjct  441   EKKLRVEDALNATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSGYGY
Sbjct  561   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSGYGY  596



>gb|ABK24483.1| unknown [Picea sitchensis]
Length=617

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 377/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  222   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  281

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARD+I VLE AIR G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  282   MSVEYENCKLLLVDKKITNARDMITVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGA  341

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL LDK  S+VLG AAKVVLTKDS 
Sbjct  342   LKVAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLQLDKVGSEVLGTAAKVVLTKDST  401

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI++LIEVA+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  402   TIVGDGSTQEAVNKRVAQIRSLIEVAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  461

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGC LLRL+SKVDA++++LENDE+KVGA IVKRALS
Sbjct  462   EKKLRVEDALNATKAAVEEGIVVGGGCALLRLASKVDAIRDTLENDEQKVGAGIVKRALS  521

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLSSD+PKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  522   YPLKLIAKNAGVNGSVVVEKVLSSDDPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  581

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPEP  + NPMDNSGYGY
Sbjct  582   ASVAKTFLTSDVVVVDIKEPEPAASPNPMDNSGYGY  617



>ref|NP_187956.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
 sp|Q9LJE4.1|CPNB2_ARATH RecName: Full=Chaperonin 60 subunit beta 2, chloroplastic; Short=CPN-60 
beta 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01754.1| GloEL protein; chaperonin, 60 kDa [Arabidopsis thaliana]
 gb|AEE75362.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=596

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/396 (90%), Positives = 379/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVG+MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNHEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKK+TNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEYDNCKLLLVDKKVTNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQE V+KRV QI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGTTQEAVNKRVVQIRNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++LENDEEKVGA+IVKRALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGAEIVKRALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFLMSDCVVVEI EPEPV AGNPMDNSGYGY
Sbjct  561   ASVAKTFLMSDCVVVEIPEPEPVPAGNPMDNSGYGY  596



>ref|XP_010094358.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
 gb|EXB55869.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
Length=769

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/392 (91%), Positives = 379/392 (97%), Gaps = 0/392 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSA+NSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  208   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSADNSLYVVEGMQFDRGYISPYFVTDSEK  267

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR G+P+LIIAEDIEQEALATLVVNKLRGA
Sbjct  268   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPVLIIAEDIEQEALATLVVNKLRGA  327

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+REEVGL+LDK  ++VLG A+KVVLTKD+ 
Sbjct  328   LKIAALKAPGFGERKSQYLDDIAILTGGTVVREEVGLTLDKVGNEVLGQASKVVLTKDTT  387

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  388   TIVGDGSTQEAVNKRVAQIRNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  447

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVD ++++LENDEEKVGADIVKRALS
Sbjct  448   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDGIRDTLENDEEKVGADIVKRALS  507

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  508   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  567

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNS  428
             +SVAKTFLMSDCVVVEIKEPE V AGNPMDNS
Sbjct  568   SSVAKTFLMSDCVVVEIKEPESVPAGNPMDNS  599



>emb|CDY26100.1| BnaC06g10960D [Brassica napus]
Length=628

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/405 (88%), Positives = 382/405 (94%), Gaps = 3/405 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNEEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AAL+APGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  325   LKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +LENDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALENDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS++N KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNENVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG---YGY*VRSTE  398
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSG   + Y V+ST+
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGLLRHSYTVKSTK  609



>gb|KEH39992.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=591

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/395 (89%), Positives = 378/395 (96%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEA+SKVGRKGVVTLEEG+SAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  196   SAGNNHEVGNMIAEALSKVGRKGVVTLEEGRSAENNLYVVEGMQFDRGYISPYFVTDSEK  255

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++NCKLLLVDKKI+NARDLIN+LE AIR+GFPILIIAEDIEQEALATLVVNKLRG+
Sbjct  256   MTVEFENCKLLLVDKKISNARDLINILEDAIRNGFPILIIAEDIEQEALATLVVNKLRGS  315

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA ++VLG AAKVVLTKD+ 
Sbjct  316   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGNEVLGTAAKVVLTKDTT  375

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV+QIKN IE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  376   TIVGDGSTQEAVTKRVSQIKNQIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  435

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L NDEEKVGADIVKRALS
Sbjct  436   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLANDEEKVGADIVKRALS  495

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+D+ +YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  496   YPLKLIAKNAGVNGSVVSEKVLSNDDTRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  555

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPE    GNPMDNSG+G
Sbjct  556   ASVAKTFLMSDCVVVEIKEPEVAPVGNPMDNSGFG  590



>ref|XP_010909417.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Elaeis guineensis]
Length=608

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/396 (88%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNM+A+AMSKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEIGNMVADAMSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDLINVLE +I+ G+PIL+IAEDIEQEALATLVVNKLRGA
Sbjct  273   MSAEYENCKLLLVDKKITNARDLINVLEDSIKGGYPILVIAEDIEQEALATLVVNKLRGA  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIAILTG TVIR+EVGL+LDKAD +VLG AAKVVLTKDS 
Sbjct  333   LKIAAIKAPGFGERKSQYLDDIAILTGATVIRDEVGLTLDKADKEVLGTAAKVVLTKDST  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NL+E A+Q+YE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIRNLMEAAEQEYEREKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LE+DE+KVGA+IV+RALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLEDDEQKVGAEIVRRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL+SDN KYGYNAATG YEDLMA GIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVTEKVLASDNLKYGYNAATGKYEDLMAVGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  608



>gb|KEH39991.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=591

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/395 (89%), Positives = 378/395 (96%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN+EVGNMIAEA+SKVGRKGVVTLEEG+SAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  196   SAGNNHEVGNMIAEALSKVGRKGVVTLEEGRSAENNLYVVEGMQFDRGYISPYFVTDSEK  255

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++NCKLLLVDKKI+NARDLIN+LE AIR+GFPILIIAEDIEQEALATLVVNKLRG+
Sbjct  256   MTVEFENCKLLLVDKKISNARDLINILEDAIRNGFPILIIAEDIEQEALATLVVNKLRGS  315

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKA ++VLG AAKVVLTKD+ 
Sbjct  316   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKAGNEVLGTAAKVVLTKDTT  375

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV+QIKN IE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  376   TIVGDGSTQEAVTKRVSQIKNQIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  435

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L NDEEKVGADIVKRALS
Sbjct  436   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLANDEEKVGADIVKRALS  495

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+D+ +YGYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  496   YPLKLIAKNAGVNGSVVSEKVLSNDDTRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  555

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFLMSDCVVVEIKEPE    GNPMDNSG+G
Sbjct  556   ASVAKTFLMSDCVVVEIKEPEVAPVGNPMDNSGFG  590



>ref|XP_010103092.1| Chaperonin 60 subunit beta 2 [Morus notabilis]
 gb|EXB94815.1| Chaperonin 60 subunit beta 2 [Morus notabilis]
Length=603

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/393 (90%), Positives = 376/393 (96%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGR GVVTLEEGKSA+N L VVEGMQFDRGYISPYFVTDSEK
Sbjct  208   SAGNNYEVGNMIAEALSKVGRNGVVTLEEGKSADNFLYVVEGMQFDRGYISPYFVTDSEK  267

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +P+LIIAEDIEQEALATLVVNKLRGA
Sbjct  268   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPVLIIAEDIEQEALATLVVNKLRGA  327

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTV+R+EVGL+LDK   +VLG A+KVVLTKD+ 
Sbjct  328   LKIAALKAPGFGERKSQYLDDIAILTGGTVVRDEVGLTLDKVGKEVLGQASKVVLTKDTT  387

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIEVA+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  388   TIVGDGSTQEAVNKRVAQIRNLIEVAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  447

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVD +K++LEN+EEKVGADIVKRALS
Sbjct  448   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDGIKDTLENEEEKVGADIVKRALS  507

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNP+YG+NAA+G YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  508   YPLKLIAKNAGVNGSVVSEKVLSSDNPRYGFNAASGKYEDLMAAGIIDPTKVVRCCLEHA  567

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             +SVAKTFLMSDCVVVEIKE EPV AGNPM NSG
Sbjct  568   SSVAKTFLMSDCVVVEIKESEPVPAGNPMGNSG  600



>ref|XP_009418590.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=612

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/396 (89%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  217   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  276

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR G+P++II+EDIEQEALATLVVNKLRG+
Sbjct  277   MTAEYENCKLLLVDKKITNARDLINVLEDAIRGGYPVVIISEDIEQEALATLVVNKLRGS  336

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIR+EVGLSLDKA  +VLG AAKVVLTKDS+
Sbjct  337   LKIAALKAPGFGERKSQYLDDIAILTGATVIRDEVGLSLDKAGKEVLGTAAKVVLTKDSS  396

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRVAQIKNLIE A+Q+YEKEKLNER+AKLSGGVAVIQVGAQTETELK
Sbjct  397   TIVGDGTTQEEVNKRVAQIKNLIEAAEQEYEKEKLNERVAKLSGGVAVIQVGAQTETELK  456

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L+NDE+KVGADIVKRALS
Sbjct  457   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLDNDEQKVGADIVKRALS  516

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS++N K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  517   YPLKLIAKNAGVNGSVVTEKVLSNENFKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  576

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPE + AGNPMDNSGYGY
Sbjct  577   ASVAKTFLTSDVVVVDIKEPETLPAGNPMDNSGYGY  612



>emb|CDY02438.1| BnaA08g00450D [Brassica napus]
Length=697

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/394 (90%), Positives = 376/394 (95%), Gaps = 0/394 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGY+SPYFVTDSEK
Sbjct  294   SAGNNAEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYVSPYFVTDSEK  353

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  354   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  413

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  414   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  473

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  474   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  533

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  534   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALS  593

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  594   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  653

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGY  422
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSG+
Sbjct  654   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGW  687



>ref|XP_008813152.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like isoform X2 [Phoenix dactylifera]
Length=601

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/396 (89%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNM+A+A+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  206   SAGNNYEIGNMVADALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  265

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCK+LLVDKKITNARDLINVLE AI+ G+PIL+IAEDIEQEALATLVVNKLRG+
Sbjct  266   MSAEYENCKVLLVDKKITNARDLINVLEDAIKGGYPILLIAEDIEQEALATLVVNKLRGS  325

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDKAD +VLG AAKVVLTKDS 
Sbjct  326   LKIAAIKAPGFGERKSQYLDDIAILTGGTVIRDEVGLTLDKADKEVLGTAAKVVLTKDST  385

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ  V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  386   TIVGDGSTQGAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  445

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGC+LLRL+SKVDA+KE+LENDE+KVGA+IV+RALS
Sbjct  446   EKKLRVEDALNATKAAVEEGIVVGGGCSLLRLASKVDAIKETLENDEQKVGAEIVRRALS  505

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL+SDN K GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  506   YPLKLIAKNAGVNGSVVIEKVLASDNLKIGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  565

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  566   ASVAKTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  601



>ref|XP_010536825.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536826.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536827.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
Length=606

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/396 (88%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  211   SAGNNYEVGNMIAEAMGKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  270

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARD++N+LE AI+  +P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  271   MSAEYENCKLLLVDKKITNARDIVNILEDAIKGAYPVLIIAEDIEQEPLATLVVNKLRGT  330

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIA+LTG TV+R+EVGL LDK   +VLG+AAKVVLTKD+ 
Sbjct  331   LKVAALKAPGFGERKSQYLDDIAVLTGATVVRDEVGLQLDKVGKEVLGNAAKVVLTKDTT  390

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRVAQI+NLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  391   TIVGDGSTEEAVKKRVAQIRNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  450

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LENDEE+VGA+IVK+ALS
Sbjct  451   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKENLENDEERVGAEIVKKALS  510

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL+SDNPKYGYNAA G YEDLMA GIIDPTKVVRCCLEHA
Sbjct  511   YPLKLIAKNAGVNGSVVSEKVLASDNPKYGYNAAIGKYEDLMAVGIIDPTKVVRCCLEHA  570

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP+ AGNPMDNSGYG+
Sbjct  571   SSVAKTFLMSDCVVVEIKEPEPLPAGNPMDNSGYGF  606



>ref|XP_008813151.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=608

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/396 (89%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNM+A+A+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEIGNMVADALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCK+LLVDKKITNARDLINVLE AI+ G+PIL+IAEDIEQEALATLVVNKLRG+
Sbjct  273   MSAEYENCKVLLVDKKITNARDLINVLEDAIKGGYPILLIAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDKAD +VLG AAKVVLTKDS 
Sbjct  333   LKIAAIKAPGFGERKSQYLDDIAILTGGTVIRDEVGLTLDKADKEVLGTAAKVVLTKDST  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ  V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQGAVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGC+LLRL+SKVDA+KE+LENDE+KVGA+IV+RALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCSLLRLASKVDAIKETLENDEQKVGAEIVRRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL+SDN K GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVIEKVLASDNLKIGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPEPV AGNPMDNSGYGY
Sbjct  573   ASVAKTFLTSDVVVVDIKEPEPVPAGNPMDNSGYGY  608



>gb|AAT90346.1| RuBisCo subunit binding-protein beta subunit [Zea mays]
Length=409

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/396 (88%), Positives = 374/396 (94%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SA NNYE+GNMIAEAMSKVGRKGVVTLEEGKS+EN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  14    SADNNYEIGNMIAEAMSKVGRKGVVTLEEGKSSENFLYVVEGMQFDRGYISPYFVTDSEK  73

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  74    MTAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  133

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD+ VLG AAKVVLTK+S 
Sbjct  134   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADNSVLGTAAKVVLTKEST  193

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  194   TIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  253

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  254   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  313

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  314   YPLKLIAKNAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  373

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPE     NPMDNSGYGY
Sbjct  374   ASVAKTFLTSDVVVVDIKEPEATPVANPMDNSGYGY  409



>gb|KDO54472.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=601

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/396 (90%), Positives = 374/396 (94%), Gaps = 6/396 (2%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  571

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP M       +GYGY
Sbjct  572   SSVAKTFLMSDCVVVEIKEPEPAMP------AGYGY  601



>ref|XP_009382612.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=609

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/396 (88%), Positives = 380/396 (96%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  214   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKITNARDLINVLE AIR G+P++IIAEDIEQEALATLVVNKLRG+
Sbjct  274   MSVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPVVIIAEDIEQEALATLVVNKLRGS  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAIL+G TVIR+EVGLSLDKA  +VLG AAKVVLTK++ 
Sbjct  334   LKIAALKAPGFGERKSQYLDDIAILSGATVIRDEVGLSLDKAGKEVLGTAAKVVLTKETT  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGS+QEEV+KRVAQI NLIE ++Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  394   TIVGDGSSQEEVTKRVAQIHNLIEASEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LENDE+KVGADIV+RALS
Sbjct  454   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEQKVGADIVRRALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVLS+D+ K+GYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  514   YPLKLIAKNAGVNGSVVVEKVLSNDDFKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  573

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASV+KTFL SD V+V+IKEPE V AGNPM+NSGYGY
Sbjct  574   ASVSKTFLTSDVVMVDIKEPESVPAGNPMNNSGYGY  609



>emb|CDX82537.1| BnaA03g32840D [Brassica napus]
Length=587

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/393 (89%), Positives = 372/393 (95%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  195   SAGNNPEVGNMIAEAMSKVGRKGVVTLEEGKSAENHLYVVEGMQFDRGYISPYFVTDSEK  254

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNCKLLLVDKK+TNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  255   MSVEYDNCKLLLVDKKVTNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  314

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+ +KVVLTK+  
Sbjct  315   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNVSKVVLTKEMT  374

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  375   TIVGDGSTQEAVNKRVVQIKNLIEQAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  434

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAV EGIVVGGGCTLLRL++KVDA+K++LENDEEKVGA+IVKRALS
Sbjct  435   EKKLRVEDALNATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALS  494

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLM AGIIDPTKVVRCCLEHA
Sbjct  495   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMVAGIIDPTKVVRCCLEHA  554

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSG
Sbjct  555   ASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSG  587



>ref|XP_007024263.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
 gb|EOY26885.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
Length=608

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/396 (88%), Positives = 376/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM KVGRKG+VTLEEG  +ENS+ VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEVGNMIAEAMGKVGRKGIVTLEEGSGSENSMYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVE +NCKLLLVDKKITNARDLI+VLE AI+ G+PI+IIAEDIEQEALATLVVNKLRG+
Sbjct  273   MAVECENCKLLLVDKKITNARDLIHVLEDAIKEGYPIVIIAEDIEQEALATLVVNKLRGS  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGLSLDKA+ +VLG AAKVVLTK++ 
Sbjct  333   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLSLDKAEKEVLGQAAKVVLTKETT  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQIKNL+E A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEAVNKRVAQIKNLVEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA++E+L+NDE+KVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAVRETLDNDEQKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLSSDNP YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPMKLIAKNAGVNGSVVIEKVLSSDNPNYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VVV+IKEPE   AGNPMDNSGYGY
Sbjct  573   ASVARTFLTSDAVVVDIKEPETAAAGNPMDNSGYGY  608



>ref|XP_008659370.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 ref|XP_008659372.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 ref|XP_008659373.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 gb|ACN28096.1| unknown [Zea mays]
 gb|ACN28325.1| unknown [Zea mays]
 gb|AFW86139.1| putative TCP-1/cpn60 chaperonin family protein isoform 1 [Zea 
mays]
 gb|AFW86140.1| putative TCP-1/cpn60 chaperonin family protein isoform 2 [Zea 
mays]
 gb|AFW86141.1| putative TCP-1/cpn60 chaperonin family protein isoform 3 [Zea 
mays]
Length=579

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/396 (88%), Positives = 374/396 (94%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKS+EN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  184   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSSENFLYVVEGMQFDRGYISPYFVTDSEK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  244   MTAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S 
Sbjct  304   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  364   TIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  424   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  484   YPLKLIAKNAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPE     NPMDNSGYGY
Sbjct  544   ASVAKTFLTSDVVVVDIKEPEAAPVANPMDNSGYGY  579



>ref|XP_006655715.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Oryza 
brachyantha]
Length=601

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/396 (88%), Positives = 377/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQF+RGYISPYFVTDSEK
Sbjct  206   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEK  265

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  266   MSAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  325

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK++ 
Sbjct  326   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEAT  385

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  386   TIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  445

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+++VDA+K++LENDE+KVGA+IV+RALS
Sbjct  446   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAARVDAIKDTLENDEQKVGAEIVRRALS  505

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  506   YPLKLIAKNAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  565

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPEP    NPMDNSGYGY
Sbjct  566   ASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYGY  601



>ref|XP_008659369.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Zea mays]
 gb|ACN34709.1| unknown [Zea mays]
 gb|AFW86138.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=600

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/396 (88%), Positives = 374/396 (94%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEGKS+EN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGKSSENFLYVVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  265   MTAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S 
Sbjct  325   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEST  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPE     NPMDNSGYGY
Sbjct  565   ASVAKTFLTSDVVVVDIKEPEAAPVANPMDNSGYGY  600



>emb|CDY10557.1| BnaC03g70570D [Brassica napus]
Length=829

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/393 (90%), Positives = 375/393 (95%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGY+SPYFVTDSEK
Sbjct  433   SAGNNAEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYVSPYFVTDSEK  492

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  493   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  552

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  553   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  612

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  613   TIVGDGSTQEAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  672

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  673   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALS  732

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  733   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  792

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSG
Sbjct  793   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSG  825



>ref|XP_003557154.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Brachypodium distachyon]
Length=599

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/396 (88%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  204   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFDRGYISPYFVTDSEK  263

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  264   MTTEYENCKLLLVDKKITNARDLINVLEEAIRGQYPILIIAEDIEQEALATLVVNKLRGS  323

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERK+QYLDDIAILTGGTVIR+EVGLSLDKAD  VLG AAKVVL K+S 
Sbjct  324   LKICAIKAPGFGERKTQYLDDIAILTGGTVIRDEVGLSLDKADKSVLGTAAKVVLNKEST  383

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEVSKRVAQIKNLIEVA+QDYEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  384   TIVGDGSTQEEVSKRVAQIKNLIEVAEQDYEKEKLNERIAKLAGGVAVIQVGAQTETELK  443

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LEN+E+KVGA+IV+RAL 
Sbjct  444   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENEEQKVGAEIVRRALC  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  504   YPLKLIAKNAGVNGSVVTEKVLSNDNVKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  563

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPEP    NPMDNSG+GY
Sbjct  564   ASVAKTFLTSDVVVVEIKEPEPAPLANPMDNSGFGY  599



>ref|XP_009793336.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nicotiana sylvestris]
Length=605

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/396 (87%), Positives = 373/396 (94%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM KVGRKGVVTLEEG+ +ENSL VVEGMQFDRGYISPYFVTD+EK
Sbjct  210   SAGNNYEVGNMIAEAMGKVGRKGVVTLEEGRGSENSLYVVEGMQFDRGYISPYFVTDNEK  269

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDL+NVLE AIR G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  270   MVAEYENCKLLLVDKKITNARDLVNVLEEAIRGGYPILIIAEDIEQEALATLVVNKLRGA  329

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLD+A S+VLGHA KVVL+KDS 
Sbjct  330   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDRAGSEVLGHAGKVVLSKDST  389

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KR+AQIK ++E  +QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  390   TIVGDGSTQEAVNKRIAQIKRIVEATEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  449

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KV+ +K +L++DE+K+GADIVKRAL 
Sbjct  450   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVEDIKGTLDDDEQKIGADIVKRALR  509

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLS+DNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  510   YPMKLIAKNAGVNGSVVIEKVLSNDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  569

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VV E KEPEPV+AGNPMDNSGYGY
Sbjct  570   ASVARTFLTSDAVVTENKEPEPVVAGNPMDNSGYGY  605



>ref|XP_009628147.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=605

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/396 (87%), Positives = 372/396 (94%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM KVGRKGVVTLEEG+ +ENSL VVEGMQFDRGYISPYFVTD+EK
Sbjct  210   SAGNNYEVGNMIAEAMGKVGRKGVVTLEEGRGSENSLYVVEGMQFDRGYISPYFVTDNEK  269

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDL+NVLE AIR G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  270   MVAEYENCKLLLVDKKITNARDLVNVLEEAIRGGYPILIIAEDIEQEALATLVVNKLRGA  329

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLD+A S+VLGHA KVVL+KDS 
Sbjct  330   LKIAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDRAGSEVLGHAGKVVLSKDST  389

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KR+AQIK ++E  +QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  390   TIVGDGSTQEAVNKRIAQIKRIVEATEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  449

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KV+ +K +L++DE+K+GADIVKRAL 
Sbjct  450   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLATKVEDIKGTLDDDEQKIGADIVKRALR  509

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLS DNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  510   YPMKLIAKNAGVNGSVVIEKVLSDDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  569

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVA+TFL SD VV E KEPEPV+AGNPMDNSGYGY
Sbjct  570   ASVARTFLTSDAVVTENKEPEPVVAGNPMDNSGYGY  605



>sp|Q43831.1|RUBB_SECCE RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta, partial [Secale cereale]
 emb|CAA93139.1| chaperonin [Secale cereale]
Length=499

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/396 (87%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQF+RGYISPYFVTDSEK
Sbjct  104   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEK  163

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  164   MTTEYENCKLLLVDKKITNARDLINVLEEAIRGQYPILIIAEDIEQEALATLVVNKLRGS  223

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERK+QYLDDIAILTGGTVIR+EVGL+LDKAD+ VLG AAKVVLTK+S 
Sbjct  224   LKICAIKAPGFGERKTQYLDDIAILTGGTVIRDEVGLTLDKADNTVLGTAAKVVLTKEST  283

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+QDYEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  284   TIVGDGSTQEEVTKRVAQIKNLIEAAEQDYEKEKLNERIAKLAGGVAVIQVGAQTETELK  343

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RAL 
Sbjct  344   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALC  403

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  404   YPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  463

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPE     NPMDNSG+GY
Sbjct  464   ASVAKTFLTSDVVVVEIKEPEAAPLANPMDNSGFGY  499



>ref|XP_008648746.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Zea mays]
Length=623

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/396 (88%), Positives = 376/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  228   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENFLYVVEGMQFDRGYISPYFVTDSEK  287

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRG+
Sbjct  288   MSAEYENCKLLLVDKKITNARDLINVLEEAIRGGYPILIIAEDIEQEALATLVVNKLRGS  347

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S 
Sbjct  348   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEST  407

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+EV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  408   TIVGDGSTQDEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  467

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  468   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  527

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  528   YPLKLIAKNAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  587

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPE     NPMDNSGYGY
Sbjct  588   ASVAKTFLTSDVVVVDIKEPESAPLANPMDNSGYGY  623



>ref|XP_002437709.1| hypothetical protein SORBIDRAFT_10g001120 [Sorghum bicolor]
 gb|EER89076.1| hypothetical protein SORBIDRAFT_10g001120 [Sorghum bicolor]
Length=579

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/396 (88%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  184   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENFLYVVEGMQFDRGYISPYFVTDSEK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  244   MSAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S 
Sbjct  304   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  364   TIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  424   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN KYGYNAATG +EDLMAAGIIDPTKVVRCCLEHA
Sbjct  484   YPLKLIAKNAGVNGSVVTEKVLSNDNFKYGYNAATGQHEDLMAAGIIDPTKVVRCCLEHA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVV+IKEPE     NPMDNSGYGY
Sbjct  544   ASVAKTFLTSDVVVVDIKEPEAAPLANPMDNSGYGY  579



>ref|XP_004964341.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=579

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/396 (88%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN L VVEGMQF+RGYISPYFVTDSEK
Sbjct  184   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENFLYVVEGMQFERGYISPYFVTDSEK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  244   MTAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S 
Sbjct  304   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRVAQIKNLIEVA+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  364   TIVGDGTTQEEVTKRVAQIKNLIEVAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  424   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS++N KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  484   YPLKLIAKNAGVNGSVVTEKVLSNENFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPE     NPMDNSGYGY
Sbjct  544   ASVAKTFLTSDVVVVEIKEPEAAPLTNPMDNSGYGY  579



>ref|NP_001056601.1| Os06g0114000 [Oryza sativa Japonica Group]
 dbj|BAA92724.1| putative chaperonin 60 beta precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18515.1| Os06g0114000 [Oryza sativa Japonica Group]
 gb|ABY52934.1| RuBisCo subunit binding-protein beta subunit [Oryza sativa Japonica 
Group]
 dbj|BAG95015.1| unnamed protein product [Oryza sativa Japonica Group]
Length=601

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/396 (87%), Positives = 376/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQF+RGYISPYFVTDSEK
Sbjct  206   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEK  265

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  266   MSAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  325

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVL K+S 
Sbjct  326   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLNKEST  385

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  386   TIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  445

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+++VDA+K++LENDE+KVGA+IV+RALS
Sbjct  446   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAARVDAIKDNLENDEQKVGAEIVRRALS  505

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  506   YPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  565

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPEP    NPMDNSGYGY
Sbjct  566   ASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYGY  601



>ref|XP_006401314.1| hypothetical protein EUTSA_v10013030mg [Eutrema salsugineum]
 gb|ESQ42767.1| hypothetical protein EUTSA_v10013030mg [Eutrema salsugineum]
Length=597

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/397 (88%), Positives = 371/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKL LVDKKITNARD+IN+LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MCAEYENCKLFLVDKKITNARDIINILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KESL NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKESLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE    AGNPMDNSGYG+
Sbjct  561   SSVAKTFLMSDCVVVEIKEPESAAPAGNPMDNSGYGF  597



>ref|XP_002864459.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40718.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=597

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/397 (88%), Positives = 372/397 (94%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKL LVDKKITNARD+IN+LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MSAEYENCKLFLVDKKITNARDIINILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVEQIKNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE    AGNPMDNSGYG+
Sbjct  561   SSVAKTFLMSDCVVVEIKEPESAAPAGNPMDNSGYGF  597



>ref|NP_001032083.1| chaperonin 60 subunit beta 3 [Arabidopsis thaliana]
 ref|NP_200461.4| chaperonin 60 subunit beta 3 [Arabidopsis thaliana]
 sp|C0Z361.1|CPNB3_ARATH RecName: Full=Chaperonin 60 subunit beta 3, chloroplastic; Short=CPN-60 
beta 3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH57140.1| AT5G56500 [Arabidopsis thaliana]
 gb|AED96773.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
 gb|AED96774.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=597

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/397 (88%), Positives = 371/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKL LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MCAEYENCKLFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE    AGNPMDNSGYG+
Sbjct  561   SSVAKTFLMSDCVVVEIKEPESAAPAGNPMDNSGYGF  597



>emb|CDX75713.1| BnaC03g37960D [Brassica napus]
Length=593

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/393 (89%), Positives = 371/393 (94%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTD+EK
Sbjct  201   SAGNNLEVGNMIAEAMSKVGRKGVVTLEEGKSAENHLYVVEGMQFDRGYISPYFVTDTEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKK+TNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  261   MSVEYENCKLLLVDKKVTNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG+A+KVVLTK+  
Sbjct  321   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKEMT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTQEAVNKRVVQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAV EGIVVGGGCTLLRL++KVDA+K++L NDEEKVGA+IVKRAL 
Sbjct  441   EKKLRVEDALNATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLGNDEEKVGAEIVKRALR  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVL++DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASVAKTFLMSDCVVVEIKEPEPV  GNPMDNSG
Sbjct  561   ASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSG  593



>ref|XP_004964340.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=598

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/396 (88%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN L VVEGMQF+RGYISPYFVTDSEK
Sbjct  203   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENFLYVVEGMQFERGYISPYFVTDSEK  262

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  263   MTAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  322

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S 
Sbjct  323   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKEST  382

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRVAQIKNLIEVA+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  383   TIVGDGTTQEEVTKRVAQIKNLIEVAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELK  442

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALS
Sbjct  443   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALS  502

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS++N KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  503   YPLKLIAKNAGVNGSVVTEKVLSNENFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  562

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPE     NPMDNSGYGY
Sbjct  563   ASVAKTFLTSDVVVVEIKEPEAAPLTNPMDNSGYGY  598



>dbj|BAF00280.1| RuBisCO subunit binding-protein beta subunit precursor [Arabidopsis 
thaliana]
Length=597

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/397 (88%), Positives = 370/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKL LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MCAEYENCKLFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATG YEDLMAA IIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAARIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE    AGNPMDNSGYG+
Sbjct  561   SSVAKTFLMSDCVVVEIKEPESAAPAGNPMDNSGYGF  597



>emb|CDY11918.1| BnaC03g13440D [Brassica napus]
Length=595

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/397 (87%), Positives = 371/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  199   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  258

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCK+ LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQEALATLVVNKLRG 
Sbjct  259   MCAEYENCKMFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEALATLVVNKLRGT  318

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K  ++VLG+A KVVLTKD+ 
Sbjct  319   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGAEVLGNAGKVVLTKDTT  378

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  379   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  438

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KESL NDEEKVGADIVK+ALS
Sbjct  439   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAVKESLANDEEKVGADIVKKALS  498

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  499   YPLKLIAKNAGVNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  558

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEI EPE    AGNPM NSGYG+
Sbjct  559   SSVAKTFLMSDCVVVEINEPESAAPAGNPMGNSGYGF  595



>ref|XP_004235655.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Solanum lycopersicum]
Length=605

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/395 (86%), Positives = 374/395 (95%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEG+ +EN+L VVEGMQFDRGYISPYFVTD+EK
Sbjct  210   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGRGSENNLFVVEGMQFDRGYISPYFVTDNEK  269

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDL+NVLE AI++G+PIL+IAEDIEQEALATLVVNKLRGA
Sbjct  270   MVAEYENCKLLLVDKKITNARDLVNVLEEAIKNGYPILVIAEDIEQEALATLVVNKLRGA  329

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL LD+A S+VLG+AAKVVL+KDS 
Sbjct  330   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLYLDQAGSEVLGNAAKVVLSKDST  389

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQIK L+E A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  390   TIVGDGSTQDAVSKRVAQIKRLLEEAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  449

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAV+EGIVVGGGCTLLRL++KV+ +K +L+NDE+K+GADIVKRAL 
Sbjct  450   EKKLRVEDALNATKAAVDEGIVVGGGCTLLRLAAKVEGIKGTLDNDEQKIGADIVKRALR  509

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLS+DNP YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  510   YPMKLIAKNAGVNGSVVIEKVLSNDNPNYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  569

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVA+TFL SD VV EIK PEP +AGNPMDNSGYG
Sbjct  570   ASVARTFLTSDAVVTEIKVPEPAVAGNPMDNSGYG  604



>sp|P21241.1|RUBB_BRANA RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta; Flags: Precursor [Brassica 
napus]
 gb|AAA32980.1| 60-kDa beta-polypeptide of plastid chaperonin-60 precursor [Brassica 
napus]
Length=588

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/383 (90%), Positives = 367/383 (96%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN+L VVEGMQFDRGY+SPYFVTDSEK
Sbjct  205   SAGNNAEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYVSPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+DNCKLLLVDKKITNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG 
Sbjct  265   MSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGT  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLGHAAKVVLTK+++
Sbjct  325   LKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETS  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGSTQDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K +L+NDEEKVGADIVKRALS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             ASVAKTFLMSDCVVVEIKEPEPV
Sbjct  565   ASVAKTFLMSDCVVVEIKEPEPV  587



>dbj|BAB11583.1| RuBisCO subunit binding-protein beta subunit precursor; chaperonin, 
60 kDa [Arabidopsis thaliana]
Length=596

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/394 (88%), Positives = 368/394 (93%), Gaps = 1/394 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKL LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MCAEYENCKLFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSG  425
             +SVAKTFLMSDCVVVEIKEPE    AGNPMDNSG
Sbjct  561   SSVAKTFLMSDCVVVEIKEPESAAPAGNPMDNSG  594



>ref|XP_006280215.1| hypothetical protein CARUB_v10026123mg [Capsella rubella]
 gb|EOA13113.1| hypothetical protein CARUB_v10026123mg [Capsella rubella]
Length=598

