BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24413_g1_i2 len=2235 path=[517:0-246 764:247-336 854:337-387
905:388-696 1211:697-726 376:727-858 1369:859-899 200:900-1203
1712:1204-1238 66:1239-1281 1789:1282-1396 1904:1397-2234]

Length=2235
                                                                      Score     E

ref|XP_004500227.1|  PREDICTED: peptide transporter PTR5-like iso...    897   0.0      
ref|XP_009780466.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       896   0.0      
ref|XP_011080847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    892   0.0      
ref|XP_011080848.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    889   0.0      
gb|EYU45754.1|  hypothetical protein MIMGU_mgv1a024850mg                889   0.0      
ref|XP_006350821.1|  PREDICTED: peptide transporter PTR1-like           885   0.0      
ref|XP_010323334.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1 isof...    884   0.0      
ref|XP_004241180.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       884   0.0      
ref|XP_010323335.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1 isof...    883   0.0      
emb|CDP09151.1|  unnamed protein product                                882   0.0      
ref|XP_006362448.1|  PREDICTED: peptide transporter PTR1-like           881   0.0      
emb|CDP09153.1|  unnamed protein product                                878   0.0      
gb|KHN02576.1|  Peptide transporter PTR1                                877   0.0      
ref|XP_006591201.1|  PREDICTED: peptide transporter PTR1-like iso...    877   0.0      
ref|XP_009779291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       873   0.0      
ref|XP_003551296.1|  PREDICTED: peptide transporter PTR1                872   0.0      
gb|EYU45753.1|  hypothetical protein MIMGU_mgv1a003661mg                870   0.0      
gb|KDP46546.1|  hypothetical protein JCGZ_08518                         868   0.0      
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       865   0.0      
gb|KDP46548.1|  hypothetical protein JCGZ_08520                         865   0.0      
ref|XP_002520427.1|  peptide transporter, putative                      864   0.0      Ricinus communis
ref|XP_009337310.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       864   0.0      
ref|XP_009591017.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       863   0.0      
gb|KEH34179.1|  proton-dependent oligopeptide transport family pr...    863   0.0      
ref|XP_007016184.1|  Peptide transporter 1                              862   0.0      
ref|XP_004294248.1|  PREDICTED: peptide transporter PTR1-like           862   0.0      
ref|XP_002313394.1|  hypothetical protein POPTR_0009s04710g             858   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       857   0.0      
ref|XP_011032155.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       856   0.0      
ref|XP_002298324.1|  hypothetical protein POPTR_0001s25570g             856   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007146742.1|  hypothetical protein PHAVU_006G065900g             855   0.0      
ref|XP_008220400.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       852   0.0      
ref|XP_009346885.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    852   0.0      
ref|XP_011081130.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       851   0.0      
ref|XP_009346886.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    851   0.0      
ref|XP_006425015.1|  hypothetical protein CICLE_v10028095mg             851   0.0      
ref|XP_008355088.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    850   0.0      
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       850   0.0      
ref|XP_009374282.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    843   0.0      
ref|XP_007208292.1|  hypothetical protein PRUPE_ppa003364mg             840   0.0      
gb|KDP24486.1|  hypothetical protein JCGZ_25050                         835   0.0      
ref|XP_010262765.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       832   0.0      
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg             830   0.0      
ref|XP_010650937.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    830   0.0      
gb|KHG14016.1|  Peptide transporter PTR1 -like protein                  830   0.0      
ref|XP_010650936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    830   0.0      
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                    830   0.0      
gb|EPS59528.1|  hypothetical protein M569_15276                         830   0.0      
gb|AFN53657.1|  putative peptide transporter                            828   0.0      
gb|KDO53228.1|  hypothetical protein CISIN_1g0083672mg                  827   0.0      
ref|XP_004143145.1|  PREDICTED: peptide transporter PTR1-like           825   0.0      
ref|XP_009624728.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       825   0.0      
ref|XP_010654188.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       825   0.0      
ref|XP_010044085.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            823   0.0      
gb|KGN47104.1|  hypothetical protein Csa_6G187970                       825   0.0      
ref|XP_004490642.1|  PREDICTED: peptide transporter PTR1-like           823   0.0      
ref|XP_004160177.1|  PREDICTED: LOW QUALITY PROTEIN: peptide tran...    823   0.0      
gb|KDO66792.1|  hypothetical protein CISIN_1g0086231mg                  822   0.0      
ref|XP_010033021.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       822   0.0      
ref|XP_010104684.1|  Peptide transporter                                822   0.0      
emb|CDP09152.1|  unnamed protein product                                822   0.0      
ref|XP_008464060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       818   0.0      
ref|XP_011090498.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       818   0.0      
ref|XP_009774291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       817   0.0      
ref|XP_010654192.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       815   0.0      
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            815   0.0      
gb|KHN40046.1|  Peptide transporter PTR1                                814   0.0      
gb|KHG08248.1|  Peptide transporter PTR1 -like protein                  813   0.0      
ref|XP_003544872.1|  PREDICTED: peptide transporter PTR1-like iso...    813   0.0      
gb|KDP24485.1|  hypothetical protein JCGZ_25049                         812   0.0      
ref|XP_003518298.1|  PREDICTED: peptide transporter PTR1-like           809   0.0      
ref|XP_011090404.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       807   0.0      
ref|XP_011003666.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       806   0.0      
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       806   0.0      
ref|XP_009795638.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       806   0.0      
ref|XP_004308641.1|  PREDICTED: peptide transporter PTR5-like           806   0.0      
ref|XP_006373974.1|  hypothetical protein POPTR_0016s11940g             805   0.0      
ref|XP_002877959.1|  proton-dependent oligopeptide transport fami...    803   0.0      
ref|XP_011019153.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            803   0.0      
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...    803   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_195738.1|  peptide transporter PTR5                              803   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870939.1|  proton-dependent oligopeptide transport fami...    803   0.0      
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             801   0.0      
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    801   0.0      
ref|NP_190982.1|  peptide transporter PTR1                              800   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287367.1|  hypothetical protein CARUB_v10000567mg             800   0.0      
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             800   0.0      
ref|XP_008442465.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    799   0.0      
ref|XP_002533893.1|  peptide transporter, putative                      819   0.0      Ricinus communis
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       797   0.0      
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       797   0.0      
ref|XP_004137914.1|  PREDICTED: peptide transporter PTR5-like           797   0.0      
ref|XP_010515930.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       796   0.0      
ref|XP_006363097.1|  PREDICTED: peptide transporter PTR1-like           796   0.0      
ref|XP_010427083.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            795   0.0      
ref|XP_004163862.1|  PREDICTED: LOW QUALITY PROTEIN: peptide tran...    795   0.0      
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    794   0.0      
ref|XP_009405847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       795   0.0      
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            794   0.0      
ref|XP_010490600.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       794   0.0      
ref|XP_010452016.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       792   0.0      
ref|XP_010423917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2            791   0.0      
ref|XP_006398647.1|  hypothetical protein EUTSA_v10013125mg             790   0.0      
ref|XP_008242154.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       790   0.0      
gb|KHN06246.1|  Peptide transporter PTR1                                788   0.0      
ref|XP_003529142.1|  PREDICTED: peptide transporter PTR1-like iso...    788   0.0      
ref|XP_008785424.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       788   0.0      
gb|KEH23143.1|  proton-dependent oligopeptide transport family pr...    786   0.0      
ref|XP_008345515.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       786   0.0      
ref|XP_008388132.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       785   0.0      
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       785   0.0      
ref|XP_011077583.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       785   0.0      
emb|CBI30424.3|  unnamed protein product                                816   0.0      
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like           784   0.0      
gb|ACJ85720.1|  unknown                                                 781   0.0      Medicago truncatula
ref|XP_009374284.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    782   0.0      
ref|XP_010676231.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       783   0.0      
ref|XP_006848107.1|  hypothetical protein AMTR_s00029p00214340          783   0.0      
ref|XP_010558361.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       782   0.0      
ref|XP_002309120.2|  proton-dependent oligopeptide transport fami...    781   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009358875.1|  PREDICTED: uncharacterized protein LOC103949485    803   0.0      
ref|XP_010262762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       781   0.0      
gb|EYU41841.1|  hypothetical protein MIMGU_mgv1a017650mg                780   0.0      
ref|XP_008239599.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       779   0.0      
emb|CDY13185.1|  BnaC04g26500D                                          778   0.0      
ref|XP_006429308.1|  hypothetical protein CICLE_v10013821mg             777   0.0      
ref|XP_010101811.1|  Peptide transporter                                778   0.0      
ref|XP_007140383.1|  hypothetical protein PHAVU_008G107200g             777   0.0      
gb|KDO53230.1|  hypothetical protein CISIN_1g0083672mg                  775   0.0      
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606    796   0.0      
gb|EYU41851.1|  hypothetical protein MIMGU_mgv1a020985mg                776   0.0      
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       773   0.0      
ref|XP_004492413.1|  PREDICTED: peptide transporter PTR1-like iso...    772   0.0      
ref|XP_003604615.1|  Peptide transporter PTR1                           773   0.0      
ref|XP_009405229.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       772   0.0      
ref|XP_007207074.1|  hypothetical protein PRUPE_ppa025891mg             772   0.0      
emb|CDY10485.1|  BnaCnng03860D                                          771   0.0      
ref|XP_004506789.1|  PREDICTED: peptide transporter PTR1-like iso...    771   0.0      
gb|KHN42300.1|  Peptide transporter PTR1                                770   0.0      
ref|XP_009122828.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2            769   0.0      
ref|XP_003516940.1|  PREDICTED: peptide transporter PTR1-like iso...    769   0.0      
ref|XP_004305145.1|  PREDICTED: peptide transporter PTR5-like           787   0.0      
ref|NP_001041994.1|  Os01g0142800                                       766   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007016185.1|  Peptide transporter 1                              766   0.0      
dbj|BAG91734.1|  unnamed protein product                                766   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392698.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       763   0.0      
gb|KDO53231.1|  hypothetical protein CISIN_1g008792mg                   761   0.0      
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...    762   0.0      
ref|XP_006848110.1|  hypothetical protein AMTR_s00029p00215100          761   0.0      
gb|EPS69660.1|  hypothetical protein M569_05105                         757   0.0      
ref|XP_011094976.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    776   0.0      
ref|XP_010907628.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       755   0.0      
gb|EYU26644.1|  hypothetical protein MIMGU_mgv1a003683mg                751   0.0      
ref|NP_001131161.1|  uncharacterized protein LOC100192469               748   0.0      Zea mays [maize]
ref|XP_006643742.1|  PREDICTED: peptide transporter PTR1-like           747   0.0      
gb|AIL30501.1|  oligopeptide transporter 1                              744   0.0      
ref|XP_009116102.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            743   0.0      
dbj|BAJ95903.1|  predicted protein                                      743   0.0      
gb|AAC32034.1|  peptide transporter                                     743   0.0      Hordeum vulgare [barley]
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    743   0.0      
ref|XP_006365835.1|  PREDICTED: peptide transporter PTR2-like           743   0.0      
ref|XP_009591011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       742   0.0      
ref|NP_001233998.1|  oligopeptide transporter 1                         739   0.0      
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           738   0.0      
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                    736   0.0      
ref|XP_006365609.1|  PREDICTED: peptide transporter PTR5-like           734   0.0      
ref|XP_004246936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       733   0.0      
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           733   0.0      
gb|KDP38200.1|  hypothetical protein JCGZ_04843                         731   0.0      
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    729   0.0      
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    729   0.0      
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like           729   0.0      
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    729   0.0      
ref|NP_178313.1|  peptide transporter PTR2                              728   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like           728   0.0      
ref|XP_004504618.1|  PREDICTED: peptide transporter PTR2-like           728   0.0      
gb|ABK24723.1|  unknown                                                 727   0.0      Picea sitchensis
ref|XP_010502212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       726   0.0      
ref|XP_010513957.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            726   0.0      
ref|XP_002521890.1|  peptide transporter, putative                      726   0.0      Ricinus communis
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             725   0.0      
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g             725   0.0      
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    725   0.0      
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       724   0.0      
ref|XP_002875108.1|  ATPTR2-B                                           724   0.0      
gb|EMT00809.1|  Peptide transporter PTR5                                724   0.0      
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    723   0.0      
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       723   0.0      
gb|KHG27963.1|  Peptide transporter PTR2 -like protein                  723   0.0      
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg             722   0.0      
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           722   0.0      
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg             723   0.0      
emb|CAA54634.1|  oligopeptide transporter 1-1                           722   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABR32183.1|  peptide transporter                                     721   0.0      Hakea actites
ref|XP_004297798.1|  PREDICTED: peptide transporter PTR2-like           721   0.0      
emb|CDY03084.1|  BnaC07g21430D                                          721   0.0      
gb|EMS46611.1|  Peptide transporter PTR5                                723   0.0      
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           721   0.0      
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       720   0.0      
gb|AAP44102.1|  peptide transporter 1                                   720   0.0      Vicia faba [broad bean]
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            720   0.0      
gb|KHG06441.1|  Peptide transporter PTR2 -like protein                  720   0.0      
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       720   0.0      
ref|XP_006292510.1|  hypothetical protein CARUB_v10018740mg             719   0.0      
ref|XP_009101283.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            718   0.0      
gb|KDP38199.1|  hypothetical protein JCGZ_04842                         717   0.0      
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       717   0.0      Vitis vinifera
gb|KFK33424.1|  hypothetical protein AALP_AA5G011300                    717   0.0      
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       717   0.0      
emb|CDY17619.1|  BnaA06g34380D                                          719   0.0      
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          715   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       715   0.0      
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260          715   0.0      Sorghum bicolor [broomcorn]
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       713   0.0      
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       713   0.0      
gb|AAO64143.1|  putative oligopeptide transporter protein               710   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00365.1|  oligopeptide transporter - like protein                710   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          712   0.0      Sorghum bicolor [broomcorn]
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       712   0.0      
ref|XP_002992575.1|  hypothetical protein SELMODRAFT_135536             711   0.0      
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       711   0.0      
ref|XP_001769410.1|  predicted protein                                  711   0.0      
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           711   0.0      
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812              710   0.0      
ref|NP_001146682.1|  hypothetical protein                               710   0.0      Zea mays [maize]
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg                710   0.0      
ref|XP_010246838.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       709   0.0      
ref|XP_009114212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            709   0.0      
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       709   0.0      
gb|ACL52627.1|  unknown                                                 708   0.0      Zea mays [maize]
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790          708   0.0      
gb|EMS68423.1|  Peptide transporter PTR2                                707   0.0      
emb|CDY17446.1|  BnaC09g20910D                                          707   0.0      
gb|ADQ43190.1|  peptide transporter                                     706   0.0      
ref|XP_010276263.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       706   0.0      
ref|XP_010105518.1|  Peptide transporter                                724   0.0      
emb|CDP05420.1|  unnamed protein product                                706   0.0      
ref|XP_002992551.1|  hypothetical protein SELMODRAFT_448814             704   0.0      
dbj|BAJ95092.1|  predicted protein                                      704   0.0      
gb|ACN26865.1|  unknown                                                 701   0.0      Zea mays [maize]
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       702   0.0      
ref|XP_007205100.1|  hypothetical protein PRUPE_ppa014631mg             699   0.0      
ref|XP_010066525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       701   0.0      
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824             701   0.0      
ref|NP_001051098.1|  Os03g0719900                                       701   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97409.1|  predicted protein                                      701   0.0      
gb|EEE59822.1|  hypothetical protein OsJ_12376                          701   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           701   0.0      
dbj|BAK03852.1|  predicted protein                                      701   0.0      
ref|XP_006346629.1|  PREDICTED: peptide transporter PTR2-like           699   0.0      
ref|XP_006658184.1|  PREDICTED: peptide transporter PTR5-like           698   0.0      
gb|EMT02211.1|  Peptide transporter PTR1                                694   0.0      
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890          694   0.0      Sorghum bicolor [broomcorn]
gb|EMT20656.1|  Peptide transporter PTR5                                692   0.0      
ref|XP_010937012.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       692   0.0      
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    692   0.0      
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            688   0.0      
ref|XP_004504617.1|  PREDICTED: peptide transporter PTR2-like           688   0.0      
ref|XP_010105516.1|  Peptide transporter                                688   0.0      
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       701   0.0      
ref|XP_003524135.1|  PREDICTED: peptide transporter PTR2-like iso...    685   0.0      
gb|EMT07041.1|  Peptide transporter PTR2                                697   0.0      
gb|KEH34180.1|  proton-dependent oligopeptide transport family pr...    678   0.0      
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         682   0.0      
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       681   0.0      
ref|NP_001058672.1|  Os07g0100600                                       680   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAD31819.1|  putative peptide transport protein                     679   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006580079.1|  PREDICTED: peptide transporter PTR2-like iso...    679   0.0      
ref|XP_008220970.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       679   0.0      
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       677   0.0      
gb|ACG41138.1|  peptide transporter PTR2                                677   0.0      Zea mays [maize]
ref|XP_007225683.1|  hypothetical protein PRUPE_ppa003292mg             675   0.0      
ref|XP_004297797.1|  PREDICTED: peptide transporter PTR2-like           674   0.0      
emb|CAN80199.1|  hypothetical protein VITISV_030909                     673   0.0      Vitis vinifera
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    674   0.0      
ref|XP_006346661.1|  PREDICTED: peptide transporter PTR2-like           681   0.0      
ref|XP_009405084.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       671   0.0      
ref|XP_011029471.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       671   0.0      
ref|XP_006649696.1|  PREDICTED: peptide transporter PTR2-like           671   0.0      
ref|XP_003531411.1|  PREDICTED: peptide transporter PTR2-like           669   0.0      
gb|AAF20002.1|AF213936_1  amino acid/peptide transporter                667   0.0      
dbj|BAJ85008.1|  predicted protein                                      668   0.0      
ref|XP_004306584.1|  PREDICTED: peptide transporter PTR2-like           667   0.0      
gb|EAY89168.1|  hypothetical protein OsI_10664                          667   0.0      
gb|EMT06014.1|  Peptide transporter PTR5                                665   0.0      
ref|XP_008798061.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       665   0.0      
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    665   0.0      
ref|XP_010105517.1|  Peptide transporter                                663   0.0      
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            662   0.0      
gb|ABF94833.1|  Peptide transporter PTR2, putative, expressed           663   0.0      
ref|XP_007158831.1|  hypothetical protein PHAVU_002G185600g             661   0.0      
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    660   0.0      
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    657   0.0      
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    658   0.0      
ref|XP_004504619.1|  PREDICTED: peptide transporter PTR2-like           658   0.0      
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...    657   0.0      
ref|XP_008787879.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       657   0.0      
gb|EMS66305.1|  Peptide transporter PTR2                                665   0.0      
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...    657   0.0      
ref|XP_002317503.2|  Peptide transporter PTR2-B family protein          657   0.0      
ref|XP_008356408.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       650   0.0      
gb|KFK43704.1|  hypothetical protein AALP_AA1G162300                    655   0.0      
ref|NP_176411.2|  putative peptide/nitrate transporter                  653   0.0      
ref|XP_010680054.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       652   0.0      
ref|XP_007142231.1|  hypothetical protein PHAVU_008G263300g             645   0.0      
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    648   0.0      
gb|EAZ02458.1|  hypothetical protein OsI_24563                          648   0.0      
ref|XP_003558412.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       649   0.0      
ref|XP_009148842.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       647   0.0      
ref|XP_009117889.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       647   0.0      
ref|XP_002886485.1|  proton-dependent oligopeptide transport fami...    647   0.0      
ref|XP_004985080.1|  PREDICTED: peptide transporter PTR2-like           646   0.0      
emb|CDY59420.1|  BnaA09g56930D                                          644   0.0      
gb|KDO66793.1|  hypothetical protein CISIN_1g0086231mg                  638   0.0      
ref|XP_010430257.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    643   0.0      
ref|XP_010497442.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.5-like       641   0.0      
gb|AAB60766.1|  Strong similarity to Arabidopsis oligopeptide tra...    640   0.0      
ref|XP_006580081.1|  PREDICTED: peptide transporter PTR2-like iso...    639   0.0      
gb|EPS63244.1|  hypothetical protein M569_11542                         637   0.0      
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...    630   0.0      
ref|XP_006391918.1|  hypothetical protein EUTSA_v10023384mg             630   0.0      
gb|KHN25958.1|  Peptide transporter PTR2                                630   0.0      
ref|XP_002465588.1|  hypothetical protein SORBIDRAFT_01g041710          630   0.0      
gb|EPS59446.1|  hypothetical protein M569_15359                         630   0.0      
ref|XP_002992553.1|  hypothetical protein SELMODRAFT_135522             628   0.0      
ref|XP_002972320.1|  hypothetical protein SELMODRAFT_97239              627   0.0      
ref|XP_006301212.1|  hypothetical protein CARUB_v10021609mg             627   0.0      
ref|XP_006649697.1|  PREDICTED: peptide transporter PTR2-like           627   0.0      
gb|EEC74827.1|  hypothetical protein OsI_10666                          627   0.0      
ref|NP_001049488.1|  Os03g0235700                                       627   0.0      
ref|XP_010314236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    622   0.0      
gb|ABF94835.1|  Peptide transporter PTR2, putative, expressed           627   0.0      
ref|XP_003561849.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    626   0.0      
ref|XP_010228915.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    625   0.0      
ref|XP_003524136.1|  PREDICTED: peptide transporter PTR2-like           630   0.0      
emb|CDX81655.1|  BnaC08g39460D                                          623   0.0      
gb|ABF94834.1|  Peptide transporter PTR2, putative, expressed           621   0.0      
ref|XP_010937010.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       620   0.0      
ref|XP_008653226.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    619   0.0      
ref|XP_010502211.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4 isof...    613   0.0      
ref|XP_010502210.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4 isof...    613   0.0      
ref|XP_010513956.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like       613   0.0      
ref|XP_010424977.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like...    612   0.0      
gb|KHN29164.1|  Peptide transporter PTR2                                610   0.0      
gb|EMT07615.1|  Peptide transporter PTR2                                609   0.0      
ref|XP_009114213.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like...    605   0.0      
ref|XP_006849520.1|  hypothetical protein AMTR_s00024p00148850          603   0.0      
ref|XP_008798033.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       599   0.0      
emb|CDY04112.1|  BnaA09g18900D                                          598   0.0      
gb|ADQ43189.1|  oligopeptide transport protein                          595   0.0      
ref|XP_008346432.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       590   0.0      
gb|EYU41848.1|  hypothetical protein MIMGU_mgv1a022560mg                591   0.0      
ref|XP_006292667.1|  hypothetical protein CARUB_v10018909mg             595   0.0      
gb|ACQ90596.1|  putative peptide transporter                            595   0.0      
ref|XP_007045396.1|  Peptide transporter 2 isoform 2                    588   0.0      
ref|XP_010105519.1|  Peptide transporter                                592   0.0      
tpg|DAA44283.1|  TPA: hypothetical protein ZEAMMB73_649598              592   0.0      
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg             583   0.0      
ref|XP_006448045.1|  hypothetical protein CICLE_v10014643mg             583   0.0      
ref|XP_002981774.1|  hypothetical protein SELMODRAFT_115215             587   0.0      
ref|XP_009129179.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    586   0.0      
dbj|BAJ86984.1|  predicted protein                                      586   0.0      
ref|XP_008653244.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    582   0.0      
ref|NP_178311.1|  peptide transporter 4                                 580   0.0      
ref|XP_008653237.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    581   0.0      
ref|XP_007134767.1|  hypothetical protein PHAVU_010G0742001g            577   0.0      
ref|XP_001774033.1|  predicted protein                                  578   0.0      
gb|EMS66306.1|  Peptide transporter PTR2                                575   0.0      
ref|XP_008672848.1|  PREDICTED: peptide transporter PTR2 isoform X1     570   0.0      
gb|EMT06499.1|  Peptide transporter PTR2                                570   0.0      
ref|XP_002967570.1|  hypothetical protein SELMODRAFT_231062             570   0.0      
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173              571   0.0      
ref|XP_006849521.1|  hypothetical protein AMTR_s00024p00149600          568   0.0      
dbj|BAJ97468.1|  predicted protein                                      565   0.0      
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285             569   0.0      
ref|XP_001774221.1|  predicted protein                                  568   0.0      
gb|ACG29609.1|  peptide transporter PTR2                                566   0.0      
ref|NP_001148128.1|  peptide transporter PTR2                           564   0.0      
ref|XP_009114214.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.5-like...    563   0.0      
ref|XP_002875105.1|  proton-dependent oligopeptide transport fami...    562   0.0      
ref|XP_008672847.1|  PREDICTED: peptide transporter PTR2 isoform X2     558   0.0      
emb|CDM81845.1|  unnamed protein product                                558   0.0      
dbj|BAJ96095.1|  predicted protein                                      557   0.0      
dbj|BAB90538.1|  putative peptide transport protein                     557   0.0      
gb|EEC71979.1|  hypothetical protein OsI_04820                          555   0.0      
dbj|BAJ87974.1|  predicted protein                                      552   0.0      
ref|XP_002962950.1|  hypothetical protein SELMODRAFT_165561             553   0.0      
ref|XP_004983459.1|  PREDICTED: probable peptide/nitrate transpor...    552   0.0      
ref|XP_002962329.1|  hypothetical protein SELMODRAFT_78769              551   0.0      
ref|XP_004985079.1|  PREDICTED: peptide transporter PTR2-like iso...    548   0.0      
ref|XP_004970956.1|  PREDICTED: peptide transporter PTR1-like iso...    547   0.0      
ref|XP_004970955.1|  PREDICTED: peptide transporter PTR1-like iso...    548   0.0      
dbj|BAH01376.1|  unnamed protein product                                546   0.0      
ref|XP_006645185.1|  PREDICTED: peptide transporter PTR1-like           546   0.0      
ref|XP_006580083.1|  PREDICTED: peptide transporter PTR2-like iso...    542   0.0      
ref|XP_004985078.1|  PREDICTED: peptide transporter PTR2-like iso...    543   0.0      
emb|CDX78212.1|  BnaA09g34070D                                          538   0.0      
ref|NP_001136757.1|  hypothetical protein                               536   0.0      
ref|XP_010229109.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       542   0.0      
ref|NP_001049489.1|  Os03g0235900                                       543   0.0      
ref|XP_002966337.1|  hypothetical protein SELMODRAFT_439656             541   2e-180   
ref|XP_002978223.1|  hypothetical protein SELMODRAFT_417946             540   9e-180   
ref|XP_008649412.1|  PREDICTED: low affinity nitrate transporter ...    537   4e-179   
ref|XP_002464816.1|  hypothetical protein SORBIDRAFT_01g027250          536   9e-179   
ref|XP_003574685.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       536   1e-178   
ref|XP_004968864.1|  PREDICTED: peptide transporter PTR2-like           534   4e-178   
ref|XP_010424978.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like...    531   5e-178   
gb|KEH36217.1|  peptide transporter                                     533   6e-178   
ref|XP_003558411.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       534   7e-178   
ref|XP_004985077.1|  PREDICTED: peptide transporter PTR2-like           534   8e-178   
gb|ACG42970.1|  peptide transporter PTR2                                533   2e-177   
ref|XP_004983455.1|  PREDICTED: probable peptide/nitrate transpor...    532   3e-177   
ref|XP_001754642.1|  predicted protein                                  532   3e-177   
dbj|BAJ91595.1|  predicted protein                                      524   9e-177   
emb|CDM81846.1|  unnamed protein product                                530   9e-177   
gb|EEC74828.1|  hypothetical protein OsI_10667                          530   1e-176   
ref|XP_002969637.1|  hypothetical protein SELMODRAFT_91845              530   8e-176   
ref|XP_006649698.1|  PREDICTED: peptide transporter PTR2-like           528   9e-176   
ref|XP_001765362.1|  predicted protein                                  529   2e-175   
ref|XP_010064621.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       527   4e-175   
ref|XP_002970902.1|  hypothetical protein SELMODRAFT_94322              527   9e-175   
ref|XP_002464820.1|  hypothetical protein SORBIDRAFT_01g027280          526   9e-175   
gb|EEE58658.1|  hypothetical protein OsJ_10061                          526   1e-174   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             526   1e-174   
gb|ACN40168.1|  unknown                                                 528   1e-174   
gb|AAF07875.1|  nitrate transporter                                     525   2e-174   
ref|XP_002975508.1|  hypothetical protein SELMODRAFT_103849             525   2e-174   
gb|AAK52575.1|AC079685_6  Putative LeOPT1 - oligopeptide transporter    524   2e-174   
gb|KEH36218.1|  peptide transporter                                     525   2e-174   
gb|EAY77491.1|  hypothetical protein OsI_32535                          524   3e-174   
ref|XP_006395821.1|  hypothetical protein EUTSA_v10004088mg             521   3e-174   
ref|XP_006420301.1|  hypothetical protein CICLE_v10004592mg             524   1e-173   
dbj|BAE93113.1|  putative low affinity nitrate transporter              523   1e-173   
gb|AAT69243.1|  low affinity nitrate transporter NRT1.1                 521   5e-173   
ref|XP_007145869.1|  hypothetical protein PHAVU_007G274900g             521   6e-173   
ref|XP_004500964.1|  PREDICTED: peptide transporter PTR1-like iso...    521   8e-173   
ref|XP_003535206.1|  PREDICTED: peptide transporter PTR3-A-like         520   1e-172   
gb|KHG28303.1|  Peptide transporter PTR1 -like protein                  521   2e-172   
dbj|BAB90539.1|  putative peptide transport protein                     519   2e-172   
ref|XP_004500965.1|  PREDICTED: peptide transporter PTR1-like iso...    520   2e-172   
ref|XP_002280138.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       520   2e-172   
gb|AAT37840.1|  low affinity nitrate transporter NRT1.2                 520   2e-172   
gb|AAK52579.1|AC079685_10  Putative LeOPT1 - oligopeptide transpo...    519   3e-172   
ref|XP_004986750.1|  PREDICTED: peptide transporter PTR2-like           520   3e-172   
ref|XP_002526568.1|  oligopeptide transporter, putative                 520   3e-172   
ref|XP_004983461.1|  PREDICTED: peptide transporter PTR2-like           519   3e-172   
gb|EAY77495.1|  hypothetical protein OsI_32539                          519   4e-172   
dbj|BAJ99733.1|  predicted protein                                      518   5e-172   
ref|XP_006489758.1|  PREDICTED: peptide transporter PTR3-A-like         520   5e-172   
ref|XP_011029778.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       518   8e-172   
ref|XP_001781231.1|  predicted protein                                  519   9e-172   
ref|XP_003625352.1|  Peptide transporter PTR3-A                         518   1e-171   
ref|XP_006420305.1|  hypothetical protein CICLE_v10004600mg             518   1e-171   
emb|CDP07455.1|  unnamed protein product                                519   2e-171   
ref|XP_002311689.2|  proton-dependent oligopeptide transport fami...    517   3e-171   
ref|XP_002991341.1|  hypothetical protein SELMODRAFT_429656             518   3e-171   
ref|XP_002969419.1|  hypothetical protein SELMODRAFT_91962              516   6e-171   
ref|XP_010023870.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       516   7e-171   
gb|EEE50467.1|  hypothetical protein OsJ_30510                          516   1e-170   
ref|XP_002285402.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2            516   1e-170   
ref|XP_003558413.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       515   1e-170   
ref|NP_001045119.1|  Os01g0902800                                       513   2e-170   
gb|EMS46266.1|  Peptide transporter PTR2                                514   2e-170   
ref|XP_002302005.2|  hypothetical protein POPTR_0002s03070g             514   2e-170   
ref|XP_002280835.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       516   2e-170   
emb|CAN63331.1|  hypothetical protein VITISV_015576                     514   2e-170   
gb|KEH36216.1|  peptide transporter                                     514   2e-170   
ref|XP_009334213.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    515   3e-170   
ref|XP_006574506.1|  PREDICTED: peptide transporter PTR3-A-like         514   4e-170   
ref|XP_004296395.1|  PREDICTED: peptide transporter PTR3-A-like         514   4e-170   
ref|XP_006661602.1|  PREDICTED: peptide transporter PTR2-like           513   5e-170   
gb|KDP46550.1|  hypothetical protein JCGZ_08522                         505   5e-170   
ref|XP_004292959.1|  PREDICTED: peptide transporter PTR1-like           514   6e-170   
gb|EMT14648.1|  Peptide transporter PTR2                                523   8e-170   
gb|KHN13143.1|  Peptide transporter PTR3-A                              513   1e-169   
ref|XP_002306899.1|  hypothetical protein POPTR_0005s25490g             514   1e-169   
ref|XP_002301861.1|  peptide transporter 2 family protein               513   1e-169   
ref|XP_006857458.1|  hypothetical protein AMTR_s00067p00181600          513   2e-169   
dbj|BAJ53174.1|  JHL18I08.8                                             513   2e-169   
ref|XP_008224155.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       512   2e-169   
ref|XP_003577531.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       512   3e-169   
ref|XP_002314492.1|  proton-dependent oligopeptide transport fami...    512   3e-169   
ref|XP_004247558.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       512   5e-169   
ref|XP_007222061.1|  hypothetical protein PRUPE_ppa003209mg             511   5e-169   
gb|AES81565.2|  peptide transporter                                     511   6e-169   
gb|EMT00870.1|  Peptide transporter PTR2                                511   7e-169   
ref|XP_011024448.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       511   8e-169   
ref|XP_010105266.1|  Peptide transporter                                511   9e-169   
ref|XP_003556370.1|  PREDICTED: peptide transporter PTR3-A-like         510   2e-168   
ref|XP_006661603.1|  PREDICTED: peptide transporter PTR2-like           509   2e-168   
gb|KDP26489.1|  hypothetical protein JCGZ_17647                         511   2e-168   
ref|XP_001778896.1|  predicted protein                                  509   2e-168   
ref|XP_007226671.1|  hypothetical protein PRUPE_ppa021364mg             509   2e-168   
ref|XP_010068667.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       510   2e-168   
gb|EEC71980.1|  hypothetical protein OsI_04821                          506   3e-168   
ref|XP_004495348.1|  PREDICTED: peptide transporter PTR3-A-like         509   3e-168   
ref|XP_003590804.1|  Peptide transporter PTR3-A                         509   3e-168   
ref|XP_008659108.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    509   4e-168   
ref|XP_010026812.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       509   4e-168   
ref|XP_008659111.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    508   5e-168   