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/397 (87%), Positives = 370/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM++VGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  202   SAGNNYEVGNMIAEAMARVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  261

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKL LVDKKIT+ARD+I +LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  262   MSAEYENCKLFLVDKKITHARDIITILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  321

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  322   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  381

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  382   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  441

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  442   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  501

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  502   YPLKLIAKNAGVNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  561

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVV+IKEPE    AGNPM NSGYG+
Sbjct  562   SSVAKTFLMSDCVVVDIKEPESAAPAGNPMGNSGYGF  598



>ref|XP_009132296.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Brassica 
rapa]
Length=591

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/397 (87%), Positives = 370/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  195   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  254

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCK+ LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQEALATLVVNKLRG 
Sbjct  255   MCAEYENCKMFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEALATLVVNKLRGT  314

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  315   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  374

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  375   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  434

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  435   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  494

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  495   YPLKLIAKNAGVNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  554

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEI EPE    AGNPM NSGYG+
Sbjct  555   SSVAKTFLMSDCVVVEINEPESAAPAGNPMGNSGYGF  591



>ref|XP_006343054.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum tuberosum]
Length=605

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/395 (86%), Positives = 374/395 (95%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEG+ +EN+L VVEGMQFDRGYISPYFVTD+EK
Sbjct  210   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGRGSENNLFVVEGMQFDRGYISPYFVTDNEK  269

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDL+NVLE AI++G+PIL+IAEDIEQEALATLVVNKLRGA
Sbjct  270   MVAEYENCKLLLVDKKITNARDLVNVLEEAIKNGYPILVIAEDIEQEALATLVVNKLRGA  329

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGL LD+A S+VLG+AAKVVL+KDS 
Sbjct  330   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLYLDQAGSEVLGNAAKVVLSKDST  389

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQIK L+E A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  390   TIVGDGSTQDAVSKRVAQIKRLLEEAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  449

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAV+EGIVVGGGCTLLRL++KV+ +K +L+NDE+K+GADIVKRAL 
Sbjct  450   EKKLRVEDALNATKAAVDEGIVVGGGCTLLRLAAKVEDIKGTLDNDEQKIGADIVKRALR  509

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLS+DNP YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  510   YPMKLIAKNAGVNGSVVIEKVLSNDNPNYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  569

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVA+TFL SD VV EIK PEP +AGNPMDNSGYG
Sbjct  570   ASVARTFLTSDAVVTEIKVPEPAVAGNPMDNSGYG  604



>gb|KDO54471.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=595

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/397 (88%), Positives = 368/397 (93%), Gaps = 14/397 (4%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQ          
Sbjct  392   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQ----------  441

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
                LRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  442   ---LRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  498

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  499   YPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  558

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPEP M AGNPMDNSGYGY
Sbjct  559   SSVAKTFLMSDCVVVEIKEPEPAMPAGNPMDNSGYGY  595



>ref|XP_003574065.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brachypodium distachyon]
 ref|XP_010233648.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brachypodium distachyon]
Length=598

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/396 (86%), Positives = 374/396 (94%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGR+GVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  203   SAGNNYEVGNMIAEAMSKVGRQGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  262

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI NARDLI +LE AI+SG+PILIIAEDIEQEALATLVVN+LRGA
Sbjct  263   MTVEYENCKLLLVDKKINNARDLITILEDAIKSGYPILIIAEDIEQEALATLVVNRLRGA  322

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIREE+GLSLDKADS+VLG AAKV++TKD+ 
Sbjct  323   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEIGLSLDKADSEVLGTAAKVLVTKDTT  382

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEVSKRV QIKN IE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  383   TIVGDGSTQEEVSKRVTQIKNQIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  442

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+KE+LENDE+K+GA+IV+++LS
Sbjct  443   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKETLENDEQKIGAEIVRKSLS  502

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL++DN +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  503   YPLKLIAKNAGVNGSVVTEKVLANDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  562

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTF+ SD VVV+IKE E   A NPM  SGYG+
Sbjct  563   ASVAKTFITSDAVVVDIKEAEQAPAANPMAGSGYGF  598



>ref|XP_010451233.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Camelina 
sativa]
Length=598

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/397 (86%), Positives = 369/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  202   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  261

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKL +VDKKIT+ RD++ +LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  262   MSAEYENCKLFIVDKKITHVRDIMTILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  321

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  322   IKVAALKAPGFGERKSQYLDDIATLTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  381

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  382   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  441

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  442   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  501

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  502   YPLKLIAKNAGVNGSVVSEKVLSNDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  561

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVV+IKEPE    AGNPM NSGYG+
Sbjct  562   SSVAKTFLMSDCVVVDIKEPESAAPAGNPMGNSGYGF  598



>emb|CDY36809.1| BnaA03g10770D [Brassica napus]
Length=607

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/397 (87%), Positives = 369/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  195   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  254

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCK+ LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQEALATLVVNKLRG 
Sbjct  255   MCAEYENCKMFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEALATLVVNKLRGT  314

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K  ++VLG+A KVVLTKD+ 
Sbjct  315   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGAEVLGNAGKVVLTKDTT  374

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  375   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  434

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  435   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  494

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSD+PK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  495   YPLKLIAKNAGVNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  554

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEI EPE    AGNPM NSG  +
Sbjct  555   SSVAKTFLMSDCVVVEINEPESAAPAGNPMGNSGLSF  591



>gb|EMS68298.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=776

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/396 (87%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQF+RGYISPYFVTDSEK
Sbjct  381   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEK  440

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  441   MTTEYENCKLLLVDKKITNARDLINVLEEAIRGQYPILIIAEDIEQEALATLVVNKLRGS  500

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERK+QYLDDIAILTGGTVIR+EVGL+LDKAD+ VLG AAKVVLTK+S 
Sbjct  501   LKICAIKAPGFGERKTQYLDDIAILTGGTVIRDEVGLTLDKADNTVLGTAAKVVLTKEST  560

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+QDYEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  561   TIVGDGSTQEEVTKRVAQIKNLIEAAEQDYEKEKLNERIAKLAGGVAVIQVGAQTETELK  620

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++L+NDE+KVGA+IV+RAL 
Sbjct  621   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLDNDEQKVGAEIVRRALC  680

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  681   YPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  740

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPE     NPMDNSG+GY
Sbjct  741   ASVAKTFLTSDVVVVEIKEPEAAPLANPMDNSGFGY  776



>ref|XP_010443301.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Camelina 
sativa]
Length=597

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/397 (86%), Positives = 368/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMEKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKL +VDKKIT+ RD++ +LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MSAEYENCKLFIVDKKITHVRDIMTILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVQQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS++NPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSNENPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVV+IKEPE    AGNPM NSGYG+
Sbjct  561   SSVAKTFLMSDCVVVDIKEPESAAPAGNPMGNSGYGF  597



>ref|XP_010483125.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Camelina 
sativa]
Length=597

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/397 (86%), Positives = 367/397 (92%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMEKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKL +VDKKIT+ RD++ +LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MSAEYENCKLFIVDKKITHVRDIMTILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKVAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKN IE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVKQIKNFIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+L NDEEKVGADIVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLS+DNPK+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSNDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM-AGNPMDNSGYGY  416
             +SVAKTFLMSDCVVV+IKEPE    AGNPM NSGYG+
Sbjct  561   SSVAKTFLMSDCVVVDIKEPESAAPAGNPMGNSGYGF  597



>ref|NP_001045601.1| Os02g0102900 [Oryza sativa Japonica Group]
 dbj|BAD07821.1| putative RuBisCO subunit binding-protein beta subunit, chloroplast 
precursor [Oryza sativa Japonica Group]
 dbj|BAF07515.1| Os02g0102900 [Oryza sativa Japonica Group]
 gb|EEC72294.1| hypothetical protein OsI_05469 [Oryza sativa Indica Group]
 gb|EEE56131.1| hypothetical protein OsJ_05004 [Oryza sativa Japonica Group]
 gb|ADR66967.1| 60 kDa chaperonin beta subunit [Oryza sativa Japonica Group]
Length=598

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/397 (86%), Positives = 374/397 (94%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAM+KVGR+GVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  202   SAGNNYEIGNMIAEAMNKVGRQGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  261

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKI NARDLI +LE AIR G+PILI+ EDIEQEALATLVVN+LRGA
Sbjct  262   MSVEYENCKLLLVDKKINNARDLITILEDAIRGGYPILIVTEDIEQEALATLVVNRLRGA  321

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIREEVGLSLDKAD DVLG AAKVV+TKDS 
Sbjct  322   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEVGLSLDKADRDVLGTAAKVVVTKDST  381

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQ+EV+KRV QIKN IEVA+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  382   TIVGDGTTQDEVNKRVTQIKNQIEVAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  441

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+ E+LENDE+KVGA+IV+++LS
Sbjct  442   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIIETLENDEQKVGAEIVRKSLS  501

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL++DN +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  502   YPLKLIAKNAGVNGSVVTEKVLANDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  561

Query  523   ASVAKTFLMSDCVVVEIKEPE-PVMAGNPMDNSGYGY  416
             ASVAKTF+ SD VVV+IKEPE    AGNPM  SG+G+
Sbjct  562   ASVAKTFITSDAVVVDIKEPEKAAAAGNPMGGSGFGF  598



>ref|XP_001754999.1| predicted protein [Physcomitrella patens]
 gb|EDQ80453.1| predicted protein [Physcomitrella patens]
Length=604

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/396 (85%), Positives = 366/396 (92%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G MIAEAM KVGRKGVVT+EEG+SAEN L VVEGMQFDRGYISPYFVTD EK
Sbjct  209   SAGNNPEIGQMIAEAMGKVGRKGVVTMEEGRSAENHLYVVEGMQFDRGYISPYFVTDPEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNC+LLLVDKKIT ARD+I +LE  IR GFP+LIIAEDIEQEAL+TLVVNKLRG+
Sbjct  269   MSVEYDNCRLLLVDKKITTARDMIGILEETIRGGFPLLIIAEDIEQEALSTLVVNKLRGS  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILT GTVIR+E+GL+LDK  ++VLG AAKVVLTKDS 
Sbjct  329   LKVAALKAPGFGERKSQYLDDIAILTSGTVIRDEIGLALDKVGTEVLGTAAKVVLTKDST  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRVAQI+NLIE+A+Q+YEKEKLNERIAKLSGGVA+IQVGAQTETELK
Sbjct  389   TIVGDGSTQDAVEKRVAQIRNLIEIAEQEYEKEKLNERIAKLSGGVAIIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KESL+NDE+KVGADIVKRAL 
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKESLDNDEQKVGADIVKRALC  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL+++N  +GYNAATG YEDLMAAGIIDP KVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVVEKVLANENSSFGYNAATGVYEDLMAAGIIDPAKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAK FL SD VV EIKEPEPV AGNPMD SGYGY
Sbjct  569   ASVAKIFLTSDVVVTEIKEPEPVQAGNPMDASGYGY  604



>emb|CDY32855.1| BnaC09g33020D [Brassica napus]
Length=594

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/396 (86%), Positives = 367/396 (93%), Gaps = 2/396 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAM+KVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  201   SAGNNYEVGNMIAEAMAKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  260

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKL LVDKKITNARD+I++LE AI+ G+P+LIIAEDIEQE LATLVVNKLRG 
Sbjct  261   MCAEYENCKLFLVDKKITNARDIISILEDAIKGGYPLLIIAEDIEQEPLATLVVNKLRGT  320

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +K+AALKAPGFGERKSQYLDDIA LTG TVIREEVGL L+K   +VLG+A KVVLTKD+ 
Sbjct  321   IKIAALKAPGFGERKSQYLDDIAALTGATVIREEVGLQLEKVGPEVLGNAGKVVLTKDTT  380

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+E V KRV QIKNLIE A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  381   TIVGDGSTEEVVKKRVEQIKNLIEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  440

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K +L NDEEKVGA+IVK+ALS
Sbjct  441   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKATLANDEEKVGAEIVKKALS  500

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEKVLSSDNPK+GYNAATG YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  501   YPLKLIAKNAGVNGSVVSEKVLSSDNPKHGYNAATGKYEDLMSAGIIDPTKVVRCCLEHA  560

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             +SVAKTFLMSDCVVVEIKEPE   A   MDNSGYG+
Sbjct  561   SSVAKTFLMSDCVVVEIKEPES--AAPAMDNSGYGF  594



>ref|XP_001780334.1| predicted protein [Physcomitrella patens]
 gb|EDQ54893.1| predicted protein [Physcomitrella patens]
Length=604

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/396 (85%), Positives = 369/396 (93%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN E+G MIAEAMSKVGRKGVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTD EK
Sbjct  209   SAGNNPEIGQMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDPEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEYDNC+LLLVDKKIT ARD+I +LE  IR GFP+LIIAEDIEQEAL+TLVVNKLRG+
Sbjct  269   MDVEYDNCRLLLVDKKITTARDMIGILEETIRGGFPLLIIAEDIEQEALSTLVVNKLRGS  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILT GTV+R+E+GLSLDK  ++VLG AAKVVLTKDS 
Sbjct  329   LKVAALKAPGFGERKSQYLDDIAILTNGTVVRDELGLSLDKVGTEVLGTAAKVVLTKDST  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V KRVAQI+NLIE+A+Q+YEKEKLNERIAKLSGGVA+IQVGAQTETELK
Sbjct  389   TIVGDGSTQDAVEKRVAQIRNLIEIAEQEYEKEKLNERIAKLSGGVAIIQVGAQTETELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+S+VDA+K++L+NDE+KVG++IV+RALS
Sbjct  449   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASQVDAIKDTLDNDEQKVGSEIVRRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL+++NP +GYNAATG Y+DLMAAGIIDP KVVRCCLEHA
Sbjct  509   YPLKLIAKNAGVNGSVVVEKVLANENPAFGYNAATGEYQDLMAAGIIDPAKVVRCCLEHA  568

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAK FL SD VV EIKEPEPV AGNPMD SGYGY
Sbjct  569   ASVAKIFLTSDVVVTEIKEPEPVPAGNPMDASGYGY  604



>gb|EMT05406.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=932

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/396 (87%), Positives = 375/396 (95%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQF+RGYISPYFVTDSEK
Sbjct  537   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEK  596

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  597   MTTEYENCKLLLVDKKITNARDLINVLEEAIRGQYPILIIAEDIEQEALATLVVNKLRGS  656

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERK+QYLDDIAILTGGTVIR+EVGL+LDKAD+ VLG AAKVVLTK+S 
Sbjct  657   LKICAIKAPGFGERKTQYLDDIAILTGGTVIRDEVGLTLDKADNTVLGTAAKVVLTKEST  716

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEEV+KRVAQIKNLIE A+QDYEKEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  717   TIVGDGSTQEEVTKRVAQIKNLIEAAEQDYEKEKLNERIAKLAGGVAVIQVGAQTETELK  776

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++L+NDE+KVGA+IV+RAL 
Sbjct  777   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLDNDEQKVGAEIVRRALC  836

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  837   YPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  896

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPE     NPMDNSG+GY
Sbjct  897   ASVAKTFLTSDVVVVEIKEPEAAPLANPMDNSGFGY  932



>gb|KCW87049.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=620

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/370 (91%), Positives = 362/370 (98%), Gaps = 0/370 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA+SKVGRKGVVTLEEGKSAENSL VVEGMQFDRGYISPYFVTDSEK
Sbjct  213   SAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEK  272

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR G+P+LI+AEDIEQEALATLVVNKLRGA
Sbjct  273   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGGYPVLIVAEDIEQEALATLVVNKLRGA  332

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIAILTGGTVIREEVGL+LDKA  +VLG+A+KVVLTKD++
Sbjct  333   LKIAAIKAPGFGERKSQYLDDIAILTGGTVIREEVGLTLDKAGKEVLGNASKVVLTKDTS  392

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRVAQI+NLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  393   TIVGDGSTQEVVNKRVAQIRNLIEAAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  452

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+K++LENDEEKVGADIVKRALS
Sbjct  453   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGADIVKRALS  512

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSEK+LS+DNPKYGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  513   YPLKLIAKNAGVNGSVVSEKILSNDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  572

Query  523   ASVAKTFLMS  494
             ASVAKTFL+S
Sbjct  573   ASVAKTFLIS  582



>emb|CDX75715.1| BnaC03g37980D [Brassica napus]
Length=563

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/404 (86%), Positives = 366/404 (91%), Gaps = 11/404 (3%)
 Frame = -2

Query  1603  SAGNNYE---VGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTD  1433
             SAGNN E    GNMIAEAMSKVGRK VVTLEEGKSAEN L VVEGMQFDRGYISPYFVTD
Sbjct  160   SAGNNPEEGIFGNMIAEAMSKVGRKCVVTLEEGKSAENYLYVVEGMQFDRGYISPYFVTD  219

Query  1432  SEKMAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKL  1253
             SEKM+VEY+NCKLLLVDKK+TNARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKL
Sbjct  220   SEKMSVEYENCKLLLVDKKVTNARDLVGVLEYAIRGGYPILIIAEDIEQEALATLVVNKL  279

Query  1252  RGALKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTK  1073
             RG LK+AALK PGFGERKSQYLDDIAILTG TVIREEVGLSLDKA  +VLG A+KVVLTK
Sbjct  280   RGTLKIAALKEPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGTASKVVLTK  339

Query  1072  DSATIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTET  893
             +  TIVGDGSTQE V+KRV QIKNLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTET
Sbjct  340   EMTTIVGDGSTQEAVNKRVVQIKNLIEQAEQEYEKEKLNERIAKLSGGVAVIQVGAQTET  399

Query  892   ELKEKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKR  713
             ELKEKKLRVEDALNATKAAV EGIVVG GCTLLRL++KVDA+K++LENDEEKVGA+IVK 
Sbjct  400   ELKEKKLRVEDALNATKAAVAEGIVVGVGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKI  459

Query  712   ALSYPLKLIAKNAGVNGSVVSEKVL--------SSDNPKYGYNAATGNYEDLMAAGIIDP  557
             ALSYPLKLIAKNAGVNGSVVSEKV         S+DN K+GYNAATG YEDL AAGIIDP
Sbjct  460   ALSYPLKLIAKNAGVNGSVVSEKVTDLTLNLHSSNDNVKFGYNAATGKYEDLTAAGIIDP  519

Query  556   TKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             TKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPV AGNPMDNSG
Sbjct  520   TKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPVPAGNPMDNSG  563



>ref|XP_004951187.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Setaria italica]
Length=599

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/397 (84%), Positives = 369/397 (93%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GN+IAEAM+KVGR+GVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  203   SAGNNYEIGNIIAEAMAKVGRQGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  262

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI NARDLI +LE AIR G+PILI+AEDIEQEALATLVVN+LRGA
Sbjct  263   MTVEYENCKLLLVDKKINNARDLITILEDAIRGGYPILIVAEDIEQEALATLVVNRLRGA  322

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIR+EVGLSLDKAD +VLG AAKVV+TKDS 
Sbjct  323   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIRDEVGLSLDKADKEVLGTAAKVVVTKDST  382

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRV QIKN IE  DQ+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  383   TIVGDGTTQEEVNKRVMQIKNQIEATDQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  442

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+ E+L+NDE+KVGA+IV+++LS
Sbjct  443   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIIETLDNDEQKVGAEIVRKSLS  502

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL++ N +YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  503   YPLKLIAKNAGVNGSVVIEKVLANKNFRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  562

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM-DNSGYGY  416
             ASVAKTF+ SD VVV+I+ PE   A NPM   SG+G+
Sbjct  563   ASVAKTFITSDAVVVDIQVPEQAPAANPMGGGSGFGF  599



>gb|EMT19476.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=654

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/422 (80%), Positives = 373/422 (88%), Gaps = 26/422 (6%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGR+GVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  233   SAGNNYEIGNMIAEAMSKVGRQGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  292

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKI NARDLI +LE AI+ G+PILIIAEDIEQEALATLVVN+LRGA
Sbjct  293   MSVEYENCKLLLVDKKINNARDLITILEEAIKGGYPILIIAEDIEQEALATLVVNRLRGA  352

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGG--------------------------TVIREE  1142
             LK+AA+KAPGFGERKSQYLDDIA LTGG                          TVIREE
Sbjct  353   LKIAAIKAPGFGERKSQYLDDIATLTGGKFNLWCKFDVSRCDIGSLIKVIIRPGTVIREE  412

Query  1141  VGLSLDKADSDVLGHAAKVVLTKDSATIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEK  962
             +GLSLDKAD +VLG+AAKVV+TKDS TIVGDG+TQEEV++RV QIKN IE ++Q+YEKEK
Sbjct  413   IGLSLDKADKEVLGNAAKVVITKDSTTIVGDGTTQEEVTRRVTQIKNQIEASEQEYEKEK  472

Query  961   LNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAveegivvggGCTLLRLSS  782
             LNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+S
Sbjct  473   LNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAS  532

Query  781   KVDALKESLENDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAA  602
             KVDA+KE+LENDE+KVGA+IV+++LSYPLKLIAKNAGVNGSVV+EKVL +DN +YGYNAA
Sbjct  533   KVDAIKETLENDEQKVGAEIVRKSLSYPLKLIAKNAGVNGSVVTEKVLVNDNFRYGYNAA  592

Query  601   TGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGY  422
             TG YEDLMAAGIIDPTKVVRCCLEHAASVAKTF+ SD VVV+IKE E   A NPM  SGY
Sbjct  593   TGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSDAVVVDIKESEQAPAANPMAGSGY  652

Query  421   GY  416
             G+
Sbjct  653   GF  654



>gb|AFW66837.1| putative TCP-1/cpn60 chaperonin family protein isoform 1 [Zea 
mays]
 gb|AFW66838.1| putative TCP-1/cpn60 chaperonin family protein isoform 2 [Zea 
mays]
Length=605

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/401 (83%), Positives = 367/401 (92%), Gaps = 5/401 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAM KVGR+GVVTLEEGKSAEN+L  VEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNYEIGNMIAEAMKKVGRQGVVTLEEGKSAENNLYSVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI NARDLI +LE AIRSG+PILI+AEDIEQEALATLVVN+LRGA
Sbjct  265   MTVEYENCKLLLVDKKINNARDLITILEDAIRSGYPILIVAEDIEQEALATLVVNRLRGA  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIREEVGLSLDKAD+ VLG AAKVV+TKDS 
Sbjct  325   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEVGLSLDKADNAVLGTAAKVVVTKDST  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRV QIKN IE  +Q+YE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGTTQEEVNKRVTQIKNQIEATEQEYEREKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+ E+LENDE+KVGA+IV+++LS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIIETLENDEQKVGAEIVRKSLS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL+++N +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVTEKVLANENFRYGYNAATGEYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIK--EPEPVMAGNPM---DNSGYGY  416
             ASVAKTF+ SD VVV+ K  E  P    NPM     SG+G+
Sbjct  565   ASVAKTFITSDAVVVDAKVAEQAPSSPANPMAMGGGSGFGF  605



>gb|ACG36615.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
Length=605

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/401 (83%), Positives = 365/401 (91%), Gaps = 5/401 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMI EAM KVGR+GVVTLEEGKSAEN+L  VEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNYEIGNMITEAMKKVGRQGVVTLEEGKSAENNLYSVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI NARDLI +LE AIRSG+PILI+AEDIEQEALATLVVN+LRGA
Sbjct  265   MTVEYENCKLLLVDKKINNARDLITILEDAIRSGYPILIVAEDIEQEALATLVVNRLRGA  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIREEVGLSLDKAD+ VLG AAKVV+TKDS 
Sbjct  325   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEVGLSLDKADNAVLGTAAKVVVTKDST  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRV QIKN IE  +Q+YE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGTTQEEVNKRVTQIKNQIEATEQEYEREKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SK DA+ E+LENDE+KVGA+IV+++LS
Sbjct  445   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKFDAIIETLENDEQKVGAEIVRKSLS  504

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL+++N +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  505   YPLKLIAKNAGVNGSVVTEKVLANENFRYGYNAATGEYEDLMAAGIIDPTKVVRCCLEHA  564

Query  523   ASVAKTFLMSDCVVVEIK--EPEPVMAGNPM---DNSGYGY  416
             ASVAKTF+ SD VVV+ K  E  P    NPM     SG+G+
Sbjct  565   ASVAKTFITSDAVVVDAKVAEQAPSSPANPMAMGGGSGFGF  605



>gb|EMS63178.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=561

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/396 (83%), Positives = 362/396 (91%), Gaps = 13/396 (3%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIA+AMSKVGR+GVVTLEEGKSAEN+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  179   SAGNNYEIGNMIADAMSKVGRQGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEK  238

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKI NARDLI +LE AI+ G+PILIIAEDIEQEALATLVVN+LRGA
Sbjct  239   MSVEYENCKLLLVDKKINNARDLITLLEDAIKGGYPILIIAEDIEQEALATLVVNRLRGA  298

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIREE+GLSLDKAD +VLG+AAKVV+TKDS 
Sbjct  299   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEIGLSLDKADKEVLGNAAKVVITKDST  358

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEE S             +Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  359   TIVGDGTTQEEAS-------------EQEYEKEKLNERIAKLSGGVAVIQVGAQTETELK  405

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVDA+KE+LENDE+KVGA+IV+++LS
Sbjct  406   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEQKVGAEIVRKSLS  465

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL +DN +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  466   YPLKLIAKNAGVNGSVVTEKVLVNDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  525

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTF+ SD VVV+IKE E   A NPM  SGYG+
Sbjct  526   ASVAKTFITSDAVVVDIKESEQAPAANPMAGSGYGF  561



>ref|NP_001146890.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
 gb|ACG24216.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
Length=604

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/401 (82%), Positives = 363/401 (91%), Gaps = 6/401 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAM KVGR+GVVTLEEGKSAEN+L  VEGMQFDRGYISPYFVTDSEK
Sbjct  205   SAGNNYEIGNMIAEAMKKVGRQGVVTLEEGKSAENNLYSVEGMQFDRGYISPYFVTDSEK  264

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI NARDLI +LE AIRSG+PILI+AEDIEQEALATLVVN+LRGA
Sbjct  265   MTVEYENCKLLLVDKKINNARDLITILEDAIRSGYPILIVAEDIEQEALATLVVNRLRGA  324

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERKSQYLDDIA LTGGTVIREEVGLSLDKAD+ VLG AAKVV+TKDS 
Sbjct  325   LKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEVGLSLDKADNAVLGTAAKVVVTKDST  384

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG+TQEEV+KRV QIKN IE  +Q+YE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  385   TIVGDGTTQEEVNKRVTQIKNQIEATEQEYEREKLNERIAKLSGGVAVIQVGAQTETELK  444

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAA  E  +VGGGCTLLRL+SKVDA+ E+LENDE+KVGA+IV+++LS
Sbjct  445   EKKLRVEDALNATKAA-VEEGIVGGGCTLLRLASKVDAIIETLENDEQKVGAEIVRKSLS  503

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVL+++N +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  504   YPLKLIAKNAGVNGSVVTEKVLANENFRYGYNAATGEYEDLMAAGIIDPTKVVRCCLEHA  563

Query  523   ASVAKTFLMSDCVVVEIK--EPEPVMAGNPM---DNSGYGY  416
             ASVAKTF+ SD VVV+ K  E  P    NPM     SG+G+
Sbjct  564   ASVAKTFITSDAVVVDAKVAEQAPSSPANPMAMGGGSGFGF  604



>ref|XP_001754571.1| predicted protein [Physcomitrella patens]
 gb|EDQ80541.1| predicted protein [Physcomitrella patens]
Length=548

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/393 (83%), Positives = 359/393 (91%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG MIAEAMSKVGR+GVVTLEEGKS+ENSL VVEGMQFDRGYISPYFVTD EK
Sbjct  155   SAGNNPEVGQMIAEAMSKVGRRGVVTLEEGKSSENSLYVVEGMQFDRGYISPYFVTDPEK  214

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEYDNC+LLLVDKKI  ARD+I +LE +IR GFP+LIIAEDIEQEAL+TLVVNKLRG+
Sbjct  215   MSVEYDNCRLLLVDKKIVTARDMIGILEESIRGGFPLLIIAEDIEQEALSTLVVNKLRGS  274

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAALKAPGFGERKSQYLDDIAILT  TVIR+E GL+LDK  ++VLG AAKVVLTKD+ 
Sbjct  275   LKVAALKAPGFGERKSQYLDDIAILTNATVIRDETGLALDKVGTEVLGTAAKVVLTKDAT  334

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VS+RV QI+NLIEVA+Q+YEKEKLNERIAKLSGGVA+IQVGAQTETELK
Sbjct  335   TIVGDGSTQDAVSRRVNQIRNLIEVAEQEYEKEKLNERIAKLSGGVAIIQVGAQTETELK  394

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKV A+  +L+NDE++VGA+IV+RAL 
Sbjct  395   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVSAIVSTLDNDEQRVGAEIVRRALC  454

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV EKVL++ NP +GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  455   YPLKLIAKNAGVNGSVVVEKVLANSNPSFGYNAATGVYEDLMAAGIIDPTKVVRCCLEHA  514

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASVAK FL SD VV EIKE E  +AGNPMD SG
Sbjct  515   ASVAKIFLTSDVVVTEIKEAEVAVAGNPMDASG  547



>ref|XP_002964742.1| hypothetical protein SELMODRAFT_142800 [Selaginella moellendorffii]
 gb|EFJ33580.1| hypothetical protein SELMODRAFT_142800 [Selaginella moellendorffii]
Length=603

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/397 (81%), Positives = 366/397 (92%), Gaps = 1/397 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+G+MIAEAM +VGRKGVVTLEEG+SAE++L+ VEGMQFDRGYISPYFVTD+EK
Sbjct  207   SAGNNYEIGDMIAEAMKRVGRKGVVTLEEGRSAESTLQFVEGMQFDRGYISPYFVTDTEK  266

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY NCKLLLVDKKITNARD++++LE AIR+G P+LIIAEDIEQEALATLVVN++RG 
Sbjct  267   MAVEYQNCKLLLVDKKITNARDIVSILEDAIRAGSPLLIIAEDIEQEALATLVVNRIRGN  326

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAPGFGERKSQYL+DIA LTGGTV+++EVGL LDK  S+VLG A+KVV+TKD +
Sbjct  327   LKVAAIKAPGFGERKSQYLEDIATLTGGTVVKDEVGLQLDKVGSEVLGTASKVVITKDYS  386

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRV QIKN +E  +QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  387   TIVGDGSTQEAVSKRVNQIKNQLEATEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  446

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGG  LLRLSSKVDA+K++LENDE+K+GA+IV++ALS
Sbjct  447   EKKLRVEDALNATKAAVEEGIVVGGGIALLRLSSKVDAIKDTLENDEQKIGAEIVRKALS  506

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSV+ EKVL+ DN  +GYNAATG +E+LMAAGIIDPTKVVRCCLEHA
Sbjct  507   YPVKLIAKNAGVNGSVIVEKVLADDNFNHGYNAATGAFENLMAAGIIDPTKVVRCCLEHA  566

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYGY  416
              SVA+TFL SD VVV I EPEP V AGNPMDNSGYGY
Sbjct  567   GSVARTFLTSDAVVVSIPEPEPAVPAGNPMDNSGYGY  603



>emb|CDX86994.1| BnaC03g52640D [Brassica napus]
Length=702

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/376 (88%), Positives = 354/376 (94%), Gaps = 0/376 (0%)
 Frame = -2

Query  1549  VGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEKMAVEYDNCKLLLVDKKIT  1370
             +GRK VVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEKM+VEY+NCKLLLVDKK+T
Sbjct  38    LGRKCVVTLEEGKSAENYLYVVEGMQFDRGYISPYFVTDSEKMSVEYENCKLLLVDKKVT  97

Query  1369  NARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGALKVAALKAPGFGERKSQY  1190
             NARDL+ VLE AIR G+PILIIAEDIEQEALATLVVNKLRG LK+AALK PGFGERKSQY
Sbjct  98    NARDLVGVLEYAIRGGYPILIIAEDIEQEALATLVVNKLRGTLKIAALKEPGFGERKSQY  157

Query  1189  LDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSATIVGDGSTQEEVSKRVAQ  1010
             LDDIAILTG TVIREEVGLSLDKA  +VLG+ +KVVLTK+  TIVGDGSTQE V+KRV Q
Sbjct  158   LDDIAILTGATVIREEVGLSLDKAAQEVLGNVSKVVLTKEMTTIVGDGSTQEAVNKRVVQ  217

Query  1009  IKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAve  830
             IKNLIE A+Q+YEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAV 
Sbjct  218   IKNLIEQAEQEYEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVA  277

Query  829   egivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVS  650
             EGIVVGGGCTLLRL++KVDA+K++LENDEEKVGA+IVKRALSYPLKLIAKNAGVNGSVVS
Sbjct  278   EGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAGVNGSVVS  337

Query  649   EKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIK  470
             EKVL++DN K+GYNAATG YEDLM AGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIK
Sbjct  338   EKVLANDNVKFGYNAATGKYEDLMVAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIK  397

Query  469   EPEPVMAGNPMDNSGY  422
             EPEPV AGNPMDNSGY
Sbjct  398   EPEPVPAGNPMDNSGY  413



>ref|XP_002961675.1| hypothetical protein SELMODRAFT_165043 [Selaginella moellendorffii]
 gb|EFJ36935.1| hypothetical protein SELMODRAFT_165043 [Selaginella moellendorffii]
Length=607

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/394 (81%), Positives = 363/394 (92%), Gaps = 1/394 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+G+MIAEAM +VGRKGVVTLEEG+SAE++L+ VEGMQFDRGYISPYFVTD+EK
Sbjct  207   SAGNNYEIGDMIAEAMKRVGRKGVVTLEEGRSAESTLQFVEGMQFDRGYISPYFVTDTEK  266

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY NCKLLLVDKKITNARD++++LE AIR+G P+LIIAEDIEQEALATLVVN++RG 
Sbjct  267   MAVEYQNCKLLLVDKKITNARDIVSILEDAIRAGSPLLIIAEDIEQEALATLVVNRIRGN  326