>ref|XP_004500227.1| PREDICTED: peptide transporter PTR5-like isoform X1 [Cicer arietinum]
 ref|XP_004500228.1| PREDICTED: peptide transporter PTR5-like isoform X2 [Cicer arietinum]
Length=570

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/566 (74%), Positives = 494/566 (87%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEEDDVYTKDGT+DYR  PANKN TGTW+ACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEEDDVYTKDGTVDYRGNPANKNITGTWRACPFILGNECCERLAYYGMSTNLVLYFKERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q + +ASKN+SNWSGTCYI PL+GAF+AD+YLGRYWTIA+FSIIYV+GMTL+TLSA+V 
Sbjct  61    HQHSATASKNVSNWSGTCYITPLIGAFVADSYLGRYWTIASFSIIYVVGMTLLTLSASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI PTC   E C  T   ++VCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E++HKS
Sbjct  121   GIKPTCQGKENCHATDLQSIVCFLALYLIALGTGGIKPCVSSYGADQFDDADENEKEHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVASFFSGTKLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS+RK +++ P DKSLL+E +  ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSPLTRICQVIVASIRKYRIEAPADKSLLYEIADTESAIKGSRKLDHTNELRFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +   + +K S + WRLCTVTQVEELKSIIRLLP+WATGIIF+TVYGQMST FV Q   MN
Sbjct  301   LGQSDNRKDSTNSWRLCTVTQVEELKSIIRLLPVWATGIIFATVYGQMSTLFVLQGQTMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             T+VG  +FKIP ASLS+FDTLSVI WVP+YDR+IVP ARKFTGHK GLT LQRMG+GLFI
Sbjct  361   THVGNSSFKIPPASLSIFDTLSVIFWVPVYDRIIVPFARKFTGHKKGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +MV AA+LE++RL  V+RHN Y++ E+P+++FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SIFSMVVAAILEIIRLRAVRRHNYYNLEEIPMTIFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
              QAPD+MRSLCSALSL T A+G YLSS LVTIV +I+TRNG PGW+ +NLNYGH+DYFFW
Sbjct  481   QQAPDAMRSLCSALSLLTVALGQYLSSLLVTIVTNISTRNGSPGWIPDNLNYGHIDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLAVLSV+NL VF++VA++YTYKK +
Sbjct  541   LLAVLSVLNLIVFILVARLYTYKKTV  566



>ref|XP_009780466.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009780467.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009780468.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=578

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/578 (74%), Positives = 498/578 (86%), Gaps = 3/578 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+DYRN+PANK KTGTWKACP+ILGNECSERLAYYGMS+NL++YF+ +L
Sbjct  1     MAEEDIYTKDGTVDYRNKPANKKKTGTWKACPYILGNECSERLAYYGMSTNLVLYFKNQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q   +ASKN SNWSGTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VP
Sbjct  61    HQHNATASKNQSNWSGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVFGMTLLTISASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC   +KC  T   T V FIALYLVALGTGGIKPCVSSYGADQFDD D  ER HK+
Sbjct  121   GLKPTCYEKDKCHATNGQTSVFFIALYLVALGTGGIKPCVSSYGADQFDDADPIERNHKN  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GALVASSLIVWIQQ++ WGWGFGVPAVAMA+AV  FFSGTRLYRYQKP
Sbjct  181   SFFNWFYFSINVGALVASSLIVWIQQDIGWGWGFGVPAVAMALAVVSFFSGTRLYRYQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSG-LESNIQGSRKLSHTNELRFFDKAA  1205
             GGSP TR+ QV+VAS RK +V +P DKSLLHET+   ES IQGSRKL+HTNEL FFDKAA
Sbjct  241   GGSPLTRICQVVVASFRKYRVALPADKSLLHETAAEAESAIQGSRKLAHTNELCFFDKAA  300

Query  1206  V-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V +ESDE   GS + WRLCTVTQVEELKS+I+LLPIWATGIIFSTVY QMS  FV QA  
Sbjct  301   VKLESDE-NSGSINNWRLCTVTQVEELKSVIKLLPIWATGIIFSTVYNQMSNMFVLQATY  359

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             M+T++G F+IPEASLSVFDT++VI+WVPIYDR+++P  RKFTGHK+GLT LQRMG GL I
Sbjct  360   MDTHLGKFRIPEASLSVFDTVAVILWVPIYDRMLIPFVRKFTGHKNGLTQLQRMGTGLVI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ AMVSAA++E+VRL +V+RHN Y+ T VP+SVFWQ+PQY I+GCAEVFTFIGQLEFFY
Sbjct  420   SVFAMVSAAIVEVVRLGIVRRHNYYNTTNVPMSVFWQIPQYMIVGCAEVFTFIGQLEFFY  479

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPDSMRSLC+ALSLTT A+G+Y+SSFLVT+V DI+TRNGKPGW+A+N N G L YFF 
Sbjct  480   DQAPDSMRSLCAALSLTTTALGSYVSSFLVTVVTDISTRNGKPGWIADNQNRGKLHYFFL  539

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAEN  2036
             LLA+LSV+N   F+ VAK Y YKKAINK S  +  A++
Sbjct  540   LLAILSVLNFFAFLAVAKRYKYKKAINKDSAAMVPADD  577



>ref|XP_011080847.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X1 [Sesamum 
indicum]
Length=600

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/569 (75%), Positives = 487/569 (86%), Gaps = 2/569 (0%)
 Frame = +3

Query  300   SEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             +E M E+D YTKDGTLDYRN PANK KTGTWKACPFILGNEC ERLAYYGMSSNL+ YF 
Sbjct  28    AEVMAEEDNYTKDGTLDYRNNPANKKKTGTWKACPFILGNECCERLAYYGMSSNLLNYFT  87

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
             T+LNQ   +ASKNL NWSGTCY+MPLVGAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA
Sbjct  88    TQLNQHNATASKNLWNWSGTCYVMPLVGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSA  147

Query  660   TVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  839
             +VPG+ PTC   ++C  T   T VCF+ALY+VALGTGGIKPCVSSYGADQFDD DE E+ 
Sbjct  148   SVPGLRPTCYTKDECYATNSQTAVCFLALYMVALGTGGIKPCVSSYGADQFDDADEVEKG  207

Query  840   HKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRY  1019
             HKSSFFNWFYFSINIGAL+ASS++VWIQ  + WGWGFGVPAVAMA+AV FFFSGTRLYRY
Sbjct  208   HKSSFFNWFYFSINIGALIASSILVWIQVNIGWGWGFGVPAVAMAIAVAFFFSGTRLYRY  267

Query  1020  QKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDK  1199
             QKPGGSP TRL QV+VASLRK +V VP DKSLL+ET+  ES I GSRKL HTN+ RF DK
Sbjct  268   QKPGGSPLTRLCQVLVASLRKYRVAVPGDKSLLYETTDAESAIVGSRKLDHTNQFRFLDK  327

Query  1200  AAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AAV +  ++ KGS +PWRLCTVTQVEELK IIRLLP+WATGIIFS VYGQM   F+ QA 
Sbjct  328   AAVEKESDHSKGSVNPWRLCTVTQVEELKGIIRLLPVWATGIIFSAVYGQMGNLFLMQAG  387

Query  1380  GMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              M+  +G   F+IPEASL++FDT+SVI WVP+YDR I+PM RKFTGHK+GLT LQR+G G
Sbjct  388   YMDARLGRSNFQIPEASLAIFDTISVIFWVPVYDRFIIPMTRKFTGHKNGLTQLQRIGTG  447

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             LFISI  M+SA +LE+ RL +V+RHN Y+V + PIS+FWQVPQYFIIGCAEVFT IGQLE
Sbjct  448   LFISIFPMISAGILEIFRLRIVRRHNSYNVKQGPISIFWQVPQYFIIGCAEVFTNIGQLE  507

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+QAPDSMRSLC+ALSLTT A+GNYLSS LVTIV  I+TR G+PGW+ +NLNYGHL Y
Sbjct  508   FFYEQAPDSMRSLCAALSLTTTALGNYLSSLLVTIVMGISTRGGRPGWIPDNLNYGHLHY  567

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             FF LLAVLSV+NLGVF+VVAK Y+YK+A+
Sbjct  568   FFLLLAVLSVLNLGVFIVVAKKYSYKRAV  596



>ref|XP_011080848.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X2 [Sesamum 
indicum]
Length=570

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/566 (75%), Positives = 485/566 (86%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D YTKDGTLDYRN PANK KTGTWKACPFILGNEC ERLAYYGMSSNL+ YF T+L
Sbjct  1     MAEEDNYTKDGTLDYRNNPANKKKTGTWKACPFILGNECCERLAYYGMSSNLLNYFTTQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +ASKNL NWSGTCY+MPLVGAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA+VP
Sbjct  61    NQHNATASKNLWNWSGTCYVMPLVGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC   ++C  T   T VCF+ALY+VALGTGGIKPCVSSYGADQFDD DE E+ HKS
Sbjct  121   GLRPTCYTKDECYATNSQTAVCFLALYMVALGTGGIKPCVSSYGADQFDDADEVEKGHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VWIQ  + WGWGFGVPAVAMA+AV FFFSGTRLYRYQKP
Sbjct  181   SFFNWFYFSINIGALIASSILVWIQVNIGWGWGFGVPAVAMAIAVAFFFSGTRLYRYQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VASLRK +V VP DKSLL+ET+  ES I GSRKL HTN+ RF DKAAV
Sbjct  241   GGSPLTRLCQVLVASLRKYRVAVPGDKSLLYETTDAESAIVGSRKLDHTNQFRFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
              +  ++ KGS +PWRLCTVTQVEELK IIRLLP+WATGIIFS VYGQM   F+ QA  M+
Sbjct  301   EKESDHSKGSVNPWRLCTVTQVEELKGIIRLLPVWATGIIFSAVYGQMGNLFLMQAGYMD  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
               +G   F+IPEASL++FDT+SVI WVP+YDR I+PM RKFTGHK+GLT LQR+G GLFI
Sbjct  361   ARLGRSNFQIPEASLAIFDTISVIFWVPVYDRFIIPMTRKFTGHKNGLTQLQRIGTGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI  M+SA +LE+ RL +V+RHN Y+V + PIS+FWQVPQYFIIGCAEVFT IGQLEFFY
Sbjct  421   SIFPMISAGILEIFRLRIVRRHNSYNVKQGPISIFWQVPQYFIIGCAEVFTNIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPDSMRSLC+ALSLTT A+GNYLSS LVTIV  I+TR G+PGW+ +NLNYGHL YFF 
Sbjct  481   EQAPDSMRSLCAALSLTTTALGNYLSSLLVTIVMGISTRGGRPGWIPDNLNYGHLHYFFL  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLAVLSV+NLGVF+VVAK Y+YK+A+
Sbjct  541   LLAVLSVLNLGVFIVVAKKYSYKRAV  566



>gb|EYU45754.1| hypothetical protein MIMGU_mgv1a024850mg [Erythranthe guttata]
Length=571

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/567 (76%), Positives = 492/567 (87%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D YTKDGT+DY+N PA++NKTGTWKACPFILGNEC ERLAYYGMSSNL++YF  +L
Sbjct  1     MAEEDNYTKDGTVDYKNDPADRNKTGTWKACPFILGNECCERLAYYGMSSNLLLYFTNQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ + SASKNLS WSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+TLSA+VP
Sbjct  61    NQHSASASKNLSIWSGTCYVTPLLGAFLADAYLGRYRTIASFSIIYVMGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC   ++CT T     VC++ALYLVA GTGGIKPCVSSYGADQFDD DE E+ HKS
Sbjct  121   GLRPTCHKKDECTATNPQIAVCYVALYLVAFGTGGIKPCVSSYGADQFDDADEVEKGHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  + WGWGFGVPAVAMA+AV FFFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQVNIGWGWGFGVPAVAMAVAVGFFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLE-SNIQGSRKLSHTNELRFFDKAA  1205
             GGSP TRL QV+VASLRKR+V VP DKSLL ETS  E + I GSRKL HT E RFFDKAA
Sbjct  241   GGSPLTRLCQVVVASLRKRRVAVPEDKSLLFETSDAEAAAIVGSRKLDHTTEFRFFDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    +Y K S +PWRLCTVTQVEELK+II+LLP+WATGIIFS VYGQM   F+ QA  M
Sbjct  301   VEVQSDYNKESINPWRLCTVTQVEELKAIIKLLPVWATGIIFSAVYGQMGNLFLLQAEYM  360

Query  1386  NTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             NT +G  TFKIPEASLS+FDTLSVIVWVPIYD+LI+P+ RKFTGHK+GLT LQRMG+GLF
Sbjct  361   NTRLGNTTFKIPEASLSIFDTLSVIVWVPIYDQLIIPITRKFTGHKNGLTQLQRMGIGLF  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI AMVSAAVLE+VRL +VKRH+ YDV E PISVFWQVPQYFIIGCAEVF +IGQ+EFF
Sbjct  421   ISIFAMVSAAVLEIVRLNIVKRHDSYDVKEAPISVFWQVPQYFIIGCAEVFMYIGQIEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPDSMRSLC+ALSLTT A+GNYLS+FLVTIV +++TRNGKPGW+A+NLN+G L YFF
Sbjct  481   YEQAPDSMRSLCAALSLTTTALGNYLSAFLVTIVTEVSTRNGKPGWIADNLNHGKLHYFF  540

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             WLLAVLS++NLG +VV AK YTYKKA+
Sbjct  541   WLLAVLSLINLGAYVVAAKRYTYKKAV  567



>ref|XP_006350821.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=574

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/568 (74%), Positives = 488/568 (86%), Gaps = 2/568 (0%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E + EDD+YTKDGT+D+RN PA KN+TGTWKACPFILGNEC ERLAYYGMS+NL++YF+ 
Sbjct  3     EVVAEDDLYTKDGTVDFRNNPAKKNETGTWKACPFILGNECCERLAYYGMSTNLVLYFKN  62

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RLNQ + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYVIGMTL+TLSA+
Sbjct  63    RLNQHSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVIGMTLLTLSAS  122

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ P+C   + C      T VCF+ALYL+ALGTGGIKPCVSSYGADQFDD+DE E+KH
Sbjct  123   VPGLKPSCSGEDVCHPKEVQTAVCFVALYLIALGTGGIKPCVSSYGADQFDDSDEVEKKH  182

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGALVASS++VWIQ  V WGWGFG+PAV MA+AV  FFSGTRLYR Q
Sbjct  183   KSSFFNWFYFSINIGALVASSVLVWIQDNVGWGWGFGIPAVTMAIAVVSFFSGTRLYRNQ  242

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QV+VAS RK KV VP +KSLL+ET+  ES I GSRKL HT +L FFDKA
Sbjct  243   KPGGSPLTRICQVLVASFRKFKVNVPEEKSLLYETTDAESAITGSRKLDHTKDLGFFDKA  302

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV    ++ KG+   WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMST FV Q   
Sbjct  303   AVQTESDHTKGNIDSWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTLFVLQGAA  362

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T VG  +FKIP ASLS+FDTLSVI WVPIYD+ IVP+ARK TGHK+GLT LQRMG GL
Sbjct  363   MDTRVGNSSFKIPPASLSIFDTLSVIFWVPIYDQFIVPIARKITGHKNGLTQLQRMGTGL  422

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI AM+SA +LE  RL  VKRHN Y++ EVP+++FWQVPQYF+IGCAEVFTFIGQLEF
Sbjct  423   FISIFAMLSAGILEFYRLKYVKRHNYYELEEVPMTIFWQVPQYFLIGCAEVFTFIGQLEF  482

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRSLCSALSLTT A+G+YLSS LVTIV +ITT+NGKPGW+ +NLNYGH+DYF
Sbjct  483   FYEQAPDAMRSLCSALSLTTVALGSYLSSMLVTIVMNITTKNGKPGWIPDNLNYGHIDYF  542

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             + LLAVLSV+NLGV++V+AK YTYK+ +
Sbjct  543   YHLLAVLSVLNLGVYLVIAKWYTYKRPV  570



>ref|XP_010323334.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X1 [Solanum lycopersicum]
Length=594

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/565 (73%), Positives = 490/565 (87%), Gaps = 0/565 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE+DVYTKDGT+DYRN+PANK KTGTWKACP+ILGNEC ERLAYYGMS+NL+ YF+T+L+
Sbjct  13    EEEDVYTKDGTVDYRNKPANKKKTGTWKACPYILGNECCERLAYYGMSTNLVYYFKTQLS  72

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q T++ASKN SNWSGTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VPG
Sbjct  73    QETVTASKNQSNWSGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVCGMTLLTVSASVPG  132

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C    KC  T   T V F+ALYLVALGTGGIKPCVSSYGADQFDD D  ER +K+S
Sbjct  133   LRPICYQKNKCHSTDSQTAVFFVALYLVALGTGGIKPCVSSYGADQFDDADPIERNYKNS  192

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVASSLIVWIQQ++SWGWGFGVPA AMA+AV  FFSG+RLYRYQKPG
Sbjct  193   FFNWFYFSINIGALVASSLIVWIQQDISWGWGFGVPAAAMALAVVSFFSGSRLYRYQKPG  252

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VASLRK  V +P +KSLL+ET+  ES I+GSRKL+HTN+LRFFD+AAV 
Sbjct  253   GSPLTRICQVVVASLRKFHVTLPAEKSLLYETAEAESAIKGSRKLAHTNDLRFFDRAAVK  312

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
                +  +GS + W+LCTVTQVEE KS+++LLPIWATGIIFSTVY QMS  FV QA+ M+T
Sbjct  313   TGSDENRGSINSWKLCTVTQVEEFKSVVKLLPIWATGIIFSTVYNQMSNYFVVQAMSMDT  372

Query  1392  YVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             Y+G  KIPEASLSVFDT++VI+WVP+YDR++VP  RKFTGHK+GLT LQRMG GL IS+ 
Sbjct  373   YLGKMKIPEASLSVFDTIAVILWVPVYDRVLVPFVRKFTGHKNGLTQLQRMGTGLVISVF  432

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             AMVSAA++E+VRL +VKRHNLY+  ++P+SVFWQ+PQY IIGCAEVFTFIGQLEFFYDQA
Sbjct  433   AMVSAALVEVVRLGIVKRHNLYNSKDIPMSVFWQIPQYMIIGCAEVFTFIGQLEFFYDQA  492

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PDSMRSLC+ALSLTT A+G+Y+SS LV IV DI+TRNGK GWL +N NYG L YFF+LL+
Sbjct  493   PDSMRSLCAALSLTTTALGSYVSSLLVIIVTDISTRNGKMGWLTDNPNYGKLHYFFFLLS  552

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINK  2006
             VLSV+N  +F++VA+ Y YKKAINK
Sbjct  553   VLSVLNFFIFLIVARRYKYKKAINK  577



>ref|XP_004241180.2| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Solanum lycopersicum]
Length=655

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/568 (74%), Positives = 490/568 (86%), Gaps = 2/568 (0%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E + EDD+YTKDGT+D+RN PA +N+TGTWKACPFILGNEC ERLAYYGMS+NL++YF+ 
Sbjct  84    EVVAEDDLYTKDGTVDFRNNPAKRNETGTWKACPFILGNECCERLAYYGMSTNLVLYFKK  143

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RLNQ + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYVIGMTL+TLSA+
Sbjct  144   RLNQHSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVIGMTLLTLSAS  203

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ P+C   + C      T VCF+ALYL+ALGTGGIKPCVSSYGADQFDD+DE E+KH
Sbjct  204   VPGLKPSCSGEDVCHPKEVQTAVCFVALYLIALGTGGIKPCVSSYGADQFDDSDEVEKKH  263

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFG+PAV MA+A+  FFSGTRLYR Q
Sbjct  264   KSSFFNWFYFSINIGALIASSVLVWIQDNVGWGWGFGIPAVTMAIAIVSFFSGTRLYRNQ  323

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QV+VAS RK KV VP +KSLL+ET+  ES I GSRKL HT +L FFDKA
Sbjct  324   KPGGSPLTRICQVLVASFRKFKVNVPEEKSLLYETTDAESAITGSRKLDHTEDLSFFDKA  383

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV    ++ KG+   WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMST FV Q   
Sbjct  384   AVQTELDHVKGNIDSWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTLFVLQGAA  443

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T VG  +FKIP ASLS+FDTLSVI WVPIYD++IVP+ARK TGHK+GLT LQRMG+GL
Sbjct  444   MDTRVGNSSFKIPPASLSIFDTLSVIFWVPIYDQIIVPIARKITGHKNGLTQLQRMGIGL  503

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI AM+ A +LE+ RL  VKRHN Y++ EVP+++FWQVPQYF+IGCAEVFT IGQLEF
Sbjct  504   FISIFAMLFAGILELYRLKYVKRHNYYELEEVPMTIFWQVPQYFLIGCAEVFTLIGQLEF  563

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRSLCSALSLTT A+G+YLSS LVTIV +ITT+NGKPGW+ +NLNYGH+DYF
Sbjct  564   FYEQAPDAMRSLCSALSLTTIALGSYLSSMLVTIVMNITTKNGKPGWIPDNLNYGHIDYF  623

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             ++LLAVLSV+NLGV++V+AK YTYK+ +
Sbjct  624   YYLLAVLSVLNLGVYLVIAKWYTYKRPV  651



>ref|XP_010323335.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X2 [Solanum lycopersicum]
 ref|XP_010323336.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X2 [Solanum lycopersicum]
Length=584

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/565 (73%), Positives = 490/565 (87%), Gaps = 0/565 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE+DVYTKDGT+DYRN+PANK KTGTWKACP+ILGNEC ERLAYYGMS+NL+ YF+T+L+
Sbjct  3     EEEDVYTKDGTVDYRNKPANKKKTGTWKACPYILGNECCERLAYYGMSTNLVYYFKTQLS  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q T++ASKN SNWSGTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VPG
Sbjct  63    QETVTASKNQSNWSGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVCGMTLLTVSASVPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C    KC  T   T V F+ALYLVALGTGGIKPCVSSYGADQFDD D  ER +K+S
Sbjct  123   LRPICYQKNKCHSTDSQTAVFFVALYLVALGTGGIKPCVSSYGADQFDDADPIERNYKNS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVASSLIVWIQQ++SWGWGFGVPA AMA+AV  FFSG+RLYRYQKPG
Sbjct  183   FFNWFYFSINIGALVASSLIVWIQQDISWGWGFGVPAAAMALAVVSFFSGSRLYRYQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VASLRK  V +P +KSLL+ET+  ES I+GSRKL+HTN+LRFFD+AAV 
Sbjct  243   GSPLTRICQVVVASLRKFHVTLPAEKSLLYETAEAESAIKGSRKLAHTNDLRFFDRAAVK  302

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
                +  +GS + W+LCTVTQVEE KS+++LLPIWATGIIFSTVY QMS  FV QA+ M+T
Sbjct  303   TGSDENRGSINSWKLCTVTQVEEFKSVVKLLPIWATGIIFSTVYNQMSNYFVVQAMSMDT  362

Query  1392  YVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             Y+G  KIPEASLSVFDT++VI+WVP+YDR++VP  RKFTGHK+GLT LQRMG GL IS+ 
Sbjct  363   YLGKMKIPEASLSVFDTIAVILWVPVYDRVLVPFVRKFTGHKNGLTQLQRMGTGLVISVF  422

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             AMVSAA++E+VRL +VKRHNLY+  ++P+SVFWQ+PQY IIGCAEVFTFIGQLEFFYDQA
Sbjct  423   AMVSAALVEVVRLGIVKRHNLYNSKDIPMSVFWQIPQYMIIGCAEVFTFIGQLEFFYDQA  482

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PDSMRSLC+ALSLTT A+G+Y+SS LV IV DI+TRNGK GWL +N NYG L YFF+LL+
Sbjct  483   PDSMRSLCAALSLTTTALGSYVSSLLVIIVTDISTRNGKMGWLTDNPNYGKLHYFFFLLS  542

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINK  2006
             VLSV+N  +F++VA+ Y YKKAINK
Sbjct  543   VLSVLNFFIFLIVARRYKYKKAINK  567



>emb|CDP09151.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/569 (73%), Positives = 485/569 (85%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT+D R  PA KN+TGTW+ACP+ILGNEC ERLAYYGMSSNL+++F+ RL
Sbjct  1     MAEDDLYTKDGTVDCRGNPAKKNETGTWRACPYILGNECCERLAYYGMSSNLVLFFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
              Q   +ASKN+S+WSGTCYI PL+GAF ADAYLGR+WTIA FSIIYV+GMTL+TLSA++P
Sbjct  61    GQHNATASKNVSDWSGTCYITPLIGAFFADAYLGRFWTIACFSIIYVLGMTLLTLSASIP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC   E C  TG  + V F+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK+
Sbjct  121   GLKPTCHGKESCHATGTQSSVVFLALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHKA  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VW+Q  V WGWGFG+PAV MA+A   FFSG+RLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVGWGWGFGIPAVTMAIAAVSFFSGSRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VAS +K KV+VP DKSLL+E    ES I+GSRKL HT++L FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASFKKYKVEVPEDKSLLYECKDTESAIEGSRKLGHTSDLVFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +YK+GS  PWRLCTVTQVEELK+IIRLLPIWATGIIFS+VYGQMST FV Q   MN
Sbjct  301   ERESDYKRGSVDPWRLCTVTQVEELKAIIRLLPIWATGIIFSSVYGQMSTLFVLQGETMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             TYVG  TF+IP ASL +FDTLSVI WVP+YDR+IVP+ARKFTGHK+GLT LQRMG+GL I
Sbjct  361   TYVGHSTFQIPPASLGIFDTLSVIFWVPVYDRIIVPVARKFTGHKNGLTQLQRMGIGLLI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM+SA +LE+VRL  VKRHN YD+ E+P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMLSAGILELVRLRYVKRHNSYDLEEIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRSLC ALSLTT A+GNYLSS LVTIV  I+T+NGKPGW+  NLN GH DYFFW
Sbjct  481   EQAPDAMRSLCVALSLTTVALGNYLSSLLVTIVTRISTKNGKPGWIPTNLNRGHTDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LLAVLSV+NLG ++++AK YTYKK +  +
Sbjct  541   LLAVLSVLNLGAYILIAKWYTYKKPVGPL  569



>ref|XP_006362448.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=584

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/576 (73%), Positives = 492/576 (85%), Gaps = 1/576 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE+DVYTKDGT+DYRN+PANK KTGTWKACP+ILGNEC ERLAYYGMS+NL+ YF+T+L+
Sbjct  3     EEEDVYTKDGTVDYRNKPANKKKTGTWKACPYILGNECCERLAYYGMSTNLVYYFKTQLS  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q T +ASKN SNW+GTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VPG
Sbjct  63    QETATASKNQSNWAGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVCGMTLLTVSASVPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C    KC  T   T V F+ALYLVALGTGGIKPCVSSYGADQFDD D  ER +K+S
Sbjct  123   LRPICYEKNKCHSTDSQTAVFFVALYLVALGTGGIKPCVSSYGADQFDDADPIERNYKNS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVASSLIVWIQQ++SWGWGFGVPA AMA AV  FFSG+RLYRYQKPG
Sbjct  183   FFNWFYFSINIGALVASSLIVWIQQDISWGWGFGVPAAAMAFAVVSFFSGSRLYRYQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VASLRK  V +P +KSLL+ET+  ES I+GSRKL+HTN+LRFFD+AAV 
Sbjct  243   GSPLTRICQVVVASLRKCHVTLPAEKSLLYETAEAESAIKGSRKLAHTNDLRFFDRAAVK  302

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
                +  +GS + W+LCTVTQVEE KS+++LLPIWATGIIFST Y QMS  FV QA+ M+T
Sbjct  303   TGLDENRGSINNWKLCTVTQVEEFKSVVKLLPIWATGIIFSTAYSQMSNYFVVQAMSMDT  362

Query  1392  YVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             ++G  KIPEASLSVFDT++VI+WVP+YDR++VP  RKFTGHK+GLT LQRMG GL IS+ 
Sbjct  363   HLGKLKIPEASLSVFDTIAVILWVPVYDRVLVPFVRKFTGHKNGLTQLQRMGTGLVISVF  422

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             AMVSAA++E+VRL +VKR NLYD  ++P+SVFWQ+PQY IIGCAEVFTFIGQLEFFYDQA
Sbjct  423   AMVSAALVEVVRLGIVKRRNLYDSKDIPMSVFWQIPQYMIIGCAEVFTFIGQLEFFYDQA  482

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PDSMRSLC+ALSLTT A+G+Y+SS LVTIV DI+TRNGK GWL++N NYG L YFF+LL+
Sbjct  483   PDSMRSLCAALSLTTTALGSYVSSLLVTIVTDISTRNGKMGWLSDNPNYGKLHYFFFLLS  542

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAENG  2039
             VLSV+N  +F++VAK Y YKKAINK  D V    NG
Sbjct  543   VLSVLNFFIFLIVAKRYKYKKAINK-DDPVPMVANG  577



>emb|CDP09153.1| unnamed protein product [Coffea canephora]
Length=618

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/572 (74%), Positives = 479/572 (84%), Gaps = 3/572 (1%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             + ME DD YTKDGT+DYR  PA+K KTGTWKACP+ILGNECSERLAYYGMSSNLMIYF  
Sbjct  46    DIMEADDYYTKDGTVDYRKNPADKRKTGTWKACPYILGNECSERLAYYGMSSNLMIYFTK  105