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAPGFGERKSQYL+DIA LTGGTV+++EVGL LDK  S+VLG A+KVV+TKD +
Sbjct  327   LKVAAIKAPGFGERKSQYLEDIATLTGGTVVKDEVGLQLDKVGSEVLGTASKVVITKDYS  386

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE VSKRV QIKN +E  +QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  387   TIVGDGSTQEAVSKRVNQIKNQLEATEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  446

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGG  LLRLSSKVDA+K++LENDE+K+GA+IV++ALS
Sbjct  447   EKKLRVEDALNATKAAVEEGIVVGGGIALLRLSSKVDAIKDTLENDEQKIGAEIVRKALS  506

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSV+ EKVL+ DN  +GYNAATG +E+LMAAGIIDPTKVVRCCLEHA
Sbjct  507   YPVKLIAKNAGVNGSVIVEKVLADDNFNHGYNAATGAFENLMAAGIIDPTKVVRCCLEHA  566

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSG  425
              SVA+TFL SD VVV I EPEP V AGNPMDNSG
Sbjct  567   GSVARTFLTSDAVVVSIPEPEPAVPAGNPMDNSG  600



>gb|EEE64974.1| hypothetical protein OsJ_19883 [Oryza sativa Japonica Group]
Length=588

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/396 (83%), Positives = 361/396 (91%), Gaps = 13/396 (3%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN+L VVEGMQF+RGYISPYFVTDSEK
Sbjct  206   SAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEK  265

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRG+
Sbjct  266   MSAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNKLRGS  325

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVL K+S 
Sbjct  326   LKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLNKEST  385

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQEE +++  +             KEKLNERIAKL+GGVAVIQVGAQTETELK
Sbjct  386   TIVGDGSTQEEAAEQEYE-------------KEKLNERIAKLAGGVAVIQVGAQTETELK  432

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+++VDA+K++LENDE+KVGA+IV+RALS
Sbjct  433   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAARVDAIKDNLENDEQKVGAEIVRRALS  492

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVV+EKVLS+DN K+GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  493   YPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHA  552

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTFL SD VVVEIKEPEP    NPMDNSGYGY
Sbjct  553   ASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYGY  588



>ref|XP_002966190.1| hypothetical protein SELMODRAFT_168153 [Selaginella moellendorffii]
 gb|EFJ32217.1| hypothetical protein SELMODRAFT_168153 [Selaginella moellendorffii]
Length=550

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/397 (80%), Positives = 358/397 (90%), Gaps = 3/397 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG MIAEAM+KVGRKGVVTLEEGKSAEN+L VVEGMQF+RGY+SPYFVTD++K
Sbjct  151   SAGNNDEVGKMIAEAMNKVGRKGVVTLEEGKSAENTLHVVEGMQFERGYMSPYFVTDTDK  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEYDNCKLLLVD+KI  ARD+I +LE AIR G+P++I+AE+IEQEALATLVVN+LRG+
Sbjct  211   MAVEYDNCKLLLVDRKIATARDVIGILEDAIRGGYPLMIMAEEIEQEALATLVVNRLRGS  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERK+QYL+DIAILTGGTV+REEVGLSLDK   +VLG+AAK+V+TKDS 
Sbjct  271   LKIVAIKAPGFGERKTQYLEDIAILTGGTVVREEVGLSLDKVGREVLGNAAKLVVTKDST  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QI+NL+EVA+Q YEKEKLNERIAKLSGGVAV+ VGAQTETELK
Sbjct  331   TIVGDGSTQEAVTKRVTQIRNLMEVAEQSYEKEKLNERIAKLSGGVAVVTVGAQTETELK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGG  LLRLS KVDA+KE+LEN E+K+GADIVKRAL 
Sbjct  391   EKKLRVEDALNATKAAVEEGIVVGGGTALLRLSKKVDAIKETLENQEQKIGADIVKRALG  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVL++DN  +GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  451   YPIKLIAKNAGVNGSVVVEKVLANDNFNFGYNAATGTYEDLMAAGIIDPTKVVRCCLEHA  510

Query  523   ASVAKTFLMSDCVVVEIKE---PEPVMAGNPMDNSGY  422
              SVAKTFL SD VVV+IKE   P     G  MDNSGY
Sbjct  511   GSVAKTFLTSDVVVVDIKEEFIPTGAAQGMAMDNSGY  547



>ref|XP_002982262.1| hypothetical protein SELMODRAFT_271545 [Selaginella moellendorffii]
 gb|EFJ16507.1| hypothetical protein SELMODRAFT_271545 [Selaginella moellendorffii]
Length=598

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/397 (80%), Positives = 357/397 (90%), Gaps = 3/397 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN EVG MIAEAM+KVGRKGVVTLEEGKSAEN+L VVEGMQF+RGY+SPYFVTD++K
Sbjct  199   SAGNNDEVGKMIAEAMNKVGRKGVVTLEEGKSAENTLHVVEGMQFERGYMSPYFVTDTDK  258

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEYDNCKLLLVD+KI  ARD+I +LE AIR G+P++I+AE+IEQEALATLVVN+LRG+
Sbjct  259   MAVEYDNCKLLLVDRKIATARDVIGILEDAIRGGYPLMIMAEEIEQEALATLVVNRLRGS  318

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERK+QYL+DIAILTGGTV+REEVGLSLDK   +VLG AAK+V+TKDS 
Sbjct  319   LKIVAIKAPGFGERKTQYLEDIAILTGGTVVREEVGLSLDKVGREVLGTAAKLVVTKDST  378

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V+KRV QI+NL+EVA+Q YEKEKLNERIAKLSGGVAV+ VGAQTETELK
Sbjct  379   TIVGDGSTQEAVTKRVTQIRNLMEVAEQSYEKEKLNERIAKLSGGVAVVTVGAQTETELK  438

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGG  LLRLS KVDA+KE+LEN E+K+GADIVKRAL 
Sbjct  439   EKKLRVEDALNATKAAVEEGIVVGGGTALLRLSKKVDAIKETLENQEQKIGADIVKRALG  498

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVL++DN  +GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  499   YPIKLIAKNAGVNGSVVVEKVLANDNFNFGYNAATGTYEDLMAAGIIDPTKVVRCCLEHA  558

Query  523   ASVAKTFLMSDCVVVEIKE---PEPVMAGNPMDNSGY  422
              SVAKTFL SD VVV+IKE   P     G  MDNSGY
Sbjct  559   GSVAKTFLTSDVVVVDIKEEFIPTGAAQGMAMDNSGY  595



>gb|KDO54475.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=571

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/357 (91%), Positives = 341/357 (96%), Gaps = 1/357 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  511

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCL  533
             YPLKLIAKNAGVNGSVVSEKVLSSDN KYGYNAATGNYEDLMAAGIIDPTK V CC+
Sbjct  512   YPLKLIAKNAGVNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTK-VSCCI  567



>ref|XP_010691436.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=610

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/394 (79%), Positives = 357/394 (91%), Gaps = 0/394 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNY++GNM+A+A+ KVGRKG+VTLEEG S+ +SL VVEGMQFDRGY SPYFVTDSEK
Sbjct  214   SAGNNYQIGNMVADALGKVGRKGIVTLEEGTSSSDSLYVVEGMQFDRGYFSPYFVTDSEK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKIT ARDL+NVLE AI++ + ++I+AEDIEQE LATLVVNKLRG+
Sbjct  274   MIVEYENCKLLLVDKKITTARDLVNVLEDAIKNNYAVVIMAEDIEQEPLATLVVNKLRGS  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AA+KAPGFG+R+ QY+DDIAILTGGTVIR+EVGLSLDK   +VLGHAAK+VLTK++A
Sbjct  334   LKIAAMKAPGFGDRRQQYMDDIAILTGGTVIRDEVGLSLDKVGKEVLGHAAKIVLTKETA  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V +R+AQIK L+E  D +YEK+KLNERIAKLS GVAVIQVGAQ+ETELK
Sbjct  394   TIVGDGSTQEAVVRRIAQIKKLVEDVDSNYEKDKLNERIAKLSSGVAVIQVGAQSETELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             E+KLRVEDAL ATKAAVEEGIVVGGGCTLLRLS+KVDA++E LEN+E+K+GADIVKRALS
Sbjct  454   ERKLRVEDALCATKAAVEEGIVVGGGCTLLRLSTKVDAIRERLENNEQKLGADIVKRALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPL LIAKNAGVNG+VV EKVLS+D+  +GYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  514   YPLDLIAKNAGVNGAVVIEKVLSNDDQNFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  573

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGY  422
             ASVAKTFL SD VV EI EPE   A NPMDNSG+
Sbjct  574   ASVAKTFLTSDAVVTEIPEPELAPAANPMDNSGF  607



>gb|EMT33855.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=659

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/396 (78%), Positives = 356/396 (90%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GN+IA+A+SKVGR GVVTLEEGKS+ENSL VVEGM+FDRGYISPYFVTD E+
Sbjct  264   SAGNDYAIGNIIADAVSKVGRHGVVTLEEGKSSENSLYVVEGMRFDRGYISPYFVTDGER  323

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI +A+DLI +LE AI SG+P+LIIAEDIEQEALA LV+N+LRG+
Sbjct  324   MTVEYNNCKLLLVDKKINSAKDLIAILEDAITSGYPVLIIAEDIEQEALAALVLNRLRGS  383

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L++AA++APGFGER+SQYLDDIA LTGGTVIR+E G+ L KAD  VLG AAKVV+TKDS 
Sbjct  384   LQIAAIRAPGFGERRSQYLDDIATLTGGTVIRDEFGVPLHKADKTVLGTAAKVVITKDST  443

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TI+GDG+TQEEV KRV QIKN IE  + +YEKEKL ERIAKL GGVA+IQVGAQTETELK
Sbjct  444   TIIGDGTTQEEVIKRVTQIKNQIEATEHEYEKEKLKERIAKLYGGVAIIQVGAQTETELK  503

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTL+RL+SKVDA+K++LENDE+KVGA+IV+++LS
Sbjct  504   EKKLRVEDALNATKAAVEEGIVVGGGCTLVRLASKVDAIKQTLENDEQKVGAEIVRKSLS  563

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIA+NAG+NGSVV EKVL+ DN  YGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA
Sbjct  564   YPLKLIAENAGINGSVVIEKVLAIDNSSYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  623

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTF+ SD VVV+I+ P+     NPM  SGYG+
Sbjct  624   ASVAKTFITSDAVVVDIRAPKCAPVVNPMCGSGYGF  659



>dbj|BAK07904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/396 (77%), Positives = 355/396 (90%), Gaps = 0/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMIA+A++KVGR GVVTLEEGKS+ENSL VVEGM+FDRGYISPYFVTD EK
Sbjct  203   SAGNDYAIGNMIADAVNKVGRHGVVTLEEGKSSENSLYVVEGMRFDRGYISPYFVTDGEK  262

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+ CKLLLVDKKI +A+DLI +LE AI SG+P+LIIAEDIEQEALA LV+N+LRG+
Sbjct  263   MTVEYNKCKLLLVDKKINSAKDLIAILEDAITSGYPVLIIAEDIEQEALAALVLNRLRGS  322

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L++AA++APGFGER+SQYLDDIA LTGGTVIR+E G+ L KAD  VLG AAKVV+TKDS 
Sbjct  323   LQIAAIRAPGFGERRSQYLDDIATLTGGTVIRDEFGVPLHKADKTVLGTAAKVVITKDST  382

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TI+GDG+TQEEV KRV QIKN IE  + +YE+EKL ERIAKL GGVAVIQVGAQTETELK
Sbjct  383   TIIGDGTTQEEVIKRVTQIKNQIEATEHEYEREKLKERIAKLYGGVAVIQVGAQTETELK  442

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAA+EEGIVVGGGCTL+RL+SKVDA+K++LENDE++VGA+IV+++LS
Sbjct  443   EKKLRVEDALNATKAAIEEGIVVGGGCTLVRLASKVDAIKQTLENDEQRVGAEIVRKSLS  502

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIA+NAGVNGSVV EKVL+ DN +YGYNAATG YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  503   YPLKLIAENAGVNGSVVIEKVLAIDNSRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHA  562

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             ASVAKTF+ SD VVV+I+ P+     NPM  SGYG+
Sbjct  563   ASVAKTFITSDAVVVDIRVPKCTPVVNPMCGSGYGF  598



>gb|EMS56406.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=617

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/404 (76%), Positives = 355/404 (88%), Gaps = 8/404 (2%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMIA+A+SKVGR GVVTLEEGKS+ENSL VVEGM+FDRGYISPYFVTD E+
Sbjct  214   SAGNDYAIGNMIADAVSKVGRHGVVTLEEGKSSENSLYVVEGMRFDRGYISPYFVTDGER  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEY+NCKLLLVDKKI +A+DLI +LE AI SG+P+LIIAEDIEQEALA LV+N+LRG+
Sbjct  274   MTVEYNNCKLLLVDKKINSAKDLITILEDAITSGYPVLIIAEDIEQEALAALVLNRLRGS  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTG--------GTVIREEVGLSLDKADSDVLGHAAK  1088
             L++AA++APGFGER+SQYLDDIA LTG        GTVIR+E G+ L KAD  VLG AAK
Sbjct  334   LQIAAIRAPGFGERRSQYLDDIATLTGVITVNLHVGTVIRDEFGVPLHKADKTVLGTAAK  393

Query  1087  VVLTKDSATIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVG  908
             VV+TKDS TI+GDG+TQEEV KRV QIKN IE  + +YEKEKL ERIAKL GGVA+IQVG
Sbjct  394   VVITKDSTTIIGDGTTQEEVIKRVTQIKNQIEATEHEYEKEKLKERIAKLYGGVAIIQVG  453

Query  907   AQTETELKEKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGA  728
             AQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTL+RL+SKVDA+K++LENDE+KVGA
Sbjct  454   AQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLIRLASKVDAIKQTLENDEQKVGA  513

Query  727   DIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKV  548
             +IV+++LSYPLKLIAKNAG+NGSVV EKVL+ DN  YGYNAATG YEDLMAAGIIDPTKV
Sbjct  514   EIVRKSLSYPLKLIAKNAGINGSVVIEKVLAIDNSSYGYNAATGKYEDLMAAGIIDPTKV  573

Query  547   VRCCLEHAASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
             VRCCLEHAASVAKTF+ SD VVV+I+ P+     NPM  SGYG+
Sbjct  574   VRCCLEHAASVAKTFITSDAVVVDIRAPKCAPVVNPMCGSGYGF  617



>emb|CDO97994.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/351 (87%), Positives = 331/351 (94%), Gaps = 7/351 (2%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGK ++N+L VVEGMQFDRGYISPYFVTDSEK
Sbjct  214   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKGSDNNLYVVEGMQFDRGYISPYFVTDSEK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MA       LLLVDKKITNARDLI++LE  IR G+PILIIAEDIEQEALATLVVNKLRGA
Sbjct  274   MA-------LLLVDKKITNARDLISILEDGIRGGYPILIIAEDIEQEALATLVVNKLRGA  326

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFG+RKSQYLDDIAILTGGTVIREEVGLS+DK  S+VLGHAAKVVLTK+  
Sbjct  327   LKIAALKAPGFGDRKSQYLDDIAILTGGTVIREEVGLSVDKVGSEVLGHAAKVVLTKEMT  386

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ V+KRVAQIKNL+E A+QDYEKEKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  387   TIVGDGSTQDAVNKRVAQIKNLVEAAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  446

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL++KVDA+K+SL+NDE+KVGADIVKRALS
Sbjct  447   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDSLDNDEQKVGADIVKRALS  506

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTK  551
             YP+KLIAKNAGVNGSVV EKVLSS+N K+GYNAATGNYEDLMAAGIIDPTK
Sbjct  507   YPMKLIAKNAGVNGSVVIEKVLSSENVKFGYNAATGNYEDLMAAGIIDPTK  557



>ref|XP_001418926.1| chaperonin 60 beta chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO97219.1| chaperonin 60 beta chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
Length=594

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/396 (72%), Positives = 338/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N EVG MIA AM+KVGRKGV++LEE +S +N+L VVEGMQFDRGYISPYFVTD E+
Sbjct  198   SAGGNMEVGEMIAAAMAKVGRKGVISLEEARSVDNNLIVVEGMQFDRGYISPYFVTDPER  257

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M   YD CKLLLVDKKI+ ARD+I +LE+AI+ GFP++IIAEDIEQEALATLVVNKLRG+
Sbjct  258   MTCVYDQCKLLLVDKKISTARDMIGILEAAIQQGFPLMIIAEDIEQEALATLVVNKLRGS  317

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERKSQYL+DIAILTGGTV++EE+GLSLDK   +VLG+AA+V L K+S 
Sbjct  318   LKITAIKAPGFGERKSQYLEDIAILTGGTVVKEELGLSLDKCGVEVLGNAARVELGKEST  377

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVG G T  EV+ RV QI  L+E  + DYEKEKLNER A+LSGGVA+IQVGAQTETELK
Sbjct  378   TIVGAGDTAAEVAARVKQINRLVEATEADYEKEKLNERAARLSGGVAIIQVGAQTETELK  437

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATK+AVEEGIV+GGGCT L+L++ VD +K +LENDE++VGADI+KRALS
Sbjct  438   EKKLRVEDALNATKSAVEEGIVIGGGCTFLKLAAAVDEIKATLENDEQRVGADIIKRALS  497

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++L+A NAGVNGSV  EKV+SS +P +GYNAATG YEDLM  G++DPTKV+RC LE+A
Sbjct  498   YPIRLVAHNAGVNGSVACEKVMSSKDPNFGYNAATGEYEDLMKGGVLDPTKVIRCSLENA  557

Query  523   ASVAKTFLMSDCVVVEIKE-PEPVMAGNPMDNSGYG  419
              SVAK FL SD VV EI E  EP   G+PMDNSGYG
Sbjct  558   CSVAKIFLTSDVVVCEIPEDEEPAAGGSPMDNSGYG  593



>ref|XP_003057879.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57830.1| predicted protein [Micromonas pusilla CCMP1545]
Length=593

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/395 (72%), Positives = 342/395 (87%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N EVG MI++AM KVGR GV+TLEE +S +N+L VVEGMQFDRGY+SPYFVTDSE+
Sbjct  198   SAGGNMEVGTMISDAMEKVGRSGVITLEEARSVDNNLIVVEGMQFDRGYVSPYFVTDSER  257

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  +YDNCKLLLVDKKI +ARD+I +LE AI+ GFP+LIIAEDIEQEALATLVVNKLRGA
Sbjct  258   MTCDYDNCKLLLVDKKIKSARDMITILEEAIKVGFPLLIIAEDIEQEALATLVVNKLRGA  317

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ ALKAPGFGERKSQYL+DIAILTGGTV+++E+GLSLDK   +VLG+AA+V L K+S 
Sbjct  318   LKICALKAPGFGERKSQYLEDIAILTGGTVVKDELGLSLDKVGVEVLGNAARVELGKESC  377

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ EV+ RV QI  L+E A+ DYEKEKLNER A+LSGGVA+IQVGAQTETELK
Sbjct  378   TIVGDGSTQLEVAARVKQINRLMEAAEADYEKEKLNERAARLSGGVAIIQVGAQTETELK  437

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGGCTLL+L++ V+ +K +L N+E+K+GADI+++AL+
Sbjct  438   EKKLRVEDALNATKAAVEEGIVIGGGCTLLKLAAAVEDIKAALPNEEQKLGADIIRKALA  497

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIA NAG NGSVV E+V +S +P +GYNAATG +EDLM  G+IDPTKV+RC LE++
Sbjct  498   YPMRLIASNAGDNGSVVVERVTNSKDPDFGYNAATGKFEDLMVGGVIDPTKVIRCALENS  557

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
              SVAK FL SD VV EI E +  +AGN MDNSGYG
Sbjct  558   VSVAKIFLTSDVVVCEIPEKKVAVAGNAMDNSGYG  592



>gb|AFW75264.1| putative TCP-1/cpn60 chaperonin family protein, partial [Zea 
mays]
Length=332

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/328 (88%), Positives = 311/328 (95%), Gaps = 0/328 (0%)
 Frame = -2

Query  1399  KLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGALKVAALKA  1220
             +LLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRG+LK+AA+KA
Sbjct  5     QLLLVDKKITNARDLINVLEEAIRGGYPILIIAEDIEQEALATLVVNKLRGSLKIAAIKA  64

Query  1219  PGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSATIVGDGST  1040
             PGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S TIVGDGST
Sbjct  65    PGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKESTTIVGDGST  124

Query  1039  QEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVED  860
             Q+EV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELKEKKLRVED
Sbjct  125   QDEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELKEKKLRVED  184

Query  859   ALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALSYPLKLIAK  680
             ALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALSYPLKLIAK
Sbjct  185   ALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAK  244

Query  679   NAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFL  500
             NAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHAASVAKTFL
Sbjct  245   NAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFL  304

Query  499   MSDCVVVEIKEPEPVMAGNPMDNSGYGY  416
              SD VVV+IKEPE     NPMDNSGYGY
Sbjct  305   TSDVVVVDIKEPESAPLANPMDNSGYGY  332



>ref|XP_007514774.1| chaperonin GroEL [Bathycoccus prasinos]
 emb|CCO15014.1| chaperonin GroEL [Bathycoccus prasinos]
Length=589

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/397 (71%), Positives = 338/397 (85%), Gaps = 2/397 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N EVG MIA AM++VGRKGV+TLEE +S +N+L VVEGMQF+RG+ISPYFVTD E+
Sbjct  192   SAGGNLEVGEMIAAAMARVGRKGVITLEEARSVDNNLIVVEGMQFERGFISPYFVTDQER  251

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  +Y+ CKLLLVDKKI++ARD+IN+LE+AI+  FP+LIIAEDIEQEA+ATLVVNKLRGA
Sbjct  252   MICDYEQCKLLLVDKKISSARDMINILEAAIKDSFPLLIIAEDIEQEAMATLVVNKLRGA  311

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV ALKAPGFGERKSQYL+DIAILTGGTV++EE+GLSLDK  ++VLG+AA+V L K+S 
Sbjct  312   LKVCALKAPGFGERKSQYLEDIAILTGGTVVKEELGLSLDKVGTEVLGNAARVTLGKESC  371

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST  EV  RV QI  LIEV + +YEKEKL+ER A+LSGGVA+IQVGAQTETELK
Sbjct  372   TIVGDGSTDLEVKARVKQINRLIEVQEAEYEKEKLSERAARLSGGVAIIQVGAQTETELK  431

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGG T L+L   VD +K+ L+NDE+++GADI+KRALS
Sbjct  432   EKKLRVEDALNATKAAVEEGIVIGGGTTFLKLGQFVDGIKDELDNDEQRLGADIIKRALS  491

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++L+A N+GVNGSV  +KVLS +NP YG+NAATG +EDLM +GIIDPTKV+RCCLE++
Sbjct  492   YPMRLVAYNSGVNGSVTVQKVLSENNPDYGFNAATGKFEDLMKSGIIDPTKVIRCCLENS  551

Query  523   ASVAKTFLMSDCVVVEIKEPEPVM--AGNPMDNSGYG  419
              SVAK FL SD VV EI E E         +DNSGYG
Sbjct  552   VSVAKIFLTSDVVVCEIPEGEEAQTAGAGALDNSGYG  588



>gb|KDO54477.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=532

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/321 (91%), Positives = 308/321 (96%), Gaps = 0/321 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  511

Query  703   YPLKLIAKNAGVNGSVVSEKV  641
             YPLKLIAKNAGVNGSVVSEKV
Sbjct  512   YPLKLIAKNAGVNGSVVSEKV  532



>gb|KDO54476.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=531

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/320 (91%), Positives = 307/320 (96%), Gaps = 0/320 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAEN L VVEGMQFDRGYISPYFVTDSEK
Sbjct  212   SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEK  271

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVEY+NCKLLLVDKKITNARDLINVLE AIR  +PILIIAEDIEQEALATLVVNKLRGA
Sbjct  272   MAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALATLVVNKLRGA  331

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKSQYLDDIAILTGGTVIR+EVGL+LDK   +VLG+A+KVVLTKD+ 
Sbjct  332   LKIAALKAPGFGERKSQYLDDIAILTGGTVIRDEVGLALDKVGKEVLGNASKVVLTKDTT  391

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ+ VSKRVAQI+ LIE A+QDYE+EKLNERIAKLSGGVAVIQVGAQTETELK
Sbjct  392   TIVGDGSTQDAVSKRVAQIRTLIENAEQDYEREKLNERIAKLSGGVAVIQVGAQTETELK  451

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDA+KE+L+NDEEKVGADIVKRAL 
Sbjct  452   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALC  511

Query  703   YPLKLIAKNAGVNGSVVSEK  644
             YPLKLIAKNAGVNGSVVSEK
Sbjct  512   YPLKLIAKNAGVNGSVVSEK  531



>emb|CEF98707.1| Chaperonin Cpn60 [Ostreococcus tauri]
Length=593

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/398 (70%), Positives = 336/398 (84%), Gaps = 4/398 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N E+G MIA AM+KVGRKGV++LEE +S +N+L VVEGMQFDRGYISPYFVTD E+
Sbjct  194   SAGGNMEIGEMIAAAMAKVGRKGVISLEEARSVDNNLIVVEGMQFDRGYISPYFVTDPER  253

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M   YD CKLL+VDKKI+ ARD+I +LE+AI+ GFP++IIAEDIEQEALATLVVNKLRG+
Sbjct  254   MTCVYDQCKLLIVDKKISTARDMIGILEAAIQQGFPLMIIAEDIEQEALATLVVNKLRGS  313

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERKSQYL+DIAILTGGTV++EE+GLSLDK   +VLG AA++ L K+S 
Sbjct  314   LKITAIKAPGFGERKSQYLEDIAILTGGTVVKEELGLSLDKCGVEVLGSAARIELGKESC  373

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVG G T  EVS RV QI  L+E  + DYEKEKL ER A+LSGGVA++QVGAQTETELK
Sbjct  374   TIVGSGDTAAEVSARVKQINRLLESTEADYEKEKLRERAARLSGGVAIVQVGAQTETELK  433

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGGCT L+L++ VD +KE+L+NDE+KVGADI+KRALS
Sbjct  434   EKKLRVEDALNATKAAVEEGIVIGGGCTFLKLAAAVDGIKETLDNDEQKVGADIIKRALS  493

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++L+A NAGVNGSV  E+V+SS +P +G+NAATG +EDLM +G++DPTKV+RC LE+A
Sbjct  494   YPIRLVAHNAGVNGSVTCERVMSSADPNFGFNAATGQFEDLMESGVLDPTKVIRCSLENA  553

Query  523   ASVAKTFLMSDCVVVEIKEPE----PVMAGNPMDNSGY  422
              SVAK FL SD VV EI E E       AG+ MDNSGY
Sbjct  554   CSVAKIFLTSDVVVCEIPEDEDAAAAAAAGSAMDNSGY  591



>gb|AFW75263.1| putative TCP-1/cpn60 chaperonin family protein, partial [Zea 
mays]
Length=334

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/339 (84%), Positives = 310/339 (91%), Gaps = 11/339 (3%)
 Frame = -2

Query  1399  KLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGALKVAALKA  1220
             +LLLVDKKITNARDLINVLE AIR G+PILIIAEDIEQEALATLVVNKLRG+LK+AA+KA
Sbjct  5     QLLLVDKKITNARDLINVLEEAIRGGYPILIIAEDIEQEALATLVVNKLRGSLKIAAIKA  64

Query  1219  PGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSATIVGDGST  1040
             PGFGERK+QYLDDIAILTG TVIR+EVGLSLDKAD  VLG AAKVVLTK+S TIVGDGST
Sbjct  65    PGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLTKESTTIVGDGST  124

Query  1039  QEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVED  860
             Q+EV+KRVAQIKNLIE A+Q+YEKEKLNERIAKL+GGVAVIQVGAQTETELKEKKLRVED
Sbjct  125   QDEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTETELKEKKLRVED  184

Query  859   ALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALSYPLKLIAK  680
             ALNATKAAVEEGIVVGGGCTLLRL++KVDA+K++LENDE+KVGA+IV+RALSYPLKLIAK
Sbjct  185   ALNATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAK  244

Query  679   NAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFL  500
             NAGVNGSVV+EKVLS+DN KYGYNAATG YEDLMAAGIIDPTKVVRCCLEHAASVAKTFL
Sbjct  245   NAGVNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFL  304

Query  499   MSDCVVVEIKEPEPVMAGNPMDNSGYGY*VRSTELETWH  383
              SD VVV+IKEPE     NPMDNSG            WH
Sbjct  305   TSDVVVVDIKEPESAPLANPMDNSG-----------NWH  332



>ref|XP_003080325.1| RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUNIT (60 KD CHAPERONIN 
(IC) [Ostreococcus tauri]
Length=621

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/398 (70%), Positives = 336/398 (84%), Gaps = 4/398 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N E+G MIA AM+KVGRKGV++LEE +S +N+L VVEGMQFDRGYISPYFVTD E+
Sbjct  222   SAGGNMEIGEMIAAAMAKVGRKGVISLEEARSVDNNLIVVEGMQFDRGYISPYFVTDPER  281

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M   YD CKLL+VDKKI+ ARD+I +LE+AI+ GFP++IIAEDIEQEALATLVVNKLRG+
Sbjct  282   MTCVYDQCKLLIVDKKISTARDMIGILEAAIQQGFPLMIIAEDIEQEALATLVVNKLRGS  341

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ A+KAPGFGERKSQYL+DIAILTGGTV++EE+GLSLDK   +VLG AA++ L K+S 
Sbjct  342   LKITAIKAPGFGERKSQYLEDIAILTGGTVVKEELGLSLDKCGVEVLGSAARIELGKESC  401

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVG G T  EVS RV QI  L+E  + DYEKEKL ER A+LSGGVA++QVGAQTETELK
Sbjct  402   TIVGSGDTAAEVSARVKQINRLLESTEADYEKEKLRERAARLSGGVAIVQVGAQTETELK  461

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGGCT L+L++ VD +KE+L+NDE+KVGADI+KRALS
Sbjct  462   EKKLRVEDALNATKAAVEEGIVIGGGCTFLKLAAAVDGIKETLDNDEQKVGADIIKRALS  521

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++L+A NAGVNGSV  E+V+SS +P +G+NAATG +EDLM +G++DPTKV+RC LE+A
Sbjct  522   YPIRLVAHNAGVNGSVTCERVMSSADPNFGFNAATGQFEDLMESGVLDPTKVIRCSLENA  581

Query  523   ASVAKTFLMSDCVVVEIKEPE----PVMAGNPMDNSGY  422
              SVAK FL SD VV EI E E       AG+ MDNSGY
Sbjct  582   CSVAKIFLTSDVVVCEIPEDEDAAAAAAAGSAMDNSGY  619



>ref|XP_005843554.1| hypothetical protein CHLNCDRAFT_59809 [Chlorella variabilis]
 gb|EFN51452.1| hypothetical protein CHLNCDRAFT_59809 [Chlorella variabilis]
Length=584

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/381 (75%), Positives = 324/381 (85%), Gaps = 0/381 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N ++G +I++AM +VGR GVVT+EE K+AE+SL VVEGMQFDRGYISPYFVTD E+
Sbjct  190   SAGGNEKIGQLISDAMMRVGRAGVVTMEESKTAEDSLHVVEGMQFDRGYISPYFVTDPER  249

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCKLLLVDKKI+ ARD+I +LE AIR G P+LI+AEDIEQEALATLVVNKLRG 
Sbjct  250   MVAEYENCKLLLVDKKISTARDMIGILEGAIRGGHPLLIMAEDIEQEALATLVVNKLRGT  309

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGERKS YL+DIAILTGG ++++E+G+SLDKAD  +LG AAKV ++K+  
Sbjct  310   LKVVAVKAPGFGERKSSYLEDIAILTGGQLVKDELGISLDKADDSILGLAAKVSVSKEHI  369

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQ +V  RV QIKNL+   D +YEKEKLNERIA+LSGGVAVIQVGAQTETELK
Sbjct  370   TIVGDGSTQADVEARVKQIKNLVAETDAEYEKEKLNERIARLSGGVAVIQVGAQTETELK  429

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV GGGC LLRLSS VDA K  L ++E+KVGADIVKRAL 
Sbjct  430   EKKLRVEDALNATKAAVEEGIVTGGGCALLRLSSMVDAFKAGLTDEEQKVGADIVKRALP  489

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             Y LKLIA NAG NGSVV ++VL   NP +GYNAATG +EDLMAAGIIDP KVVRC LE+A
Sbjct  490   YSLKLIANNAGDNGSVVMQRVLEDANPNFGYNAATGKFEDLMAAGIIDPVKVVRCALENA  549

Query  523   ASVAKTFLMSDCVVVEIKEPE  461
             ASVAK FL SD VVV I EPE
Sbjct  550   ASVAKVFLTSDVVVVAIPEPE  570



>ref|XP_001692504.1| chaperonin 60B2 [Chlamydomonas reinhardtii]
 gb|EDP03982.1| chaperonin 60B2 [Chlamydomonas reinhardtii]
Length=577

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 337/395 (85%), Gaps = 5/395 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N +VG +I++AM+KVGR+GVVT+EE K+AE++L  VEGMQFDRGY SPYFVTD E+
Sbjct  182   SAGGNPDVGKLISDAMAKVGRQGVVTMEESKTAEDALIFVEGMQFDRGYYSPYFVTDPER  241

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NC++LLVDKKI+ ARD+I +LE+AIR  +P+LI+AED+EQEALATLVVNKLRG 
Sbjct  242   MLAEYENCRILLVDKKISTARDIIGILEAAIRGNYPLLIMAEDVEQEALATLVVNKLRGT  301