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +LNQ T  AS+NLSNWSGTCYIMPL+GAFLAD+YLGRYWTIA+FS IY IGMTL+TLSA+
Sbjct  106   QLNQHTADASRNLSNWSGTCYIMPLLGAFLADSYLGRYWTIASFSTIYFIGMTLLTLSAS  165

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ PTC A + C  TG  T VCFIALYLVALGTGGIKPCVSSYGADQFDD DE E+  
Sbjct  166   VPGLKPTCSAKDVCQPTGTQTTVCFIALYLVALGTGGIKPCVSSYGADQFDDADETEKNF  225

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             K SFFNWFYFSINIGAL+ASSL+V+IQ  V WGWGFG+PA AMA+AV  FFSGTR+YRYQ
Sbjct  226   KGSFFNWFYFSINIGALIASSLLVYIQLHVGWGWGFGIPAAAMAIAVVSFFSGTRIYRYQ  285

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
              PGGSP TRL QV+VAS RK  V +P DKS L+E +   S I GSRKL HT+    FDKA
Sbjct  286   IPGGSPLTRLCQVLVASFRKHSVPLPADKSQLYEVADETSAIVGSRKLEHTDSFSCFDKA  345

Query  1203  AV-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AV  ESD   +   S WRLCTVTQVEELKSI+RLLP+WATGI+FS VYGQM   FVSQA 
Sbjct  346   AVETESDRANESKVSAWRLCTVTQVEELKSIVRLLPVWATGIMFSAVYGQMGNLFVSQAE  405

Query  1380  GMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              M+T++G  +F+IPEASLSVFDTLSVI+WVPIYD +I P ARK TG K+GLT LQRMG+G
Sbjct  406   VMDTHLGKTSFEIPEASLSVFDTLSVIIWVPIYDTIITPFARKITGRKNGLTQLQRMGIG  465

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             L IS+ AMVSAAVLE+VRL +VK+HNLYD   +PISVFWQ+PQYFIIGCAEVFTFIGQLE
Sbjct  466   LVISVFAMVSAAVLEIVRLGIVKKHNLYDAELIPISVFWQIPQYFIIGCAEVFTFIGQLE  525

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+QAPDSMRSLC+ALSLTT A+GNYLSSFLVTIV   +TR GKPGW+ +NLNYGHLDY
Sbjct  526   FFYEQAPDSMRSLCAALSLTTTALGNYLSSFLVTIVTKASTRGGKPGWIPDNLNYGHLDY  585

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             FFWLLA LSV+N GVF+V+A+ YTYKKA+  +
Sbjct  586   FFWLLAALSVLNFGVFLVIAQRYTYKKAVGTL  617



>gb|KHN02576.1| Peptide transporter PTR1 [Glycine soja]
Length=572

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/571 (73%), Positives = 491/571 (86%), Gaps = 4/571 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD YTKDGT+DY   PANK +TGTWKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWKACPFILGNECCERLAYYGMSTNLVLYFKKRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q +  ASKN+SNWSGTCYI PLVGAFLAD+YLGRYWTIA FSIIY IGMTL+TLSA+VP
Sbjct  61    HQHSAIASKNVSNWSGTCYITPLVGAFLADSYLGRYWTIAVFSIIYAIGMTLLTLSASVP  120

Query  669   GISPTCIAH--EKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             GI PTC  H  E C  T  ++ VCF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++H
Sbjct  121   GIKPTCHGHGDENCHATTLESAVCFLALYLIALGTGGIKPCVSSYGADQFDDTDPAEKEH  180

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVASFFSGTRLYRNQ  240

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGS  TR+ QV+VAS+RK KV+VP D+SLL+ET+  ES I+GSRKL HT+ELRFFDKA
Sbjct  241   KPGGSALTRICQVVVASIRKYKVEVPADESLLYETAETESAIKGSRKLDHTDELRFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
              V+   +  K S +PWRLCTVTQVEELKSI+RLLP+WATGIIFSTVYGQMST FV Q   
Sbjct  301   TVLARSDKVKESTNPWRLCTVTQVEELKSILRLLPVWATGIIFSTVYGQMSTLFVLQGQT  360

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T VG  TFKIP ASLS+FDTLSVI WVP+YDR+IVP+ARKFTG+K+GLT LQRMG+GL
Sbjct  361   MDTRVGNSTFKIPPASLSIFDTLSVIFWVPVYDRIIVPIARKFTGYKNGLTQLQRMGIGL  420

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI +MV+AA+LE++RL MV+RH+ Y + E+P+++FWQVPQYF+IGCAEVF FIGQLEF
Sbjct  421   FISIFSMVAAAILELIRLRMVRRHDYYQLEEIPMTIFWQVPQYFVIGCAEVFYFIGQLEF  480

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRS CSALSLTT A+G YLSS LVTIV  ITTRNG+PGW+ +NLN+GH+DYF
Sbjct  481   FYEQAPDAMRSFCSALSLTTVALGQYLSSLLVTIVTKITTRNGRPGWIPDNLNFGHIDYF  540

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             FWLLA+LSV+NL  F+VV+ +YTYK+ +  +
Sbjct  541   FWLLALLSVVNLIAFLVVSMLYTYKRPVGTL  571



>ref|XP_006591201.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Glycine 
max]
 ref|XP_006591202.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
Length=572

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/571 (73%), Positives = 491/571 (86%), Gaps = 4/571 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD YTKDGT+DY   PANK +TGTWKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWKACPFILGNECCERLAYYGMSTNLVLYFKKRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q +  ASKN+SNWSGTCYI PLVGAFLAD+YLGRYWTIA FSIIY IGMTL+TLSA+VP
Sbjct  61    HQHSAIASKNVSNWSGTCYITPLVGAFLADSYLGRYWTIAVFSIIYAIGMTLLTLSASVP  120

Query  669   GISPTCIAH--EKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             GI PTC  H  E C  T  ++ VCF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++H
Sbjct  121   GIKPTCHGHGDENCHATTLESAVCFLALYLIALGTGGIKPCVSSYGADQFDDTDPAEKEH  180

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQ  240

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGS  TR+ QV+VAS+RK KV+VP D+SLL+ET+  ES I+GSRKL HT+ELRFFDKA
Sbjct  241   KPGGSALTRICQVVVASIRKYKVEVPADESLLYETAETESAIKGSRKLDHTDELRFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
              V+   +  K S +PWRLCTVTQVEELKSI+RLLP+WATGIIFSTVYGQMST FV Q   
Sbjct  301   TVLARSDKVKESTNPWRLCTVTQVEELKSILRLLPVWATGIIFSTVYGQMSTLFVLQGQT  360

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T VG  TFKIP ASLS+FDTLSVI WVP+YDR+IVP+ARKFTG+K+GLT LQRMG+GL
Sbjct  361   MDTRVGNSTFKIPPASLSIFDTLSVIFWVPVYDRIIVPIARKFTGYKNGLTQLQRMGIGL  420

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI +MV+AA+LE++RL MV+RH+ Y + E+P+++FWQVPQYF+IGCAEVF FIGQLEF
Sbjct  421   FISIFSMVAAAILELIRLRMVRRHDYYQLEEIPMTIFWQVPQYFVIGCAEVFYFIGQLEF  480

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRS CSALSLTT A+G YLSS LVTIV  ITTRNG+PGW+ +NLN+GH+DYF
Sbjct  481   FYEQAPDAMRSFCSALSLTTVALGQYLSSLLVTIVTKITTRNGRPGWIPDNLNFGHIDYF  540

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             FWLLA+LSV+NL  F+VV+ +YTYK+ +  +
Sbjct  541   FWLLALLSVVNLIAFLVVSMLYTYKRPVGTL  571



>ref|XP_009779291.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009779292.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=572

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/568 (74%), Positives = 483/568 (85%), Gaps = 8/568 (1%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E   EDD+YTKDGT+DYRN PA K +TGTWKACPFILGNEC ERLAYYGMS+NL++YF+ 
Sbjct  7     EVSGEDDLYTKDGTVDYRNNPAKKAETGTWKACPFILGNECCERLAYYGMSTNLVLYFKK  66

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RLNQ + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYVIGMTL+TLSA+
Sbjct  67    RLNQHSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIACFSIIYVIGMTLLTLSAS  126

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ P+    E        T VCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KH
Sbjct  127   VPGLKPSSDPKEV------QTAVCFVALYLIALGTGGIKPCVSSYGADQFDDADEVEKKH  180

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASS++VWIQ  + WGWGFG+PAV MA+ V  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSVLVWIQDNMGWGWGFGIPAVTMAIDVVSFFSGTRLYRNQ  240

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QV+VAS RK KV VP DK+ L+ET+  ES I GSRKL HT +LRFFDKA
Sbjct  241   KPGGSPLTRICQVVVASFRKFKVDVPGDKTSLYETTDAESAITGSRKLDHTKDLRFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV    ++ KG+   WRLCTVTQVEELK+IIRLLPIWATGIIFS VY QMST FV Q   
Sbjct  301   AVQTESDHMKGNIDQWRLCTVTQVEELKAIIRLLPIWATGIIFSAVYSQMSTMFVLQGAS  360

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T+VG  +F IP ASLS+FDTLSVI WVPIYD+LIVP++RK TGHK+GLT LQRMG GL
Sbjct  361   MDTHVGNSSFMIPPASLSIFDTLSVIFWVPIYDQLIVPISRKITGHKNGLTQLQRMGTGL  420

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI AMVSAA+LE+ RL  VKRHN Y++ +VP+S+FWQVPQYF+IGCAEVFTFIGQLEF
Sbjct  421   FISIFAMVSAAILELFRLKYVKRHNYYELEQVPMSIFWQVPQYFLIGCAEVFTFIGQLEF  480

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRSLCSALSLTT A+GNYLSS LVTIV +ITT+NGKPGW+ +NLNYGHLDYF
Sbjct  481   FYDQAPDAMRSLCSALSLTTVALGNYLSSLLVTIVMNITTKNGKPGWIPDNLNYGHLDYF  540

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             ++LLAVLSV+NLG ++++AK YTYK+ +
Sbjct  541   YYLLAVLSVLNLGAYLMIAKWYTYKRPV  568



>ref|XP_003551296.1| PREDICTED: peptide transporter PTR1 [Glycine max]
Length=572

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/568 (73%), Positives = 488/568 (86%), Gaps = 4/568 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD YTKDGT+DY   PANK +TGTWKACP+ILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWKACPYILGNECCERLAYYGMSTNLVLYFKNRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ + +ASKN+SNWSGTCYI PL+GA+LAD+YLGRYWTIA FSIIY IGMTL+TLSA+VP
Sbjct  61    NQHSATASKNVSNWSGTCYITPLIGAYLADSYLGRYWTIAVFSIIYAIGMTLLTLSASVP  120

Query  669   GISPTCIAH--EKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             GI PTC  H  E C  T  ++ VCF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++ 
Sbjct  121   GIKPTCHGHGDENCRATTLESAVCFLALYLIALGTGGIKPCVSSYGADQFDDTDSAEKER  180

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQ  240

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGS  TR+ QV++AS+RK  V+VP D+SLL+ET+  ES I+GSRKL HTNELRFFDKA
Sbjct  241   KPGGSAITRICQVVMASIRKYNVEVPADESLLYETAETESAIKGSRKLDHTNELRFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV+   +  K S +PWRLCTVTQVEELKSI+R+LP+WATGIIFSTVYGQMST FV Q   
Sbjct  301   AVLAQSDKVKESTNPWRLCTVTQVEELKSILRILPVWATGIIFSTVYGQMSTLFVLQGQT  360

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T VG  TFKIP ASLS+FDTLSVI WVP+YDR+IVP+A KFTG+K+GLT LQRMG+GL
Sbjct  361   MDTRVGNSTFKIPPASLSIFDTLSVIFWVPVYDRIIVPIATKFTGNKNGLTQLQRMGIGL  420

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI +MV+AA+LE++RL MV+RHN Y + E+P+++FWQVPQYFIIGCAEVF FIGQLEF
Sbjct  421   FISIFSMVAAAILELIRLRMVRRHNYYQLEEIPMTIFWQVPQYFIIGCAEVFYFIGQLEF  480

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRS CSALSLTT A+G YLSS LVTIV  I+TRNG PGW+ +NLN+GH+DYF
Sbjct  481   FYEQAPDAMRSFCSALSLTTVALGQYLSSLLVTIVTKISTRNGSPGWIPDNLNFGHIDYF  540

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             FWLLA+LSV+NL  F+VV+ +YTYK+ +
Sbjct  541   FWLLALLSVVNLIAFLVVSMLYTYKRPV  568



>gb|EYU45753.1| hypothetical protein MIMGU_mgv1a003661mg [Erythranthe guttata]
Length=571

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/565 (72%), Positives = 484/565 (86%), Gaps = 2/565 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EEDD+YTKDGT+DY+N PANK +TGTWKACP+ILGNEC ERLA+YGMSSNL++YF+ RLN
Sbjct  3     EEDDLYTKDGTVDYQNNPANKTRTGTWKACPYILGNECCERLAFYGMSSNLVVYFKERLN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q + +AS N+SNW+GTCYI PL+GAF+ADAYLGRYWTIA+FSI+YVIGMTL+TLSA++PG
Sbjct  63    QHSTTASNNVSNWAGTCYITPLIGAFVADAYLGRYWTIASFSILYVIGMTLLTLSASIPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTCI    C  T     VCF+ALYL+ALGTGGIKPCVSS+GADQFDDTDE E+ HKSS
Sbjct  123   LKPTCIDKNTCHATSGQAAVCFVALYLIALGTGGIKPCVSSFGADQFDDTDELEKNHKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYF INIGAL+A+S++V+IQ  V W WGFG+PAVAMA+AV FFFSGTRLYR QKPG
Sbjct  183   FFNWFYFVINIGALIAASVLVYIQMHVGWQWGFGIPAVAMAIAVVFFFSGTRLYRNQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV++AS RK  V+VP DKSLL+ET   ES I+GSRK+ HTN L FFDKAAV 
Sbjct  243   GSPLTRICQVVIASFRKYNVQVPADKSLLYETLDAESAIKGSRKIEHTNNLAFFDKAAVD  302

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
                + KK   +PW+LCTVTQVEELK+IIRLLPIWATGIIF+TVYGQM T FV Q + M+ 
Sbjct  303   TQPDVKKAPINPWKLCTVTQVEELKAIIRLLPIWATGIIFATVYGQMGTLFVLQGLTMDA  362

Query  1392  YVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             ++G  +F+IP ASLS+FDTLSVI WVPIYDR+IVP ARKFTGHK+GLT LQRMG GLFIS
Sbjct  363   HLGKSSFEIPAASLSIFDTLSVIFWVPIYDRVIVPFARKFTGHKNGLTQLQRMGTGLFIS  422

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +M+SA +LE+VRL  VKRHN Y++ ++P+S+FWQVP YFIIGCAEVF FIGQLEFFY+
Sbjct  423   IFSMLSAGILELVRLRYVKRHNYYELEQIPMSIFWQVPHYFIIGCAEVFMFIGQLEFFYE  482

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSAL LTT A+G+YLS+ LVTIV  ++TRNGK GW+ +NLNYGHL YF+WL
Sbjct  483   QAPDAMRSLCSALQLTTVALGSYLSTLLVTIVTKVSTRNGKLGWIPDNLNYGHLHYFYWL  542

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LAVLSV+NLGVF++VAK YTYKK I
Sbjct  543   LAVLSVLNLGVFLLVAKWYTYKKPI  567



>gb|KDP46546.1| hypothetical protein JCGZ_08518 [Jatropha curcas]
Length=570

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/563 (73%), Positives = 477/563 (85%), Gaps = 2/563 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+DYR  PANK +TGTW+ACPFI+GNEC ERLAYYGMSSNL++YF+  L
Sbjct  1     MAEEDIYTKDGTVDYRGNPANKKETGTWRACPFIIGNECCERLAYYGMSSNLVLYFKNIL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ + +A+KN S+WSGTCY  PL+GAFLADA+LGRY TIA F  IYVIGMTL+ LSA+VP
Sbjct  61    NQDSATATKNNSDWSGTCYTTPLIGAFLADAFLGRYRTIAIFMSIYVIGMTLLALSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C +   C  T   +  CF+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK 
Sbjct  121   GLKPKCYSKNDCDPTDGQSAACFVALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+ASS++V++Q   SWGWGFG+PA+AM +A+T F+ GTRLYR QKP
Sbjct  181   SFFNWFYFSINVGALIASSVLVYVQDNWSWGWGFGIPAIAMLIALTSFYLGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRLFQVIVAS+RK KVKVP DKSLLHET+  ESNI+GSRK+ HT +  FFDKAAV
Sbjct  241   GGSPLTRLFQVIVASIRKYKVKVPADKSLLHETADAESNIKGSRKVEHTKDFSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K S  PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS  FV Q   MN
Sbjct  301   ETEKDNVKESVDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNLFVLQGDQMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              YVG  +FKIP ASLSVFDTLSVI WVPIYDR+IVP+ARKFTGHK+GLT LQRMG+GL I
Sbjct  361   KYVGNSSFKIPSASLSVFDTLSVIFWVPIYDRIIVPVARKFTGHKTGLTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ AMVSAAVLEM+RLAMV+RHN+Y+V EVPISVFWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SVFAMVSAAVLEMIRLAMVERHNIYEVKEVPISVFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
              +APD+MRSLCSALSLTT A+GNYLSS LVTI   IT +NGKPGW+ +NLNYGH+DYFFW
Sbjct  481   QEAPDAMRSLCSALSLTTVALGNYLSSLLVTITMSITAKNGKPGWIPDNLNYGHVDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYK  1991
             +LA+LSV+NL  F++++K YTYK
Sbjct  541   VLAILSVLNLVAFLLISKWYTYK  563



>ref|XP_010033028.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033029.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033030.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033031.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033032.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 gb|KCW52563.1| hypothetical protein EUGRSUZ_J01942 [Eucalyptus grandis]
Length=570

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/566 (72%), Positives = 481/566 (85%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DY+  PANK KTGTWKACPFILGNEC ERLAYYGMSSNL++YF+ RL
Sbjct  1     MGEEDVYTKDGTVDYKGDPANKKKTGTWKACPFILGNECCERLAYYGMSSNLVLYFKLRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q + +AS N++NW+GTCYI PL+GAF ADAYLGRYWTIA FSIIYV GMTL+TLSA+V 
Sbjct  61    HQHSTTASNNVTNWAGTCYITPLIGAFFADAYLGRYWTIACFSIIYVFGMTLLTLSASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC   + C  T   + VCFIALYL+ALGTGGIKPCVSSYGADQFDD DE E+K K 
Sbjct  121   GLKPTCTGKDNCHATDIQSAVCFIALYLIALGTGGIKPCVSSYGADQFDDADEAEKKRKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A S +V+IQ  V WG GFG+PA AMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINVGALIAGSFLVYIQDNVGWGLGFGIPAAAMAIAVCTFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VAS RK +V+VP DKS L+ET+  ES I+GSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRLSQVVVASFRKYRVEVPADKSQLYETADAESAIKGSRKLDHTQDLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K   +PWRLCTVTQVEELK+IIRLLP+WATGI+F+TVY QM T FV Q   M+
Sbjct  301   ETQTDHVKDPVNPWRLCTVTQVEELKAIIRLLPVWATGIVFATVYNQMGTLFVLQGYTMD  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              +VG  TF+IP ASLS+FDTLSV+ WVP+YDR+IVP+AR+FTGHKSGLT LQRMG+GLFI
Sbjct  361   PHVGNSTFEIPAASLSIFDTLSVLFWVPVYDRIIVPVARRFTGHKSGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM+SAA+LE+VRL MV+RH+ YD   VP+S+FWQVPQYF+IGCAEVFTF+GQLEFFY
Sbjct  421   SIFAMISAAILEVVRLKMVRRHDYYDYKYVPMSIFWQVPQYFLIGCAEVFTFVGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS+CSALSLTTNA+GNYLSS LVTIV  I+TR+GK GW+ +NLNYGHL YFFW
Sbjct  481   EQAPDAMRSMCSALSLTTNALGNYLSSVLVTIVTRISTRHGKLGWIPDNLNYGHLQYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLAVLSV+NLGV++++AK YTYKKA+
Sbjct  541   LLAVLSVINLGVYLLIAKWYTYKKAV  566