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGERKS YL+DIAILTGGTV+++E+G++L+KA  +VLG AAKV ++K++ 
Sbjct  302   LKVVAVKAPGFGERKSSYLEDIAILTGGTVVKDELGITLEKATEEVLGLAAKVSISKEAT  361

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG TQ++V  RV QI+NL    +Q+YEKEKLNERIA+LSGGVA+IQVGAQTETELK
Sbjct  362   TIVGDGRTQQQVEGRVKQIRNLAAETEQEYEKEKLNERIARLSGGVAIIQVGAQTETELK  421

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGGCTLLRLS KVD++KE+L N+E+K+GADI+KRALS
Sbjct  422   EKKLRVEDALNATKAAVEEGIVIGGGCTLLRLSQKVDSIKETLSNEEQKMGADIIKRALS  481

Query  703   YPLKLIAKNAGVNGSVVSEKVLSS-DNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             YP+KLIA NAG NGSVV ++V+ + D P YGYNAAT  +EDLM AGIIDPTKVVRC LE+
Sbjct  482   YPIKLIANNAGTNGSVVMQRVMDNIDQPYYGYNAATDTFEDLMEAGIIDPTKVVRCSLEN  541

Query  526   AASVAKTFLMSDCVVVEIKE----PEPVMAGNPMD  434
             A SVAKTFL++D VV EI E    P P   G   D
Sbjct  542   AVSVAKTFLLADVVVTEIPEKEKAPAPAAGGGDYD  576



>ref|XP_002951713.1| hypothetical protein VOLCADRAFT_81582 [Volvox carteri f. nagariensis]
 gb|EFJ47164.1| hypothetical protein VOLCADRAFT_81582 [Volvox carteri f. nagariensis]
Length=577

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/378 (72%), Positives = 333/378 (88%), Gaps = 1/378 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNN ++G +I++AM+KVGR+GVVT+EE K+AE++L VVEGMQFDRGY SPYFVTD E+
Sbjct  183   SAGNNADIGKLISDAMAKVGRQGVVTMEESKTAEDNLVVVEGMQFDRGYYSPYFVTDPER  242

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NC++LLVDKKI+ ARD+I +LESAIR  +P+L++AED+EQEALATLVVNKLRG 
Sbjct  243   MLCEYENCRILLVDKKISTARDIIGILESAIRGNYPLLVMAEDVEQEALATLVVNKLRGT  302

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGERKS YL+DIAILTGGTV+++E+G++LDKA  +VLG AAKV ++K+  
Sbjct  303   LKVVAVKAPGFGERKSSYLEDIAILTGGTVVKDELGITLDKATEEVLGVAAKVSISKEHC  362

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG TQ+EV  RV QI+NL+   +Q+YE+EKLNERIA+LSGGVA+IQVGAQTETELK
Sbjct  363   TIVGDGRTQKEVEARVKQIRNLVAETEQEYEREKLNERIARLSGGVAIIQVGAQTETELK  422

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEG+V+GGGCTLLRLS  VD ++ +LEN+E+K+GADI+KRALS
Sbjct  423   EKKLRVEDALNATKAAVEEGVVIGGGCTLLRLSQNVDQIRAALENEEQKMGADIIKRALS  482

Query  703   YPLKLIAKNAGVNGSVVSEKVLSS-DNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             YP+KLIA NAGVNGSVV ++V+ + + P YGYNAAT  YEDLM AGIIDPTKVVRC LE+
Sbjct  483   YPIKLIANNAGVNGSVVMQRVMDNIEQPYYGYNAATDKYEDLMEAGIIDPTKVVRCSLEN  542

Query  526   AASVAKTFLMSDCVVVEI  473
             A SVAKTFL++D VV EI
Sbjct  543   ACSVAKTFLLADVVVTEI  560



>ref|XP_002500045.1| chaperonin 60 beta [Micromonas sp. RCC299]
 gb|ACO61303.1| chaperonin 60 beta [Micromonas sp. RCC299]
Length=594

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/397 (73%), Positives = 341/397 (86%), Gaps = 2/397 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N EVG MI++AM+KVGRKGV+TLEE KS +N+L VVEGMQFDRGYISPYFVTDSE+
Sbjct  197   SAGGNMEVGMMISDAMAKVGRKGVITLEEAKSVDNNLIVVEGMQFDRGYISPYFVTDSER  256

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  +YDNCKLLLVDKKI +ARD+I +LE AI+SGFP+L+IAEDIEQEALATLVVNKLRGA
Sbjct  257   MTCDYDNCKLLLVDKKIKSARDMITILEEAIKSGFPLLVIAEDIEQEALATLVVNKLRGA  316

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+ ALKAPGFGERKSQYL+DIAILTG TV+++E+GLSLDK   +VLG+AA+V L K+S 
Sbjct  317   LKICALKAPGFGERKSQYLEDIAILTGATVVKDELGLSLDKVGPEVLGNAARVELGKESC  376

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGST+ EV+ RV QI  L E A+ +YEKEKLNER A+LSGGVA+IQ GAQTETELK
Sbjct  377   TIVGDGSTELEVAARVKQINRLCEAAEAEYEKEKLNERAARLSGGVAIIQCGAQTETELK  436

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGGCTLL+L++ VD +K+ L NDE+K+GADI++RAL 
Sbjct  437   EKKLRVEDALNATKAAVEEGIVIGGGCTLLKLAAAVDDIKKELPNDEQKLGADIIQRALK  496

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIA NAG NGSVV E+V +S +  +GYNAATG ++DLM  GIIDPTKV+RC LE++
Sbjct  497   YPMRLIAANAGDNGSVVVERVTASKDANFGYNAATGEFQDLMVNGIIDPTKVIRCALENS  556

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAG--NPMDNSGYG  419
              SVAK FL SD VV EI E EP++AG    MDNSGYG
Sbjct  557   CSVAKIFLTSDVVVCEIPENEPMIAGGAGAMDNSGYG  593



>ref|XP_010261583.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=589

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/395 (69%), Positives = 340/395 (86%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMIA+A+ +VG+KGVVT+E+G+  ENSL++VEGMQFDRGY+SPYFVTD +K
Sbjct  186   SAGNDYVVGNMIADALQQVGKKGVVTIEKGRCTENSLQIVEGMQFDRGYLSPYFVTDRQK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+ NCKLLLVDKKI N ++L  +L+ A++  +PI+I+AE IEQEALA ++ NKLRG 
Sbjct  246   MSVEFHNCKLLLVDKKIINPKELFRILDGAVKEKYPIVIVAEGIEQEALAPIIRNKLRGV  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTV+R+++GL+L+++  +VLG A+KVV+TKDS 
Sbjct  306   LKAAAIKAPAFGERKSHYLDDIAILTGGTVVRDDMGLTLERSGKEVLGTASKVVITKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V+KRV+QI+ L+E  + +++K+ LNERIA+L GG+A+IQVGAQTE ELK
Sbjct  366   LIVTDGSTQPAVNKRVSQIRALVENTEGNFQKKILNERIARLCGGIAIIQVGAQTEVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEGIVVGGGC+LLRLS KV+ +K++LEN+E+K+GADI KRALS
Sbjct  426   DKQLRIEDALNATKAAIEEGIVVGGGCSLLRLSLKVENIKDTLENEEQKIGADIFKRALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPL+LIAKNAG NGSVV EKVLS D+ +YGYNAA   YEDL+AAGIIDPTKVVRCCLEHA
Sbjct  486   YPLRLIAKNAGGNGSVVVEKVLSIDDVRYGYNAAKDCYEDLIAAGIIDPTKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAK FL SD V+V+IKE EPV    P+ +SG G
Sbjct  546   ASVAKVFLTSDVVIVDIKELEPVPMRKPIPSSGVG  580



>gb|KFM24710.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Auxenochlorella protothecoides]
Length=529

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/381 (71%), Positives = 326/381 (86%), Gaps = 0/381 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N  +G +IA AM++VGR GVVT+EE K+AE+SL+VVEGMQFDRGYISPYFVTD E+
Sbjct  135   SAGGNAVIGELIASAMARVGRAGVVTMEESKTAEDSLQVVEGMQFDRGYISPYFVTDPER  194

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+ C+LLLVD+KI  ARD++ VLE AIR G+P+LI+AEDIEQEALATLVVNKLRGA
Sbjct  195   MVAEYEGCRLLLVDRKIATARDMVGVLEGAIRGGYPLLIMAEDIEQEALATLVVNKLRGA  254

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGERK+ YL+DIAILTGGTV++EE+G+SLD A  +VLG AAK+ ++K+S 
Sbjct  255   LKVVAVKAPGFGERKTSYLEDIAILTGGTVVKEEMGVSLDGAGEEVLGTAAKISVSKESL  314

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGD ST E ++ RV QI+N+    + +YEKEKLNER+A+LSGGVAVIQVGAQTETELK
Sbjct  315   TIVGDSSTAEAIAARVRQIRNMAAETEAEYEKEKLNERVARLSGGVAVIQVGAQTETELK  374

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV GGGCTLL+L+ ++DA + SL+NDE+++GADI++RAL 
Sbjct  375   EKKLRVEDALNATKAAVEEGIVTGGGCTLLQLAQRIDAFRGSLDNDEQRMGADILRRALP  434

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIA NAG NGSVV ++VL   +P +GYNAATG YEDL+AAGIIDP KV+RC LE+A
Sbjct  435   YPLKLIASNAGDNGSVVMQRVLDGGSPAFGYNAATGAYEDLLAAGIIDPAKVIRCALENA  494

Query  523   ASVAKTFLMSDCVVVEIKEPE  461
             ASVAKTFL S  +V EI + E
Sbjct  495   ASVAKTFLTSSVIVTEIPQEE  515



>ref|XP_005647445.1| chaperonin 60B2 [Coccomyxa subellipsoidea C-169]
 gb|EIE22901.1| chaperonin 60B2 [Coccomyxa subellipsoidea C-169]
Length=546

 Score =   532 bits (1370),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 274/397 (69%), Positives = 333/397 (84%), Gaps = 2/397 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N  +G +I++AM +VGR+GVVT+EE ++AE+ L VVEGMQF+RGYISPYFVTD E+
Sbjct  151   SAGGNEVIGQLISDAMGRVGRQGVVTMEESRTAEDHLYVVEGMQFERGYISPYFVTDPER  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E++NC+LLLVDKKI+ ARD++ +LE+A+R GF +LI+AEDIEQEALAT+VVNKLRG 
Sbjct  211   MVGEFENCRLLLVDKKISTARDIVGILEAAVRGGFSLLIMAEDIEQEALATMVVNKLRGT  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGERKS YL+DIAI+TG  V++EE+GLSLDK   +VLG AAKV ++K+S 
Sbjct  271   LKVIAVKAPGFGERKSSYLEDIAIMTGAQVVKEELGLSLDKVGEEVLGIAAKVTVSKEST  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDG  +  V+ RV QIKN+I   +QDYE+EKLNER+A+LSGGVAVIQVGAQTETELK
Sbjct  331   TIVGDGRAEASVAARVRQIKNMIAETEQDYEREKLNERVARLSGGVAVIQVGAQTETELK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIV+GGGCT L+L+ KVD +KE+LENDE+KVGA+IV+RALS
Sbjct  391   EKKLRVEDALNATKAAVEEGIVIGGGCTFLKLARKVDEVKETLENDEQKVGAEIVRRALS  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPL+LIA NAGVNGSVV +KVL + +   GYNAAT  YEDLMAAGIIDPTKV+R  + +A
Sbjct  451   YPLRLIANNAGVNGSVVQQKVLENLDANVGYNAATDVYEDLMAAGIIDPTKVLRVAMLNA  510

Query  523   ASVAKTFLMSDCVVVEIKEPE-PVMAGNPMDNSGYGY  416
             ASVAK FL SD ++ EI +PE    AG  MD  G GY
Sbjct  511   ASVAKVFLTSDVIITEIPQPEGAAQAGAGMDAMG-GY  546



>sp|Q42693.1|RUBB_CHLRE RecName: Full=RuBisCO large subunit-binding protein subunit beta-1; 
AltName: Full=60 kDa chaperonin subunit beta-1; AltName: 
Full=CPN-60 beta-1, partial [Chlamydomonas reinhardtii]
 gb|AAA98641.1| chaperonin beta-like subunit [Chlamydomonas reinhardtii]
Length=435

 Score =   525 bits (1352),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 329/390 (84%), Gaps = 1/390 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N ++G++I++AM+KVGR GVVT+EEGK+AE+ L  VEGMQF+RGY SPYFVTD E+
Sbjct  35    SAGGNTDIGSLISDAMAKVGRTGVVTMEEGKTAEDQLVFVEGMQFERGYTSPYFVTDPER  94

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCK+LLVDKKI+ ARD+I +LESAIR  +P+LI+AE++EQEALATLVVNKLRG 
Sbjct  95    MICEYENCKILLVDKKISTARDIITILESAIRGNYPLLIMAEEVEQEALATLVVNKLRGT  154

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGER+S YL+DIAILTGGTV+ +E+G+SL++A   VLG AAK+ +TK+  
Sbjct  155   LKVVAIKAPGFGERRSSYLEDIAILTGGTVVGDEMGVSLEQATDAVLGTAAKITITKERT  214

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             T+VGDGST  +V+ RV QI+NL    DQDYE+EKL ERIA+LSGGVA+IQVGAQTETELK
Sbjct  215   TVVGDGSTAADVAARVKQIRNLQMQTDQDYEREKLQERIARLSGGVAIIQVGAQTETELK  274

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNAT+AAVEEG+V GGGCTLLRLS KVD +K  + + E+++GADI+KRAL 
Sbjct  275   EKKLRVEDALNATRAAVEEGVVPGGGCTLLRLSEKVDVIKRRMTDPEQQMGADIIKRALC  334

Query  703   YPLKLIAKNAGVNGSVVSEKVLSS-DNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             YP+KLIA+NAGVNGSVV  +V+ + D P YGYNAAT ++E+LM  GIIDP+KVVRC +E+
Sbjct  335   YPIKLIAQNAGVNGSVVMNEVMKNLDRPHYGYNAATDSFENLMETGIIDPSKVVRCSMEN  394

Query  526   AASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A SVAKTFL++D VV E+KE E     NP+
Sbjct  395   AVSVAKTFLLADVVVTELKEIEAGAKPNPV  424



>ref|XP_001701113.1| chaperonin 60B1 [Chlamydomonas reinhardtii]
 gb|EDO97815.1| chaperonin 60B1 [Chlamydomonas reinhardtii]
Length=580

 Score =   530 bits (1364),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 265/390 (68%), Positives = 330/390 (85%), Gaps = 1/390 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N ++G++I++AM+KVGR GVVT+EEGK+AE+ L  VEGMQF+RGY SPYFVTD E+
Sbjct  180   SAGGNTDIGSLISDAMAKVGRTGVVTMEEGKTAEDQLVFVEGMQFERGYTSPYFVTDPER  239

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+NCK+LLVDKKI+ ARD+I +LESAIR  +P+LI+AE++EQEALATLVVNKLRG 
Sbjct  240   MICEYENCKILLVDKKISTARDIITILESAIRGNYPLLIMAEEVEQEALATLVVNKLRGT  299

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAPGFGER+S YL+DIAILTGGTV+R+E+G+SL++A   VLG AAK+ +TK+  
Sbjct  300   LKVVAIKAPGFGERRSSYLEDIAILTGGTVVRDEMGVSLEQATDAVLGTAAKITITKERT  359

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             T+VGDGST  +V+ RV QI+NL    DQDYE+EKL ERIA+LSGGVA+IQVGAQTETELK
Sbjct  360   TVVGDGSTAADVAARVKQIRNLQMQTDQDYEREKLQERIARLSGGVAIIQVGAQTETELK  419

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNAT+AAVEEG+V GGGCTLLRLS KVD +K  + + E+++GADI+KRAL 
Sbjct  420   EKKLRVEDALNATRAAVEEGVVPGGGCTLLRLSEKVDVIKRRMTDPEQQMGADIIKRALC  479

Query  703   YPLKLIAKNAGVNGSVVSEKVLSS-DNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             YP+KLIA+NAGVNGSVV  +V+ + D P YGYNAAT ++E+LM  GIIDP+KVVRC +E+
Sbjct  480   YPIKLIAQNAGVNGSVVMNEVMKNLDRPHYGYNAATDSFENLMETGIIDPSKVVRCSMEN  539

Query  526   AASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A SVAKTFL++D VV E+KE E     NP+
Sbjct  540   AVSVAKTFLLADVVVTELKEIEAGAKPNPV  569



>gb|KDP31429.1| hypothetical protein JCGZ_11805 [Jatropha curcas]
Length=592

 Score =   529 bits (1363),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 260/392 (66%), Positives = 335/392 (85%), Gaps = 0/392 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+  VGNMIA+A+ +VGR+GVVT+E GK  EN+L++V+GMQFDRGY+SPYFVTD  K
Sbjct  184   SAGNDSIVGNMIADALREVGRRGVVTIENGKYIENNLQIVKGMQFDRGYLSPYFVTDRRK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ NCKLLLVDKKITNA+++  +L++A++  +PI+I+AE IEQEALA ++ NKL+G 
Sbjct  244   MIVEFHNCKLLLVDKKITNAKEMFKILDNAVKEKYPIVIVAEGIEQEALAPVIRNKLKGV  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTVIR+E+G  L+KA  +VLG A KVV+T DS 
Sbjct  304   LKAAAIKAPAFGERKSHYLDDIAILTGGTVIRDEMGFILEKAGVEVLGSATKVVVTNDST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V  RV+QI+NL+E +++ ++++ LNERIA+LSGG+A++QVGAQTE ELK
Sbjct  364   LIVTDGSTQAAVQARVSQIRNLVENSEEKFQRKILNERIARLSGGIAILQVGAQTEVELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+V+GGGC+LLRLS+KVD +KE L+++E+K+GA+I KRALS
Sbjct  424   DKQLRIEDALNATKAAIEEGVVIGGGCSLLRLSTKVDGIKEFLDDEEQKIGAEIFKRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP +LIAKNAGVNG++V  ++LS+DNP+YGYNAA   YEDL++AGIIDPTKVVRCCLE+A
Sbjct  484   YPTRLIAKNAGVNGNIVINQILSNDNPRYGYNAARDRYEDLISAGIIDPTKVVRCCLENA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNS  428
             ASVAKTFL+SD VVV+IKEP  +    PM  +
Sbjct  544   ASVAKTFLISDAVVVDIKEPRMLPMRKPMSKT  575



>ref|XP_006437814.1| hypothetical protein CICLE_v10031053mg [Citrus clementina]
 gb|ESR51054.1| hypothetical protein CICLE_v10031053mg [Citrus clementina]
Length=583

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 265/392 (68%), Positives = 332/392 (85%), Gaps = 0/392 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI++A+ +VGR GVVT+E+GK  E+SL +VEGM+FDRG++SPYFVTD +K
Sbjct  151   SAGNDYTVGKMISDALQQVGRNGVVTIEKGKCTESSLEIVEGMRFDRGFLSPYFVTDRQK  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ + KLLLVDKKITN +D+  +L+SA++  +PI+I+AEDIEQ+ALA L+ NKLRG 
Sbjct  211   RTVEFHDGKLLLVDKKITNPKDMFKILDSAVKEKYPIVIVAEDIEQQALALLIRNKLRGV  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGG VIR+E+GL+LDKA  +VLG A KVV+TKDS 
Sbjct  271   LKAAAIKAPAFGERKSHYLDDIAILTGGLVIRDEMGLTLDKAGKEVLGTAIKVVITKDST  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+  V KR+++I++L E+ ++ ++K  LNERIA+LSGG+A++QVGAQT  ELK
Sbjct  331   LIVTDGSTRAAVEKRISEIRSLAEITEERFQKNILNERIARLSGGIAILQVGAQTVVELK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEGIVVGGGC+LLRLS+KV+ +KE L+N+E+K+GA+I KRALS
Sbjct  391   DKQLRIEDALNATKAAIEEGIVVGGGCSLLRLSTKVEGIKELLDNEEQKIGAEIFKRALS  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAGVNG+ V ++VLS+D+P+YGYNAA   YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  451   YPTKLIAKNAGVNGNFVVDQVLSNDDPRYGYNAARNRYEDLMAAGIIDPTKVVRCCLEHA  510

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNS  428
             ASVAKTFL SD VVV IKE EPV     M +S
Sbjct  511   ASVAKTFLTSDAVVVNIKESEPVPRRKLMPSS  542



>ref|XP_002269341.2| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Vitis 
vinifera]
Length=610

 Score =   528 bits (1361),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 332/379 (88%), Gaps = 0/379 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VGR+GV+T+E+GK AENSL++VEGMQFDRGY+SPYFVTD +K
Sbjct  177   SAGNDYTVGNMISDAIRQVGRRGVITIEKGKCAENSLQIVEGMQFDRGYLSPYFVTDRQK  236

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKITN +++  +L++A++  +PI+I+AE IEQEALA ++ NKLRG 
Sbjct  237   MMVEFHDCKLLLVDKKITNPKEMFKILDNAVKEKYPIVIVAEGIEQEALAPVIRNKLRGV  296

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDD+AILTGGTVI +E+GL+L+KA  +VLG A KVV+TKDS 
Sbjct  297   LKAAAIKAPAFGERKSHYLDDLAILTGGTVISDEMGLTLEKAGKEVLGTATKVVITKDST  356

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V KRV+QI+ L+E  +++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  357   LIVTDGSTQPAVEKRVSQIRGLVENTEENFQKKILNERIARLSGGIAILQVGAQTQVELK  416

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDA+NATKAA+EEG+VVGGGC+LLRLS KVD +KE L+N+E+K+GA+I KRAL+
Sbjct  417   DKQLRIEDAVNATKAAIEEGVVVGGGCSLLRLSLKVDGIKELLDNEEQKIGAEIFKRALT  476

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP +LIAKNAGVN SVV EKVLS+D+ +YGYNAA   YEDLMAAGI+DP+KVVRCCLEHA
Sbjct  477   YPARLIAKNAGVNDSVVIEKVLSNDDFRYGYNAAIDCYEDLMAAGIMDPSKVVRCCLEHA  536

Query  523   ASVAKTFLMSDCVVVEIKE  467
             ASVAKTFL SD VVV+IKE
Sbjct  537   ASVAKTFLTSDAVVVDIKE  555



>emb|CBI27426.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 332/379 (88%), Gaps = 0/379 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VGR+GV+T+E+GK AENSL++VEGMQFDRGY+SPYFVTD +K
Sbjct  151   SAGNDYTVGNMISDAIRQVGRRGVITIEKGKCAENSLQIVEGMQFDRGYLSPYFVTDRQK  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKITN +++  +L++A++  +PI+I+AE IEQEALA ++ NKLRG 
Sbjct  211   MMVEFHDCKLLLVDKKITNPKEMFKILDNAVKEKYPIVIVAEGIEQEALAPVIRNKLRGV  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDD+AILTGGTVI +E+GL+L+KA  +VLG A KVV+TKDS 
Sbjct  271   LKAAAIKAPAFGERKSHYLDDLAILTGGTVISDEMGLTLEKAGKEVLGTATKVVITKDST  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V KRV+QI+ L+E  +++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  331   LIVTDGSTQPAVEKRVSQIRGLVENTEENFQKKILNERIARLSGGIAILQVGAQTQVELK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDA+NATKAA+EEG+VVGGGC+LLRLS KVD +KE L+N+E+K+GA+I KRAL+
Sbjct  391   DKQLRIEDAVNATKAAIEEGVVVGGGCSLLRLSLKVDGIKELLDNEEQKIGAEIFKRALT  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP +LIAKNAGVN SVV EKVLS+D+ +YGYNAA   YEDLMAAGI+DP+KVVRCCLEHA
Sbjct  451   YPARLIAKNAGVNDSVVIEKVLSNDDFRYGYNAAIDCYEDLMAAGIMDPSKVVRCCLEHA  510

Query  523   ASVAKTFLMSDCVVVEIKE  467
             ASVAKTFL SD VVV+IKE
Sbjct  511   ASVAKTFLTSDAVVVDIKE  529



>ref|XP_006484293.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=612

 Score =   528 bits (1360),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 263/383 (69%), Positives = 328/383 (86%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI++A+ +VGR GVVT+E+GK  ENSL +VEGM+FDRG++SPYFVTD +K
Sbjct  180   SAGNDYTVGKMISDALQQVGRNGVVTIEKGKCTENSLEIVEGMRFDRGFLSPYFVTDRQK  239

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ + KLLLVDKKI N +D+  +L+SA++  +PI+I+AEDIEQ+ALA L+ NKLRG 
Sbjct  240   RTVEFHDGKLLLVDKKIKNPKDMFKILDSAVKEKYPIVIVAEDIEQQALALLIRNKLRGV  299

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGG VIR+E+GL+LDKA  +VLG A KVV+TKDS 
Sbjct  300   LKAAAIKAPAFGERKSHYLDDIAILTGGLVIRDEMGLTLDKAGKEVLGTAIKVVITKDST  359

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+  V KR+++I++L E+ ++ ++K  LNERIA+LSGG+A++QVGAQT  ELK
Sbjct  360   LIVTDGSTRAAVEKRISEIRSLAEITEERFQKNILNERIARLSGGIAILQVGAQTVVELK  419

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEGIVVGGGC+LLRLS+KV+ +KE L+N+E+K+GA+I KRALS
Sbjct  420   DKQLRIEDALNATKAAIEEGIVVGGGCSLLRLSAKVEGIKELLDNEEQKIGAEIFKRALS  479

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAGVNG+ V ++VLS+D+P+YGYNAA   YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  480   YPTKLIAKNAGVNGNFVVDQVLSNDDPRYGYNAARNRYEDLMAAGIIDPTKVVRCCLEHA  539

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             ASVAKTFL SD VVV IKE EPV
Sbjct  540   ASVAKTFLTSDAVVVNIKESEPV  562



>ref|XP_007227057.1| hypothetical protein PRUPE_ppa020938mg [Prunus persica]
 gb|EMJ28256.1| hypothetical protein PRUPE_ppa020938mg [Prunus persica]
Length=611

 Score =   526 bits (1356),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 331/382 (87%), Gaps = 0/382 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN++ VGNMI +A+ +VG+KGVVT+E+GK  EN+L++VEGMQFDRGY+SPYFVTD  +
Sbjct  184   SAGNDFAVGNMIYDALLQVGKKGVVTIEQGKCTENNLQIVEGMQFDRGYLSPYFVTDRRR  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ NCKLLLVDKKITN +++  +L++A++  +P++I+AE IEQEALA ++ NKLRG 
Sbjct  244   RIVEFQNCKLLLVDKKITNPKEMFKLLDNAVQEKYPMVIVAEGIEQEALAPVIRNKLRGV  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTV+R+E+G+ L+ A+ +VLG A KVV+TKDS 
Sbjct  304   LKAAAIKAPAFGERKSHYLDDIAILTGGTVVRDEMGIILEHANKEVLGTATKVVITKDST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI+ L+E  +++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  364   LIVTDGSTREAVEKRVSQIRKLVENTEEEFQKKILNERIARLSGGIAILQVGAQTQVELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC+LLRLS KVD +KE L+N+E+K+GA+I KRALS
Sbjct  424   DKQLRIEDALNATKAAIEEGVVVGGGCSLLRLSKKVDGIKELLDNEEQKIGAEIFKRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNG+VV EK+LS+DN  YGYNAA   YEDLM AGI+DP+KVVRCCLEHA
Sbjct  484   YPVKLIAKNAGVNGNVVVEKILSNDNIGYGYNAAKDCYEDLMKAGIMDPSKVVRCCLEHA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEP  458
             ASVAKTFL SD VVV+IKE +P
Sbjct  544   ASVAKTFLTSDAVVVDIKETQP  565



>ref|XP_009611004.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nicotiana tomentosiformis]
Length=612

 Score =   526 bits (1356),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 266/396 (67%), Positives = 333/396 (84%), Gaps = 5/396 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VG+KGVVT+E+G + E SL VVEGMQFDRGY+SPYFVTD  K
Sbjct  185   SAGNDYAIGNMISEALRQVGKKGVVTIEKGNNTETSLEVVEGMQFDRGYLSPYFVTDRRK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE  NCKLLLVDKKITN ++L+ +L++A++  +P+LI+AE IEQ+ALA ++ NKLRG 
Sbjct  245   RIVELHNCKLLLVDKKITNPKELVKILDNAVKEKYPVLIVAEGIEQDALAPVIRNKLRGV  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  305   LKVAAIKAPSFGERKSHCLDDIAILTGGTVIRDDMGLTLENAHKDLLGTASKVVITKDST  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+T+  VSKRV+QI+ L+E  +++++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  365   LIVTDGNTRAAVSKRVSQIQKLVENTEENFQKKILNERIARLSGGIAIIQVGAQTQVELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE L+N+++K+GADI KRALS
Sbjct  425   DKQLRIEDALNAARAATEEGVVVGGGCCLLRLSSKVDAIKEMLDNEDQKIGADIFKRALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNG++V EK+LS DN KYGYNAA   YEDLMAA I+DP KVVRCCLEHA
Sbjct  485   YPAKQIAKNAGVNGNIVVEKILSVDNMKYGYNAARDRYEDLMAAKILDPAKVVRCCLEHA  544

Query  523   ASVAKTFLMSDCVVVEIKEPEPV---MAGNPMDNSG  425
             A+VAKTFL+SD VV++I  PEPV   M   PM  SG
Sbjct  545   AAVAKTFLISDAVVIDI--PEPVSRQMRRPPMPTSG  578



>ref|XP_009774325.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=547

 Score =   523 bits (1348),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 265/396 (67%), Positives = 329/396 (83%), Gaps = 5/396 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VG+KGVVT+E+G + E SL VVEGMQFDRGY+SPYFVTD  K
Sbjct  120   SAGNDYAIGNMISEALKQVGKKGVVTIEKGNNTETSLEVVEGMQFDRGYLSPYFVTDRRK  179

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE  NCKLLLVDKKITN ++L+ +LE+A++  +P+LI+AE IEQ+ALA ++ NKLRG 
Sbjct  180   RIVELHNCKLLLVDKKITNPKELVKILENAVKEKYPVLIVAEGIEQDALAPVIRNKLRGV  239

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  240   LKVAAIKAPSFGERKSHCLDDIAILTGGTVIRDDMGLTLENAHKDLLGTASKVVITKDST  299

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  V +RV QI+ L+E  +++++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  300   LIVTDGNTQAAVMRRVTQIQKLVENTEENFQKKILNERIARLSGGIAIIQVGAQTQVELK  359

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLS KVDA+KE L+ND++K+GADIVKRALS
Sbjct  360   DKQLRIEDALNAARAATEEGVVVGGGCCLLRLSIKVDAIKEMLDNDDQKIGADIVKRALS  419

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNG++  EK+LS DN KYGYN A   YEDLMAA I+DP KVVRCCLEHA
Sbjct  420   YPAKQIAKNAGVNGNIAVEKILSVDNMKYGYNVARDRYEDLMAAKILDPAKVVRCCLEHA  479

Query  523   ASVAKTFLMSDCVVVEIKEPEPV---MAGNPMDNSG  425
             A+VAKTFL+SD VV++I  PEPV   M   PM  SG
Sbjct  480   AAVAKTFLISDAVVIDI--PEPVSRHMRRPPMPTSG  513



>ref|XP_002514548.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF47654.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=592

 Score =   525 bits (1352),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/389 (65%), Positives = 335/389 (86%), Gaps = 0/389 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI++A+ +VG++GVVT+++G+  +N+L++V+GMQFDRGY+SPYFVTD  K
Sbjct  186   SAGNDYAVGKMISDALREVGKRGVVTIDKGEYIDNNLQIVKGMQFDRGYLSPYFVTDRRK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ NCKLLLVDKKITN +++  +L++A++  +PI+++AE IEQEALA ++ NKLRGA
Sbjct  246   MTVEFHNCKLLLVDKKITNPKEMFKILDNAVKEKYPIVVVAEGIEQEALAPVIRNKLRGA  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERK  YLDDIAILTG TVIR+E+GL+L+K   +VLG A KVV+TKDS 
Sbjct  306   LKAAAIKAPAFGERKGHYLDDIAILTGATVIRDEMGLTLEKVGKEVLGSATKVVITKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V KRV+QI+ L E  +++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  366   LIVTDGSTQAAVQKRVSQIRGLAENTEENFQKKILNERIARLSGGIAILQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+V+GGGC+LLRLS+KVDA+KE L+N+E+K+GA+I KRALS
Sbjct  426   DKQLRIEDALNATKAAIEEGVVIGGGCSLLRLSTKVDAIKELLDNEEQKIGAEIFKRALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP +LIAKNAGVNG++V  ++LS+D+P+YGYNAA   YEDL++AGIIDPTKVVRCCLE+A
Sbjct  486   YPTRLIAKNAGVNGNIVINQILSNDDPRYGYNAARDRYEDLISAGIIDPTKVVRCCLENA  545

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             ASVAKTF+ SD VVV+IK P+P+    PM
Sbjct  546   ASVAKTFITSDAVVVKIKVPQPLPIRKPM  574



>ref|XP_008243762.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Prunus mume]
Length=625

 Score =   526 bits (1354),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 330/382 (86%), Gaps = 0/382 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI +A+ +VG+KGVVT+E+GK  EN+L++VEGMQFDRGY+SPYFVTD  +
Sbjct  188   SAGNDYAVGNMIYDALLQVGKKGVVTIEQGKCTENNLQIVEGMQFDRGYLSPYFVTDRRR  247

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ NCKLLLVDKKITN +++  +L++A++  +P++I+AE IEQEALA ++ NKLRG 
Sbjct  248   RIVEFQNCKLLLVDKKITNPKEMFKLLDNAVQEKYPMVIVAEGIEQEALAPVIRNKLRGV  307

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTV+R+E+G+ L+ A  +VLG A KVV+TKDS 
Sbjct  308   LKAAAIKAPAFGERKSHYLDDIAILTGGTVVRDEMGIILEDAGKEVLGTATKVVITKDST  367

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI+ L+E  +++++K+ LNERIA+LSGGVA++QVGAQT+ ELK
Sbjct  368   LIVTDGSTREAVEKRVSQIRKLVENTEEEFQKKILNERIARLSGGVAILQVGAQTQVELK  427

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC+LLRLS KVD +KE L+N+E+K+GA+I KRALS
Sbjct  428   DKQLRIEDALNATKAAIEEGVVVGGGCSLLRLSKKVDGIKELLDNEEQKIGAEIFKRALS  487

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLI+KNAGVNG+VV EK+LS+DN  YGYNAA   YEDLM AGI+DP+KVVRCCLEHA
Sbjct  488   YPVKLISKNAGVNGNVVVEKILSNDNMGYGYNAAKDCYEDLMKAGIMDPSKVVRCCLEHA  547

Query  523   ASVAKTFLMSDCVVVEIKEPEP  458
             ASVAKTFL SD VVV+IKE +P
Sbjct  548   ASVAKTFLTSDAVVVDIKETQP  569



>ref|XP_010320800.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X5 [Solanum lycopersicum]
Length=578

 Score =   523 bits (1347),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 329/383 (86%), Gaps = 2/383 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  146   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  205

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+ +L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  206   RIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  265

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS YLDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  266   LKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVITKDST  325

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  VSKRV+QI+NL+E  ++ ++K+ LNERIA+LSGG+AVIQVGAQT+ ELK
Sbjct  326   LIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQVELK  385

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE+L+N+++K+GADI KRALS
Sbjct  386   DKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALS  445

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTKVVRCC+EHA
Sbjct  446   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHA  505

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL+SD VV++I  P PV
Sbjct  506   AAVAKTFLISDAVVIDI--PGPV  526



>ref|XP_008804418.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=595

 Score =   524 bits (1349),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 260/383 (68%), Positives = 329/383 (86%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMIAEA+ +VGRKGVV +E GK  ENSL++VEGMQFDRGY+SPYFVTD   
Sbjct  176   SAGNDYSVGNMIAEALKRVGRKGVVRIENGKCTENSLQIVEGMQFDRGYLSPYFVTDRAN  235

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE++N K+LLVDKKITNA+++  +L+SA++  +P+LIIAE IE+EALA ++ NKL+G 
Sbjct  236   MSVEFENSKILLVDKKITNAKEMFKLLDSAVKDKYPLLIIAEGIEEEALAPIIRNKLKGV  295

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK  A+KAP FGERKS  +DDIA+LTGGTV+R+E+GL+L+KA  +VLG A  +V+TKDS 
Sbjct  296   LKGVAIKAPAFGERKSHCMDDIAVLTGGTVVRDEMGLTLEKAGKEVLGSAVNIVITKDST  355

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V KRVAQ++NL+E +++ ++K+ LNERIA+L GG+A+I+VGAQT  ELK
Sbjct  356   LIVTDGSTQHAVEKRVAQLRNLVENSEEKFKKKILNERIARLCGGIAIIKVGAQTVVELK  415

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+EDALNATK+A+EEG+VVGGGC+LLRLS KVD++KESL+N+E+ +GADI KRALS
Sbjct  416   DKKLRIEDALNATKSAIEEGVVVGGGCSLLRLSMKVDSIKESLDNEEQMIGADIFKRALS  475

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAG+NG VV EKVLSS++ +YGYNAA   YEDLMAAGI+DPTKVVRCC+EHA
Sbjct  476   YPSKLIAKNAGINGDVVVEKVLSSNDVRYGYNAAKNCYEDLMAAGILDPTKVVRCCVEHA  535

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL SD VVV+ KE EP+
Sbjct  536   AAVAKTFLTSDVVVVDTKEAEPI  558



>ref|XP_009774324.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Nicotiana sylvestris]
Length=612

 Score =   524 bits (1350),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 265/396 (67%), Positives = 329/396 (83%), Gaps = 5/396 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VG+KGVVT+E+G + E SL VVEGMQFDRGY+SPYFVTD  K
Sbjct  185   SAGNDYAIGNMISEALKQVGKKGVVTIEKGNNTETSLEVVEGMQFDRGYLSPYFVTDRRK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE  NCKLLLVDKKITN ++L+ +LE+A++  +P+LI+AE IEQ+ALA ++ NKLRG 
Sbjct  245   RIVELHNCKLLLVDKKITNPKELVKILENAVKEKYPVLIVAEGIEQDALAPVIRNKLRGV  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  305   LKVAAIKAPSFGERKSHCLDDIAILTGGTVIRDDMGLTLENAHKDLLGTASKVVITKDST  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  V +RV QI+ L+E  +++++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  365   LIVTDGNTQAAVMRRVTQIQKLVENTEENFQKKILNERIARLSGGIAIIQVGAQTQVELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLS KVDA+KE L+ND++K+GADIVKRALS
Sbjct  425   DKQLRIEDALNAARAATEEGVVVGGGCCLLRLSIKVDAIKEMLDNDDQKIGADIVKRALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNG++  EK+LS DN KYGYN A   YEDLMAA I+DP KVVRCCLEHA
Sbjct  485   YPAKQIAKNAGVNGNIAVEKILSVDNMKYGYNVARDRYEDLMAAKILDPAKVVRCCLEHA  544

Query  523   ASVAKTFLMSDCVVVEIKEPEPV---MAGNPMDNSG  425
             A+VAKTFL+SD VV++I  PEPV   M   PM  SG
Sbjct  545   AAVAKTFLISDAVVIDI--PEPVSRHMRRPPMPTSG  578



>ref|XP_010320799.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X4 [Solanum lycopersicum]
Length=594

 Score =   523 bits (1348),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 329/383 (86%), Gaps = 2/383 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  187   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  246

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+ +L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  247   RIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  306

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS YLDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  307   LKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVITKDST  366

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  VSKRV+QI+NL+E  ++ ++K+ LNERIA+LSGG+AVIQVGAQT+ ELK
Sbjct  367   LIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQVELK  426

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE+L+N+++K+GADI KRALS
Sbjct  427   DKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALS  486

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTKVVRCC+EHA
Sbjct  487   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHA  546

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL+SD VV++I  P PV
Sbjct  547   AAVAKTFLISDAVVIDI--PGPV  567



>ref|XP_010320798.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X3 [Solanum lycopersicum]
Length=608

 Score =   523 bits (1348),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 329/383 (86%), Gaps = 2/383 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  187   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  246

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+ +L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  247   RIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  306

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS YLDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  307   LKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVITKDST  366

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  VSKRV+QI+NL+E  ++ ++K+ LNERIA+LSGG+AVIQVGAQT+ ELK
Sbjct  367   LIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQVELK  426

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE+L+N+++K+GADI KRALS
Sbjct  427   DKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALS  486

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTKVVRCC+EHA
Sbjct  487   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHA  546

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL+SD VV++I  P PV
Sbjct  547   AAVAKTFLISDAVVIDI--PGPV  567



>ref|XP_009356483.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Pyrus x bretschneideri]
Length=616

 Score =   523 bits (1347),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 263/388 (68%), Positives = 329/388 (85%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI +A+ +VG+KGVVT+E GKS EN L++VEGMQFDRGY+SPYFVTD +K
Sbjct  184   SAGNDYTVGKMIYDALCQVGKKGVVTIESGKSTENDLQIVEGMQFDRGYLSPYFVTDRKK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKIT+  +L  VL++A++  +P++I+AE IEQEAL  ++ NKLRGA
Sbjct  244   MIVEFQDCKLLLVDKKITHPEELFKVLDNAVQEKYPVVIVAEGIEQEALTPVIRNKLRGA  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTG TV+R+E+G+ L     +VLG A KVV+TKDS 
Sbjct  304   LKAAAIKAPAFGERKSHYLDDIAILTGATVVRDEMGIVLYDVGKEVLGTATKVVITKDST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI+ L+E  +++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  364   VIVTDGSTREAVEKRVSQIQKLVENTEEEFQKKILNERIARLSGGIAILQVGAQTQIELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC+LLRLS KVD +KE L+N+E+K+GA+I KRALS
Sbjct  424   DKQLRIEDALNATKAAIEEGVVVGGGCSLLRLSKKVDTIKELLDNEEQKIGAEIFKRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLS+D+  YGYNAA   YEDLM AGI+DP+KVVRCCLE+A
Sbjct  484   YPVKLIAKNAGVNGSVVVEKVLSNDDMGYGYNAAKDCYEDLMKAGIMDPSKVVRCCLENA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVAKTFL SD VVVEIKE +P+  G P
Sbjct  544   ASVAKTFLTSDAVVVEIKETQPIPKGMP  571



>ref|XP_006307550.1| hypothetical protein CARUB_v10009172mg [Capsella rubella]
 gb|EOA40448.1| hypothetical protein CARUB_v10009172mg [Capsella rubella]
Length=439

 Score =   516 bits (1330),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 258/388 (66%), Positives = 326/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI  A  KVGR GVVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  17    SAGNDYEVGNMIFNAFQKVGRAGVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  76

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L+SA++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  77    REAEFHDCKLLLVDKKITNPKDMFKILDSAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  136

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  137   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  196

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G+TQ+ V +RV QIKNLI+  +++++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  197   LIVTNGATQKAVEERVTQIKNLIQNTEENFQKKILNERVARLSGGIAIIQVGAQTQVELK  256

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD +K++L+N E+K+GADI K+ALS
Sbjct  257   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLATKVDRIKDTLDNTEQKIGADIFKKALS  316

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVLS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  317   YPIRLIAKNAGTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  376

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE +P    NP
Sbjct  377   ASVAQTFLTSDCVVVEIKEIKPRPIINP  404



>ref|XP_010320797.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=617

 Score =   523 bits (1347),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 329/383 (86%), Gaps = 2/383 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  185   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+ +L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  245   RIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS YLDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  305   LKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVITKDST  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  VSKRV+QI+NL+E  ++ ++K+ LNERIA+LSGG+AVIQVGAQT+ ELK
Sbjct  365   LIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQVELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE+L+N+++K+GADI KRALS
Sbjct  425   DKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTKVVRCC+EHA
Sbjct  485   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHA  544

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL+SD VV++I  P PV
Sbjct  545   AAVAKTFLISDAVVIDI--PGPV  565



>ref|XP_010320795.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=619

 Score =   523 bits (1346),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 329/383 (86%), Gaps = 2/383 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  187   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  246

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+ +L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  247   RIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  306

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS YLDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  307   LKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVITKDST  366

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  VSKRV+QI+NL+E  ++ ++K+ LNERIA+LSGG+AVIQVGAQT+ ELK
Sbjct  367   LIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQVELK  426

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE+L+N+++K+GADI KRALS
Sbjct  427   DKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALS  486

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTKVVRCC+EHA
Sbjct  487   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHA  546

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL+SD VV++I  P PV
Sbjct  547   AAVAKTFLISDAVVIDI--PGPV  567



>ref|XP_008389354.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Malus domestica]
Length=614

 Score =   522 bits (1345),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 264/388 (68%), Positives = 328/388 (85%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI +A+ +VG+KGVVT+E GKS EN L++VEGMQFDRGY+SPYFVTD +K
Sbjct  184   SAGNDYTVGNMIYDALRQVGKKGVVTIESGKSTENDLQIVEGMQFDRGYLSPYFVTDRKK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKIT+  +L  VL++A++  +P++I+AE IEQEAL  ++ NKLRGA
Sbjct  244   MIVEFQDCKLLLVDKKITHPXELFKVLDNAVQEKYPVVIVAEGIEQEALTPVIRNKLRGA  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTG TV+R+E+G+ L     +VLG A KVV+TKDS 
Sbjct  304   LKAAAIKAPAFGERKSHYLDDIAILTGATVVRDEMGIVLYDVGKEVLGTATKVVITKDST  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV  GST+E V KRV+QI+ L+E  +++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  364   LIVTXGSTREAVEKRVSQIQKLVENTEEEFQKKILNERIARLSGGIAILQVGAQTQIELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC+LLRLS KVDA+KE L+N E+K+GA+I KRALS
Sbjct  424   DKQLRIEDALNATKAAIEEGVVVGGGCSLLRLSKKVDAIKELLDNKEQKIGAEIFKRALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+KLIAKNAGVNGSVV EKVLS+D+  YGYNAA   YEDLM AGI DP+KVVRCCLE+A
Sbjct  484   YPVKLIAKNAGVNGSVVVEKVLSNDDMGYGYNAAKDCYEDLMKAGIXDPSKVVRCCLENA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVAKTFL SD VVVEIKE +P+  G P
Sbjct  544   ASVAKTFLTSDAVVVEIKETQPIPRGMP  571



>ref|XP_006348604.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Solanum 
tuberosum]
Length=594

 Score =   521 bits (1341),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 262/383 (68%), Positives = 327/383 (85%), Gaps = 2/383 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  185   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+  L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  245   RIAELHDCKLLLVDKKISNPKELVKFLDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  305   LKVAAIKAPSFGERKSHCLDDIAILTGGTVIRDDMGLTLENAHKDLLGSASKVVITKDST  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+  VSKRV+QI+NL+E   + ++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  365   LIVTDGSTRMAVSKRVSQIQNLVENTQEKFQKKILNERIARLSGGIAIIQVGAQTQVELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNAT+AA EEG+VVGGGC LLRLSSKVDA+KE L+N+++K+GADI KRALS
Sbjct  425   DKQLRIEDALNATRAATEEGVVVGGGCCLLRLSSKVDAIKEMLDNEDQKIGADIFKRALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTKVVRCCLEHA
Sbjct  485   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCLEHA  544

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL+SD VV++I  PEPV
Sbjct  545   AAVAKTFLISDAVVIDI--PEPV  565



>ref|XP_010905780.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Elaeis guineensis]
Length=595

 Score =   521 bits (1341),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 260/383 (68%), Positives = 328/383 (86%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG+MIAEA+ +VGRKGVV +E GK  ENSL++VEGMQFDRGY+SPYFVTD   
Sbjct  176   SAGNDYSVGDMIAEALKRVGRKGVVRIENGKCTENSLQIVEGMQFDRGYLSPYFVTDCAN  235

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE++N K+LLVDKKITNA+++  +L+SA++  +P+LIIAE IE+EALA ++ NKL+G 
Sbjct  236   MSVEFENSKILLVDKKITNAKEMFKLLDSAVKDKYPLLIIAEGIEEEALAPVIRNKLKGV  295

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKV A+KAP FGERKS  +DDIAILTGGTV+R+E+GL+L+ A  +VLG A KVV+TKDS 
Sbjct  296   LKVVAIKAPAFGERKSHCMDDIAILTGGTVVRDEMGLTLENAGKEVLGSAVKVVITKDST  355

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +GSTQ  V KRV Q++NL+E  ++ ++K+ LNERIA+L GG+A+I+VGAQT  ELK
Sbjct  356   LIVTNGSTQHAVEKRVTQLRNLVENTEEKFKKKILNERIARLCGGIAIIKVGAQTVVELK  415

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+EDA+NATK+A+EEG+VVGGGC+LLRLS KVD++KESL+N+E+ +GADI KRALS
Sbjct  416   DKKLRIEDAVNATKSAIEEGVVVGGGCSLLRLSMKVDSIKESLDNEEQMIGADIFKRALS  475

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAG+NG VV EKVLSS++ +YGYNAA   YEDLMAAGI+DPTKVVRCC+EHA
Sbjct  476   YPSKLIAKNAGINGDVVVEKVLSSNDVRYGYNAAKNCYEDLMAAGILDPTKVVRCCVEHA  535

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+VAKTFL SD VVV+ KE EPV
Sbjct  536   AAVAKTFLTSDVVVVDTKEAEPV  558



>ref|XP_010066785.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW64830.1| hypothetical protein EUGRSUZ_G02400 [Eucalyptus grandis]
Length=594

 Score =   520 bits (1339),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 261/390 (67%), Positives = 334/390 (86%), Gaps = 1/390 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN++ VG+MI +A  +VGR+GVVT+E+GK  E+SL++VEGMQFDRGY+SPYFV D +K
Sbjct  185   SAGNDHAVGSMIFDAFRQVGRRGVVTIEKGKCTESSLQIVEGMQFDRGYLSPYFVNDRKK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ NCKLLLVDKKITN +D+  +++SA++  +PIL++AE IEQEALA L+ NKLRG 
Sbjct  245   MTVEFHNCKLLLVDKKITNPKDMFKIMDSAVKEKYPILVVAEGIEQEALAPLIRNKLRGV  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDDIAILTGGTVIR+++GL+L+KA  +VLG A+KVV+TK+S 
Sbjct  305   LKVAAIKAPAFGERKSHCLDDIAILTGGTVIRDDMGLTLEKATKEVLGTASKVVVTKNST  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST++ V +RV+QI+ L++  D++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  365   LIVTDGSTRKAVEERVSQIRGLVKNTDENFQKKILNERIARLSGGIAILQVGAQTQVELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+V+GGGC+LLRLS+KVD +KE L+N+E+K+GA+I K+ALS
Sbjct  425   DKQLRIEDALNATKAAIEEGVVIGGGCSLLRLSTKVDCIKEHLDNEEQKIGAEIFKKALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP + IAKNAGVNGSVV EKVLSS+   YGYNAA   YEDL+AAGI+DPTKVVRC LEHA
Sbjct  485   YPARQIAKNAGVNGSVVVEKVLSSNVMNYGYNAARDCYEDLLAAGIMDPTKVVRCSLEHA  544

Query  523   ASVAKTFLMSDCVVVEIKEPE-PVMAGNPM  437
             ASVAKTFL SD VVV+IKE E P+    PM
Sbjct  545   ASVAKTFLTSDAVVVDIKEVEQPIRMPMPM  574



>ref|XP_011077788.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Sesamum indicum]
Length=584

 Score =   519 bits (1337),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 256/395 (65%), Positives = 333/395 (84%), Gaps = 0/395 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+ A+ +VGR GVVT+E+G  AEN+L +VEGMQFDRGY+SPYFVTD +K
Sbjct  186   SAGNDYVLGNMISYALQQVGRWGVVTIEKGNYAENNLEIVEGMQFDRGYLSPYFVTDRQK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKIT+ R+L  +L++A++  +P++I+AE IEQEALA ++ NKLRG 
Sbjct  246   MTVEFHDCKLLLVDKKITDPRELFKILDNAVKEKYPVVIVAEGIEQEALAPVIRNKLRGV  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKSQYL+DIA+LTGGTVIR+E+GL+L+ A+ D+LG A+KVV+TKDS 
Sbjct  306   LKAAAIKAPAFGERKSQYLEDIAVLTGGTVIRDEMGLNLENANKDMLGSASKVVITKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQE V  RV+Q++ L++   + ++K+ LNERIA+LSGG+A++QVGAQT  ELK
Sbjct  366   LIVTDGSTQEAVKNRVSQMQRLVDNTVEKFQKKILNERIARLSGGIAILQVGAQTVVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR EDALNATKAA+EEG+VVGGGC LLRLS+K+D+++E L+N+E+++GADI+KRAL+
Sbjct  426   DKQLRAEDALNATKAAIEEGVVVGGGCCLLRLSTKIDSVREGLDNEEQRIGADILKRALA  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP + IAKNAGVNG+ V  K+LSSD+  +GYNAA   YEDLMAAGI+DP+KVVRCCLEHA
Sbjct  486   YPTRQIAKNAGVNGNTVINKILSSDDINFGYNAARDRYEDLMAAGILDPSKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSGYG  419
             ASVAKTFL +D VV+EIKEP   +   P+  SG G
Sbjct  546   ASVAKTFLTADAVVIEIKEPVSKVLRKPIPTSGIG  580



>ref|XP_011009115.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Populus euphratica]
Length=592

 Score =   519 bits (1336),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 257/389 (66%), Positives = 332/389 (85%), Gaps = 4/389 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VGR+GVVT+E+G+  EN L +VEGMQFDRGY+SPYFVTD ++
Sbjct  183   SAGNDYTVGNMISDALQQVGRRGVVTIEKGRCTENILEIVEGMQFDRGYLSPYFVTDRQR  242

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E+ NCKLLLVDKKI NA+++  +L++A++  +PI+I+AED++QEALA ++ NKL+G 
Sbjct  243   MVAEFHNCKLLLVDKKIQNAKEVFKILDNAVKEMYPIVIVAEDVDQEALAPIIRNKLKGL  302

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTVIR+++GL L+KA  +VLG A KVV+TKDS 
Sbjct  303   LKGAAIKAPAFGERKSHYLDDIAILTGGTVIRDDMGLKLEKAGKEVLGTATKVVITKDST  362

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI +L+E  ++ ++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  363   LIVTDGSTREAVEKRVSQICSLVENTEEKFQKKILNERIARLSGGIAILQVGAQTQVELK  422

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K LR+EDALNATKAA+EEG+VVGGGC+LLRLS+KVD +KE L+N+E+K+GA+I KRALS
Sbjct  423   DKLLRIEDALNATKAAIEEGVVVGGGCSLLRLSTKVDGIKEFLDNEEQKIGAEIFKRALS  482

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP +LIAKN+GVNG+VV  +VLS+ + +YGYNAAT  YEDL+ AGIIDPTKVVRCCLEHA
Sbjct  483   YPARLIAKNSGVNGNVVINQVLSNADIRYGYNAATDTYEDLITAGIIDPTKVVRCCLEHA  542

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
              SVAKTFL SD VVV+I+E +P+    PM
Sbjct  543   TSVAKTFLTSDAVVVDIRESDPL----PM  567



>ref|XP_003516734.2| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Glycine max]
 gb|KHN31084.1| Chaperonin 60 subunit beta 4, chloroplastic [Glycine soja]
Length=605

 Score =   515 bits (1327),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 259/395 (66%), Positives = 326/395 (83%), Gaps = 2/395 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI+EA+ +VGR GVVT+E G+S ENSL +VEGMQFDRGY+SPYFV +  K
Sbjct  181   SAGNDYSVGNMISEALHQVGRSGVVTIETGRSTENSLEIVEGMQFDRGYLSPYFVNNRRK  240

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE  NCKLLLVDKKIT  ++LIN+L ++ +  +P+LI+AE IEQEALA ++ NKLRGA
Sbjct  241   MTVELHNCKLLLVDKKITKTKELINILNNSAKEKYPVLIVAEGIEQEALAPVIKNKLRGA  300

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERK+ YL+DIAILTGGTVIRE++G +L+KA  + LG A KVV+TK+S 
Sbjct  301   LKVAAIKAPAFGERKTHYLEDIAILTGGTVIREDMGFNLEKAHKNDLGSATKVVITKNST  360

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV Q++ L+E   ++++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  361   LIVTDGSTREAVEKRVCQLRRLVENTVENFQKKILNERIARLSGGIAILQVGAQTQVELK  420

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC LLRLS KVD +K+ LEN+E+++GA+I +RALS
Sbjct  421   DKQLRIEDALNATKAAIEEGVVVGGGCCLLRLSQKVDGIKKLLENEEQQIGAEIFRRALS  480

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP ++IAKNAGVNG+V+ +KVLS DN  +GYNAA   YEDLM AGI+DPTKVVRCC+EH+
Sbjct  481   YPTRMIAKNAGVNGNVIIDKVLSDDNLNFGYNAARDCYEDLMKAGIMDPTKVVRCCIEHS  540

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNPMDNSG  425
             ASVAK FL S  VVVE KE  P P+    PM  SG
Sbjct  541   ASVAKAFLTSSAVVVERKELKPIPIPRRKPMPTSG  575



>ref|XP_010460336.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=551

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/388 (66%), Positives = 327/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR GVVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  129   SAGNDYEVGNMISNAFQQVGRAGVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  188

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  189   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  248

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  249   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  308

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  309   LIVTNGDTQKAVDERVSQIKNLIQNTNESFQKKILNERVARLSGGIAIIQVGAQTQVELK  368

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  369   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALS  428

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVLS+ N  YGYNAA   YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  429   YPIRLIAKNAGTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMSAGIIDPTKVVRCCLEHA  488

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE +P    NP
Sbjct  489   ASVAQTFLTSDCVVVEIKEIKPRPIINP  516



>ref|NP_001185097.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
 gb|AEE30664.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
Length=559

 Score =   513 bits (1322),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 257/388 (66%), Positives = 326/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR GVVT+E+GK   N+L +VEGMQF+RGY+SPYFVTD  K
Sbjct  137   SAGNDYEVGNMISNAFQQVGRTGVVTIEKGKYLVNNLEIVEGMQFNRGYLSPYFVTDRRK  196

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L+SA++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  197   REAEFHDCKLLLVDKKITNPKDMFKILDSAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  256

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  257   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  316

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLIE  +++++K+ LNER+A+LSGG+A+IQVGA T+ ELK
Sbjct  317   LIVTNGFTQKAVDERVSQIKNLIENTEENFQKKILNERVARLSGGIAIIQVGALTQVELK  376

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD +KE+L+N E+K+GA+I K+ALS
Sbjct  377   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLATKVDRIKETLDNTEQKIGAEIFKKALS  436

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNA  NG++V EKVLS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  437   YPIRLIAKNADTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  496

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             +SVA+TFL SDCVVVEIKE +P    NP
Sbjct  497   SSVAQTFLTSDCVVVEIKEIKPRPIINP  524



>ref|XP_011009108.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Populus euphratica]
Length=593

 Score =   514 bits (1325),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 255/384 (66%), Positives = 330/384 (86%), Gaps = 1/384 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VGR+GVVT+E+G+  EN L +VEGMQFDRGY+SPYFVTD ++
Sbjct  183   SAGNDYTVGNMISDALQQVGRRGVVTIEKGRCTENILEIVEGMQFDRGYLSPYFVTDRQR  242

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E+ NCKLLLVDKKI NA+++  +L++A++  +PI+I+AED++QEALA ++ NKL+G 
Sbjct  243   MVAEFHNCKLLLVDKKIQNAKEVFKILDNAVKEMYPIVIVAEDVDQEALAPIIRNKLKGL  302

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTVIR+++GL L+KA  +VLG A KVV+TKDS 
Sbjct  303   LKGAAIKAPAFGERKSHYLDDIAILTGGTVIRDDMGLKLEKAGKEVLGTATKVVITKDST  362

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI +L+E  ++ ++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  363   LIVTDGSTREAVEKRVSQICSLVENTEEKFQKKILNERIARLSGGIAILQVGAQTQVELK  422

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEK-VGADIVKRAL  707
             +K LR+EDALNATKAA+EEG+VVGGGC+LLRLS+KVD +KE L+N+E+K +GA+I KRAL
Sbjct  423   DKLLRIEDALNATKAAIEEGVVVGGGCSLLRLSTKVDGIKEFLDNEEQKMIGAEIFKRAL  482

Query  706   SYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             SYP +LIAKN+GVNG+VV  +VLS+ + +YGYNAAT  YEDL+ AGIIDPTKVVRCCLEH
Sbjct  483   SYPARLIAKNSGVNGNVVINQVLSNADIRYGYNAATDTYEDLITAGIIDPTKVVRCCLEH  542

Query  526   AASVAKTFLMSDCVVVEIKEPEPV  455
             A SVAKTFL SD VVV+I+E +P+
Sbjct  543   ATSVAKTFLTSDAVVVDIRESDPL  566



>ref|NP_173947.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
 sp|Q9C667.1|CPNB4_ARATH RecName: Full=Chaperonin 60 subunit beta 4, chloroplastic; Short=CPN-60 
beta 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG50688.1|AC079829_21 chaperonin precursor, putative [Arabidopsis thaliana]
 gb|AEE30663.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
Length=611

 Score =   514 bits (1325),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 257/388 (66%), Positives = 326/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR GVVT+E+GK   N+L +VEGMQF+RGY+SPYFVTD  K
Sbjct  189   SAGNDYEVGNMISNAFQQVGRTGVVTIEKGKYLVNNLEIVEGMQFNRGYLSPYFVTDRRK  248

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L+SA++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  249   REAEFHDCKLLLVDKKITNPKDMFKILDSAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  308

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  309   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  368

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLIE  +++++K+ LNER+A+LSGG+A+IQVGA T+ ELK
Sbjct  369   LIVTNGFTQKAVDERVSQIKNLIENTEENFQKKILNERVARLSGGIAIIQVGALTQVELK  428

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD +KE+L+N E+K+GA+I K+ALS
Sbjct  429   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLATKVDRIKETLDNTEQKIGAEIFKKALS  488

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNA  NG++V EKVLS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  489   YPIRLIAKNADTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  548

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             +SVA+TFL SDCVVVEIKE +P    NP
Sbjct  549   SSVAQTFLTSDCVVVEIKEIKPRPIINP  576



>ref|XP_010460335.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=636

 Score =   515 bits (1326),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 257/390 (66%), Positives = 329/390 (84%), Gaps = 4/390 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR GVVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  214   SAGNDYEVGNMISNAFQQVGRAGVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  274   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  334   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  394   LIVTNGDTQKAVDERVSQIKNLIQNTNESFQKKILNERVARLSGGIAIIQVGAQTQVELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  454   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVLS+ N  YGYNAA   YEDLM+AGIIDPTKVVRCCLEHA
Sbjct  514   YPIRLIAKNAGTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMSAGIIDPTKVVRCCLEHA  573

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE  P P++  NP
Sbjct  574   ASVAQTFLTSDCVVVEIKEIKPRPII--NP  601



>ref|XP_004490321.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=578

 Score =   513 bits (1321),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 329/396 (83%), Gaps = 1/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI+EA+ KVGRKGVVT+ +GK  E+SL +VEGMQFDRGY+SPYFVT+  K
Sbjct  179   SAGNDYVVGEMISEALDKVGRKGVVTIGKGKYIESSLEIVEGMQFDRGYLSPYFVTNRRK  238

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE  NCKLLLVDKKITN ++L+N+L  A++  + ILI+AE IEQEALA ++ NKL G 
Sbjct  239   MTVELHNCKLLLVDKKITNPKELLNILNDAVKEKYSILIVAEGIEQEALAPVIKNKLSGV  298

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKSQYL+DIAILTGG VIRE++G +L+KA  +VLG A KVV+TKDS 
Sbjct  299   LKVAAIKAPAFGERKSQYLEDIAILTGGIVIREDMGFTLEKASKNVLGSATKVVITKDST  358

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              +V DGST+  V KRV Q++ L+E  D++++K  LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  359   LLVTDGSTRPSVEKRVNQLRRLVENTDENFQKNILNERIARLSGGIAILQVGAQTQVELK  418

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNAT+AA+EEG+VVGGGC+LLRLS KVD +K  L+N+E+K+GA+I KRALS
Sbjct  419   DKQLRIEDALNATRAAIEEGVVVGGGCSLLRLSMKVDGIKSLLDNEEQKIGAEIFKRALS  478

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP ++IAKNAGVNG++V +KVLS+DN  +GYNAA   YEDLM A I+DPTKVVRCC+EHA
Sbjct  479   YPARMIAKNAGVNGNIVIDKVLSNDNMNFGYNAARDCYEDLMKARIMDPTKVVRCCIEHA  538

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM-DNSGYG  419
             ASVAKTFL S+ VV+++KE +P+    PM  +SG G
Sbjct  539   ASVAKTFLTSNAVVIDLKELQPLPQRKPMAASSGLG  574



>ref|XP_004297181.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=616

 Score =   514 bits (1324),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 321/383 (84%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI  A+ +VG+KGVV++E+GKS EN+L+VVEGMQFDRGY+SPYFVTD +K
Sbjct  184   SAGNDYTVGNMIYSALCQVGKKGVVSIEKGKSTENTLQVVEGMQFDRGYLSPYFVTDRQK  243

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+  CKLLLVDK IT+  +L  +L++A++  + I+I+AE IEQEAL  ++ NKLRGA
Sbjct  244   MIVEFQECKLLLVDKIITHPEELFKILDNAVKEKYAIVIVAEGIEQEALTPVIRNKLRGA  303

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK  A+KAP FGERKS YLDDIAILTG TV+REE+G+ L K   +VLG A KVV+TKD+ 
Sbjct  304   LKAVAIKAPAFGERKSHYLDDIAILTGATVVREEMGMILHKTGPEVLGTATKVVITKDTT  363

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V+KRV+QI+ L+E   ++++K+ LNERI +LSGG+A++QVGAQT+ ELK
Sbjct  364   LIVTDGSTREAVNKRVSQIQRLVENTKEEFQKKILNERIGRLSGGIAILQVGAQTQVELK  423

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC LLRLS KVD  KE ++N+E+K+GA+I K+ALS
Sbjct  424   DKQLRIEDALNATKAAIEEGVVVGGGCCLLRLSKKVDVFKELMDNEEQKIGAEIFKKALS  483

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAGVNGSVV EKVLS+ N  YGYNAA   YEDLM AGI+DP+KVVRCCLEHA
Sbjct  484   YPAKLIAKNAGVNGSVVVEKVLSNANMGYGYNAARDCYEDLMKAGIMDPSKVVRCCLEHA  543

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             ASVAKTFL+SD VVVEIKE  P+
Sbjct  544   ASVAKTFLLSDAVVVEIKESNPI  566



>dbj|BAD95277.1| chaperonin precursor [Arabidopsis thaliana]
Length=611

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 257/388 (66%), Positives = 326/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR GVVT+E+GK   N+L +VEGMQF+RGY+SPYFVTD  K
Sbjct  189   SAGNDYEVGNMISNAFQQVGRTGVVTIEKGKYLVNNLEIVEGMQFNRGYLSPYFVTDRRK  248

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L+SA++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  249   REAEFHDCKLLLVDKKITNPKDMFKILDSAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  308

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  309   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  368

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLIE  +++++K+ LNER+A+LSGG+A+IQVGA T+ ELK
Sbjct  369   LIVTNGFTQKAVDERVSQIKNLIENNEENFQKKILNERVARLSGGIAIIQVGALTQVELK  428