>gb|KDP46548.1| hypothetical protein JCGZ_08520 [Jatropha curcas]
Length=570

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/563 (73%), Positives = 476/563 (85%), Gaps = 2/563 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+DYR  PANK +TGTW+ACPFI+GNEC ERLAYYGMSSNL++YF+  L
Sbjct  1     MAEEDIYTKDGTVDYRGNPANKKETGTWRACPFIIGNECCERLAYYGMSSNLVLYFKNIL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ + +A+KN S+WSGTCY  PL+GAFLADA+LGRY TIA F  IYVIGMTL+ LSA+VP
Sbjct  61    NQDSATATKNNSDWSGTCYTTPLIGAFLADAFLGRYRTIAIFMSIYVIGMTLLALSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C +   C  T   +  CF+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK 
Sbjct  121   GLKPKCYSKNDCDPTDGQSAACFVALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+ASS++V++Q+  SWGWGFG+PA+AM +A+T F+ GTR YR QKP
Sbjct  181   SFFNWFYFSINVGALIASSVLVYVQENWSWGWGFGIPAIAMLIALTSFYLGTRYYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRLFQVIVAS+RK KVKVP DKSLLHET+  ESNI+GSRK+ HT +  FFDKAAV
Sbjct  241   GGSPLTRLFQVIVASIRKYKVKVPADKSLLHETADAESNIKGSRKVEHTKDFSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K S  PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS  FV Q   MN
Sbjct  301   ETEKDNVKESVDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNLFVLQGDQMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              YVG  +FKIP ASLSVFD LSVI WVPIYDR+IVP+ARKFTGHK+GLT LQRMG+GL I
Sbjct  361   KYVGNSSFKIPSASLSVFDPLSVIFWVPIYDRIIVPVARKFTGHKTGLTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ AMVSAAVLEM+RLAMV+RHN+Y+V EVPISVFWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SVFAMVSAAVLEMIRLAMVERHNIYEVKEVPISVFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
              +APD+MRSLCSALSLTT A+GNYLSS LVTI   IT +NGKPGW+ +NLNYGH+DYFFW
Sbjct  481   QEAPDAMRSLCSALSLTTVALGNYLSSLLVTITMSITAKNGKPGWIPDNLNYGHVDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYK  1991
             +LA+LSV+NL  F++++K YTYK
Sbjct  541   VLAILSVLNLVAFLLISKWYTYK  563



>ref|XP_002520427.1| peptide transporter, putative [Ricinus communis]
 gb|EEF41840.1| peptide transporter, putative [Ricinus communis]
Length=571

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/567 (72%), Positives = 477/567 (84%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE+D+YTKDGT+DYR  PA+K KTGTW+ACPFI+GNEC ERLAYYGMSSNL++YF+  L
Sbjct  1     MEEEDIYTKDGTVDYRGNPASKKKTGTWRACPFIIGNECCERLAYYGMSSNLVLYFKNIL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS+ +A+KN S+WSGTCY  PL+GAFLADAY GRYWTIA FSIIYVIGMTL+ LSA++P
Sbjct  61    NQSSATATKNNSDWSGTCYTTPLIGAFLADAYFGRYWTIAIFSIIYVIGMTLLALSASIP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P C A + C  T   + V F+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+KHK 
Sbjct  121   GIKPKCYAKDDCDPTDAQSAVFFLALYLVALGTGGIKPCVSSYGADQFDDTDENEKKHKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+G L+ASS++V++Q   SWGWGFG+PA+AMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINVGGLIASSVLVYVQMNWSWGWGFGIPAIAMAIAVVSFFSGTKLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSG-LESNIQGSRKLSHTNELRFFDKAA  1205
             GGSPFTRLFQVIVAS++K K+KVP DK+LL+E S   ESNI+GSR++ HT +  FFDKAA
Sbjct  241   GGSPFTRLFQVIVASIKKYKIKVPADKALLYEISNDAESNIKGSRRIDHTKDFSFFDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    +  K S  PW+LCTVTQVEELKSIIRLLP+WATGIIF+ VY QMS  FV Q   M
Sbjct  301   VETETDNVKDSVDPWKLCTVTQVEELKSIIRLLPVWATGIIFAAVYSQMSNLFVLQGDQM  360

Query  1386  NTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             N YVG  +FKIP ASLSVFDTLSVI WVPIYDR++ P  RKFTGHK+G T LQRMG+GL 
Sbjct  361   NKYVGNSSFKIPSASLSVFDTLSVIFWVPIYDRILAPFVRKFTGHKNGFTQLQRMGIGLV  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             IS+ AMVSAAVLE+ RL MV+RHN Y++ EVPISVFWQVPQYF+IGCAEVFTFIGQLEFF
Sbjct  421   ISVFAMVSAAVLELTRLQMVRRHNYYELKEVPISVFWQVPQYFLIGCAEVFTFIGQLEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y +APD+MRSLCSALSLTT A+GNYLSS LVTI   IT RNGKPGW+ +NLNYGH+DYFF
Sbjct  481   YQEAPDAMRSLCSALSLTTVALGNYLSSLLVTITMSITARNGKPGWIPDNLNYGHIDYFF  540

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             W+LAVLSV+NLG F+ ++K YTYK  +
Sbjct  541   WVLAVLSVLNLGAFLFISKWYTYKTPL  567



>ref|XP_009337310.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
 ref|XP_009337311.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
Length=582

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/574 (72%), Positives = 484/574 (84%), Gaps = 2/574 (0%)
 Frame = +3

Query  285   D*QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNL  464
             D   ++   EE+DVYTKDGT+D+R  PA +N TGTWKACPFILGNEC ERLAYYGMSSNL
Sbjct  5     DLPTKAAVAEENDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNL  64

Query  465   MIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTL  644
             +IYF+T+LNQ++ +A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYVIGMTL
Sbjct  65    VIYFKTQLNQTSAAAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTL  124

Query  645   MTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  824
             +T+SA+VPG+ PTC++ + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD D
Sbjct  125   LTMSASVPGMKPTCVSKDVCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDD  184

Query  825   EKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGT  1004
             E E+KHK SFFNWFYFSIN+GA++ASS++VWIQ+ V W WGFGVPAVAMA+AV  FFSGT
Sbjct  185   EVEKKHKGSFFNWFYFSINVGAMIASSVLVWIQENVGWEWGFGVPAVAMAIAVLSFFSGT  244

Query  1005  RLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNEL  1184
             RLYR QKPGGSP TR+ QVIVAS+R  K+KVP DKSLL+ET+  ES+IQGSRKL HTNE 
Sbjct  245   RLYRNQKPGGSPLTRIIQVIVASIRNYKLKVPEDKSLLYETADAESSIQGSRKLDHTNEF  304

Query  1185  RFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQF  1364
             RFFDKAAVV   +  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS  F
Sbjct  305   RFFDKAAVVVQGDQIKDSKSPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNFF  364

Query  1365  VSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQ  1538
             V Q   M+  VG  +F+IP ASLS+FDTLSVI WVPIYDR+IVP ARK+TGHK+GLT LQ
Sbjct  365   VLQGTLMDIRVGHSSFEIPAASLSIFDTLSVIFWVPIYDRIIVPAARKYTGHKNGLTTLQ  424

Query  1539  RMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTF  1718
             RMG+GLFISI +MV AAVLE++RL  V+++N Y    +P+SVFWQVPQYF+IG AEVFTF
Sbjct  425   RMGIGLFISIFSMVCAAVLELIRLRSVRQNNYYTRDHMPMSVFWQVPQYFLIGAAEVFTF  484

Query  1719  IGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNY  1898
             IGQLEFFYDQAPD+MRSLCSALSL+T A+GNY +S LVTIV   T +NG PGW+ NNLNY
Sbjct  485   IGQLEFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVTIVTKTTKKNGNPGWIPNNLNY  544

Query  1899  GHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             GHLDYFFWLLAVLSV+NLGV++ +AK YTYKK +
Sbjct  545   GHLDYFFWLLAVLSVLNLGVYLFIAKWYTYKKTV  578



>ref|XP_009591017.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana tomentosiformis]
Length=572

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/568 (73%), Positives = 481/568 (85%), Gaps = 8/568 (1%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E   EDD+YTKDGT+DYRN PA K +TG+WKACPFILGNEC ERLAYYGMS+NL++YF+ 
Sbjct  7     EVSGEDDLYTKDGTVDYRNNPAKKTETGSWKACPFILGNECCERLAYYGMSTNLVLYFKK  66

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RLNQ + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYVIGMTL+TLSA+
Sbjct  67    RLNQHSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIACFSIIYVIGMTLLTLSAS  126

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ P+    E        T VCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KH
Sbjct  127   VPGLKPSSDPKEV------QTAVCFVALYLIALGTGGIKPCVSSYGADQFDDADEVEKKH  180

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFG+PAV MA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSVLVWIQDNVGWGWGFGIPAVTMAIAVVSFFSGTRLYRNQ  240

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             +PGGSP TR+ QV+VAS RK KV VP DK+ L+ET+  ES I GSRKL HT +L FFDKA
Sbjct  241   RPGGSPLTRICQVVVASFRKFKVDVPGDKTSLYETTDAESAITGSRKLDHTKDLCFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV    ++ KG+   WRLCTVTQVEELK+IIRLLPIWATGI+FS VY QMST FV Q   
Sbjct  301   AVQTESDHMKGNIDGWRLCTVTQVEELKAIIRLLPIWATGIVFSAVYSQMSTMFVLQGAS  360

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+T VG  +FKIP ASLS+FDTLSVI WVPIYD++IVP+ARK TGHK+GLT LQRMG GL
Sbjct  361   MDTRVGNSSFKIPPASLSIFDTLSVIFWVPIYDQVIVPIARKITGHKNGLTQLQRMGTGL  420

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI AMVSAA+LE+ RL  VKRHN Y++ +VP+S+FWQVPQYF+IGCAEVFTFIGQLEF
Sbjct  421   FISIFAMVSAAILELFRLKYVKRHNYYELEQVPMSIFWQVPQYFLIGCAEVFTFIGQLEF  480

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRSL SALSLTT A+GNYLSS LVTIV   TT+NGKPGW+ +NLNYGHLDYF
Sbjct  481   FYEQAPDAMRSLSSALSLTTVALGNYLSSLLVTIVMKTTTKNGKPGWIPDNLNYGHLDYF  540

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             ++LLAVLSV+NLGV++++AK YTYK+ +
Sbjct  541   YYLLAVLSVLNLGVYLMIAKWYTYKRPV  568



>gb|KEH34179.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=570

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/566 (73%), Positives = 490/566 (87%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE++VYTKDGT+DY   PAN+ KTGTWKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEEENVYTKDGTVDYLGNPANRKKTGTWKACPFILGNECCERLAYYGMSTNLVLYFKERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q +  ASKN+SNW+GTCYI PL+GAF+AD+YLGRYWTIA+FSI+YVIGMTL+TLSA+V 
Sbjct  61    HQHSAVASKNVSNWAGTCYITPLIGAFVADSYLGRYWTIASFSILYVIGMTLLTLSASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P C   + C  T   + VCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GIKPECQGKDNCHATTLQSAVCFLALYLIALGTGGIKPCVSSYGADQFDDDDEDEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTKLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS+RK +V  P DKSLL+E +  ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSPLTRIAQVIVASIRKYRVDAPTDKSLLYEIADTESAIKGSRKLDHTNELRFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K S +PWRLCTVTQVEELKSI+RLLP+WATGIIF+TVYGQMST FV Q   MN
Sbjct  301   QGESDNLKESINPWRLCTVTQVEELKSILRLLPVWATGIIFATVYGQMSTLFVLQGQTMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             T+VG  +FKIP ASLS+FDT+SVI WVP+YDR+IVP+ARKFTGHK+GLT LQRMGVGLFI
Sbjct  361   THVGNSSFKIPPASLSIFDTISVIFWVPVYDRIIVPIARKFTGHKNGLTQLQRMGVGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +MV+AA LE+VRL  V+R+N Y++ E+P+++FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SIFSMVAAAFLELVRLRTVRRNNYYELEEIPMTIFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRSLCSALSL T A G YLSS LVTIV +I+T+NG PGW+ +NLNYGH+DYFFW
Sbjct  481   EQAPDAMRSLCSALSLLTVAFGQYLSSLLVTIVTNISTKNGSPGWIPDNLNYGHIDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLAVLSV+NL V+V+VA++YTYKK +
Sbjct  541   LLAVLSVLNLIVYVLVARLYTYKKTV  566



>ref|XP_007016184.1| Peptide transporter 1 [Theobroma cacao]
 gb|EOY33803.1| Peptide transporter 1 [Theobroma cacao]
Length=569

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/566 (72%), Positives = 481/566 (85%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ME+DD+YTKDGT+DY+  PANK +TGTW+ACPFI+GNE  ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEKDDIYTKDGTVDYKGNPANKKETGTWRACPFIIGNEGCERLAYYGMSTNLVLYFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ +  A+KN  NW GTCYI PL+GAFLADAYLGRYWTIA FSIIY+ GMTL+ LSA+V 
Sbjct  61    NQHSAVATKNNQNWGGTCYITPLIGAFLADAYLGRYWTIACFSIIYIFGMTLLALSASVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P C   + C  T   + + F+ALYL+ALGTGGIKPCVSSYGADQFDDTDEKE+KHKS
Sbjct  121   GIRPRCYTKDSCDPTDTQSAMAFLALYLIALGTGGIKPCVSSYGADQFDDTDEKEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+A+S++VW+Q  VSWGWGFG+PA+AMA+AV FFFSGTRLYRYQKP
Sbjct  181   SFFNWFYFSINIGALIAASVLVWVQDNVSWGWGFGIPAIAMAIAVCFFFSGTRLYRYQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VAS+RK KV VP DKS+L+ET+  ESNI+GSRK+ HT +L FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASIRKYKVAVPADKSILYETADAESNIKGSRKIDHTTDLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ KGS +PWRLCTVTQVEELK+IIRLLPIWA+GIIFSTVY QM   FV Q   M+
Sbjct  301   ETERDHIKGS-NPWRLCTVTQVEELKAIIRLLPIWASGIIFSTVYSQMGNLFVLQGERMD  359

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             T VG   F+IP ASLS+FDTLSVI WVPIYDR+IVP  R+FTGHK+GLT LQRMG+GLFI
Sbjct  360   TRVGHSKFRIPPASLSIFDTLSVIFWVPIYDRIIVPATRRFTGHKNGLTQLQRMGIGLFI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AMV+AA LE  RL M++RHN Y++ E+P+++FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  420   SIFAMVAAAFLERERLKMIRRHNYYELKEMPMTIFWQVPQYFLIGCAEVFTFIGQLEFFY  479

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS CSALSLTT A+G+YLSS LVTIV  +T +NGKPGW+ +NLNYGH+DYFFW
Sbjct  480   EQAPDAMRSFCSALSLTTVALGSYLSSLLVTIVTSVTAKNGKPGWIPDNLNYGHVDYFFW  539

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLA LSV+NL VFV +A  YTYK+A+
Sbjct  540   LLAALSVLNLAVFVWIANWYTYKRAV  565



>ref|XP_004294248.1| PREDICTED: peptide transporter PTR1-like [Fragaria vesca subsp. 
vesca]
Length=586

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/568 (72%), Positives = 483/568 (85%), Gaps = 2/568 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E+DDVYTKDGT+DY+  PANK  TGTWKACPFILGNEC ERLAYYGMSSNL+IYF+TRL+
Sbjct  18    EDDDVYTKDGTVDYKGDPANKKVTGTWKACPFILGNECCERLAYYGMSSNLVIYFKTRLH  77

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             QS+  A+K+ SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYVIGMTL+TLSA+VPG
Sbjct  78    QSSARAAKSNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTLSASVPG  137

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTC++ + C      T  CFIALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHK S
Sbjct  138   MKPTCVSKDDCYANNGQTAACFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKKHKGS  197

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSIN+GAL+ASS++VWIQ    W WGFG+PAVAMA+AV  FFSGTRLYR QKPG
Sbjct  198   FFNWFYFSINVGALIASSVLVWIQMNEGWSWGFGIPAVAMAIAVVCFFSGTRLYRNQKPG  257

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VAS+RK KVKVP DKS+L+ET+  ES I+GSRKL HTNE  FFDKAAVV
Sbjct  258   GSPLTRIIQVLVASVRKYKVKVPEDKSILYETTDAESAIKGSRKLDHTNEFSFFDKAAVV  317

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
             E  ++ K S  PWRL TVTQVEELKSIIRLLP+WATGIIF+ VY QMS  FV Q   M+ 
Sbjct  318   EPTDHIKDSKDPWRLATVTQVEELKSIIRLLPVWATGIIFAAVYNQMSNFFVLQGTLMDL  377

Query  1392  YVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +VG  +F+IP ASLSVFDTLSVI+WVPIYD+LIVP ARKFTGH++G+T LQRMG+GLFIS
Sbjct  378   HVGKSSFEIPAASLSVFDTLSVIIWVPIYDQLIVPFARKFTGHRNGITTLQRMGIGLFIS  437

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV AA+LE++RL  VK +N YD   +P+SVFWQ PQYF+IG AEVFTFIGQL+FFYD
Sbjct  438   IFSMVCAAILELIRLRKVKENNYYDDEHMPMSVFWQSPQYFLIGAAEVFTFIGQLDFFYD  497

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSL+T A+GNY +S LVTIV ++TT+N KPGW+ +NLNYGHLDYFFW+
Sbjct  498   QAPDAMRSLCSALSLSTVALGNYFNSLLVTIVTNVTTKNNKPGWIPDNLNYGHLDYFFWM  557

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LAVLS++NLG F++++K YTYKK +  +
Sbjct  558   LAVLSILNLGAFLLISKWYTYKKTVGSI  585



>ref|XP_002313394.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 ref|XP_006379037.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 ref|XP_006379038.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 ref|XP_006379039.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|EEE87349.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|ERP56834.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|ERP56835.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|ERP56836.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
Length=570

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/566 (71%), Positives = 479/566 (85%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DY   PAN+ +TGTW+ACPFI+GNE  ERLAYYGMSSNL++YF+ RL
Sbjct  1     MAEEDVYTKDGTVDYLGNPANRKETGTWRACPFIIGNEFCERLAYYGMSSNLVLYFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS+ +A++N  NW GTCY+ PL+GAF+ADAYLGRYWTIA+FS IYV GMTL+T+SATV 
Sbjct  61    NQSSATATRNNLNWGGTCYLTPLIGAFVADAYLGRYWTIASFSTIYVAGMTLLTMSATVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C + + C  TG  T V F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GLRPECYSKDHCHPTGGQTAVTFVALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+A S++VWIQ  VSWGWGFG+PA+AMA+AV  FFSGT+L+RYQKP
Sbjct  181   SFFNWFYLSINVGALIAGSVLVWIQDNVSWGWGFGIPAIAMAIAVVSFFSGTKLFRYQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK+KV+VP DKSLLHET+  ESNI+GSRKL HT E  F DKAAV
Sbjct  241   GGSPLTRICQVLVASFRKQKVEVPADKSLLHETADAESNIKGSRKLDHTEEFSFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KG+  PW LCTVTQVEELK+IIRLLPIWATGIIFS VY QM   FV Q   M+
Sbjct  301   ETEKDDIKGTGDPWNLCTVTQVEELKAIIRLLPIWATGIIFSAVYSQMGNLFVLQGETMD  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              +VG  TF+IP ASLS+FDTLSVI WVP+YDR+IVP+ARKFTGHK+GLT LQRMG+GLFI
Sbjct  361   KFVGNSTFEIPSASLSIFDTLSVIFWVPVYDRIIVPVARKFTGHKNGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AMVSAA+LE+ RL MV+ +N Y++  VPIS+FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMVSAAILELKRLQMVRNNNYYELDSVPISIFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS+CSALSLTT A+GNYLSS LVTIV  I+T+NGK GW+ +NLNYGH+DYFFW
Sbjct  481   EQAPDAMRSMCSALSLTTVALGNYLSSLLVTIVTTISTKNGKAGWIPDNLNYGHIDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LL +LSV+NLG F++++  YTYKKAI
Sbjct  541   LLGMLSVLNLGAFLLISNWYTYKKAI  566



>ref|XP_009374278.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
 ref|XP_009374279.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
Length=582

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/570 (72%), Positives = 482/570 (85%), Gaps = 2/570 (0%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             ++   EE DVYTKDGT+D+R  PA +N TGTWKACPFILGNEC ERLAYYGMSSNL+IYF
Sbjct  9     KAAPPEEKDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVIYF  68

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             +T+LNQ++  A+KN SNWSGTCY+ PL+GA LADAYLGRY TIA+FSIIYVIGMTL+T+S
Sbjct  69    KTQLNQTSAVAAKNNSNWSGTCYLTPLLGAVLADAYLGRYKTIASFSIIYVIGMTLLTMS  128

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A+VPG+ PTC++ + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  129   ASVPGMKPTCVSKDDCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  188

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             KHK+SFFNWFYFSIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV  FFSGTRLYR
Sbjct  189   KHKASFFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTRLYR  248

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET+  ES+IQGSRKL HTNE RFFD
Sbjct  249   NQKPGGSPVTRIIQVVVASVRKYKVKVPEDKSLLYETADAESSIQGSRKLDHTNEFRFFD  308

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAAV   D+  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+  Y QMS  FV Q 
Sbjct  309   KAAVEVPDDNIKDSKSPWRLTTVTQVEELKSIIRLLPIWATGIIFAAAYNQMSNFFVLQG  368

Query  1377  IGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
               M+  VG  +F+IP ASLSVFDTLSVI WVPIYDR+IVP ARK+TGHK+GLT LQRMG+
Sbjct  369   TLMDVRVGHSSFEIPAASLSVFDTLSVIFWVPIYDRIIVPAARKYTGHKNGLTTLQRMGI  428

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GLFISI +MV AAVLE++RL  V+++N Y+   +P+SVFWQVPQYF+IG AEVFTFIGQL
Sbjct  429   GLFISIFSMVCAAVLELIRLRSVRQNNYYEYEHMPMSVFWQVPQYFLIGAAEVFTFIGQL  488

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRSLCSALSL+T A+GNY +S LV+IV   TT++G PGW+ +NLNYGHLD
Sbjct  489   EFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVSIVTKTTTKDGNPGWIPDNLNYGHLD  548