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD +KE+L+N E+K+GA+I K+ALS
Sbjct  429   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLATKVDRIKETLDNTEQKIGAEIFKKALS  488

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNA  NG++V EKVLS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  489   YPIRLIAKNADTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  548

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             +SVA+TFL SDCVVVEIKE +P    NP
Sbjct  549   SSVAQTFLTSDCVVVEIKEIKPRPIINP  576



>ref|XP_006574985.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Glycine 
max]
 gb|KHN29911.1| Chaperonin 60 subunit beta 4, chloroplastic [Glycine soja]
Length=605

 Score =   513 bits (1320),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/397 (65%), Positives = 327/397 (82%), Gaps = 4/397 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI+EA+ KVGR GVVT+E G+S EN L +VEGMQFDRGY+SPYFV +  K
Sbjct  181   SAGNDYSVGNMISEALHKVGRMGVVTIETGRSTENCLEIVEGMQFDRGYLSPYFVNNRRK  240

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE  NCKLLLVDKKIT  ++LIN+L ++ +  +P+LI+AE IEQEALA ++ NKLRGA
Sbjct  241   MTVELHNCKLLLVDKKITKTKELINILNNSAKEKYPVLIVAEGIEQEALAPVIKNKLRGA  300

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERK+ YL+DIAILTGGTVIRE++G +L+KA  + LG A KVV+TK+S 
Sbjct  301   LKVAAIKAPAFGERKTHYLEDIAILTGGTVIREDMGFTLEKAHKNDLGSATKVVITKNST  360

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV Q++ L+E   ++++K  LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  361   LIVTDGSTREAVEKRVHQLRRLVENTVENFQKNILNERIARLSGGIAILQVGAQTQVELK  420

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LRVEDALNATKAA+EEG+VVGGGC+LLRLS KVD +K+ L+N+E+++GA+I +RALS
Sbjct  421   DKQLRVEDALNATKAAIEEGVVVGGGCSLLRLSQKVDGIKKLLDNEEQQIGAEIFRRALS  480

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP ++IAKNAG+NG+V+ +KVLS +N  +GYNAA  +YEDLM AGI+DPTKVVRCC+EH+
Sbjct  481   YPTRMIAKNAGLNGNVIIDKVLSDNNMNFGYNAARDSYEDLMKAGIMDPTKVVRCCIEHS  540

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGN----PMDNSG  425
             ASVAK FL S+ VVVE KE EP+        PM  SG
Sbjct  541   ASVAKAFLTSNAVVVERKELEPIPMPRRKSMPMPTSG  577



>ref|XP_010477881.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=551

 Score =   511 bits (1315),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 325/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR  VVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  129   SAGNDYEVGNMISNAFQQVGRAAVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  188

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  189   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  248

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  249   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  308

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  309   LIVTNGDTQKAVDERVSQIKNLIQNTEESFQKKILNERVARLSGGIAIIQVGAQTQVELK  368

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  369   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDKIKDTLDNSEQKIGAEIFKKALS  428

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVLS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  429   YPIRLIAKNAGTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  488

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE +P    NP
Sbjct  489   ASVAQTFLTSDCVVVEIKEIKPRPIINP  516



>ref|XP_010499067.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Camelina sativa]
Length=551

 Score =   509 bits (1312),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 254/388 (65%), Positives = 325/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR  VVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  129   SAGNDYEVGNMISNAFQQVGRAAVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  188

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  189   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  248

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  249   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  308

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  309   LIVTNGDTQKAVDERVSQIKNLIQNTNESFQKKILNERVARLSGGIAIIQVGAQTQVELK  368

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  369   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALS  428

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EK+LS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  429   YPIRLIAKNAGTNGNIVIEKILSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  488

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE +P    NP
Sbjct  489   ASVAQTFLTSDCVVVEIKEIKPRPIINP  516



>ref|XP_010477879.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010477880.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=607

 Score =   511 bits (1317),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 256/390 (66%), Positives = 327/390 (84%), Gaps = 4/390 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR  VVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  185   SAGNDYEVGNMISNAFQQVGRAAVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  245   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  305   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  365   LIVTNGDTQKAVDERVSQIKNLIQNTEESFQKKILNERVARLSGGIAIIQVGAQTQVELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  425   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDKIKDTLDNSEQKIGAEIFKKALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVLS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  485   YPIRLIAKNAGTNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  544

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE  P P++  NP
Sbjct  545   ASVAQTFLTSDCVVVEIKEIKPRPII--NP  572



>ref|XP_007045690.1| TCP-1/cpn60 chaperonin family protein isoform 2 [Theobroma cacao]
 gb|EOY01522.1| TCP-1/cpn60 chaperonin family protein isoform 2 [Theobroma cacao]
Length=448

 Score =   505 bits (1301),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 253/377 (67%), Positives = 322/377 (85%), Gaps = 0/377 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI++A+  VGR+GVV +E+GK  ENSL++VEGMQ DRGY+SPYFVTD EK
Sbjct  40    SAGNDYTVGKMISDALQHVGRRGVVKIEKGKCNENSLQIVEGMQLDRGYLSPYFVTDPEK  99

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ NCKLLLVDKKIT+ +++  +L+SA++  +PI+I+AEDIEQEALA ++ NKL+G 
Sbjct  100   RIVEFHNCKLLLVDKKITHPKEMFKILDSAVKEKYPIVIVAEDIEQEALAPVIRNKLKGV  159

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDDIAILTG TVIR+++GL+LD+A  +VLG A KVV+TKDS 
Sbjct  160   LKAAAIKAPAFGERKSHCLDDIAILTGATVIRDDMGLTLDRAGKEVLGTATKVVITKDST  219

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              +V DG+T+E V KRV+QI+ L+E  +++++K+ LN+RIA+LSG +A++QVGAQT+ ELK
Sbjct  220   YVVSDGNTREAVQKRVSQIERLVENTEENFQKKILNDRIAQLSGRIAILQVGAQTQVELK  279

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR EDALNATKAA+EEG+VVGGGC LLRLS+KVD +K  L+N E+K+GA+I KRALS
Sbjct  280   DKQLRNEDALNATKAAIEEGVVVGGGCILLRLSAKVDGIKSLLDNQEQKIGAEIFKRALS  339

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAGVNGSVV  KVLS+D+ +YGYNAA+ +YEDLM AGI+DPTKVVRCCLE+A
Sbjct  340   YPTKLIAKNAGVNGSVVVGKVLSNDDIRYGYNAASNSYEDLMKAGIMDPTKVVRCCLENA  399

Query  523   ASVAKTFLMSDCVVVEI  473
             ASVAKTFL SD VVV+I
Sbjct  400   ASVAKTFLTSDAVVVDI  416



>ref|XP_010499065.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Camelina sativa]
Length=636

 Score =   511 bits (1317),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/390 (65%), Positives = 327/390 (84%), Gaps = 4/390 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR  VVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  214   SAGNDYEVGNMISNAFQQVGRAAVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  273

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  274   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  333

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  334   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  393

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  394   LIVTNGDTQKAVDERVSQIKNLIQNTNESFQKKILNERVARLSGGIAIIQVGAQTQVELK  453

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  454   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALS  513

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EK+LS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  514   YPIRLIAKNAGTNGNIVIEKILSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  573

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE  P P++  NP
Sbjct  574   ASVAQTFLTSDCVVVEIKEIKPRPII--NP  601



>ref|XP_010499066.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Camelina sativa]
Length=608

 Score =   510 bits (1314),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/390 (65%), Positives = 327/390 (84%), Gaps = 4/390 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMI+ A  +VGR  VVT+E+G+   N+L +VEGMQF+RGY+S YFVTD  K
Sbjct  186   SAGNDYEVGNMISNAFQQVGRAAVVTIEKGRYLVNNLEIVEGMQFNRGYLSQYFVTDRRK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E+ +CKLLLVDKKITN +D+  +L++A++  FP+LI+AEDIEQ+ALA ++ NKL+G 
Sbjct  246   REAEFHDCKLLLVDKKITNPKDMFKILDAAVKEEFPVLIVAEDIEQDALAPVIRNKLKGN  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS  LDD+AI TG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  306   LKVAAIKAPAFGERKSHCLDDLAIFTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIKNLI+  ++ ++K+ LNER+A+LSGG+A+IQVGAQT+ ELK
Sbjct  366   LIVTNGDTQKAVDERVSQIKNLIQNTNESFQKKILNERVARLSGGIAIIQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD +K++L+N E+K+GA+I K+ALS
Sbjct  426   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EK+LS+ N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  486   YPIRLIAKNAGTNGNIVIEKILSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNP  440
             ASVA+TFL SDCVVVEIKE  P P++  NP
Sbjct  546   ASVAQTFLTSDCVVVEIKEIKPRPII--NP  573



>ref|XP_008446494.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Cucumis melo]
Length=553

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 254/393 (65%), Positives = 328/393 (83%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGN++++A+ +VG KGVV +E+GKS +NSL++VEGMQFDRGY+SPYFVTD  K
Sbjct  154   SAGNDYAVGNLVSDALRQVGWKGVVQIEKGKSVDNSLQIVEGMQFDRGYLSPYFVTDRRK  213

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKI++ +++  +L+SA++  +PI+I+AE IEQEALA ++ NKLRG 
Sbjct  214   MVVEFHDCKLLLVDKKISDPKEMFKILDSAVKEKYPIVILAEGIEQEALAPVIRNKLRGV  273

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIA LTG TV+RE+ GL+L+K   +VLG A KVV++KDS 
Sbjct  274   LKAAAIKAPAFGERKSHYLDDIATLTGATVVREDNGLTLEKTGKEVLGSACKVVISKDST  333

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+T+E V KRV QI+ L+E  ++ + K+ LNERIA+LSG +A+IQVGAQTE ELK
Sbjct  334   LIVTDGNTREAVQKRVIQIQKLMENTEEKFPKKILNERIARLSGRIAIIQVGAQTEVELK  393

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +++LR+EDALNA+KAA+EEG+VVGGGC LLRLS+KVDA+K  LENDE+ +GA+I KRALS
Sbjct  394   DRQLRIEDALNASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMIGAEIFKRALS  453

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIA+NAGVNGSVV +K+LS+++  YGYNAAT  YE+LM AGI+DP+KVVRCCLEHA
Sbjct  454   YPTKLIARNAGVNGSVVIDKILSNNDLDYGYNAATDRYENLMKAGIMDPSKVVRCCLEHA  513

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASV+KTFL SD VVV++KE + +    PM  SG
Sbjct  514   ASVSKTFLTSDAVVVDMKESQLIPRRTPMPISG  546



>ref|XP_010552083.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   511 bits (1315),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 256/408 (63%), Positives = 334/408 (82%), Gaps = 3/408 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMIA+A+ KVGR G+VT+E+GK  ENSL++VEGMQF+RG++SPYFVTD  K
Sbjct  195   SAGNDYEVGNMIADALRKVGRTGLVTIEKGKCLENSLQIVEGMQFNRGFLSPYFVTDRRK  254

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E+ +CKLLLVD+KITN +++  +L+SA++  FP+LI+AEDIEQEALA ++ NKL+G 
Sbjct  255   MEAEFHDCKLLLVDRKITNPKEMFKILDSAVKEDFPVLIVAEDIEQEALAPVIRNKLKGN  314

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDD+AILTG TVIR+E+G+SL+KA  +VLG A ++++TKDS 
Sbjct  315   LKAAAIKAPAFGERKSHCLDDLAILTGATVIRDEMGMSLEKAGKEVLGTATRILVTKDST  374

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGS +  V +RV QIK LIE  + +++K  LNER+A+L+GG+A+I+VGAQT+ ELK
Sbjct  375   LIVTDGSNRGAVEERVCQIKKLIENTEGNFQKNILNERVARLAGGIAIIRVGAQTQVELK  434

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L++EDALNATK+A+EEG+VVGGGC LLRLSSKVD +K+ LEN E+K+GA+I K+ALS
Sbjct  435   DKQLKIEDALNATKSAIEEGVVVGGGCALLRLSSKVDRIKDILENTEQKIGAEIFKKALS  494

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVL+S+N  YGYNAA   YEDLM A I+DPTKVVRCCLEHA
Sbjct  495   YPIRLIAKNAGANGNIVVEKVLASENVTYGYNAAKNVYEDLMLARIMDPTKVVRCCLEHA  554

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNPMDNSGYGY*VRSTELETW  386
             ASVAKTFL S+ VVVEIKE  P P++   P+  S   +   S  ++ +
Sbjct  555   ASVAKTFLTSEAVVVEIKEIRPRPII-NPPLPTSSASHIFPSKRMKRF  601



>emb|CDY20555.1| BnaC07g12220D [Brassica napus]
Length=607

 Score =   509 bits (1312),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 257/388 (66%), Positives = 326/388 (84%), Gaps = 0/388 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMIA A  +VGR GVVT+E+GK   N+L VVEGMQF+RGY+SPYFVTD  K
Sbjct  186   SAGNDYEVGNMIANAFQQVGRSGVVTIEKGKYLVNNLEVVEGMQFNRGYLSPYFVTDRRK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ +CKLLLVDKKITN +D+  +L+SA++  FP+LI+AE+IEQ+ALA ++ NKL+G 
Sbjct  246   REVEFHDCKLLLVDKKITNPKDMFKILDSAVKEEFPVLIVAEEIEQDALAPVIRNKLKGN  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDD+AILTG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  306   LKAAAIKAPSFGERKSHCLDDLAILTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIK L++  +++++K+ LNERIA+LSGG+A IQVGAQT+ ELK
Sbjct  366   LIVTNGDTQKAVEERVSQIKKLVQNTEENFQKKILNERIARLSGGIASIQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD++K++L+N E+K+GA+I K+ALS
Sbjct  426   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLAAKVDSIKDTLDNTEQKIGAEIFKKALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVL ++N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  486   YPIRLIAKNAGTNGNIVIEKVLLNENMMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVA TFL SD VVVEIKE +P    NP
Sbjct  546   ASVANTFLTSDAVVVEIKENKPRPMINP  573



>ref|XP_009103088.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Brassica rapa]
Length=566

 Score =   508 bits (1308),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 329/393 (84%), Gaps = 1/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMIA A  +VGR GVVT+E+GK   N+L VVEGMQF+RGY+SPYFVTD  K
Sbjct  145   SAGNDYEVGNMIANAFQQVGRSGVVTIEKGKYLVNNLEVVEGMQFNRGYLSPYFVTDRRK  204

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ +CKLLLVD+KITN +D+  +L+SA++  FP+LI+AE+IEQ+ALA ++ NKL+G 
Sbjct  205   REVEFHDCKLLLVDEKITNPKDMFKILDSAVKEEFPVLIVAEEIEQDALAPVIRNKLKGN  264

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDD+AILTG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  265   LKAAAIKAPSFGERKSHCLDDLAILTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  324

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIK L++  +++++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  325   LIVTNGDTQKAVEERVSQIKKLVQNTEENFQKKILNERIARLSGGIALIQVGAQTQVELK  384

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD++K++L+N E+K+GA+I K+ALS
Sbjct  385   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLAAKVDSIKDTLDNTEQKIGAEIFKKALS  444

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVL ++N  YGYNAA   YEDLM AGIIDP+KVVRCCLEHA
Sbjct  445   YPIRLIAKNAGTNGNIVIEKVLLNENMMYGYNAAKNQYEDLMMAGIIDPSKVVRCCLEHA  504

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNS  428
             ASVA TFL SD VVVEIKE +P  M   PM  S
Sbjct  505   ASVANTFLTSDAVVVEIKENKPRPMINPPMPTS  537



>ref|XP_008446493.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Cucumis melo]
Length=599

 Score =   509 bits (1310),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 254/393 (65%), Positives = 328/393 (83%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGN++++A+ +VG KGVV +E+GKS +NSL++VEGMQFDRGY+SPYFVTD  K
Sbjct  200   SAGNDYAVGNLVSDALRQVGWKGVVQIEKGKSVDNSLQIVEGMQFDRGYLSPYFVTDRRK  259

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKI++ +++  +L+SA++  +PI+I+AE IEQEALA ++ NKLRG 
Sbjct  260   MVVEFHDCKLLLVDKKISDPKEMFKILDSAVKEKYPIVILAEGIEQEALAPVIRNKLRGV  319

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIA LTG TV+RE+ GL+L+K   +VLG A KVV++KDS 
Sbjct  320   LKAAAIKAPAFGERKSHYLDDIATLTGATVVREDNGLTLEKTGKEVLGSACKVVISKDST  379

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+T+E V KRV QI+ L+E  ++ + K+ LNERIA+LSG +A+IQVGAQTE ELK
Sbjct  380   LIVTDGNTREAVQKRVIQIQKLMENTEEKFPKKILNERIARLSGRIAIIQVGAQTEVELK  439

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +++LR+EDALNA+KAA+EEG+VVGGGC LLRLS+KVDA+K  LENDE+ +GA+I KRALS
Sbjct  440   DRQLRIEDALNASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMIGAEIFKRALS  499

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIA+NAGVNGSVV +K+LS+++  YGYNAAT  YE+LM AGI+DP+KVVRCCLEHA
Sbjct  500   YPTKLIARNAGVNGSVVIDKILSNNDLDYGYNAATDRYENLMKAGIMDPSKVVRCCLEHA  559

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASV+KTFL SD VVV++KE + +    PM  SG
Sbjct  560   ASVSKTFLTSDAVVVDMKESQLIPRRTPMPISG  592



>ref|XP_009103087.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Brassica rapa]
Length=607

 Score =   509 bits (1310),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 329/393 (84%), Gaps = 1/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMIA A  +VGR GVVT+E+GK   N+L VVEGMQF+RGY+SPYFVTD  K
Sbjct  186   SAGNDYEVGNMIANAFQQVGRSGVVTIEKGKYLVNNLEVVEGMQFNRGYLSPYFVTDRRK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ +CKLLLVD+KITN +D+  +L+SA++  FP+LI+AE+IEQ+ALA ++ NKL+G 
Sbjct  246   REVEFHDCKLLLVDEKITNPKDMFKILDSAVKEEFPVLIVAEEIEQDALAPVIRNKLKGN  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDD+AILTG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  306   LKAAAIKAPSFGERKSHCLDDLAILTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIK L++  +++++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  366   LIVTNGDTQKAVEERVSQIKKLVQNTEENFQKKILNERIARLSGGIALIQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL++KVD++K++L+N E+K+GA+I K+ALS
Sbjct  426   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLAAKVDSIKDTLDNTEQKIGAEIFKKALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVL ++N  YGYNAA   YEDLM AGIIDP+KVVRCCLEHA
Sbjct  486   YPIRLIAKNAGTNGNIVIEKVLLNENMMYGYNAAKNQYEDLMMAGIIDPSKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNS  428
             ASVA TFL SD VVVEIKE +P  M   PM  S
Sbjct  546   ASVANTFLTSDAVVVEIKENKPRPMINPPMPTS  578



>ref|XP_009418029.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=591

 Score =   508 bits (1307),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 249/383 (65%), Positives = 324/383 (85%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN++ VG+MIAEA+ +VGRKGVV +E+G+S EN L++VEGMQFDRGY+SPYFVT+   
Sbjct  176   SAGNDHAVGSMIAEAVRRVGRKGVVRIEDGRSTENGLQIVEGMQFDRGYLSPYFVTNRAD  235

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++NCK+LL+DKKITNAR+++ +L+ A++  FP+LI+AED E EALA ++ NKL+G 
Sbjct  236   MLVEFNNCKILLIDKKITNAREMLKILDGAVKENFPLLIVAEDFEPEALAPVIRNKLKGV  295

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERK+ YL+DIA+LTGGTVIR+++GL+LD    +VLG + KV++ KDS 
Sbjct  296   LKAAAIKAPSFGERKTDYLNDIAVLTGGTVIRDDMGLTLDTVGKEVLGSSVKVIIGKDST  355

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  V KRVAQI++L + +++ ++K+ LNERIA+L GG+A+IQVGAQT  ELK
Sbjct  356   LIVTDGSTQHAVEKRVAQIRSLEQYSEEKFQKKILNERIARLCGGIAIIQVGAQTVVELK  415

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+ED+LNATKAA+EEG+VVGGGCTLLRLS+ VD +K+ L+N+E+K+GADI KRALS
Sbjct  416   DKKLRIEDSLNATKAAIEEGVVVGGGCTLLRLSTMVDGIKDYLDNEEQKIGADIFKRALS  475

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAGVNG V+  KVLS+D+ +YGYNAA   YEDL+AAGI+DP+KVVRCCLEHA
Sbjct  476   YPAKLIAKNAGVNGDVIVNKVLSNDDIRYGYNAAMNCYEDLVAAGILDPSKVVRCCLEHA  535

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             A+ AKTFL SD VVV++K  E +
Sbjct  536   AATAKTFLTSDLVVVDVKGTETI  558



>gb|EYU28916.1| hypothetical protein MIMGU_mgv1a003338mg [Erythranthe guttata]
Length=591

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 331/400 (83%), Gaps = 5/400 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+G VT+E+G  AE++L +V+GM+FDRG++S YFVTD +K
Sbjct  186   SAGNDYIIGNMISEAIRQVGRRGFVTIEKGNYAESNLEIVKGMKFDRGFLSQYFVTDRKK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CKLLLVDKKIT+ RD + +L++A++  +P++IIAE IE+EALA ++ NKLRG 
Sbjct  246   MIVEFHDCKLLLVDKKITDPRDFLKILDNAVKEQYPVVIIAEGIEEEALAPVIRNKLRGV  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIA+LTGGTVIREE+G +L+ A  D+LG A+KVV+TKDS 
Sbjct  306   LKAAAVKAPSFGERKSHYLDDIAVLTGGTVIREEMGYTLENAHKDMLGSASKVVITKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGS  E V +RV+QI+ L+E  ++ ++K  LNER+A+L GGVA++QVGAQT  ELK
Sbjct  366   LIVTDGSNDEAVKERVSQIQGLVENTEEKFQKNILNERVARLLGGVAILQVGAQTVVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATKAA+EEG+VVGGGC LLRLS+K+ +++E+L+N+E+K+GADI+KRALS
Sbjct  426   DKQLKVEDALNATKAAIEEGVVVGGGCCLLRLSTKIASIRENLDNEEQKIGADILKRALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP + IAKNAGVNGS V +K+L SD+  YGYNAA   YEDLMAAGIIDPTKVVRCCLEHA
Sbjct  486   YPARQIAKNAGVNGSTVIQKILLSDDVNYGYNAAKDIYEDLMAAGIIDPTKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKEP---EPVMAG--NPMDNSGYG  419
             ASVAKTFL +D VVVEIKEP    P + G   PM  SG G
Sbjct  546   ASVAKTFLTADAVVVEIKEPVKARPNLMGERKPMPTSGIG  585



>ref|XP_006415907.1| hypothetical protein EUTSA_v10007125mg [Eutrema salsugineum]
 gb|ESQ34260.1| hypothetical protein EUTSA_v10007125mg [Eutrema salsugineum]
Length=604

 Score =   508 bits (1307),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 255/394 (65%), Positives = 334/394 (85%), Gaps = 3/394 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMIA+A+ +VGR GVVT+E+GK   N+L++VEGMQF+RGY+SPYFVTD  K
Sbjct  183   SAGNDYEVGNMIADALQQVGRVGVVTIEKGKYLVNNLQIVEGMQFNRGYLSPYFVTDRRK  242

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ +CKLLLVDKKIT+ +++  +L+SA++  +P+LI+AE+IEQ+ALA ++ NKL+G 
Sbjct  243   REVEFHDCKLLLVDKKITDPKEMFKILDSAVKEDYPVLIVAEEIEQDALAPVIRNKLKGN  302

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDD+AILTG TVIR+E+GLSL+KA  +VLG A ++++TKDS 
Sbjct  303   LKAAAIKAPAFGERKSHCLDDLAILTGATVIRDEMGLSLEKAGKEVLGTAKRILVTKDST  362

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G+TQ+ V +RV+QIK L++  ++ ++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  363   LIVTNGNTQKAVEERVSQIKKLVQNTEERFQKKILNERIARLSGGIAIIQVGAQTQVELK  422

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGGC LLRL+SKVD++K++L+N E+K+GA+I ++ALS
Sbjct  423   DKQLKVEDALNATKSAIEEGIVVGGGCALLRLASKVDSIKDTLDNTEQKMGAEIFRKALS  482

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVL ++N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  483   YPIRLIAKNAGTNGNIVIEKVLLNENMMYGYNAAKNRYEDLMLAGIIDPTKVVRCCLEHA  542

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNPMDNS  428
             ASVAKTFL SD VVVEIKE  P P++   PM  S
Sbjct  543   ASVAKTFLTSDAVVVEIKEIKPRPII-NPPMPTS  575



>emb|CDY66193.1| BnaA07g36980D [Brassica napus]
Length=607

 Score =   507 bits (1306),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 258/393 (66%), Positives = 328/393 (83%), Gaps = 1/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YEVGNMIA A  +VGR GVVT+E+GK   N+L VVEGMQF+RGY+SPYFVTD  K
Sbjct  186   SAGNDYEVGNMIANAFQQVGRSGVVTIEKGKYLVNNLEVVEGMQFNRGYLSPYFVTDRRK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ +CKLLLVD+KITN +D+  +L+SA++  FP+LI+AE+IEQ+ALA ++ NKL+G 
Sbjct  246   REVEFHDCKLLLVDEKITNPKDMFKILDSAVKEEFPVLIVAEEIEQDALAPVIRNKLKGN  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDD+AILTG TVIR+E+GLSL+KA  +VLG A +V++TKDS 
Sbjct  306   LKAAAIKAPSFGERKSHCLDDLAILTGATVIRDEMGLSLEKAGKEVLGTAKRVLVTKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +G TQ+ V +RV+QIK L++  +++++K+ LNERIA+LSGG+A+IQVGAQT+ ELK
Sbjct  366   LIVTNGDTQKAVEERVSQIKKLVQNTEENFQKKILNERIARLSGGIALIQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+L+VEDALNATK+A+EEGIVVGGG  LLRL++KVD++K+SL+N E+K+GA+I K+ALS
Sbjct  426   DKQLKVEDALNATKSAIEEGIVVGGGSALLRLAAKVDSIKDSLDNTEQKIGAEIFKKALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++LIAKNAG NG++V EKVL ++N  YGYNAA   YEDLM AGIIDPTKVVRCCLEHA
Sbjct  486   YPIRLIAKNAGTNGNIVIEKVLLNENMMYGYNAAKNQYEDLMMAGIIDPTKVVRCCLEHA  545

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNS  428
             ASVA TFL SD VVVEIKE +P  M   PM  S
Sbjct  546   ASVANTFLTSDAVVVEIKENKPRPMINPPMPTS  578



>ref|XP_007146371.1| hypothetical protein PHAVU_006G034900g [Phaseolus vulgaris]
 gb|ESW18365.1| hypothetical protein PHAVU_006G034900g [Phaseolus vulgaris]
Length=616

 Score =   507 bits (1305),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 318/383 (83%), Gaps = 0/383 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI+EA+ KVG++GVVT+E GKS ENSL +VEGMQFDRGY+SPYFV +  K
Sbjct  186   SAGNDYAVGNMISEALHKVGKRGVVTIETGKSTENSLEIVEGMQFDRGYMSPYFVNNRRK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE  NCKLLLVDKKITN ++LIN+L ++ +  +PI+I+AEDIEQEALA ++ NKLRGA
Sbjct  246   MTVELHNCKLLLVDKKITNTKELINILNNSAKEKYPIVIVAEDIEQEALAPVIKNKLRGA  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERK+  L+DIAILTGGTVIRE++G +L+KA  DVLG A KVV+TK+S 
Sbjct  306   LKVAAIKAPAFGERKTHCLEDIAILTGGTVIREDMGFTLEKATKDVLGSATKVVITKNST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+  V KRV Q+K L+E     + K+ LNERIA+LSG +A+IQVGAQT+ ELK
Sbjct  366   LIVTDGSTRSVVEKRVNQLKRLVENTVDKFPKKILNERIARLSGSIAIIQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA++EG+VVGGGC+LLRLS KVDA+K  L+N+E+K+GA+I +RALS
Sbjct  426   DKQLRIEDALNATKAAIDEGVVVGGGCSLLRLSKKVDAIKVLLDNEEQKIGAEIFRRALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP K+IAKNAGVNG+VV  KVL  DN  +GYNAA   YEDLM A I+DPTKVVRCC+EH+
Sbjct  486   YPAKMIAKNAGVNGNVVINKVLLEDNMNFGYNAAKDCYEDLMKARIMDPTKVVRCCIEHS  545

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
             ASVAK+FL S  VV+E K  +P+
Sbjct  546   ASVAKSFLTSHAVVIEHKVLQPI  568



>ref|XP_007045689.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
 gb|EOY01521.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
Length=617

 Score =   505 bits (1300),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 253/377 (67%), Positives = 322/377 (85%), Gaps = 0/377 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG MI++A+  VGR+GVV +E+GK  ENSL++VEGMQ DRGY+SPYFVTD EK
Sbjct  209   SAGNDYTVGKMISDALQHVGRRGVVKIEKGKCNENSLQIVEGMQLDRGYLSPYFVTDPEK  268

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
               VE+ NCKLLLVDKKIT+ +++  +L+SA++  +PI+I+AEDIEQEALA ++ NKL+G 
Sbjct  269   RIVEFHNCKLLLVDKKITHPKEMFKILDSAVKEKYPIVIVAEDIEQEALAPVIRNKLKGV  328

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDDIAILTG TVIR+++GL+LD+A  +VLG A KVV+TKDS 
Sbjct  329   LKAAAIKAPAFGERKSHCLDDIAILTGATVIRDDMGLTLDRAGKEVLGTATKVVITKDST  388

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              +V DG+T+E V KRV+QI+ L+E  +++++K+ LN+RIA+LSG +A++QVGAQT+ ELK
Sbjct  389   YVVSDGNTREAVQKRVSQIERLVENTEENFQKKILNDRIAQLSGRIAILQVGAQTQVELK  448

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR EDALNATKAA+EEG+VVGGGC LLRLS+KVD +K  L+N E+K+GA+I KRALS
Sbjct  449   DKQLRNEDALNATKAAIEEGVVVGGGCILLRLSAKVDGIKSLLDNQEQKIGAEIFKRALS  508

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIAKNAGVNGSVV  KVLS+D+ +YGYNAA+ +YEDLM AGI+DPTKVVRCCLE+A
Sbjct  509   YPTKLIAKNAGVNGSVVVGKVLSNDDIRYGYNAASNSYEDLMKAGIMDPTKVVRCCLENA  568

Query  523   ASVAKTFLMSDCVVVEI  473
             ASVAKTFL SD VVV+I
Sbjct  569   ASVAKTFLTSDAVVVDI  585



>ref|XP_004135135.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Cucumis 
sativus]
Length=597

 Score =   504 bits (1298),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 325/393 (83%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG+++++A  +VG KGVV +E+GKS +NSL++VEGMQFDRGY+SPYFVTD  K
Sbjct  198   SAGNDYAVGSLVSDAFRQVGWKGVVQIEKGKSVDNSLQIVEGMQFDRGYLSPYFVTDRRK  257

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+  CKLLLVDKKI++ +++  +L++A++  +PI+I+AE IE EALA ++ NKLRG 
Sbjct  258   MVVEFHECKLLLVDKKISDPKEMFKILDNAVKEKYPIVILAEGIEPEALAPVIRNKLRGV  317

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIA LTG TV+RE+ GL+L+K   +VLG A KVV++KDS 
Sbjct  318   LKAAAIKAPAFGERKSHYLDDIATLTGATVVREDNGLTLEKTGKEVLGSACKVVISKDST  377

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+T+E V KRV QI+ L+E  ++ + K+ LNERIA+LSG +A+IQVGAQTE ELK
Sbjct  378   LIVTDGNTREAVQKRVLQIQKLMENTEEKFPKKILNERIARLSGRIAIIQVGAQTEVELK  437

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +++LR+EDALNA+KAA+EEG+VVGGGC LLRLS+KVDA+K  LENDE+ VGA+I KRALS
Sbjct  438   DRQLRIEDALNASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMVGAEIFKRALS  497

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIA+NAGVNGSVV +K+LS+++  YGYNAAT  YEDLM AGI+DP+KVVRCCLEHA
Sbjct  498   YPTKLIARNAGVNGSVVIDKILSNNDLDYGYNAATDRYEDLMKAGIMDPSKVVRCCLEHA  557

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASV+KTFL SD VVV++KE + +    PM  SG
Sbjct  558   ASVSKTFLTSDAVVVDMKESQLIPRRTPMPISG  590



>gb|KGN52011.1| hypothetical protein Csa_5G607990 [Cucumis sativus]
Length=619

 Score =   504 bits (1299),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 325/393 (83%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG+++++A  +VG KGVV +E+GKS +NSL++VEGMQFDRGY+SPYFVTD  K
Sbjct  220   SAGNDYAVGSLVSDAFRQVGWKGVVQIEKGKSVDNSLQIVEGMQFDRGYLSPYFVTDRRK  279

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+  CKLLLVDKKI++ +++  +L++A++  +PI+I+AE IE EALA ++ NKLRG 
Sbjct  280   MVVEFHECKLLLVDKKISDPKEMFKILDNAVKEKYPIVILAEGIEPEALAPVIRNKLRGV  339

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIA LTG TV+RE+ GL+L+K   +VLG A KVV++KDS 
Sbjct  340   LKAAAIKAPAFGERKSHYLDDIATLTGATVVREDNGLTLEKTGKEVLGSACKVVISKDST  399

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+T+E V KRV QI+ L+E  ++ + K+ LNERIA+LSG +A+IQVGAQTE ELK
Sbjct  400   LIVTDGNTREAVQKRVLQIQKLMENTEEKFPKKILNERIARLSGRIAIIQVGAQTEVELK  459