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             YFFWLLA+LSV+NL V++ ++K YTYKK +
Sbjct  549   YFFWLLAMLSVLNLVVYLFISKWYTYKKTV  578



>ref|XP_011032155.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Populus euphratica]
 ref|XP_011032156.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Populus euphratica]
Length=570

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/566 (71%), Positives = 477/566 (84%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DY   PAN+ +TGTW+ACPFI+GNE  ERLAYYGMSSNL++YF+ RL
Sbjct  1     MAEEDVYTKDGTVDYLGNPANRKETGTWRACPFIIGNEFCERLAYYGMSSNLVLYFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS+ +A++N  NW GTCYI PL+GAF+ADAYLGRYWTIA+FS IYV GMTL+T+SATVP
Sbjct  61    NQSSATATRNNLNWGGTCYITPLIGAFVADAYLGRYWTIASFSSIYVAGMTLLTMSATVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C + + C  T   T V F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GLRPECYSKDHCHPTDGQTAVTFVALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+A S++VWIQ  VSWGWGFG+PA+AMA+AV  FFSGT+L+RYQKP
Sbjct  181   SFFNWFYLSINVGALIAGSVLVWIQDNVSWGWGFGIPAIAMAIAVVSFFSGTKLFRYQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RKRKV+VP DKSLLHET+  ESNI+GSRKL HT E  F DKAAV
Sbjct  241   GGSPVTRICQVLVASFRKRKVEVPADKSLLHETADAESNIKGSRKLDHTKEFSFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K +  PW LCTVTQVEELK+IIRLLPIWATGIIFS VY QM   FV Q   M+
Sbjct  301   ETEKDDIKSTGDPWNLCTVTQVEELKAIIRLLPIWATGIIFSAVYSQMGNLFVLQGETMD  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              +VG  TF+IP ASLS+FDTLSVI WVP+YDR++VP+ RKFTGHK+GLT LQRMG+GLFI
Sbjct  361   KFVGNSTFEIPSASLSIFDTLSVIFWVPVYDRIVVPVTRKFTGHKNGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AMVSAAVLE+ RL MV+ +N Y++  VP+S+FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMVSAAVLELKRLQMVRNNNYYELDSVPMSIFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS+CSALSLTT A+GNYLSS LVTIV  I+T+NGK GW+ +NLNYGH+DYFFW
Sbjct  481   EQAPDAMRSMCSALSLTTVALGNYLSSLLVTIVTSISTKNGKAGWIPDNLNYGHIDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LL +LSV+NLG F++++  YTYKKAI
Sbjct  541   LLGILSVLNLGAFLLISNWYTYKKAI  566



>ref|XP_002298324.1| hypothetical protein POPTR_0001s25570g [Populus trichocarpa]
 gb|EEE83129.1| hypothetical protein POPTR_0001s25570g [Populus trichocarpa]
Length=570

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/566 (70%), Positives = 477/566 (84%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DYR  PANK +TGTW+ACP+I+GNE  ERLAYYGMSSNL++YF+ RL
Sbjct  1     MAEEDVYTKDGTVDYRGNPANKKETGTWRACPYIIGNEFCERLAYYGMSSNLILYFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ + +A++N  NW GTCY+ PL+GAF ADAYLGRYWTIA FSIIYV+GMTL+T+SATVP
Sbjct  61    NQQSATATRNNLNWGGTCYLTPLIGAFFADAYLGRYWTIACFSIIYVMGMTLLTISATVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C A + C  T   + + F++LYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GLRPKCYAEDDCNPTDAQSALAFVSLYLIALGTGGIKPCVSSYGADQFDDADEVEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+A S++VW+Q  VSWGWGFG+PA+AMA+AV  FFSGTRL+RYQKP
Sbjct  181   SFFNWFYLSINVGALIAGSVLVWVQDNVSWGWGFGIPAIAMAIAVASFFSGTRLFRYQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV++AS RK+KV+VP DK+LL+ET+  ESNI+GSRKL HT E  F DKAAV
Sbjct  241   GGSPLTRICQVLLASFRKKKVEVPADKALLYETADAESNIKGSRKLDHTEEFSFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KG   PWRLCTVTQVEELKSIIRLLPIWATGIIF+ VY QM   FV Q   M+
Sbjct  301   ETEKDDIKGPVDPWRLCTVTQVEELKSIIRLLPIWATGIIFTAVYSQMGNLFVLQGEQMD  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              YVG   F+IP ASLS+FDTLSVI WVP+YDR+IVP+ARK+TGHK+GLT LQRMG+GLFI
Sbjct  361   KYVGNSNFQIPSASLSIFDTLSVIFWVPVYDRIIVPVARKYTGHKNGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +MVSAA+LE+ RL MV+RHN Y++  VP+S+FWQ PQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SIFSMVSAAILELKRLEMVRRHNSYELKTVPLSIFWQAPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS+CSALSLTT A+G+YLSS LVTIV  I+T+NGKPGW+  NLNYGH+DYFFW
Sbjct  481   EQAPDAMRSMCSALSLTTVALGSYLSSLLVTIVTSISTKNGKPGWIPENLNYGHIDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LL VLSV+NL VF++++  YTYKK +
Sbjct  541   LLGVLSVLNLCVFLLISNWYTYKKPV  566



>ref|XP_007146742.1| hypothetical protein PHAVU_006G065900g [Phaseolus vulgaris]
 gb|ESW18736.1| hypothetical protein PHAVU_006G065900g [Phaseolus vulgaris]
Length=570

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/569 (72%), Positives = 490/569 (86%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD YTKDGT+DY   PANK +TGTW+ACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWRACPFILGNECCERLAYYGMSTNLVLYFKNRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q + +ASKN+SNWSGTCYI PL+GAFLAD+YLGRYWTIA FSIIYVIGMTL+TLSA+VP
Sbjct  61    HQHSATASKNVSNWSGTCYITPLIGAFLADSYLGRYWTIAGFSIIYVIGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C   E C  T  ++ +CF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++HKS
Sbjct  121   GMKPACHGDENCRATTLESAICFLALYLIALGTGGIKPCVSSYGADQFDDTDPVEKEHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGS  TR+ QV++AS+RK  V+VP D SLL+ETS  ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSALTRICQVVLASIRKYHVEVPSDTSLLYETSEDESAIKGSRKLDHTNELRFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             V   +  + S +PWRLCTVTQVEELKS++RLLP+WATGIIFSTVYGQMST FV Q   MN
Sbjct  301   VGRSDKVRESTNPWRLCTVTQVEELKSVLRLLPVWATGIIFSTVYGQMSTLFVLQGQTMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             T+VG  +FKIP ASLS+FDTLSVI WVP+YDR+IVP+ARKFTGH++G+T LQRMGVGLF+
Sbjct  361   THVGNSSFKIPPASLSIFDTLSVIFWVPVYDRIIVPVARKFTGHRNGITQLQRMGVGLFL  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +MV+AA+LE++RL MV+RHN Y + EVP+++FWQVPQYF+IGCAEVF FIGQLEFFY
Sbjct  421   SIFSMVAAAILELIRLKMVRRHNYYQLEEVPMTIFWQVPQYFVIGCAEVFYFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS CSALSLTT A+G YLSS LVTIV  I+T+NG PGW+ +NLN+GH+DYFFW
Sbjct  481   EQAPDAMRSFCSALSLTTVALGQYLSSLLVTIVTKISTKNGSPGWIPDNLNFGHIDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LL++LSV+NL  F++V+ +YTYK+ +  +
Sbjct  541   LLSLLSVLNLIAFLLVSMLYTYKRPVGTL  569



>ref|XP_008220400.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Prunus mume]
Length=581

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/577 (72%), Positives = 485/577 (84%), Gaps = 3/577 (1%)
 Frame = +3

Query  279   VAD*QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSS  458
             +A+  + ++A   +DVYTKDGTLD+R  PA +N TGTWKACPFILGNEC ERLAYYGMSS
Sbjct  1     MAEDDVPTKAAAAEDVYTKDGTLDFRGNPAKRNSTGTWKACPFILGNECCERLAYYGMSS  60

Query  459   NLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGM  638
             NL+IYF+T+LNQ++  A+KN SNW GTCY+ PL+GAFLADAYLGRY TIA+FSIIYVIGM
Sbjct  61    NLVIYFKTQLNQTSAVAAKNNSNWGGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGM  120

Query  639   TLMTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDD  818
             TL+T+SA+VPG+ PTC   + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD
Sbjct  121   TLLTMSASVPGLKPTCSGKDNCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDD  180

Query  819   TDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFS  998
              DE E+KHK SFFNWFYFSIN+GAL+ASS++VWIQ+ V WGWGFGVPAVAMA+AV  FFS
Sbjct  181   DDEVEKKHKGSFFNWFYFSINVGALIASSVLVWIQENVGWGWGFGVPAVAMAIAVVSFFS  240

Query  999   GTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLE-SNIQGSRKLSHT  1175
             GTRLYRYQKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET+  E S+IQGSRKL HT
Sbjct  241   GTRLYRYQKPGGSPLTRIIQVLVASVRKYKVKVPEDKSLLYETADAESSSIQGSRKLDHT  300

Query  1176  NELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMS  1355
             NE RFFDKAAV    ++ K S  PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS
Sbjct  301   NEFRFFDKAAVEVQSDHIKDSKDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYNQMS  360

Query  1356  TQFVSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLT  1529
               FV Q   M+  VG  +F+IP ASLS+FDTLSVI WVPIYDR++VP+ARK+TGHK+GLT
Sbjct  361   NFFVLQGTLMDIRVGHSSFEIPAASLSIFDTLSVIFWVPIYDRVLVPVARKYTGHKNGLT  420

Query  1530  HLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEV  1709
              LQRMG+GLFISI +M+ AAVLE++RL  V+ HN Y+   +P+SVFWQVPQYF+IG AEV
Sbjct  421   TLQRMGIGLFISIFSMICAAVLELIRLRSVREHNYYEYEHMPMSVFWQVPQYFLIGAAEV  480

Query  1710  FTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANN  1889
             FTFIGQLEFFYDQAPD+MRSLCSALSL+T A+GNY +S LVTIV   TT+N  PGW+ NN
Sbjct  481   FTFIGQLEFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVTIVTKTTTKNKNPGWIPNN  540

Query  1890  LNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LNYGHLDYFFWLLAVLSV+NLG +++++K YTYKK +
Sbjct  541   LNYGHLDYFFWLLAVLSVLNLGAYLLISKWYTYKKTV  577



>ref|XP_009346885.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
Length=615

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/617 (68%), Positives = 492/617 (80%), Gaps = 13/617 (2%)
 Frame = +3

Query  171   MGFFLWGRRFH-----ESW*QPDVRLKKNFPERDREILGAIVAD*QIRSEAMEEDDVYTK  335
             MG ++   + H     E W  P     K  PE   E       D   ++   EE+DVYTK
Sbjct  1     MGAYIMDHQTHHLILCEFWVYPKRARAKESPEAMAE------DDLPTKAAVAEENDVYTK  54

Query  336   DGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTISASK  515
             DGT+D+R  PA +N TGTWKACPFILGNEC ERLAYYGMSSNL+IYF+T+LNQ++ +A+K
Sbjct  55    DGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVIYFKTQLNQTSAAAAK  114

Query  516   NLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTCIAH  695
             N SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYVIGMTL+T+SA+VPG+ PTC++ 
Sbjct  115   NNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTMSASVPGMKPTCVSK  174

Query  696   EKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFS  875
             + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHK SFFNWFYFS
Sbjct  175   DVCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKKHKGSFFNWFYFS  234

Query  876   INIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPFTRLF  1055
             IN+GA++ASS++VWIQ+ V W WGFGVPAVAMA+AV  FFSGTRLYR QKPGGSP TR+ 
Sbjct  235   INVGAMIASSVLVWIQENVGWEWGFGVPAVAMAIAVLSFFSGTRLYRNQKPGGSPLTRII  294

Query  1056  QVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDEYKKG  1235
             QVIVAS+R  K+KVP DKSLL+ET+  ES+IQGSRKL HTNE RFFDKAAVV   +  K 
Sbjct  295   QVIVASIRNYKLKVPEDKSLLYETADAESSIQGSRKLDHTNEFRFFDKAAVVVQGDQIKD  354

Query  1236  SFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG--TFK  1409
             S SPWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS  FV Q   M+  VG  +F+
Sbjct  355   SKSPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNFFVLQGTLMDIRVGHSSFE  414

Query  1410  IPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMVSAA  1589
             IP ASLS+FDTLSV   VPIYDR+IVP ARK+TGHK+ LT LQRMG+GL I I +MV AA
Sbjct  415   IPAASLSIFDTLSVTFLVPIYDRIIVPAARKYTGHKNRLTTLQRMGIGLLIFIFSMVCAA  474

Query  1590  VLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMRS  1769
             VLE++RL  V+++N Y    +P+SVFWQVPQYF+IG AEVFTFIGQLEFFYDQAPD+MRS
Sbjct  475   VLELIRLRSVRQNNYYTRDHMPMSVFWQVPQYFLIGAAEVFTFIGQLEFFYDQAPDAMRS  534

Query  1770  LCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVMN  1949
             LCSALSL+T A+GNY +S LVTIV   T +NG PGW+ NNLNYGHLDYFFWLLAVLSV+N
Sbjct  535   LCSALSLSTVALGNYFNSILVTIVTKTTKKNGNPGWIPNNLNYGHLDYFFWLLAVLSVLN  594

Query  1950  LGVFVVVAKMYTYKKAI  2000
             LGV++ +AK YTYKK +
Sbjct  595   LGVYLFIAKWYTYKKTV  611



>ref|XP_011081130.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=549

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/567 (71%), Positives = 468/567 (83%), Gaps = 25/567 (4%)
 Frame = +3

Query  306   AMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             AM EDD+YTKDGT+DY N PA KNKTGTWKACPFILGNEC ERLAYYGMSSNL++YF+ +
Sbjct  2     AMAEDDLYTKDGTVDYHNNPAKKNKTGTWKACPFILGNECCERLAYYGMSSNLVVYFKEQ  61

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             LNQ + +AS N+SNWSGTCYI PL+GAF+ADAYLGRYWTIA FSIIYVIGMTL+TLSA++
Sbjct  62    LNQHSTTASNNVSNWSGTCYITPLIGAFVADAYLGRYWTIALFSIIYVIGMTLLTLSASI  121

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
             PG+ PTC A + C  T     VCF+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK
Sbjct  122   PGLKPTCQAKDSCHATSTQAAVCFVALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHK  181

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYFSINIGAL+A+S++VW                       FFFSGTRLYR QK
Sbjct  182   SSFFNWFYFSINIGALIAASVLVW-----------------------FFFSGTRLYRNQK  218

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV++AS RK +++VP DKSLL+E    ES I+GSRKL HT +L FFDKAA
Sbjct  219   PGGSPLTRICQVLIASFRKYRIEVPADKSLLYECKDAESAIKGSRKLEHTEDLGFFDKAA  278

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    ++ KGS  PWRLCTVTQVEELK+IIRLLP+WATGIIF+TVYGQMST FV Q + M
Sbjct  279   VETQSDHMKGSVDPWRLCTVTQVEELKAIIRLLPVWATGIIFATVYGQMSTLFVLQGLTM  338

Query  1386  NTYVGT--FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             +  VG   F+IP ASL +FDTLSVI WVPIYDR+IVP+ARKFTGHK+GLT LQRMG GLF
Sbjct  339   DAQVGKTGFEIPAASLGIFDTLSVIFWVPIYDRIIVPVARKFTGHKNGLTQLQRMGTGLF  398

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI +M+SA +LE++RL  V+RHN YD+  +P+S+FWQVPQYFIIGCAEVF FIGQLEFF
Sbjct  399   ISIFSMLSAGILELIRLRYVRRHNYYDLKVIPMSIFWQVPQYFIIGCAEVFMFIGQLEFF  458

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPD+MRSLCSAL LTT A+G+YLS+ LVTIV  I+TRNGK GW+ +NLNYGHL YF+
Sbjct  459   YEQAPDAMRSLCSALQLTTVALGSYLSTLLVTIVTRISTRNGKLGWIPDNLNYGHLHYFY  518

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             WLLAVLSV+NLGVF++VAK YTYKK +
Sbjct  519   WLLAVLSVLNLGVFLLVAKWYTYKKPL  545



>ref|XP_009346886.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009346887.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
Length=582

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/574 (72%), Positives = 479/574 (83%), Gaps = 2/574 (0%)
 Frame = +3

Query  285   D*QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNL  464
             D   ++   EE+DVYTKDGT+D+R  PA +N TGTWKACPFILGNEC ERLAYYGMSSNL
Sbjct  5     DLPTKAAVAEENDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNL  64

Query  465   MIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTL  644
             +IYF+T+LNQ++ +A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYVIGMTL
Sbjct  65    VIYFKTQLNQTSAAAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTL  124

Query  645   MTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  824
             +T+SA+VPG+ PTC++ + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD D
Sbjct  125   LTMSASVPGMKPTCVSKDVCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDD  184

Query  825   EKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGT  1004
             E E+KHK SFFNWFYFSIN+GA++ASS++VWIQ+ V W WGFGVPAVAMA+AV  FFSGT
Sbjct  185   EVEKKHKGSFFNWFYFSINVGAMIASSVLVWIQENVGWEWGFGVPAVAMAIAVLSFFSGT  244

Query  1005  RLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNEL  1184
             RLYR QKPGGSP TR+ QVIVAS+R  K+KVP DKSLL+ET+  ES+IQGSRKL HTNE 
Sbjct  245   RLYRNQKPGGSPLTRIIQVIVASIRNYKLKVPEDKSLLYETADAESSIQGSRKLDHTNEF  304

Query  1185  RFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQF  1364
             RFFDKAAVV   +  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS  F
Sbjct  305   RFFDKAAVVVQGDQIKDSKSPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNFF  364

Query  1365  VSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQ  1538
             V Q   M+  VG  +F+IP ASLS+FDTLSV   VPIYDR+IVP ARK+TGHK+ LT LQ
Sbjct  365   VLQGTLMDIRVGHSSFEIPAASLSIFDTLSVTFLVPIYDRIIVPAARKYTGHKNRLTTLQ  424

Query  1539  RMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTF  1718
             RMG+GL I I +MV AAVLE++RL  V+++N Y    +P+SVFWQVPQYF+IG AEVFTF
Sbjct  425   RMGIGLLIFIFSMVCAAVLELIRLRSVRQNNYYTRDHMPMSVFWQVPQYFLIGAAEVFTF  484

Query  1719  IGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNY  1898
             IGQLEFFYDQAPD+MRSLCSALSL+T A+GNY +S LVTIV   T +NG PGW+ NNLNY
Sbjct  485   IGQLEFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVTIVTKTTKKNGNPGWIPNNLNY  544

Query  1899  GHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             GHLDYFFWLLAVLSV+NLGV++ +AK YTYKK +
Sbjct  545   GHLDYFFWLLAVLSVLNLGVYLFIAKWYTYKKTV  578



>ref|XP_006425015.1| hypothetical protein CICLE_v10028095mg [Citrus clementina]
 ref|XP_006488478.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Citrus sinensis]
 ref|XP_006488479.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Citrus sinensis]
 ref|XP_006488480.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Citrus sinensis]
 gb|ESR38255.1| hypothetical protein CICLE_v10028095mg [Citrus clementina]
Length=574

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/572 (71%), Positives = 485/572 (85%), Gaps = 7/572 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE+D+YTKDGTLDY+  PA+K KTGTWKACPFILGNEC ERLAYYGMS+NL+ YF+ +L+
Sbjct  3     EEEDIYTKDGTLDYKGNPADKTKTGTWKACPFILGNECCERLAYYGMSTNLVRYFKHQLD  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             QS+ +ASKN+ +WSGTCYI PL+GAFLADAYLGRYWTIA FSIIYVIGMT +T++A+V G
Sbjct  63    QSSSTASKNVLDWSGTCYITPLIGAFLADAYLGRYWTIAIFSIIYVIGMTFLTVTASVSG  122

Query  672   ISPTCIA---HEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             + P C      E C VT   +   F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KH
Sbjct  123   LKPVCHGPRGEETCQVTDAQSATFFVALYLIALGTGGIKPCVSSYGADQFDDADEAEKKH  182

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASS++VWIQ    WGWGFG+PAVAMA+AV  FFSGTRL+R Q
Sbjct  183   KSSFFNWFYFSINIGALIASSVLVWIQDNEGWGWGFGIPAVAMAIAVVSFFSGTRLFRNQ  242

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QV+ AS+RK KV++P DKSLL+ET+  ESNI GSRKL HT +  FFDKA
Sbjct  243   KPGGSPLTRICQVVAASIRKHKVELPADKSLLYETADAESNITGSRKLDHTKDFSFFDKA  302

Query  1203  AV-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AV ++SD  K+ S +PWRLCTVTQVEELK+I+RLLPIWATGIIFS VY QMS+ FV Q  
Sbjct  303   AVEIQSDNIKE-SVNPWRLCTVTQVEELKAIVRLLPIWATGIIFSAVYSQMSSLFVLQGE  361

Query  1380  GMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              M+T+VG  +FKIP ASLS+FDTLSVI WVPIYDR+IVP+ RKFTGHK+GLT LQRMG+G
Sbjct  362   RMDTHVGNSSFKIPPASLSIFDTLSVIFWVPIYDRIIVPVTRKFTGHKNGLTQLQRMGIG  421