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +++LR+EDALNA+KAA+EEG+VVGGGC LLRLS+KVDA+K  LENDE+ VGA+I KRALS
Sbjct  460   DRQLRIEDALNASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMVGAEIFKRALS  519

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIA+NAGVNGSVV +K+LS+++  YGYNAAT  YEDLM AGI+DP+KVVRCCLEHA
Sbjct  520   YPTKLIARNAGVNGSVVIDKILSNNDLDYGYNAATDRYEDLMKAGIMDPSKVVRCCLEHA  579

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASV+KTFL SD VVV++KE + +    PM  SG
Sbjct  580   ASVSKTFLTSDAVVVDMKESQLIPRRTPMPISG  612



>emb|CDP00506.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   502 bits (1292),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 250/396 (63%), Positives = 325/396 (82%), Gaps = 1/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI+ A+ KVGRKGVV +E+G   ENSLR+VEGM+FDRGY+SPYFVT+  +
Sbjct  151   SAGNDYAVGNMISNALQKVGRKGVVRIEKGNHGENSLRIVEGMEFDRGYLSPYFVTNRRE  210

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E  NCKLLLVDKKITNA+++  +L++A++  +PI+I+AE IEQEALA +V NKL+G 
Sbjct  211   MIAELHNCKLLLVDKKITNAKEMFKILDNAVKEKYPIVIVAEGIEQEALAPVVRNKLKGT  270

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK  A++AP FGERKS YLDDIAILTGGTVIR+++GL+L+ A   +LG A+KVV+TK+S 
Sbjct  271   LKAVAIRAPAFGERKSHYLDDIAILTGGTVIRDDMGLTLENAHKGLLGSASKVVITKNST  330

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG  QE V KRV+QI+ L+E  ++ ++K+ LNERIA+LSGG+A++QVGAQT+ E+K
Sbjct  331   LIVTDGRNQEAVQKRVSQIQRLVENTEEKFQKKLLNERIARLSGGIAILQVGAQTQVEMK  390

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC LLRLS KV+ +K  L+N+E+++GADI+++AL+
Sbjct  391   DKQLRMEDALNATKAAIEEGVVVGGGCCLLRLSLKVEDIKNHLDNEEQRIGADILRKALA  450

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP + IAKN+G+NG+ V EKVLS DN  YGYNAA   YEDL+AA I+DP+KVVRCCLEHA
Sbjct  451   YPARQIAKNSGLNGNAVIEKVLSVDNAAYGYNAARDKYEDLVAARILDPSKVVRCCLEHA  510

Query  523   ASVAKTFLMSDCVVVEIKEPEP-VMAGNPMDNSGYG  419
             ASVA TFL SD VV++IKEP P  +   P+  SG G
Sbjct  511   ASVANTFLTSDAVVIDIKEPVPNNLMRKPLPTSGIG  546



>ref|XP_002315987.2| hypothetical protein POPTR_0010s14520g [Populus trichocarpa]
 gb|EEF02158.2| hypothetical protein POPTR_0010s14520g [Populus trichocarpa]
Length=585

 Score =   500 bits (1288),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 252/383 (66%), Positives = 322/383 (84%), Gaps = 7/383 (2%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VGR+GVVT+E+G+  EN L +VEGMQFDRGY+SPYFVTD ++
Sbjct  183   SAGNDYTVGNMISDALQQVGRRGVVTIEKGRCTENILEIVEGMQFDRGYLSPYFVTDRQR  242

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ NCKLLLVDKKI NA+++  +L++A++  +PI+I+AED++QEALA ++ NKL+G 
Sbjct  243   MVVEFHNCKLLLVDKKIQNAKEVFKILDNAVKEMYPIVIVAEDVDQEALAPIIRNKLKGL  302

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTVIR+++GL L+KA  +VLG A KVV+TKDS 
Sbjct  303   LKGAAIKAPAFGERKSHYLDDIAILTGGTVIRDDMGLKLEKAGKEVLGTATKVVITKDST  362

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI +L+E  ++ ++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  363   LIVTDGSTREAVEKRVSQICSLVENTEEKFQKKILNERIARLSGGIAILQVGAQTQVELK  422

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K LR+EDALNATKAA+EEG+VVGGGC+LLRLS+K+  L         K+GA+I KRALS
Sbjct  423   DKLLRIEDALNATKAAIEEGVVVGGGCSLLRLSTKLFQLL-------TKIGAEIFKRALS  475

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP +LIAKNAGVNG+VV  +VLS+ + +YGYNAAT  YEDL+ AGIIDPTKVVRCCLEHA
Sbjct  476   YPARLIAKNAGVNGNVVINQVLSNADIRYGYNAATDTYEDLITAGIIDPTKVVRCCLEHA  535

Query  523   ASVAKTFLMSDCVVVEIKEPEPV  455
              SVAKTFL SD VVV+IKE +P+
Sbjct  536   TSVAKTFLTSDAVVVDIKESDPL  558



>ref|XP_004155289.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin 60 subunit beta 4, 
chloroplastic-like [Cucumis sativus]
Length=597

 Score =   499 bits (1285),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 252/393 (64%), Positives = 324/393 (82%), Gaps = 0/393 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VG+++++A  +VG KGVV +E+GKS +NSL++VEGMQFDRGY+SPYFVTD  K
Sbjct  198   SAGNDYAVGSLVSDAFRQVGWKGVVQIEKGKSVDNSLQIVEGMQFDRGYLSPYFVTDRRK  257

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+  CKLLLVDKKI++ +++  +L++A++  +PI+I+AE IE EALA ++ NKLRG 
Sbjct  258   MVVEFHECKLLLVDKKISDPKEMFKILDNAVKEKYPIVILAEGIEPEALAPVIRNKLRGV  317

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIA LTG TV+RE+ GL+L+K   +VLG A KVV++KDS 
Sbjct  318   LKAAAIKAPAFGERKSHYLDDIATLTGATVVREDNGLTLEKTGKEVLGSACKVVISKDST  377

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+T+E V KRV QI+ L+E  ++ + K+ LNERIA+LSG +A+IQVGAQTE ELK
Sbjct  378   LIVTDGNTREAVQKRVLQIQKLMENTEEKFPKKILNERIARLSGRIAIIQVGAQTEVELK  437

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +++LR+EDALNA+KAA+EEG+VVGGGC  LRLS+KVDA+K  LENDE+ VGA+I KRALS
Sbjct  438   DRQLRIEDALNASKAAIEEGVVVGGGCCXLRLSTKVDAIKNVLENDEQMVGAEIFKRALS  497

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP KLIA+NAGVNGSVV +K+LS+++  YGYNAAT  YEDLM AGI+DP+KVVRCCLEHA
Sbjct  498   YPTKLIARNAGVNGSVVIDKILSNNDLDYGYNAATDRYEDLMKAGIMDPSKVVRCCLEHA  557

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
             ASV+KTFL SD VVV++KE + +    PM  SG
Sbjct  558   ASVSKTFLTSDAVVVDMKESQLIPRRTPMPISG  590



>ref|XP_006653448.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Oryza 
brachyantha]
Length=583

 Score =   498 bits (1282),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 246/389 (63%), Positives = 322/389 (83%), Gaps = 0/389 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG++Y VGNMI++A  +VGRKG+V +E G+  EN L +VEGMQFDRGY+SPYFVTD   
Sbjct  177   SAGDDYAVGNMISDAFKRVGRKGMVRIENGRGTENGLEIVEGMQFDRGYLSPYFVTDRTN  236

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ E+ +CK+LLVDK IT+A ++I +L+SA++  +P+LI+AED+E++A+A L+ NKL+G 
Sbjct  237   MSAEFTDCKILLVDKTITDASEIIRILDSAVKEDYPLLIVAEDVEEKAMADLIKNKLKGT  296

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA+KAP FGE+K+Q LDDIAI+TGGTV+RE++G +L++A  +VLG A KVV+ KDS 
Sbjct  297   IKVAAIKAPSFGEQKTQCLDDIAIMTGGTVVREDMGYTLERAGKEVLGSACKVVIGKDST  356

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  + KRVAQIK  IE +++ Y+K+ L ERIA+L GG+A+IQVGAQT  E+K
Sbjct  357   LIVTDGSTQHAIEKRVAQIKGQIENSNERYQKKILGERIARLCGGIAIIQVGAQTVIEMK  416

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+EDALNAT+AA+EEG+V+GGGC+LLRLS K+DA+KESL+N E+K+GADI K+ALS
Sbjct  417   DKKLRIEDALNATRAAIEEGVVIGGGCSLLRLSMKIDAIKESLDNVEQKIGADIFKQALS  476

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP  LIA NAGVNG+ V EK+L +D+ +YGYNAA   YEDLMAAGI+DP+KVVRCC+EHA
Sbjct  477   YPTALIASNAGVNGNFVIEKLLLNDDSRYGYNAAKDRYEDLMAAGILDPSKVVRCCIEHA  536

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A VAK+FL SD VVVE KE +PV    PM
Sbjct  537   AVVAKSFLTSDVVVVEAKESKPVRIRPPM  565



>ref|XP_010696183.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=584

 Score =   493 bits (1270),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 252/396 (64%), Positives = 323/396 (82%), Gaps = 1/396 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMIAEA+ KVGRKGVV  E G   EN++++VEGMQFDRGY+SPYFVT+  K
Sbjct  185   SAGNDYAVGNMIAEALEKVGRKGVVRTEIGTCTENTMQIVEGMQFDRGYLSPYFVTNRRK  244

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VEYDNCKLLLVDKKI + +++  +LE A++  FPI+I+AE IEQEALA ++ NKL+G+
Sbjct  245   MTVEYDNCKLLLVDKKIKHPKEVFKMLEKAVKGDFPIVIVAEGIEQEALAPIIRNKLKGS  304

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK  A+KAP FGERKS  LDDIAILT GTVIR+++GL L+K   DVLG A KVV+T  + 
Sbjct  305   LKAVAIKAPDFGERKSHSLDDIAILTRGTVIRDDLGLDLEKVGMDVLGTATKVVITNKTT  364

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +GST++ V KRV++IK   E   ++++K+ L+ERIA+LSGG+A+I+VGA T+ ELK
Sbjct  365   LIVTNGSTRQAVEKRVSEIKAYAEHVQENFQKKILHERIARLSGGIAIIEVGAHTQIELK  424

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+ED+LNA KAA+EEG+VVGGGCTLLRLS KVD +KE L+N+E+KVGA+I +RALS
Sbjct  425   DKQLRIEDSLNAAKAAIEEGVVVGGGCTLLRLSLKVDEIKEQLDNEEQKVGAEIFRRALS  484

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP++ IA+NAGV+GSVV +KVLS+D+ +YGYNAA+  Y++LM AGI+DPTKVVRCCLEHA
Sbjct  485   YPIRKIAENAGVSGSVVVQKVLSNDDLRYGYNAASDCYQNLMEAGIMDPTKVVRCCLEHA  544

Query  523   ASVAKTFLMSDCVVVEIKEPEPV-MAGNPMDNSGYG  419
             ASVAKTFL+SD V V+I+E  P      PM  SG G
Sbjct  545   ASVAKTFLISDAVAVDIEERRPFPRTPMPMPMSGVG  580



>gb|KDD74080.1| TCP-1/cpn60 chaperonin [Helicosporidium sp. ATCC 50920]
Length=622

 Score =   494 bits (1273),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/388 (64%), Positives = 316/388 (81%), Gaps = 4/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG N  +G +IAEAMSKVGR+GVV++EE K+AE+SL +VEGMQFDRG+ISPYFVTD E+
Sbjct  224   SAGGNEVIGALIAEAMSKVGREGVVSMEESKTAEDSLEIVEGMQFDRGFISPYFVTDPER  283

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                EYD+ +LLLVDKK+ +AR+L+  LE+A+R  +P++I+AED+EQEALATLVVNKLRGA
Sbjct  284   GVAEYDDARLLLVDKKVASARELVGALEAAVRGAYPLVIVAEDVEQEALATLVVNKLRGA  343

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L+V A+KAPGFGER++ YL+D+A+LTGG V+ + +G SLDK   + LG AA+V ++KD  
Sbjct  344   LRVVAVKAPGFGERRTSYLEDLAVLTGGQVVSDALGTSLDKVGEEFLGRAARVTVSKDRI  403

Query  1063  TIV---GDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTET  893
             T+V   GD      V++RVA ++   E AD DYE+EKL ER+AKL+GGVA+++VGAQTET
Sbjct  404   TVVGRAGDSEVASAVAQRVASVRRAAEAADSDYEREKLQERVAKLAGGVALVRVGAQTET  463

Query  892   ELKEKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKR  713
             ELKEKKLRVEDALNATKAAVEEGIV GGGCTLLRL+S V  L+  L NDE+++GAD+V R
Sbjct  464   ELKEKKLRVEDALNATKAAVEEGIVTGGGCTLLRLASCVAELRSQLANDEQRMGADVVAR  523

Query  712   ALSYPLKLIAKNAGVNGSVVSEKVL-SSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCC  536
             ALS PLKLIA NAG NG++V+EKV   + + +YGYNAATG Y DL+AAGI+DP KVVRC 
Sbjct  524   ALSAPLKLIAANAGGNGAIVAEKVAEHAADARYGYNAATGQYGDLLAAGIVDPAKVVRCA  583

Query  535   LEHAASVAKTFLMSDCVVVEIKEPEPVM  452
             LE+A+SVA+TFL S  VV EI +PEP M
Sbjct  584   LENASSVARTFLTSSVVVTEIPQPEPAM  611



>gb|EEE61069.1| hypothetical protein OsJ_14927 [Oryza sativa Japonica Group]
Length=623

 Score =   493 bits (1270),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/389 (63%), Positives = 321/389 (83%), Gaps = 0/389 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG++Y VGNMI++A  +VGRKG+V +E G+  EN L +VEGMQF+RGY+SPYFVTD   
Sbjct  217   SAGDDYAVGNMISDAFKRVGRKGMVRIENGRGTENGLEIVEGMQFERGYLSPYFVTDCTN  276

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ E+ +CK+LLVDKKIT+A ++I +L+SA++  +P+LI+AED+E++A+A L+ NKL+G 
Sbjct  277   MSAEFTDCKILLVDKKITDASEIIRILDSAVKEDYPLLIVAEDVEEKAMADLIKNKLKGT  336

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA+KAP FGE+ +Q LDDIAI+TGGT++RE++G +L+KA  +VLG A+KVV+ KDS 
Sbjct  337   IKVAAIKAPSFGEQMTQCLDDIAIMTGGTLVREDMGYTLEKAGKEVLGSASKVVVGKDST  396

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGSTQ  + KRVAQIK  IE + + Y+K+ L ERIA+L GG+A+IQVGAQT  E+K
Sbjct  397   LIVTDGSTQHVIEKRVAQIKGQIENSSERYQKKILGERIARLCGGIAIIQVGAQTIIEMK  456

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+EDALNATKAA+EEG+V+GGGC+LLRLS K+D +KESL+N E+K+GADI K+ALS
Sbjct  457   DKKLRIEDALNATKAAIEEGVVIGGGCSLLRLSMKIDRIKESLDNMEQKIGADIFKQALS  516

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP  LIA NAGVNGS V EKVL +++ +YGYNAA   YEDLMAAGI+DP+KVVRCC+EHA
Sbjct  517   YPTALIANNAGVNGSFVIEKVLLNEDSRYGYNAAKNRYEDLMAAGILDPSKVVRCCIEHA  576

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A VAK+FL SD V+VE KE +PV    PM
Sbjct  577   AVVAKSFLTSDVVIVEAKEGKPVRIRPPM  605



>gb|EEC67866.1| hypothetical protein OsI_35492 [Oryza sativa Indica Group]
Length=588

 Score =   491 bits (1265),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/389 (63%), Positives = 321/389 (83%), Gaps = 0/389 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG++Y VGNMI++A  +VGRKG+V +E G+  EN L +VEGMQF+RGY+SPYFVTD   
Sbjct  182   SAGDDYAVGNMISDAFKRVGRKGMVRIENGRGTENGLEIVEGMQFERGYLSPYFVTDCTN  241

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ E+ +CK+LLVDKKIT+A ++I +L+SA++  +P+LI+AED+E++A+A L+ NKL+G 
Sbjct  242   MSAEFTDCKILLVDKKITDASEIIRILDSAVKEDYPLLIVAEDVEEKAMADLIKNKLKGT  301

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA+KAP FGE+ +Q LDDIAI+TGGT++RE++G +L+KA  +VLG A+KVV+ KDS 
Sbjct  302   IKVAAIKAPSFGEQMTQCLDDIAIMTGGTLVREDMGYTLEKAGKEVLGSASKVVVGKDST  361

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV +GSTQ  + KRVAQIK  IE + + Y+K+ L ERIA+L GG+A+IQVGAQT  E+K
Sbjct  362   LIVTNGSTQHVIEKRVAQIKGQIENSSERYQKKILGERIARLCGGIAIIQVGAQTIIEMK  421

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+EDALNATKAA+EEG+V+GGGC+LLRLS K+D +KESL+N E+K+GADI K+ALS
Sbjct  422   DKKLRIEDALNATKAAIEEGVVIGGGCSLLRLSMKIDRIKESLDNMEQKIGADIFKQALS  481

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP  LIA NAGVNGS V EKVL +++ +YGYNAA   YEDLMAAGI+DP+KVVRCC+EHA
Sbjct  482   YPTALIANNAGVNGSFVIEKVLLNEDSRYGYNAAKNRYEDLMAAGILDPSKVVRCCIEHA  541

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A VAK+FL SD V+VE KE +PV    PM
Sbjct  542   AVVAKSFLTSDVVIVEAKEGKPVRIRPPM  570



>ref|XP_004975721.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Setaria 
italica]
Length=588

 Score =   482 bits (1240),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 311/380 (82%), Gaps = 1/380 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A  +VGRKG+V +E G+  ENSL VVEGMQF+RGY+SPYFVTD   
Sbjct  181   SAGNDYAVGNMISDAFQRVGRKGMVRIENGRGTENSLDVVEGMQFERGYLSPYFVTDRSN  240

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +CK+L+VDKKIT+A ++I +L+SA++  +P+LIIAED+E+ A+A L+ NKL+G 
Sbjct  241   MTVEFTDCKILMVDKKITDASEIIRILDSAVKENYPLLIIAEDVEEAAMADLIKNKLKGT  300

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA+KA  FGE+K+Q LDDIA++TGGTV+R+++G SL+KA  +VLG AAKVV+ KDS 
Sbjct  301   IKVAAVKAFSFGEQKTQCLDDIAVMTGGTVVRDDMGYSLEKAGKEVLGSAAKVVIRKDST  360

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST   V KRVA IK  IE + + Y K+ L ERIA+L GG+A+IQVGAQT  E+K
Sbjct  361   LIVTDGSTHHAVEKRVALIKGQIENSKERYNKKILGERIARLCGGIAIIQVGAQTVIEMK  420

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKE-SLENDEEKVGADIVKRAL  707
             +KKLR+EDALNAT+AA+EEG+VVGGGC+LLRLS K+DA+K+ SL+N E+K+GADI K+AL
Sbjct  421   DKKLRIEDALNATRAAIEEGVVVGGGCSLLRLSKKIDAIKDSSLDNMEQKIGADIFKKAL  480

Query  706   SYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             SYP  LIA NAGVNG  V EKVL +D   YGYNAA   YEDLMAAGI+DP+KVVRCC+EH
Sbjct  481   SYPTSLIANNAGVNGDFVIEKVLLNDTTNYGYNAAKNRYEDLMAAGILDPSKVVRCCIEH  540

Query  526   AASVAKTFLMSDCVVVEIKE  467
             AA VAK+FL SD VVVE KE
Sbjct  541   AAVVAKSFLTSDVVVVEAKE  560



>ref|XP_010320801.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X6 [Solanum lycopersicum]
Length=543

 Score =   476 bits (1224),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 238/351 (68%), Positives = 301/351 (86%), Gaps = 0/351 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y +GNMI+EA+ +VGR+GVVT+E+G S + +L VVEGMQFDRGY+SPYFVTD  K
Sbjct  187   SAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVTDRRK  246

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                E  +CKLLLVDKKI+N ++L+ +L++A++  +P+LIIAE IEQ+ALA ++ NKLRG 
Sbjct  247   RIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNKLRGV  306

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERKS YLDDIAILTGGTVIR+++GL+L+ A  D+LG A+KVV+TKDS 
Sbjct  307   LKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVITKDST  366

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DG+TQ  VSKRV+QI+NL+E  ++ ++K+ LNERIA+LSGG+AVIQVGAQT+ ELK
Sbjct  367   LIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQVELK  426

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNA +AA EEG+VVGGGC LLRLSSKVDA+KE+L+N+++K+GADI KRALS
Sbjct  427   DKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALS  486

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTK  551
             YP K IAKNAGVNGS+V EK+LS D+ KYGYNAA   YEDLMAA I+DPTK
Sbjct  487   YPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTK  537



>ref|XP_003579836.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Brachypodium 
distachyon]
Length=586

 Score =   477 bits (1228),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 243/389 (62%), Positives = 314/389 (81%), Gaps = 0/389 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A  +VGRKG+V +E G+  ENSL +VEGMQF+RGY+SPYFVT+   
Sbjct  180   SAGNDYAVGNMISDAFKRVGRKGMVRIENGRGTENSLEIVEGMQFERGYLSPYFVTNHAN  239

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VE+ +CK+LLVDK IT+ R+L+ V  SA++  FP++IIAED+E+EALATL  NKL G 
Sbjct  240   MSVEFTDCKILLVDKIITDPRELLKVCFSAVKEDFPLVIIAEDVEEEALATLTRNKLSGM  299

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA++A  FGE+K+Q L+DIAI+TGGTV+R+++G +L++A  +VLG A+KVV+ KDS 
Sbjct  300   IKVAAIEALSFGEQKTQCLEDIAIMTGGTVVRDDMGYTLEEAGKEVLGSASKVVIKKDST  359

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST   V KRVAQIK  IE + + Y+K+ L ERIA+L G +A+IQVGAQT  E+K
Sbjct  360   LIVTDGSTLHAVEKRVAQIKGQIENSKERYQKKILGERIARLCGAIAIIQVGAQTVIEMK  419

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +KKLR+EDALNAT AA++EG+VVGGGC+LLRLS K+D +KESL+N E+K+GADI K ALS
Sbjct  420   DKKLRIEDALNATMAAIDEGVVVGGGCSLLRLSKKIDIIKESLDNIEQKIGADIFKHALS  479

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP  LIA NAG++G  V +KVLS++N  YGYNAA   YEDLMAAGI+DP+KVVRCC+EHA
Sbjct  480   YPTILIANNAGMSGKFVIQKVLSNENTNYGYNAANDCYEDLMAAGILDPSKVVRCCIEHA  539

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A VA++FL SD VVVE KE +PV    PM
Sbjct  540   AVVARSFLTSDVVVVEAKESKPVRIRPPM  568



>ref|XP_006844149.1| hypothetical protein AMTR_s00006p00260480 [Amborella trichopoda]
 gb|ERN05824.1| hypothetical protein AMTR_s00006p00260480 [Amborella trichopoda]
Length=550

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/360 (67%), Positives = 306/360 (85%), Gaps = 0/360 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+YE+G++IA+++ KVGR G+V +E+GKS  NSL VVEGM FDRGY+SPYFVTD EK
Sbjct  190   SAGNDYEIGSLIADSIRKVGRMGMVKIEKGKSTVNSLHVVEGMHFDRGYLSPYFVTDREK  249

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+VEY+NCKLLLVDKKI   +++ N+LE+AIR  +PILIIAEDIEQEALA ++ NKLRG+
Sbjct  250   MSVEYENCKLLLVDKKIAKPKEMFNLLEAAIREKYPILIIAEDIEQEALAPVIRNKLRGS  309

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS  LDDIAILTGGTVIR+++GLSL KA  +VLG A KVV+TKDS 
Sbjct  310   LKAAAIKAPAFGERKSHCLDDIAILTGGTVIRDDMGLSLGKAKKEVLGSATKVVITKDST  369

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              I+ DG+T+E V+ RV+Q+K L+E +++ ++K+ LNERIA+LSG VA++QVGAQTE ELK
Sbjct  370   LIITDGTTKEAVNTRVSQLKILMENSEEKFDKKILNERIARLSGAVAIVQVGAQTEVELK  429

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EK LRVED+LN+T+AA+EEGIVVGGGCT+LRLS KVD +K+SLEN+E+KVGADI ++AL 
Sbjct  430   EKTLRVEDSLNSTRAAIEEGIVVGGGCTMLRLSLKVDTIKKSLENEEQKVGADIFRKALV  489

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP+K IA+NAG+NG+VV EKV+ +++ +YGYNA+ G YEDLMAAGIIDP+K     L  A
Sbjct  490   YPMKRIAENAGINGNVVVEKVMLTEDVRYGYNASKGIYEDLMAAGIIDPSKAWDSVLGEA  549



>ref|XP_006573191.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Glycine max]
Length=587

 Score =   469 bits (1207),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 306/395 (77%), Gaps = 20/395 (5%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI+EA+ +VGR GVVT+E G+S ENSL +VEGMQFDRGY+SPYFV +  K
Sbjct  181   SAGNDYSVGNMISEALHQVGRSGVVTIETGRSTENSLEIVEGMQFDRGYLSPYFVNNRRK  240

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE  NCKLLLVDKKIT  ++LIN+L ++ +  +P+LI+AE IEQEALA ++ NKLRGA
Sbjct  241   MTVELHNCKLLLVDKKITKTKELINILNNSAKEKYPVLIVAEGIEQEALAPVIKNKLRGA  300

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LKVAA+KAP FGERK+ YL+DIAILTGGTVIRE++G +L+KA  + LG A KVV+TK+S 
Sbjct  301   LKVAAIKAPAFGERKTHYLEDIAILTGGTVIREDMGFNLEKAHKNDLGSATKVVITKNST  360

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV Q++ L+E   ++++K+ LNERIA+LSGG+A++Q+         
Sbjct  361   LIVTDGSTREAVEKRVCQLRRLVENTVENFQKKILNERIARLSGGIAILQI---------  411

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
                      L   +AA+EEG+VVGGGC LLRLS KVD +K+ LEN+E+++GA+I +RALS
Sbjct  412   ---------LRTRQAAIEEGVVVGGGCCLLRLSQKVDGIKKLLENEEQQIGAEIFRRALS  462

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YP ++IAKNAGVNG+V+ +KVLS DN  +GYNAA   YEDLM AGI+DPTKVVRCC+EH+
Sbjct  463   YPTRMIAKNAGVNGNVIIDKVLSDDNLNFGYNAARDCYEDLMKAGIMDPTKVVRCCIEHS  522

Query  523   ASVAKTFLMSDCVVVEIKE--PEPVMAGNPMDNSG  425
             ASVAK FL S  VVVE KE  P P+    PM  SG
Sbjct  523   ASVAKAFLTSSAVVVERKELKPIPIPRRKPMPTSG  557



>gb|EMS68279.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=622

 Score =   468 bits (1203),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/410 (59%), Positives = 315/410 (77%), Gaps = 21/410 (5%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A  +VGR+G+V +E G+S  NSL VVEGMQF+RGY+SP+FVT+   
Sbjct  197   SAGNDYAVGNMISDAFKRVGREGMVRIENGRSTVNSLEVVEGMQFERGYLSPFFVTNHAN  256

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M+ EY +CK+LLVDK I++ R+L+ V  SA++  FP+LIIAED+E+EAL+TL  NKL G 
Sbjct  257   MSAEYTDCKILLVDKIISDPRELLRVCFSAVKEDFPLLIIAEDVEEEALSTLTRNKLSGM  316

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA+KAP FGE+K+Q L+DIAI+TGGTV+R+++G +L++A  + LG A+KV++ KDS 
Sbjct  317   IKVAAIKAPSFGEQKTQCLEDIAIITGGTVVRDDMGYTLEEAGQEFLGSASKVIVKKDST  376

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST   V KRVAQIK  +E + + Y+K+ L ERIA+LSG +A+IQVGAQT  ELK
Sbjct  377   LIVTDGSTLHAVEKRVAQIKGQVENSKERYQKKILGERIARLSGAIAIIQVGAQTVIELK  436

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEE------------  740
             +KKLR+EDALNAT AA+EEG+VVGGGC+LLRLS K+D +KESL+N E+            
Sbjct  437   DKKLRIEDALNATMAAIEEGVVVGGGCSLLRLSQKIDMIKESLDNLEQKAQLEFTTIRAY  496

Query  739   ---------KVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYE  587
                      K+GADI K ALSYP  LIA NAG++G  V EKVL++DN  YGYNAA G YE
Sbjct  497   WCNYAFVVVKIGADIFKHALSYPSTLIANNAGMSGKFVIEKVLANDNASYGYNAANGCYE  556

Query  586   DLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             DLMA+GI+DP+KVVRCC+EH+A VAK+FL SD V+VE +E +P+    PM
Sbjct  557   DLMASGILDPSKVVRCCIEHSAVVAKSFLTSDVVIVEAQESKPIRVRPPM  606



>ref|XP_008653444.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Zea mays]
 tpg|DAA44367.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=588

 Score =   466 bits (1199),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 240/380 (63%), Positives = 310/380 (82%), Gaps = 1/380 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI +A  +VGR+G+V +E G+  ENSL V+EGMQF+RGY+SPYFVTD   
Sbjct  181   SAGNDYAVGNMIYDAFQRVGRQGMVRIENGRGTENSLEVLEGMQFERGYLSPYFVTDRGN  240

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+ +C++LLVDKKIT+A ++I +L+SA++  +P+LIIAED+E++A+A L+ NKL+G 
Sbjct  241   MTVEFTDCQILLVDKKITDASEIIRILDSAVKENYPLLIIAEDVEEQAMADLIKNKLKGT  300

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +KVAA+KA  FGE+K+Q LDDIAI+TGGT++R+++G  L+KA  +VLG A+KVV+TKDS 
Sbjct  301   IKVAAVKAFSFGEQKTQCLDDIAIMTGGTLVRDDMGHILEKAGKEVLGSASKVVITKDST  360

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGS +  V +RVA IK  IE + + Y K+ L ERIA+L G +AVIQVGAQT  E+K
Sbjct  361   LIVTDGSNRRAVEERVAMIKGQIENSKESYNKKILGERIARLCGAIAVIQVGAQTIIEMK  420

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKE-SLENDEEKVGADIVKRAL  707
             +KKLR+EDALN T+AA+EEG+VVGGGC+LLRLS K+DA+KE SL+N E++VGADI K+AL
Sbjct  421   DKKLRIEDALNTTRAAIEEGVVVGGGCSLLRLSEKIDAIKESSLDNIEQEVGADIFKQAL  480

Query  706   SYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             SYP  LIAKNAGVNG  V +KVL +D+  YGYNAA   YEDLMAAGI+D TKVVRCC+EH
Sbjct  481   SYPTSLIAKNAGVNGDFVIKKVLLNDDANYGYNAAKNCYEDLMAAGILDATKVVRCCIEH  540

Query  526   AASVAKTFLMSDCVVVEIKE  467
             AA VAK+FL SD V+VE KE
Sbjct  541   AAVVAKSFLTSDVVIVEAKE  560



>ref|XP_010091675.1| Chaperonin 60 subunit beta 4 [Morus notabilis]
 gb|EXB44941.1| Chaperonin 60 subunit beta 4 [Morus notabilis]
Length=649

 Score =   462 bits (1190),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 236/351 (67%), Positives = 304/351 (87%), Gaps = 0/351 (0%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VG++GVVT+E+GK  ENSL+VVEGMQFDRGY+SPYFVTD  K
Sbjct  186   SAGNDYTVGNMISDALHQVGKRGVVTIEKGKCTENSLQVVEGMQFDRGYLSPYFVTDRHK  245

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             MAVE+ NCKLLLVDKKI +A+++  +L+SA++  +PI+I+AE IEQEALA ++ NKL+G 
Sbjct  246   MAVEFHNCKLLLVDKKIADAKEMFRILDSAVKEEYPIVIVAEGIEQEALAPVIRNKLKGV  305

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             +K AA+KAP FGERKS YLDDIAILTGGTVIR+E+GL+L+KA  +VLG A KVV+TKDS 
Sbjct  306   IKAAAIKAPAFGERKSHYLDDIAILTGGTVIRDEMGLTLEKAGKEVLGTATKVVITKDST  365

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV QI+ L+E  ++ + K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  366   LIVTDGSTREAVEKRVTQIRRLVENTEEKFPKKILNERIARLSGGIAILQVGAQTQVELK  425

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             +K+LR+EDALNATKAA+EEG+VVGGGC+LLRLS+KVD +K+ L+NDE+++GA+I KRALS
Sbjct  426   DKQLRIEDALNATKAAIEEGVVVGGGCSLLRLSTKVDGIKQVLDNDEQRIGAEIFKRALS  485

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTK  551
             YP+KLIAKNAG NG+VV EK+L+SD+  +GYNAA   YEDLM AGI+DP+K
Sbjct  486   YPVKLIAKNAGANGNVVVEKILASDDTGFGYNAAKDCYEDLMKAGIMDPSK  536



>ref|XP_011009123.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Populus euphratica]
Length=562

 Score =   454 bits (1167),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 235/390 (60%), Positives = 306/390 (78%), Gaps = 36/390 (9%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+Y VGNMI++A+ +VGR+GVVT+E+G+  EN L +VEGMQFDRGY+SPYFVTD ++
Sbjct  183   SAGNDYTVGNMISDALQQVGRRGVVTIEKGRCTENILEIVEGMQFDRGYLSPYFVTDRQR  242

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E+ NCKLLLVDKKI NA+++  +L++A++  +PI+I+AED++QEALA ++ NKL+G 
Sbjct  243   MVAEFHNCKLLLVDKKIQNAKEVFKILDNAVKEMYPIVIVAEDVDQEALAPIIRNKLKGL  302