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             LFISIL+M++AAVLE++RL MV+ HN YD+ E+P+S+ WQVPQYF+IGCAEVFTFIGQLE
Sbjct  422   LFISILSMIAAAVLELIRLRMVREHNYYDLPEMPMSIMWQVPQYFLIGCAEVFTFIGQLE  481

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+QAPD+MRSLCSALSLTT A+GNYLSS LVTIV  I+T+NG  GW+ +NLN GHL Y
Sbjct  482   FFYEQAPDAMRSLCSALSLTTVALGNYLSSLLVTIVTSISTKNGNLGWIPDNLNRGHLHY  541

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             FFWLL VLSV+N+G +++V+K YTYK+ +  +
Sbjct  542   FFWLLTVLSVLNMGAYLLVSKWYTYKRPVGSL  573



>ref|XP_008355088.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 8.2-like 
[Malus domestica]
Length=582

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/565 (72%), Positives = 479/565 (85%), Gaps = 2/565 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE++VYTKDGT+D+R  PA +N+TGTWKACPFILGNEC ERLAYYGMSSNL+IYF+T+LN
Sbjct  14    EENNVYTKDGTVDFRGNPAKRNETGTWKACPFILGNECCERLAYYGMSSNLVIYFKTQLN  73

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q++  A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+SA+VPG
Sbjct  74    QTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVVGMTLLTMSASVPG  133

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTC++ + C   G      FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHK S
Sbjct  134   MKPTCVSKDDCHANGGQIAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKKHKGS  193

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV  FFSGT LYR QKPG
Sbjct  194   FFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTXLYRNQKPG  253

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VAS+RK KVKVP DKSLL+ET+  ES+IQGSRKL HTNE RFFDKAAV 
Sbjct  254   GSPVTRIIQVVVASVRKYKVKVPADKSLLYETADAESSIQGSRKLDHTNEFRFFDKAAVE  313

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
               D++ K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+  Y QMS  FV Q   ++ 
Sbjct  314   VQDDHLKDSKSPWRLTTVTQVEELKSIIRLLPIWATGIIFAAAYNQMSNFFVLQGPQVDV  373

Query  1392  YVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              VG  +FKIP ASLSVFDTLSVI WVPIYDR+IVP ARK+TGHK+GLT LQRMG+GLFIS
Sbjct  374   RVGHSSFKIPAASLSVFDTLSVIFWVPIYDRIIVPAARKYTGHKNGLTTLQRMGIGLFIS  433

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV AAVLE++RL  V+++N Y+   +P+SV WQVPQYF+IG AEVFTFIGQLEFFYD
Sbjct  434   IFSMVCAAVLELIRLRSVRQNNYYEYEHMPMSVXWQVPQYFLIGAAEVFTFIGQLEFFYD  493

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSL+T A+GNY +S LV+IV   TT++G PGW+ +NLNYGHLDYFFWL
Sbjct  494   QAPDAMRSLCSALSLSTVALGNYFNSILVSIVTKTTTKDGNPGWIPDNLNYGHLDYFFWL  553

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA+LS +NL V++ ++K YTYKK +
Sbjct  554   LAMLSFLNLVVYLFISKWYTYKKTV  578



>ref|XP_008355414.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=582

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/570 (72%), Positives = 477/570 (84%), Gaps = 2/570 (0%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             ++   EE D YTKDGT+D+R  PA +N TGTWKACPFILGNEC ERLAYYGMSSNL+IYF
Sbjct  9     KAAPPEEKDAYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVIYF  68

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             +T+LNQ++  A+KN SNW GTCY+ PL+GAFLADAYLGRY TIA+FSIIYV GMTL+T+S
Sbjct  69    KTQLNQTSAVAAKNNSNWXGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVXGMTLLTMS  128

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A+VPG+ PTC++ + C   G      FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  129   ASVPGMKPTCVSKDDCHANGGQXAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  188

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             KHK SFFNWFYFSIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV  FFSGT LYR
Sbjct  189   KHKGSFFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTXLYR  248

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET+  ES+IQGSRKL HTNE RFFD
Sbjct  249   NQKPGGSPVTRIIQVVVASVRKYKVKVPADKSLLYETADAESSIQGSRKLDHTNEFRFFD  308

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAAV   D++ K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+  Y QMS  FV Q 
Sbjct  309   KAAVEVQDDHLKDSKSPWRLTTVTQVEELKSIIRLLPIWATGIIFAAAYNQMSNFFVLQG  368

Query  1377  IGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
               M+  VG  +FKIP ASLSVFDTLSVI WVPIYDR+IVP ARK+TGHK+GLT LQRMG+
Sbjct  369   TLMDVRVGHSSFKIPAASLSVFDTLSVIFWVPIYDRIIVPAARKYTGHKNGLTTLQRMGI  428

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GLFISI +MV AAVLE++RL  V+++N Y+   +P+SVFWQVPQYF+IG AEVFTFIGQL
Sbjct  429   GLFISIFSMVCAAVLELIRLRSVRQNNYYEYEHMPMSVFWQVPQYFLIGAAEVFTFIGQL  488

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRSLCSALSL+T A+GNY +S LV+IV   TT++G PGW+ +NLNYGHLD
Sbjct  489   EFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVSIVTKTTTKDGNPGWIPDNLNYGHLD  548

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             YFFWLLA+LS +NL V++ ++K YTYKK +
Sbjct  549   YFFWLLAMLSFLNLVVYLFISKWYTYKKTV  578



>ref|XP_009374282.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009374283.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
Length=582

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/570 (71%), Positives = 476/570 (84%), Gaps = 2/570 (0%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             ++   EE DVYTKDGT+D+R +PA +N TGTWKACPFILGNEC ERLAYYGMSSN +IYF
Sbjct  9     KAAPPEEKDVYTKDGTVDFRGKPAKRNATGTWKACPFILGNECCERLAYYGMSSNRVIYF  68

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             +T+LNQ++  A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIY IGMTL+T+S
Sbjct  69    KTQLNQTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYFIGMTLLTMS  128

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A+VPG+ PTC++ + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  129   ASVPGMKPTCVSKDDCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  188

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             KHK+SFFNWFYFSIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV  FFSGTRLYR
Sbjct  189   KHKASFFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTRLYR  248

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET+  ES+IQGSRKL HTNE RFFD
Sbjct  249   NQKPGGSPVTRIIQVVVASVRKYKVKVPEDKSLLYETADAESSIQGSRKLDHTNEFRFFD  308

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAAV   D+  K S SPWRL TVTQVEELKSIIRLLPIWA GIIF+    QMS  FV Q 
Sbjct  309   KAAVEVQDDNIKDSKSPWRLTTVTQVEELKSIIRLLPIWAAGIIFAAACNQMSNFFVLQG  368

Query  1377  IGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
               M+  VG  +FKIP ASL VFDTLSVI WVPIYDR+IVP ARK TGHK+GLT LQRMG+
Sbjct  369   TLMDVRVGHSSFKIPAASLIVFDTLSVIFWVPIYDRIIVPAARKHTGHKNGLTTLQRMGI  428

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GLFISI +MV A VLE++RL  V+++N Y+   +P+SVFWQVPQYF+IG AEVFT IGQL
Sbjct  429   GLFISIFSMVCATVLELIRLRSVRQNNYYEYEHMPMSVFWQVPQYFLIGAAEVFTCIGQL  488

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRSLCSALSL+T A+GNY +S LV+IV   TT++G PGW+ +NLNYGHLD
Sbjct  489   EFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVSIVTKTTTKDGNPGWIPDNLNYGHLD  548

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             YFFWLLA+LSV+NL V++ ++K YTYKK +
Sbjct  549   YFFWLLAMLSVLNLVVYLFISKWYTYKKTV  578



>ref|XP_007208292.1| hypothetical protein PRUPE_ppa003364mg [Prunus persica]
 gb|EMJ09491.1| hypothetical protein PRUPE_ppa003364mg [Prunus persica]
Length=581

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/577 (71%), Positives = 483/577 (84%), Gaps = 3/577 (1%)
 Frame = +3

Query  279   VAD*QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSS  458
             +A+  + ++A   +DVYTKDGT+D+   PA +N TGTWKACPFILGNEC ERLAYYGMSS
Sbjct  1     MAEDDVPTKAAAAEDVYTKDGTVDFHGNPAKRNATGTWKACPFILGNECCERLAYYGMSS  60

Query  459   NLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGM  638
             NL++YF+T+L+Q++  A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYVIGM
Sbjct  61    NLVLYFKTQLHQTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGM  120

Query  639   TLMTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDD  818
             TL+T+SA+VPG+ PTC   + C   G  T   FIALYL+ALGTGGIKPCVSSYGADQFDD
Sbjct  121   TLLTMSASVPGLKPTCSGKDNCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDD  180

Query  819   TDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFS  998
              DE E+KHK SFFNWFYFSIN+GAL+ASS++VWIQ+ V WGWGFGVPAVAMA+AV  FFS
Sbjct  181   DDEVEKKHKGSFFNWFYFSINVGALIASSVLVWIQENVGWGWGFGVPAVAMAIAVVSFFS  240

Query  999   GTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLE-SNIQGSRKLSHT  1175
             G+RLYR QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET+  E S+IQGSRKL HT
Sbjct  241   GSRLYRNQKPGGSPLTRIIQVLVASVRKYKVKVPEDKSLLYETADAESSSIQGSRKLDHT  300

Query  1176  NELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMS  1355
             NE RFFDKAAV    ++ K S  PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QMS
Sbjct  301   NEFRFFDKAAVEVQSDHIKDSKDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYNQMS  360

Query  1356  TQFVSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLT  1529
               FV Q   M+  VG  +F+IP ASLS+FDTLSVI WVPIYDR++VP+ARK+TGHK+GLT
Sbjct  361   NFFVLQGNLMDIRVGHSSFEIPAASLSIFDTLSVIFWVPIYDRVLVPVARKYTGHKNGLT  420

Query  1530  HLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEV  1709
              LQRMG+GLFISI +M+ AAVLE++RL  V+ HN Y+   +P+SVFWQVPQYF+IG AEV
Sbjct  421   TLQRMGIGLFISIFSMICAAVLELIRLRSVREHNYYEYEHMPMSVFWQVPQYFLIGAAEV  480

Query  1710  FTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANN  1889
             FTFIGQ EFFYDQAPD+MRSLCSAL+L+T A+GNY +S LVTIV   TT+N  PGW+ NN
Sbjct  481   FTFIGQSEFFYDQAPDAMRSLCSALALSTVALGNYFNSILVTIVTKTTTKNKNPGWIPNN  540

Query  1890  LNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LNYGHLDYFFWLLAVLSV+NLG +++++K YTYKK +
Sbjct  541   LNYGHLDYFFWLLAVLSVLNLGAYLLISKWYTYKKTV  577



>gb|KDP24486.1| hypothetical protein JCGZ_25050 [Jatropha curcas]
Length=568

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/564 (70%), Positives = 474/564 (84%), Gaps = 2/564 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD++TKDGT++ + +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDLFTKDGTVNIKGKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLADAYLGRYWTIA+F IIY++GM L+T SA++P
Sbjct  61    NQGNVAASNNVTNWSGTCYITPLIGAFLADAYLGRYWTIASFVIIYILGMALLTFSASLP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  TG  + VCF+ALYL+ALGTGGIKPCVSS+GADQFD+TD+ E++ KS
Sbjct  121   GLKPSC-DKDSCHPTGTQSAVCFVALYLIALGTGGIKPCVSSFGADQFDETDDIEKEKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYF+INIGALVASS++VWIQ  V WGWGFG+P VAMA+AV FFFSG++LYR QKP
Sbjct  180   SFFNWFYFTINIGALVASSVLVWIQMNVGWGWGFGIPTVAMAIAVVFFFSGSKLYRIQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVAS RK  VKVP+DKSLL+ET+  ES+IQGSRKL HT++L+FFDKAAV
Sbjct  240   GGSPLTRIFQVIVASFRKLHVKVPVDKSLLYETTDEESHIQGSRKLEHTDKLKFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K +  PWRLCTVTQVEELK+IIRLLP+WA+GI+FSTVY QMST FV Q   M+
Sbjct  300   ETQSDSLKSTPDPWRLCTVTQVEELKAIIRLLPVWASGIVFSTVYSQMSTMFVLQGNTMD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSVI W P+YDR IVP ARKFTG++ G T LQRMG+GL IS
Sbjct  360   QHMGPKFKIPSASLSLFDTLSVIFWAPVYDRFIVPYARKFTGNERGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A VLE++RL  V+ HN YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  420   IFAMIVAGVLEVIRLQYVQTHNYYDLEYIPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  +T R+GK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLCSALSLTTVAVGNYLSTLLVTIVTKVTARHGKLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA+LSV+N  V++ +AK YTYKKA
Sbjct  540   LAILSVLNFFVYLWIAKWYTYKKA  563



>ref|XP_010262765.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262766.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262768.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262769.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262770.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
Length=568

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/565 (70%), Positives = 479/565 (85%), Gaps = 2/565 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT D+RN+PA K +TGTWKACP+ILGNEC ERLAYYGMS+NL+ Y + +L
Sbjct  1     MAEEDIYTKDGTTDFRNKPAIKKETGTWKACPYILGNECCERLAYYGMSTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  + A+ N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+FSIIYV GMTL+TLSA+V 
Sbjct  61    HQHNVVAANNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFSIIYVCGMTLLTLSASVR  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C   + C  T   + VCF+ALYLVALGTGGIKPCVSS+GADQFDDTDE E+K+KS
Sbjct  121   GLKPNC-EKDVCHPTEAQSAVCFVALYLVALGTGGIKPCVSSFGADQFDDTDEVEKKYKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+A+S++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  180   SFFNWFYFSINIGALLAASVLVWIQTNVGWGWGFGIPAVAMAIAVMSFFSGTRLYRNQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR  QV+VAS RK +VKVP DKSLL+ET+ +ES ++GSRKL +T +  F DKAAV
Sbjct  240   GGSPLTRFCQVVVASFRKFQVKVPSDKSLLYETADVESVVKGSRKLDYTEQFSFLDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ KG  +PWRLCTVTQVEELK+IIRLLPIWATGI+FSTVY QM T FV Q   M+
Sbjct  300   QTETDHIKGFANPWRLCTVTQVEELKAIIRLLPIWATGIMFSTVYSQMGTLFVLQGNTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDT+SVI WVPIYDR+IVP ARKFTGHK+G T LQRMG+GL IS
Sbjct  360   LHMGPHFQIPSASLSIFDTISVIFWVPIYDRIIVPYARKFTGHKNGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+SA +LE+VRL MV+RHN YD+  VP+S+FWQVPQYF++GCAEVFTFIGQLEFFY+
Sbjct  420   IFAMLSAGILELVRLRMVRRHNYYDLDHVPMSIFWQVPQYFLVGCAEVFTFIGQLEFFYE  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD++RSL SA+SLTT A+GNYLS+ LVTIV D+TTR+GK GW+ +NLN GHL YFFWL
Sbjct  480   QAPDALRSLSSAISLTTVALGNYLSTLLVTIVTDVTTRHGKLGWIPDNLNKGHLHYFFWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA+LSV+NLG +++VA+ +TYK+A+
Sbjct  540   LAILSVLNLGAYLLVARWFTYKRAV  564



>ref|XP_006429306.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 ref|XP_006429307.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 ref|XP_006480967.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Citrus sinensis]
 ref|XP_006480968.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Citrus sinensis]
 ref|XP_006480969.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Citrus sinensis]
 gb|ESR42546.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 gb|ESR42547.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
Length=568

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/569 (69%), Positives = 474/569 (83%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+D   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q +L
Sbjct  1     MAEEDIYTKDGTVDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQKQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLAD+Y+GR+WTIA+FSIIY +GMTL+TL+A+V 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADSYMGRFWTIASFSIIYCLGMTLLTLTASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  TG  T V F+ALYL+ALGTGGIKPCVSS+GADQFD+TD+ ER+ KS
Sbjct  121   GLKPSC-DKDACHPTGAQTAVTFVALYLIALGTGGIKPCVSSFGADQFDETDDGEREKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGALVASS++VWIQ  V WGWGFG+PAVAMA+AV FFFSG+RLYR QKP
Sbjct  180   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGIPAVAMAIAVVFFFSGSRLYRIQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK  V VP DKSLL+ET+  E NIQGSRKL  T++ +FFDKAAV
Sbjct  240   GGSPLTRIMQVIVASFRKSNVVVPADKSLLYETADEECNIQGSRKLESTSKFKFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS  PWRLCTVTQVEELK+IIRLLP+WA+GI+F+TVY QMST FV Q   M+
Sbjct  300   ETQTDRVKGSADPWRLCTVTQVEELKAIIRLLPVWASGIVFATVYSQMSTMFVLQGNTMD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSVI W P+YD +IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  360   QHMGPNFKIPSASLSLFDTLSVIFWAPVYDIVIVPFARKFTGHERGFTQLQRMGIGLLIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV+A +LE+VRL +VKR+N YD+  +P+++FWQVPQYFI+GCAEVFTFIGQLEFFYD
Sbjct  420   IFSMVAAGILEVVRLNIVKRNNYYDLETIPMTIFWQVPQYFIVGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  +TTRNGK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLCSALSLTTVAVGNYLSTLLVTIVTKVTTRNGKLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             LA+LSV+N  V++ +AK +TYKKA  + +
Sbjct  540   LAILSVLNFLVYLWIAKWFTYKKATGRAN  568



>ref|XP_010650937.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X2 [Vitis 
vinifera]
 emb|CBI16003.3| unnamed protein product [Vitis vinifera]
Length=569

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/568 (69%), Positives = 473/568 (83%), Gaps = 1/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D YTKDGT++Y+  PANK KTGTW ACP+ILGNE  ERLAYYGMSSNL++YF+ +L
Sbjct  1     MAEEDNYTKDGTINYQGNPANKKKTGTWTACPYILGNEFCERLAYYGMSSNLVLYFKYKL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q + +ASKN+ NWSGTCY+ P +GAFLADAYLGRYWTIA+FSIIYVIGMTL+T++A+VP
Sbjct  61    HQDSATASKNVLNWSGTCYLTPFIGAFLADAYLGRYWTIASFSIIYVIGMTLLTVTASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  T   T VCF+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+ HKS
Sbjct  121   GLKPNCSPSGVCDPTETQTAVCFLALYLVALGTGGIKPCVSSYGADQFDDTDEHEKTHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+A S++VWIQ+ + WG GFG+PA AMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINVGALIAGSILVWIQENIGWGVGFGIPAAAMAIAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VASL+K +V+VP DKSLL+E +  ES IQGSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRMSQVVVASLKKYRVQVPADKSLLYEIADGESGIQGSRKLDHTKDLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K S  PW++CTVTQVEELK+IIRLLP+WATGIIFS VY QM + FV Q   M+
Sbjct  301   EIQSDHIKDSPDPWKICTVTQVEELKAIIRLLPVWATGIIFSAVYSQMGSLFVVQGESMD  360

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDT+SVI WVPIYDR+IVP+ARKFTGH +G+T LQRMG+GLFIS
Sbjct  361   PHMGRHFEIPSASLSIFDTISVIFWVPIYDRIIVPVARKFTGHSNGITQLQRMGIGLFIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+SA +LE+VRL +VKRHN YD   +P+S+F+QVPQYFIIGCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLSAGILEVVRLGIVKRHNYYDHDRIPLSIFYQVPQYFIIGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRS CSALSL T A+GNYLSS LVTIV D++TR GK GW+ +NLN GHL YFF+L
Sbjct  481   QAPDAMRSFCSALSLATVALGNYLSSLLVTIVTDVSTRGGKLGWIPDNLNRGHLHYFFFL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LA+LSV+NL  F+ VAK YTYK+A+  +
Sbjct  541   LAILSVLNLVAFLFVAKWYTYKRAVGTL  568



>gb|KHG14016.1| Peptide transporter PTR1 -like protein [Gossypium arboreum]
Length=552

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/567 (71%), Positives = 460/567 (81%), Gaps = 22/567 (4%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E D YTKDGT+D++  PAN  KTGTWKACPFI+GNEC ERLAYYGMSSNL+ YF+ RL
Sbjct  1     MAESDFYTKDGTVDHKGNPANIKKTGTWKACPFIIGNECCERLAYYGMSSNLVRYFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ    A++N  NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ +SATV 
Sbjct  61    NQHASVATRNNQNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVFGMTLLAMSATVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P C   + C  T   + V F+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+KHKS
Sbjct  121   GIKPRCYTEDNCDPTVTQSAVFFVALYLVALGTGGIKPCVSSYGADQFDDTDETEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VW+Q  VSWGW                  GTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVSWGW------------------GTRLYRNQKP  222

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VAS RK +V +P DKSLL+ET+  ESNI+GSRK+ HT +L FFD+AAV
Sbjct  223   GGSPLTRLCQVVVASFRKCRVAIPADKSLLYETTDAESNIKGSRKVEHTEDLSFFDRAAV  282

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               ESDE KKG+ + WRLCTVTQVEELK++IRLLPIWATGIIF+ VY QMS  FV Q   M
Sbjct  283   ETESDE-KKGTVNSWRLCTVTQVEELKAVIRLLPIWATGIIFAAVYSQMSNLFVLQGERM  341