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK AA+KAP FGERKS YLDDIAILTGGTVIR+++GL L+KA  +VLG A KVV+TKDS 
Sbjct  303   LKGAAIKAPAFGERKSHYLDDIAILTGGTVIRDDMGLKLEKAGKEVLGTATKVVITKDST  362

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV DGST+E V KRV+QI +L+E  ++ ++K+ LNERIA+LSGG+A++QVGAQT+ ELK
Sbjct  363   LIVTDGSTREAVEKRVSQICSLVENTEEKFQKKILNERIARLSGGIAILQVGAQTQVELK  422

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEK-VGADIVKRAL  707
             +K LR+EDALNATKAA+EEG+VVGGGC+LLRLS+KVD +KE L+N+E+K +GA+I KRAL
Sbjct  423   DKLLRIEDALNATKAAIEEGVVVGGGCSLLRLSTKVDGIKEFLDNEEQKMIGAEIFKRAL  482

Query  706   SYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEH  527
             SYP +LIAKN+GVNG+VV                                 +VVRCCLEH
Sbjct  483   SYPARLIAKNSGVNGNVVI-------------------------------NQVVRCCLEH  511

Query  526   AASVAKTFLMSDCVVVEIKEPEPVMAGNPM  437
             A SVAKTFL SD VVV+I+E +P+    PM
Sbjct  512   ATSVAKTFLTSDAVVVDIRESDPL----PM  537



>ref|XP_010090495.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
 gb|EXB39594.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
Length=496

 Score =   442 bits (1136),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 254/393 (65%), Positives = 282/393 (72%), Gaps = 90/393 (23%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGNNYEVGNMIAEA SK                             G++S         
Sbjct  191   SAGNNYEVGNMIAEAWSK-----------------------------GHVS---------  212

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
                     +LLLVDKKITNARDL+NVLE AIR G+P+LI+AEDIEQEALATLVVNKLRG 
Sbjct  213   -------TQLLLVDKKITNARDLVNVLEDAIRGGYPVLIVAEDIEQEALATLVVNKLRGT  265

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             LK+AALKAPGFGERKS+YLDDIAILTGGTV+R+EVGL+LDK  ++ LG A+KVVLTKD+ 
Sbjct  266   LKIAALKAPGFGERKSEYLDDIAILTGGTVVRDEVGLTLDKVGNEFLGQASKVVLTKDTT  325

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIVGDGSTQE V++RVAQI+NLIE                          VGAQTETELK
Sbjct  326   TIVGDGSTQEAVNERVAQIRNLIE--------------------------VGAQTETELK  359

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             EKKLRVEDALNATKAAVEEGIVVGGGCTLLRL+SKVD ++++LENDEEKVGADIVKRALS
Sbjct  360   EKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDGIRDTLENDEEKVGADIVKRALS  419

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
             YPLKLIAKNAGVNGSVVSE+VLSSD+P+YGYNAATG YEDLMA G               
Sbjct  420   YPLKLIAKNAGVNGSVVSEEVLSSDDPRYGYNAATGKYEDLMAGG---------------  464

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNPMDNSG  425
                   +   DCVVVEIKEPEPV AGNPM NSG
Sbjct  465   ----NNYSNQDCVVVEIKEPEPVPAGNPMGNSG  493



>ref|WP_011433315.1| molecular chaperone GroEL [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_477934.1| chaperonin GroEL [Synechococcus sp. JA-2-3B'a(2-13)]
 sp|Q2JKV7.1|CH602_SYNJB RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 
2; AltName: Full=Protein Cpn60 2 [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02671.1| chaperonin GroEL [Synechococcus sp. JA-2-3B'a(2-13)]
Length=539

 Score =   440 bits (1132),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 234/388 (60%), Positives = 291/388 (75%), Gaps = 2/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIA+AM  VGR GV+T+EE KS E  L VVEGMQFDRGYISPYFVTDSE+
Sbjct  150   SAGNDSEVGEMIAKAMDAVGRDGVITVEESKSLETELDVVEGMQFDRGYISPYFVTDSER  209

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+N  LL+   KI++ +DL+ +LE   R G P+L+IAED+E EALATLVVN+LRG 
Sbjct  210   MVAEYENAYLLITSNKISSLQDLVPILERVAREGRPLLVIAEDVEGEALATLVVNRLRGV  269

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L   A+KAP FG+R+   L+DIAILTGG +I E+VG+ LDK   D++G A K+ +TKD  
Sbjct  270   LNAVAVKAPAFGDRRKAMLEDIAILTGGQLISEDVGIKLDKVTLDMMGVARKITVTKDKT  329

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DGST+  V KRVAQI+  +E  D +Y++EKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  330   TIVTDGSTKAAVEKRVAQIRKQLETTDSEYDREKLQERIAKLAGGVAVIKVGAATETELK  389

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNAT+AAVEEGIV GGG TLL LS  + A K  L N EE+VGA+IV RAL 
Sbjct  390   DRKLRIEDALNATRAAVEEGIVPGGGATLLHLSKGIPAFKAKL-NAEEQVGAEIVYRALQ  448

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL  IA NAG+ GSVV EKVL  + P +G++A TG Y D+ A GI+DP KVVR  L++A
Sbjct  449   APLFQIAHNAGLEGSVVVEKVLEKEMP-FGFDALTGTYVDMFAQGIVDPAKVVRSALQNA  507

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A  +L ++ +VVE  EP+P     P
Sbjct  508   ASIAGMYLTTEAIVVEKPEPKPAAGSAP  535



>emb|CDN11427.1| Heat shock protein 60 family chaperone GroEL [Richelia intracellularis]
Length=571

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 235/388 (61%), Positives = 299/388 (77%), Gaps = 4/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIAEAM+KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+T++E+
Sbjct  157   SAGNDEEVGTMIAEAMAKVTKDGVITVEESKSLSTELEVVEGMQIDRGYISPYFITNNER  216

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE DN ++L+ DKKI+N +DL+ VLE   ++G P+LIIAEDIE EALATLVVNK RG 
Sbjct  217   MTVELDNARILITDKKISNIQDLVGVLEKVAKAGQPLLIIAEDIEGEALATLVVNKARGV  276

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L V A+KAPGFGER+   L+DIAILTGG +I EE+GLSLD A  D+LG A K+ + K++ 
Sbjct  277   LSVCAIKAPGFGERRKAMLEDIAILTGGQLISEEIGLSLDNASLDMLGTARKIEIDKENT  336

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV  G  + +V KR+ Q++  +EV D +Y+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  337   TIVAAGDHKADVQKRIEQVRKQLEVTDSEYDKEKLQERIAKLAGGVAVIKVGAATETELK  396

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR++DALNATKAAVEEGIV GGG TL+ L++KVDA+K SL  +E ++GADIV R+L 
Sbjct  397   DRKLRIQDALNATKAAVEEGIVPGGGTTLIHLTTKVDAIKNSL-TEEAQIGADIVARSLD  455

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ +A NAG  GSVV +KV  ++    GYNA TG Y+D++AAGIIDP KVVR  L++A
Sbjct  456   MPLRQMADNAGAEGSVVVDKVRGTEF-NIGYNAITGEYQDMIAAGIIDPAKVVRSALQNA  514

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ +V EI E EP  AG P
Sbjct  515   ASIASMVLTTEAIVAEIPEKEP--AGAP  540



>ref|WP_011610149.1| molecular chaperone GroEL [Trichodesmium erythraeum]
 ref|YP_720226.1| chaperonin GroEL [Trichodesmium erythraeum IMS101]
 sp|Q119S1.1|CH601_TRIEI RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 
1; AltName: Full=Protein Cpn60 1 [Trichodesmium erythraeum 
IMS101]
 gb|ABG49753.1| chaperonin GroEL [Trichodesmium erythraeum IMS101]
Length=561

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 237/381 (62%), Positives = 294/381 (77%), Gaps = 3/381 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG + EVG MI+EAM KV + GV+T+EE KS    L VVEGMQ DRGY+SPYFVTD E+
Sbjct  149   SAGGDAEVGRMISEAMDKVTKDGVITVEESKSLSTDLEVVEGMQIDRGYLSPYFVTDQER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             + V+++N ++L+ DKKI++ +DL+ VLE   R+G  +LIIAEDIE EALATLVVNK RG 
Sbjct  209   LVVDFENARILITDKKISSIQDLVPVLEKVARAGQSLLIIAEDIEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+KAPGFG+R+   L DIAILTGG +I EEVGLSL+  D D++G   K+ + KD+ 
Sbjct  269   LNVAAVKAPGFGDRRKAMLQDIAILTGGQLISEEVGLSLEMVDLDMMGIGRKISINKDNT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DG T EEV KR+AQI+  +  +D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVADGGTAEEVKKRIAQIRKQLGESDSDYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG TL+ LS+KV+ LK SL N+EEK+GADIV+RAL 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTTLIHLSTKVEELKGSLNNEEEKIGADIVRRALE  448

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL  IA N+GV GSV+ EKV S+D    GYN  TG YEDL+AAGI+DP  VVR  L++A
Sbjct  449   APLNQIANNSGVEGSVIVEKVRSTDF-SVGYNVITGEYEDLIAAGILDPAMVVRSALQNA  507

Query  523   ASVAKTFLMSDCVVVEIKEPE  461
              S+A   L ++ VVVE  +PE
Sbjct  508   GSIAGMVLTTEAVVVE--KPE  526



>ref|WP_037217788.1| molecular chaperone GroEL [Richelia intracellularis]
Length=563

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 235/388 (61%), Positives = 299/388 (77%), Gaps = 4/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIAEAM+KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+T++E+
Sbjct  149   SAGNDEEVGTMIAEAMAKVTKDGVITVEESKSLSTELEVVEGMQIDRGYISPYFITNNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE DN ++L+ DKKI+N +DL+ VLE   ++G P+LIIAEDIE EALATLVVNK RG 
Sbjct  209   MTVELDNARILITDKKISNIQDLVGVLEKVAKAGQPLLIIAEDIEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L V A+KAPGFGER+   L+DIAILTGG +I EE+GLSLD A  D+LG A K+ + K++ 
Sbjct  269   LSVCAIKAPGFGERRKAMLEDIAILTGGQLISEEIGLSLDNASLDMLGTARKIEIDKENT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV  G  + +V KR+ Q++  +EV D +Y+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVAAGDHKADVQKRIEQVRKQLEVTDSEYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR++DALNATKAAVEEGIV GGG TL+ L++KVDA+K SL  +E ++GADIV R+L 
Sbjct  389   DRKLRIQDALNATKAAVEEGIVPGGGTTLIHLTTKVDAIKNSL-TEEAQIGADIVARSLD  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ +A NAG  GSVV +KV  ++    GYNA TG Y+D++AAGIIDP KVVR  L++A
Sbjct  448   MPLRQMADNAGAEGSVVVDKVRGTEF-NIGYNAITGEYQDMIAAGIIDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ +V EI E EP  AG P
Sbjct  507   ASIASMVLTTEAIVAEIPEKEP--AGAP  532



>ref|WP_017296590.1| molecular chaperone GroEL [Nodosilinea nodulosa]
Length=557

 Score =   438 bits (1127),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 295/388 (76%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG++ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQFDRGYISPYFVTD E+
Sbjct  150   SAGSDEEIGTMIAEAMDKVTKDGVITVEESKSLYTELDVVEGMQFDRGYISPYFVTDQER  209

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E DN ++L+VDKKI + +DL++VLE   R G P+LIIAEDIE EALATLVVNK RG 
Sbjct  210   MVTELDNARILIVDKKIGSIQDLVSVLERVAREGAPLLIIAEDIEGEALATLVVNKARGV  269

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+K+P FG+R+   L DIA+LTGG VI EE+GLSL+ AD  +LG A KV +TKD+ 
Sbjct  270   LNVAAIKSPSFGDRRKAMLQDIAVLTGGQVISEEIGLSLETADLSMLGLATKVTITKDTT  329

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             T+V D   + ++ KR+AQI+  +E  D DY+KEKL+ER+AKL+GGVAVI+VGA TETELK
Sbjct  330   TLVSDAGNKADIDKRIAQIRQELERTDSDYDKEKLSERLAKLAGGVAVIKVGAATETELK  389

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR++DAL+ATKAAVEEGIV GGG TLL L+ K++ALK SL + EE +G DIV RA+ 
Sbjct  390   DRKLRIDDALSATKAAVEEGIVPGGGATLLHLAPKLEALKGSLSS-EEAIGVDIVMRAVE  448

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAG  GSV+ EKV +   P  GYNA TG YEDL+ AGIIDP KVVR  L+ A
Sbjct  449   APLRQIADNAGQQGSVIVEKVRAMSFP-MGYNALTGTYEDLIQAGIIDPAKVVRSALQDA  507

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ +V EI EP P  AG+P
Sbjct  508   ASIAGMVLTTEALVAEIPEP-PAPAGDP  534



>ref|WP_017711036.1| molecular chaperone GroEL [Prochlorothrix hollandica]
Length=559

 Score =   438 bits (1126),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 240/388 (62%), Positives = 290/388 (75%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             S+GN+ EVG MIAEAM KV + GV+T+EE KS    L VVEGMQFDRGYISPYFVTD E+
Sbjct  149   SSGNDEEVGRMIAEAMDKVTKDGVITVEESKSLITELEVVEGMQFDRGYISPYFVTDQER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E D+  LL+ DKKI++ +DL+ VLE   R+G P+LIIAED++ EALATLVVNK+RG 
Sbjct  209   MVAELDDVLLLITDKKISSIQDLVPVLEKLARAGKPLLIIAEDVDGEALATLVVNKMRGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L   A+KAPGFG+R+   L DIAILTGG +I EE+GLSLD    D+LG A KV L KD+ 
Sbjct  269   LNAVAVKAPGFGDRRKAMLQDIAILTGGQLISEEIGLSLDTVTLDMLGKARKVTLQKDTT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV    ++++V+ R+ QI+  +E  D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   IIVAGEESRKDVATRIGQIRKQLEETDSDYDKEKLQERIAKLAGGVAVIKVGAPTETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
              +KLR+EDALNATKAAVEEGIV GGG TLLRL+ K+D LK SL   EE +G DIV RALS
Sbjct  389   NRKLRIEDALNATKAAVEEGIVPGGGTTLLRLAQKLDGLKASLSR-EESLGVDIVARALS  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAGV GSVV EKVL+      GYNA T  YEDL+AAGI+DP KVVR  L+ A
Sbjct  448   APLRQIADNAGVEGSVVVEKVLAQTPFSMGYNALTNTYEDLVAAGIVDPAKVVRSALQDA  507

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             ASVA   L ++ +VVE  +PEP  +G P
Sbjct  508   ASVAAMVLTTEVIVVE--KPEPEGSGGP  533



>ref|WP_006099811.1| molecular chaperone GroEL [Coleofasciculus chthonoplastes]
 gb|EDX76853.1| chaperonin GroL [Coleofasciculus chthonoplastes PCC 7420]
Length=557

 Score =   436 bits (1122),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 229/382 (60%), Positives = 294/382 (77%), Gaps = 4/382 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIA+AM KV + GV+T+EE KS    L VVEGMQ DRGY+SPYFV+D E+
Sbjct  149   SAGNDEEVGQMIAQAMDKVTKDGVITVEESKSLSTELEVVEGMQIDRGYLSPYFVSDQER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE+++  +L+ DKKI N ++L+++LE   R+  P+LIIAED+E EALATLVVNK RG 
Sbjct  209   MTVEFEDSYILITDKKINNIQELVSILEKVARASKPLLIIAEDVEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+KAPGFG+R+ Q L DIA+LTGG +I EE+GLSLD A ++++G A K+ + KDS 
Sbjct  269   LNVAAVKAPGFGDRRKQMLQDIAVLTGGQLISEEIGLSLDSASTEMMGTARKITIDKDST  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV  G T+ EV KR+AQI+  +E  D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVASGETKPEVEKRIAQIRKQLEETDSDYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAA++EGIV GG  TL+RL SKVD +K +L+  EE++GADIV + L 
Sbjct  389   DRKLRIEDALNATKAAIDEGIVPGGATTLIRLISKVDGIKANLDA-EEQIGADIVAKTLE  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ +A NAGV G+V+ EKV  S     GYNAATG  EDL+AAGI+DP KVVR  L++A
Sbjct  448   APLRQMADNAGVEGAVIVEKVRESQG-NIGYNAATGKLEDLIAAGILDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEP  458
              S+A   L ++ +VVE  +PEP
Sbjct  507   GSIAGMVLTTEALVVE--KPEP  526



>ref|WP_011429241.1| molecular chaperone GroEL [Synechococcus sp. JA-3-3Ab]
 ref|YP_473815.1| chaperonin GroEL [Synechococcus sp. JA-3-3Ab]
 sp|Q2JXD4.1|CH601_SYNJA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 
1; AltName: Full=Protein Cpn60 1 [Synechococcus sp. JA-3-3Ab]
 gb|ABC98552.1| chaperonin GroEL [Synechococcus sp. JA-3-3Ab]
Length=542

 Score =   435 bits (1118),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 288/381 (76%), Gaps = 2/381 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIA AM  VGR GV+T+EE KS E  L VVEGMQFDRGYISPYFVTD+E+
Sbjct  150   SAGNDPEVGEMIARAMDAVGRDGVITVEESKSLETQLEVVEGMQFDRGYISPYFVTDTER  209

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  EY+N  LL+   K++N +DL+ VLE   R G P+L+IAED+E EALATLVVNKLRG 
Sbjct  210   MVAEYENAYLLITSNKLSNLQDLVPVLERVAREGRPLLVIAEDVEGEALATLVVNKLRGV  269

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L   A+KAP FG+R+   L+DIAILTGG +I E++G+ L+    D++G A K+ +TKD  
Sbjct  270   LNAVAVKAPAFGDRRKAMLEDIAILTGGQLISEDIGIKLENVTLDMMGVARKITVTKDKT  329

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DGST+  V KRVAQI+  +E  D +Y++EKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  330   TIVTDGSTKAAVEKRVAQIRKQLETTDSEYDREKLQERIAKLAGGVAVIKVGAATETELK  389

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNAT+AAVEEGIV GGG TLL LS  + A K +L N EE+VGADIV RAL 
Sbjct  390   DRKLRIEDALNATRAAVEEGIVPGGGATLLHLSKGIPAFKANL-NAEEQVGADIVCRALQ  448

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL  IA NAG+ GSVV EKVL  + P +G++A TG Y D+ A GI+DP KVVR  L++A
Sbjct  449   APLYQIAHNAGLEGSVVVEKVLEKEMP-FGFDALTGTYVDMFAQGIVDPAKVVRSALQNA  507

Query  523   ASVAKTFLMSDCVVVEIKEPE  461
             AS+A  +L ++ +VVE  EP+
Sbjct  508   ASIAAMYLTTEAIVVEKPEPK  528



>ref|WP_035984973.1| molecular chaperone GroEL [Leptolyngbya sp. KIOST-1]
Length=560

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 235/388 (61%), Positives = 294/388 (76%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAG++ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQFDRGYISPYFVTD E+
Sbjct  150   SAGSDEEIGRMIAEAMDKVTKDGVITVEESKSLYTELDVVEGMQFDRGYISPYFVTDQER  209

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E DN ++L+ DKKI + +DL++VLE   R G P+LIIAEDIE EALATLVVNK RG 
Sbjct  210   MVTELDNARVLITDKKIGSIQDLVSVLERVAREGAPLLIIAEDIEGEALATLVVNKARGV  269

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+KAP FG+R+   L DIA+LTGG VI EEVGLSLD AD  +LG A KV LTKD+ 
Sbjct  270   LNVAAIKAPSFGDRRKAMLQDIAVLTGGQVISEEVGLSLDTADLSMLGTATKVTLTKDTT  329

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             T+V +   + ++ KR+AQI+  +E  D DY+KEKL+ER+AKL+GGVAVI+VGA TETELK
Sbjct  330   TLVSEAGNKADIDKRIAQIRQELERTDSDYDKEKLSERLAKLAGGVAVIKVGAATETELK  389

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR++DAL+ATKAAVEEGIV GGG TLL L+ ++ A+K +L   EE +G DIV RA+ 
Sbjct  390   DRKLRIDDALSATKAAVEEGIVPGGGATLLHLAPRLAAVKANLST-EEAIGVDIVMRAVE  448

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAG  GSV+ EKV + D P  GYNA +G+Y+DL+ AGIIDP KVVR  L+ A
Sbjct  449   APLRQIADNAGQEGSVIVEKVKAMDFP-MGYNALSGDYQDLIQAGIIDPAKVVRSALQDA  507

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ +V EI EP P  AG+P
Sbjct  508   ASIAGMVLTTEALVAEIPEP-PAPAGDP  534



>ref|WP_015186725.1| 60 kDa chaperonin [Gloeocapsa sp. PCC 7428]
 ref|YP_007126008.1| 60 kDa chaperonin [Gloeocapsa sp. PCC 7428]
 gb|AFZ28848.1| 60 kDa chaperonin [Gloeocapsa sp. PCC 7428]
Length=549

 Score =   434 bits (1115),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 234/388 (60%), Positives = 301/388 (78%), Gaps = 4/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIAEAM +V + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDDEVGAMIAEAMERVTKDGVITVEESKSLTTDLEVVEGMQLDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M V+++N ++L+ DKKI+  +DLI VLE   R+G P+LIIAED++ EALATLVVNK RG 
Sbjct  209   MVVDFENPRILITDKKISTIQDLIPVLEKVARAGQPLLIIAEDVDGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L V A+KAPGFG+R+ + L DIA+LTGG VI EEVGLSLD A  +++G A KV + K++ 
Sbjct  269   LNVCAIKAPGFGDRRKEMLRDIAVLTGGQVISEEVGLSLDDASLEMMGVARKVTIDKEAT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV  G  +++V KR+AQI+  +E +D +Y+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVAGGDNKDDVQKRIAQIRRQLEESDSEYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG  L+ LS+KV+ +K SL NDEEK+GADIVKR+L 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTMLIHLSTKVEDIKNSL-NDEEKIGADIVKRSLE  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ +A NAGV GSV+ EKV  ++    GYNAATG ++DL+AAGI+DP KVVR  L++A
Sbjct  448   APLRQMADNAGVEGSVIVEKVRETEF-NIGYNAATGEFQDLIAAGILDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
              S+A   L ++ +VVE  +PE   A  P
Sbjct  507   GSIAGMVLTTEALVVE--KPEKKAAAAP  532



>ref|WP_009458011.1| MULTISPECIES: molecular chaperone GroEL [Fischerella]
 gb|EHC11622.1| 60 kDa chaperonin [Fischerella sp. JSC-11]
Length=550

 Score =   434 bits (1115),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 232/388 (60%), Positives = 299/388 (77%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDEEIGAMIAEAMEKVTKDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++N ++L+ DKKI++ +DL+ VLE   R G P+LIIAED+E EALATLVVNK RG 
Sbjct  209   MTVEFENARILITDKKISSIQDLVPVLEKVARLGQPLLIIAEDVEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+KAPGFG+R+   L DIAILTGG +I EE+GLSLD    ++LG A ++ + K++ 
Sbjct  269   LSVAAIKAPGFGDRRKAMLQDIAILTGGQLISEEIGLSLDMVSLEMLGVARRISIDKENT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DG  +++V KR+AQI+  +E  D +Y+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVADGEHKDDVQKRIAQIRKQLEETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG  L+ LS+KV  +K SL N+EE++GADIV R+L 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTMLIHLSTKVAEIKNSL-NEEEQIGADIVGRSLD  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAGV GSV+ EKV +++    GYNAATG ++D++AAGI+DP KVVR  L++A
Sbjct  448   APLRQIADNAGVEGSVIVEKVRTTEF-NVGYNAATGEFQDMIAAGILDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ VV E  E +P   G P
Sbjct  507   ASIASMVLTTEAVVAEKPEKKPA-GGAP  533



>ref|WP_008230076.1| Heat shock protein 60 family chaperone GroEL [Richelia intracellularis]
 emb|CCH65789.1| Heat shock protein 60 family chaperone GroEL [Richelia intracellularis 
HM01]
Length=562

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 226/382 (59%), Positives = 297/382 (78%), Gaps = 2/382 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MI+EAM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+T++E+
Sbjct  149   SAGNDDEVGTMISEAMVKVTKDGVITVEESKSLSTELEVVEGMQIDRGYISPYFITNNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE +N ++L+ DKKI+N +DL+ +LE   +SG P+LIIAEDIE EALATLVVNK RG 
Sbjct  209   MTVELENPRILITDKKISNVQDLVGILEKVAKSGQPLLIIAEDIEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L V A+KAPGFG+R+   L+DI ILTGG +I EE+GL+LD A  D+LG A K+ + K++ 
Sbjct  269   LSVCAIKAPGFGDRRKAMLEDITILTGGQLISEEIGLNLDAASLDMLGTARKIEIDKENT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TI+  G   ++V KR+AQI+  +E+ D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIIAAGDNTQDVQKRIAQIRKQLELTDSDYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR++DALNATKAAVEEGIV GGG TL+ LS+K+DA+K  L  +EE++GADIV R+L 
Sbjct  389   DRKLRIQDALNATKAAVEEGIVPGGGTTLIHLSTKIDAIKNKL-TEEEQIGADIVARSLE  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL  IA+NAG  GSV+++KV +++   +GYNA  G Y+D++AAGIIDP KVVR  L++A
Sbjct  448   LPLCQIAENAGAEGSVITDKVRNTEF-NFGYNAMNGEYQDMIAAGIIDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEP  458
             AS+A   L ++ +V EI E +P
Sbjct  507   ASIASMVLTTEAIVAEIPEKQP  528



>ref|WP_016865329.1| molecular chaperone GroEL [Fischerella muscicola]
Length=553

 Score =   433 bits (1113),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 231/388 (60%), Positives = 300/388 (77%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDEEIGAMIAEAMEKVTKDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++N ++L+ DKKI++ +DL+ VLE   R G P+LIIAED+E EALATLVVNK RG 
Sbjct  209   MTVEFENARILITDKKISSIQDLVPVLEKVARLGQPLLIIAEDVEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+KAPGFG+R+   L DIAILTGG +I EE+GLSLD A  ++LG A ++ + K++ 
Sbjct  269   LSVAAIKAPGFGDRRKAMLQDIAILTGGQLISEEIGLSLDIASLEMLGVARRISIDKENT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV DG   ++V KR+AQI+  +E  D +Y+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVADGQHTDDVQKRIAQIRKQLEETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG  L+ LS+K+  +K++L N+EE++GADIV R+L 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTMLIHLSTKIPEIKKNL-NEEEQIGADIVGRSLD  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAGV GSV+ EKV +++    GYNAATG ++D++AAGI+DP KVVR  L++A
Sbjct  448   APLRQIADNAGVEGSVIVEKVRTTEF-NVGYNAATGEFQDMIAAGILDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ VV E  E +P   G P
Sbjct  507   ASIASMVLTTEAVVAEKPEKKPA-GGAP  533



>ref|WP_016859319.1| molecular chaperone GroEL [Fischerella muscicola]
Length=557

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 232/388 (60%), Positives = 295/388 (76%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDEEIGAMIAEAMDKVTKDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++N ++L+ DKKI+N +DL+ VLE   R G P+LIIAED+E EALATLVVNK RG 
Sbjct  209   MTVEFENARILITDKKISNIQDLVPVLEKVARLGQPLLIIAEDVEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L  AA+KAPGFG+R+   L DIAILTGG ++ EE+GLSLD    ++LG A K+ + KD+ 
Sbjct  269   LSAAAIKAPGFGDRRKAMLQDIAILTGGQLVSEEIGLSLDIVSLEMLGTAQKIAIDKDNT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV       +V KR+AQI+  +E  D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVAGSEHSADVQKRIAQIRKQLEETDSDYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG  L+ L++KV  +K SL NDEEK+GADIV+R+L 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTMLIHLATKVAEIKNSL-NDEEKIGADIVERSLD  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAGV G+V+ EKV +++    GYNAATG ++D++AAGI+DP KVVR  L++A
Sbjct  448   APLRQIADNAGVEGAVIVEKVRTTEF-NVGYNAATGEFQDMIAAGILDPAKVVRYALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ VV E  E +P   G P
Sbjct  507   ASIASMVLTTEAVVAEKPEKKPA-GGAP  533



>ref|WP_026722382.1| molecular chaperone GroEL [Fischerella sp. PCC 9431]
Length=559

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 294/388 (76%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDEEIGAMIAEAMEKVTKDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++N ++L+ DKKI+N +DL+ VLE   R G P+LIIAED+E EALATLVVNK RG 
Sbjct  209   MTVEFENARILITDKKISNIQDLVPVLEKVARLGQPLLIIAEDVEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L  AA+KAPGFG+R+   L DIAILTGG +I EE+GLSLD    ++LG A K+ + KD+ 
Sbjct  269   LSAAAIKAPGFGDRRKAMLQDIAILTGGQLISEEIGLSLDIVSLEMLGTAQKIAIDKDNT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV       +V KR+AQI+  +E  D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVAGSEHSADVQKRIAQIRKQLEETDSDYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG  L+ LS KV  +K +L +DEEK+GADIV+R+L 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTMLIHLSKKVAEIKNTL-SDEEKIGADIVERSLD  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAGV G+V+ EKV +++    GYNAATG ++D++AAGIIDP KVVR  L++A
Sbjct  448   APLRQIADNAGVEGAVIVEKVRTTEF-NVGYNAATGEFQDMIAAGIIDPAKVVRYALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ VV E  E +P   G P
Sbjct  507   ASIASMVLTTEAVVAEKPEKKPA-GGAP  533



>ref|WP_039715090.1| molecular chaperone GroEL [Scytonema millei]
 gb|KIF17530.1| molecular chaperone GroEL [Scytonema millei VB511283]
Length=555

 Score =   431 bits (1108),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 232/388 (60%), Positives = 298/388 (77%), Gaps = 4/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ EVG MIAEAM +V + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDEEVGAMIAEAMERVTKDGVITVEESKSLTTDLEVVEGMQLDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M  E++N +LL+ DKKI+  +DLI++LE   R+G P++IIAED++ EALATLVVNK RG 
Sbjct  209   MVAEFENPRLLITDKKISTIQDLISILEKVARAGQPLIIIAEDVDGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L V A+KAPGFG+R+ + L DIA+LTGG +I EE+GLSLD A  +++G A KV++ K+S 
Sbjct  269   LSVCAIKAPGFGDRRKEMLRDIAVLTGGQLISEEIGLSLDTASLEMMGVARKVIIDKEST  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
             TIV +G  + +V KR++QI+  +  +D DY+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   TIVAEGENKADVEKRISQIRKQLAESDSDYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG TL+ L+ KVD  K SL+ DEEKV A+IV RAL 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTTLIHLAKKVDEFKASLQ-DEEKVAAEIVARALE  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ +A NAGV GSVV E+V  +D    GYNAATG +EDL+AAGI+DP KVVR  L++A
Sbjct  448   APLRQMADNAGVEGSVVVERVRETDF-NVGYNAATGEFEDLIAAGILDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
              S+A   L ++ +VVE  +PE   A  P
Sbjct  507   GSIAGMVLTTEALVVE--KPEKKAAAAP  532



>ref|WP_016873105.1| molecular chaperone GroEL [Chlorogloeopsis fritschii]
Length=553

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 229/388 (59%), Positives = 297/388 (77%), Gaps = 3/388 (1%)
 Frame = -2

Query  1603  SAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENSLRVVEGMQFDRGYISPYFVTDSEK  1424
             SAGN+ E+G MIAEAM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+TD+E+
Sbjct  149   SAGNDEEIGAMIAEAMEKVTKDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITDNER  208

Query  1423  MAVEYDNCKLLLVDKKITNARDLINVLESAIRSGFPILIIAEDIEQEALATLVVNKLRGA  1244
             M VE++N ++L+ DKKI++ +DL+ VLE   R G  +LIIAED+E EALATLVVNK RG 
Sbjct  209   MTVEFENARILITDKKISSIQDLVPVLEKVARLGQALLIIAEDVEGEALATLVVNKARGV  268

Query  1243  LKVAALKAPGFGERKSQYLDDIAILTGGTVIREEVGLSLDKADSDVLGHAAKVVLTKDSA  1064
             L VAA+KAPGFGER+   L+DIAILTGG +I EE+GLSLD    ++LG A K+ + K++ 
Sbjct  269   LTVAAIKAPGFGERRKAMLEDIAILTGGQLISEEIGLSLDTVSLEMLGTARKISIDKENT  328

Query  1063  TIVGDGSTQEEVSKRVAQIKNLIEVADQDYEKEKLNERIAKLSGGVAVIQVGAQTETELK  884
              IV + +  ++V KR+ QI+  ++  D +Y+KEKL ERIAKL+GGVAVI+VGA TETELK
Sbjct  329   VIVSESAQTQDVQKRIGQIRKQLQETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELK  388

Query  883   EKKLRVEDALNATKAAveegivvggGCTLLRLSSKVDALKESLENDEEKVGADIVKRALS  704
             ++KLR+EDALNATKAAVEEGIV GGG  L+ LS+K+D +K SL NDEE++GA+I+KR+L 
Sbjct  389   DRKLRIEDALNATKAAVEEGIVPGGGTMLIHLSTKIDEIKNSL-NDEEQIGAEIIKRSLD  447

Query  703   YPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHA  524
              PL+ IA NAG  GSV+ EKV ++D    GYNAATG ++DL+AAGIIDP KVVR  L++A
Sbjct  448   APLRQIADNAGAEGSVIVEKVRTTDF-NVGYNAATGEFQDLIAAGIIDPAKVVRSALQNA  506

Query  523   ASVAKTFLMSDCVVVEIKEPEPVMAGNP  440
             AS+A   L ++ +V E  E +P   G P
Sbjct  507   ASIAAMVLTTEAIVAEKPEKKPA-GGAP  533



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4495759397920