Query  1386  NTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             NT+VG  TFKIP ASLS+FDTLSVI WVPIYDR+IVP+ RKFTGHK+GLT LQRMG+GLF
Sbjct  342   NTHVGNSTFKIPPASLSIFDTLSVIFWVPIYDRIIVPVTRKFTGHKNGLTQLQRMGIGLF  401

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI AMV AA+LE+ RL  V+RHN Y+V E+P+++FWQVPQYF+IGCAEVFT IGQLEFF
Sbjct  402   ISIFAMVVAAILELERLREVRRHNYYEVKEMPMTIFWQVPQYFLIGCAEVFTLIGQLEFF  461

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPD+MRS CSAL LTT A+GNYLSS LVTIV  ITTRN K GW+ +NLNYGH+ YFF
Sbjct  462   YEQAPDAMRSFCSALQLTTIALGNYLSSLLVTIVTAITTRNDKLGWIPDNLNYGHIHYFF  521

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
              LLAVLSV+NLG F+++AK YTYKKA+
Sbjct  522   LLLAVLSVLNLGAFLLIAKWYTYKKAV  548



>ref|XP_010650936.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X1 [Vitis 
vinifera]
Length=582

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/565 (70%), Positives = 472/565 (84%), Gaps = 1/565 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D YTKDGT++Y+  PANK KTGTW ACP+ILGNE  ERLAYYGMSSNL++YF+ +L
Sbjct  14    MAEEDNYTKDGTINYQGNPANKKKTGTWTACPYILGNEFCERLAYYGMSSNLVLYFKYKL  73

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q + +ASKN+ NWSGTCY+ P +GAFLADAYLGRYWTIA+FSIIYVIGMTL+T++A+VP
Sbjct  74    HQDSATASKNVLNWSGTCYLTPFIGAFLADAYLGRYWTIASFSIIYVIGMTLLTVTASVP  133

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  T   T VCF+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+ HKS
Sbjct  134   GLKPNCSPSGVCDPTETQTAVCFLALYLVALGTGGIKPCVSSYGADQFDDTDEHEKTHKS  193

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+A S++VWIQ+ + WG GFG+PA AMA+AV  FFSGTRLYR QKP
Sbjct  194   SFFNWFYLSINVGALIAGSILVWIQENIGWGVGFGIPAAAMAIAVVSFFSGTRLYRNQKP  253

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VASL+K +V+VP DKSLL+E +  ES IQGSRKL HT +L FFDKAAV
Sbjct  254   GGSPLTRMSQVVVASLKKYRVQVPADKSLLYEIADGESGIQGSRKLDHTKDLSFFDKAAV  313

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K S  PW++CTVTQVEELK+IIRLLP+WATGIIFS VY QM + FV Q   M+
Sbjct  314   EIQSDHIKDSPDPWKICTVTQVEELKAIIRLLPVWATGIIFSAVYSQMGSLFVVQGESMD  373

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDT+SVI WVPIYDR+IVP+ARKFTGH +G+T LQRMG+GLFIS
Sbjct  374   PHMGRHFEIPSASLSIFDTISVIFWVPIYDRIIVPVARKFTGHSNGITQLQRMGIGLFIS  433

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+SA +LE+VRL +VKRHN YD   +P+S+F+QVPQYFIIGCAEVFTFIGQLEFFY+
Sbjct  434   IFAMLSAGILEVVRLGIVKRHNYYDHDRIPLSIFYQVPQYFIIGCAEVFTFIGQLEFFYE  493

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRS CSALSL T A+GNYLSS LVTIV D++TR GK GW+ +NLN GHL YFF+L
Sbjct  494   QAPDAMRSFCSALSLATVALGNYLSSLLVTIVTDVSTRGGKLGWIPDNLNRGHLHYFFFL  553

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA+LSV+NL  F+ VAK YTYK+A+
Sbjct  554   LAILSVLNLVAFLFVAKWYTYKRAV  578



>ref|XP_007026785.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
 ref|XP_007026786.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY07287.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY07288.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
Length=568

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/567 (69%), Positives = 477/567 (84%), Gaps = 2/567 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YT DGT+D    PANK+KTG WKAC FILGNEC ERLAYYGM +NL+ Y + RL
Sbjct  1     MGEDDIYTNDGTVDIHKNPANKSKTGNWKACRFILGNECCERLAYYGMGTNLVNYLEQRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMTL+TLSA+V 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADAYLGRYWTIAGFSIIYVLGMTLLTLSASVT  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  T   + V F+ALY++ALGTGGIKPCVSS+GADQFD+TD+ ERK KS
Sbjct  121   GLKPSC-NGDVCHPTASQSAVFFVALYMIALGTGGIKPCVSSFGADQFDETDDIERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V WGWGFG+PA AMA+AV FFFSG+R+YR Q+P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQMNVGWGWGFGIPAAAMAIAVVFFFSGSRMYRLQRP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIV+S RK  VKVP D+SLL+ET+  E +IQGSRKL HT++L+FFDKAAV
Sbjct  240   GGSPLTRIFQVIVSSFRKLNVKVPADESLLYETADQECSIQGSRKLEHTDKLKFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +Y KGS +PWRLCTVT+VEELKSIIRLLPIWA+GI+F+TVY QMST FV Q   M+
Sbjct  300   ETQTDYVKGSVNPWRLCTVTEVEELKSIIRLLPIWASGIVFATVYSQMSTMFVLQGNTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSVI W P+YDR+IVP ARKFTG + G T LQRMG+GL IS
Sbjct  360   QHMGPHFKIPSASLSLFDTLSVIFWAPVYDRIIVPWARKFTGKERGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV+A +LE+VRL +V+++N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  420   IFSMVTAGILEVVRLKIVRKNNYYDLEYIPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRS+CSALSLTT A+GNYLS+ LVTIV+ +TTR+GK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSMCSALSLTTVALGNYLSTLLVTIVSKVTTRDGKLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LA+LS++N  V++ +A+ YTYKKA  +
Sbjct  540   LAILSLVNFLVYLWIARWYTYKKATGR  566



>gb|EPS59528.1| hypothetical protein M569_15276, partial [Genlisea aurea]
Length=571

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/569 (69%), Positives = 471/569 (83%), Gaps = 4/569 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT+D+   PA KN+TG+WKACPFILGNEC+ERLAYYGMSSNL+IYF+ RL
Sbjct  1     MAEDDLYTKDGTVDFHGNPAKKNETGSWKACPFILGNECAERLAYYGMSSNLVIYFKERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
              + + +AS ++SNWSGTCY+ PL+GAF+ADAYLGRYWTIATFS+IY  GMTL+TLSA++P
Sbjct  61    GKHSSAASNSVSNWSGTCYLTPLIGAFIADAYLGRYWTIATFSMIYAFGMTLLTLSASIP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI PTC + + C   G  + V F+ALYLVALGTGGIKPCVSS+GADQFDDTDE ++K KS
Sbjct  121   GIKPTCESKDSCHANGAQSAVFFVALYLVALGTGGIKPCVSSFGADQFDDTDEADKKRKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VW+Q  V W WGFG+PAV M +AV  FF GTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQTNVGWQWGFGIPAVTMLVAVVSFFCGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETS-GLESNIQGSRKLSHTNELRFFDKAA  1205
             GGSP TR+ QV+VAS RK K++VP D  LL+ET+   ES I+GSRKL HT +L FFDKAA
Sbjct  241   GGSPLTRICQVVVASFRKYKIEVPEDGKLLYETADDTESAIKGSRKLEHTGDLSFFDKAA  300

Query  1206  VV-ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             VV   DE K  S  PWRLCTVTQVEELK+++RLLPIWATGI+F+TVYGQM T FV Q   
Sbjct  301   VVAHGDEVKSPSNDPWRLCTVTQVEELKAVVRLLPIWATGIVFATVYGQMGTLFVLQGAT  360

Query  1383  MNTYVGT--FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+  +G   F IP ASL++FDTLSVI WVP+YDR++VP AR+FTG ++GLT LQRMG GL
Sbjct  361   MDARMGNSGFTIPAASLTIFDTLSVIFWVPVYDRIVVPAARRFTGRRNGLTQLQRMGTGL  420

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FISI AM SA +LE+VRL  V RH  YD  +VP+S+FWQ+PQYFIIGCAEVF FIGQLEF
Sbjct  421   FISIFAMASAGILELVRLKYVARHGYYDRKQVPMSIFWQIPQYFIIGCAEVFMFIGQLEF  480

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPD+MRSLCSAL LTT A+GNYLS+ LVT+V D+T RNGKPGW+ +NLNYGH+DYF
Sbjct  481   FYEQAPDAMRSLCSALQLTTVALGNYLSTLLVTVVTDVTARNGKPGWIPDNLNYGHVDYF  540

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAIN  2003
             F++LAVLSV+NLG F+VVA  YTYKK + 
Sbjct  541   FYMLAVLSVLNLGAFLVVANWYTYKKPVG  569



>gb|AFN53657.1| putative peptide transporter [Linum usitatissimum]
Length=571

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/567 (69%), Positives = 468/567 (83%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E++  TKDGTLD++  PA+K  TGTWKACPFI+GNEC ERLAYYGMSSNL++YF+ +L
Sbjct  1     MSEEEFLTKDGTLDHKGNPADKRITGTWKACPFIIGNECCERLAYYGMSSNLVLYFKNQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS+ +A+KN S+WSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ +SA+VP
Sbjct  61    NQSSATATKNNSDWSGTCYLTPLLGAFLADAYLGRYWTIAGFSIIYVFGMTLLAMSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTCI+ + C  T   + V F+ALY++ALGTGGIKPCVSSYGADQFDD D +E++HK+
Sbjct  121   GLKPTCISKDNCHATEGQSAVFFVALYMIALGTGGIKPCVSSYGADQFDDADVEEKEHKA  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GALVASSL+VW+Q+ VSWG GFG+PA+AMA+AV  FFSGTR YRYQ P
Sbjct  181   SFFNWFYFSINVGALVASSLLVWVQENVSWGLGFGIPAIAMAIAVASFFSGTRKYRYQTP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK KV  P DKSLL+E++  ES I GSRKL HT +  F DKAAV
Sbjct  241   GGSPLTRICQVIVASCRKYKVSPPNDKSLLYESADSESGITGSRKLDHTKDFSFLDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               E D  K  S +PWRLCTVTQ+EE K+IIRLLPIWATGI+F+ VY QMS  FV Q   M
Sbjct  301   ETEKDHIKDTSVNPWRLCTVTQIEEFKAIIRLLPIWATGIVFAAVYSQMSNLFVLQGDTM  360

Query  1386  NTYVGT--FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             +  VG   FKI  A++SVFDT+SVI WVPIYDRLIVP  RK TGHK+G T LQRMG+GL 
Sbjct  361   DKRVGNSKFKISAANVSVFDTISVIFWVPIYDRLIVPAVRKITGHKNGFTQLQRMGIGLV  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI AMV  A+LE++RL MV+ HN Y++  VPIS+FWQVPQYF+IGCAEVFTFIGQLEFF
Sbjct  421   ISIFAMVYPAILELIRLKMVREHNYYELESVPISIFWQVPQYFLIGCAEVFTFIGQLEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPD+MRSLCSALSLTT A+GNYLSS LVTIV  +TT+ GKPGW+ +NLNYGH+DYFF
Sbjct  481   YEQAPDAMRSLCSALSLTTVALGNYLSSLLVTIVTGVTTKGGKPGWIPDNLNYGHVDYFF  540

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             WLLAVLSV+NL  ++V+A  YTYKK +
Sbjct  541   WLLAVLSVVNLMAYMVIASWYTYKKPV  567



>gb|KDO53228.1| hypothetical protein CISIN_1g0083672mg [Citrus sinensis]
 gb|KDO53229.1| hypothetical protein CISIN_1g0083672mg [Citrus sinensis]
Length=568

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/569 (69%), Positives = 472/569 (83%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+D   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q +L
Sbjct  1     MAEEDIYTKDGTVDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQKQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLAD+Y+GR+WTIA+FSIIY +GMTL+TL+A+V 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADSYMGRFWTIASFSIIYCLGMTLLTLTASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  TG  T V F+ALYL+ALGTGGIKPCVSS+GADQFD+TD+ ER+ KS
Sbjct  121   GLKPSC-DKDACHPTGAQTAVTFVALYLIALGTGGIKPCVSSFGADQFDETDDGEREKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGALVASS++VWIQ  V WGWGFG+PAVAMA+AV FFFSG+RLYR QKP
Sbjct  180   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGIPAVAMAIAVVFFFSGSRLYRIQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK  V VP DKSLL+ET+  E NIQGSRKL  T++ +FFDKAAV
Sbjct  240   GGSPLTRIMQVIVASFRKSNVVVPADKSLLYETADEECNIQGSRKLESTSKFKFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS  PWRLCTVTQVEELK+IIRLLP+WA+GI+F+TVY QMST FV Q   M+
Sbjct  300   ETQTDRVKGSADPWRLCTVTQVEELKAIIRLLPVWASGIVFATVYSQMSTMFVLQGNTMD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSVI W PIYD +IVP ARK TGH+ G T LQRMG+GL IS
Sbjct  360   QHMGPNFKIPSASLSLFDTLSVIFWAPIYDIVIVPFARKLTGHERGFTQLQRMGIGLLIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV+A +LE+VRL +VKR+N YD+  +P+++FWQVPQYFI+GCAEVFTFIGQLEFFYD
Sbjct  420   IFSMVAAGILEVVRLNIVKRNNYYDIETIPMTIFWQVPQYFIVGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  +TT+NGK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLCSALSLTTVAVGNYLSTLLVTIVTKVTTKNGKLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             L +LSV+N  V++ +AK +TYKKA  + +
Sbjct  540   LTILSVLNFLVYLWIAKWFTYKKATGRAN  568



>ref|XP_004143145.1| PREDICTED: peptide transporter PTR1-like [Cucumis sativus]
Length=570

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/568 (69%), Positives = 479/568 (84%), Gaps = 3/568 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EED +YT+DGT+DYR  PA + +TGTW+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  3     EEDSIYTQDGTVDYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKDHLN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q + +ASKN++NW GTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  63    QHSATASKNVNNWIGTCYITPLIGAFLADAYLGRYRTIAAFSILYVFGMTLLTLSASVPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTC++ + C  T   + +CF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSS
Sbjct  123   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFY SIN+G L+ASS++VW+Q+ VSWGWGFG+PA+AMA+AV  FFSGTRLYR QKPG
Sbjct  183   FFNWFYLSINVGGLIASSVLVWVQENVSWGWGFGIPAIAMAIAVVSFFSGTRLYRNQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-  1208
             GSPFTR+ QVIVAS RK KVKVP  K+ L+ET+  ES+I GSRKL HT++ RFFDKAAV 
Sbjct  243   GSPFTRICQVIVASFRKYKVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  301

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +ESD+  KGS   W+LCTVTQVEELK+IIRLLP+WATGI F+ VY Q+ST FV Q   M+
Sbjct  302   LESDQMLKGSVDRWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQISTLFVLQGDRMD  361

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI WVP+YDR+IVP+ARK+TGH +G+T LQRMG+GLFIS
Sbjct  362   PHIGPNFEIPAASLSIFDTLSVIFWVPVYDRIIVPVARKYTGHSNGITQLQRMGIGLFIS  421

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             ILAM+SAA+LE+VRL  V+RHN Y++  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY+
Sbjct  422   ILAMLSAAILELVRLQDVRRHNYYELKHMPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYE  481

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL SALSLTT A+GNYLSS LVTIV   +T+ G+ GW+ +NLNYGH+ YFF+L
Sbjct  482   QAPDAMRSLGSALSLTTVALGNYLSSLLVTIVNKASTKGGRLGWIPDNLNYGHVHYFFFL  541

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LA+LS+ NL  F V+AK Y YK+ I  +
Sbjct  542   LAILSIKNLIAFFVIAKWYKYKRPIGTL  569



>ref|XP_009624728.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana tomentosiformis]
Length=569

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/569 (69%), Positives = 469/569 (82%), Gaps = 1/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD Y KDGT+DYRN PA K +TGTW+ACP+ILGNEC ERLAYYG+++NL+ Y + ++
Sbjct  1     MAEDDKYVKDGTVDYRNNPAIKKETGTWRACPYILGNECCERLAYYGINTNLVNYLKFQM  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N+S++ A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMT++TLSA+V 
Sbjct  61    NESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTVLTLSASVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C  +  C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  121   GLKPPCDDNNTCHPKGIQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDEIEKKKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVAS+++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAVAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVAS RK KVK+P D SLL+ET+  ES +QGSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVASFRKFKVKIPRDTSLLYETADEESAVQGSRKLDHTEQLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS +PW LCTVTQVEELKSIIRLLPIWATGIIFS+VY QM T FV Q   M+
Sbjct  301   ETQSDKIKGSVNPWSLCTVTQVEELKSIIRLLPIWATGIIFSSVYSQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++  +F+IP ASLS+FDT+SVI WVP+YDR+IV +ARKFTGHK+G T LQR+ +GL IS
Sbjct  361   LHMTNSFQIPSASLSLFDTISVIFWVPVYDRVIVALARKFTGHKNGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A  LEMVRL  V+ HN Y++  +P+S+FWQVPQYF++GCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLIAGTLEMVRLRTVREHNYYEMKHIPMSIFWQVPQYFVVGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSL T A+GNYLS+FLV IV D++TRNG PGW+ +NLNYGHL YFFWL
Sbjct  481   QAPDAMRSLCSALSLITTALGNYLSTFLVNIVTDMSTRNGGPGWIPDNLNYGHLHYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             LAVLSV+N G F+ VAK YTYKKAI   S
Sbjct  541   LAVLSVLNFGFFLFVAKFYTYKKAIGPTS  569



>ref|XP_010654188.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
 ref|XP_010654189.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
 ref|XP_010654190.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
 ref|XP_010654191.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
Length=569

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/563 (70%), Positives = 463/563 (82%), Gaps = 1/563 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+D+R+ PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MAEEDIYTKDGTIDFRSNPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  + A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA+  
Sbjct  61    NQRNVVAINNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAGFSIIYVFGMTLLTLSASAH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  TG  T V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE ERK KS
Sbjct  121   GLKPLCDGQNVCYPTGLQTAVFFVGLYLIALGTGGIKPCVSSFGADQFDDSDETERKSKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VW+Q  V WGWGFG+PAVAM +AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALLASSVLVWVQTNVGWGWGFGIPAVAMGIAVMSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVASLRK +V+VP DK LL+ET+  ES + GSRKL HT  L FFDKAAV
Sbjct  241   GGSPLTRICQVIVASLRKFQVEVPADKCLLYETADSESAVTGSRKLDHTKHLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS   WRLCTVTQVEELKSIIRLLPIWATGI+FS VY QM T FV Q   M+
Sbjct  301   ETHIDAIKGSVDSWRLCTVTQVEELKSIIRLLPIWATGIVFSAVYSQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++ G+F+IP ASLS+FDT+SVI WVPIYDRLIVP ARKFTGHKSG T LQR+ +GL IS
Sbjct  361   LHITGSFQIPSASLSLFDTISVIFWVPIYDRLIVPFARKFTGHKSGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A  LE++RL MV+ HN Y++  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLVAGTLELLRLRMVREHNYYELKHIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LV +V D++TR GKPGW+ +NLNYGHL YFFWL
Sbjct  481   QAPDAMRSLCSALSLTTAALGNYLSTLLVNVVTDVSTRGGKPGWIPDNLNYGHLHYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKK  1994
             LA LSV NLGV++ VA+ YTYK+
Sbjct  541   LAALSVFNLGVYLQVARWYTYKR  563



>ref|XP_010044085.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Eucalyptus grandis]
 ref|XP_010044086.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Eucalyptus grandis]
 gb|KCW86092.1| hypothetical protein EUGRSUZ_B02793 [Eucalyptus grandis]
Length=571

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/566 (68%), Positives = 471/566 (83%), Gaps = 2/566 (0%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             + M E+D+YTKDGT+  R  PA++ KTG WKAC FILGNEC ERLAYYGM +NL+ Y   
Sbjct  2     DIMAEEDIYTKDGTVTIRGDPADRTKTGNWKACRFILGNECCERLAYYGMGTNLVNYIHE  61

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RL+QS ++AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA FS++YV+GMTL+T+SA+
Sbjct  62    RLHQSNVAASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIAIFSMVYVLGMTLLTISAS  121

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ P+C  + +C      T  CF+ALYL+ALGTGGIKPCVSS+GADQFD+TDE ERK 
Sbjct  122   VPGLKPSC-ENGECHPKTSQTAACFVALYLIALGTGGIKPCVSSFGADQFDETDEPERKK  180

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFY SINIGAL+ASS++VWIQ  V WGWGFG+PAVAMA+A+ FFFSG+RLYR Q
Sbjct  181   KSSFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAIVFFFSGSRLYRIQ  240

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QVIVAS RK KV+VP DK+ LHET+  E  IQGSRKL HT+EL+FFDKA
Sbjct  241   KPGGSPLTRIAQVIVASFRKMKVEVPADKTHLHETADAECTIQGSRKLEHTDELQFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV    +  KG+  PWRLCTVTQVEELKSIIRLLP+WA+GI+F+TVY QMST FV Q   
Sbjct  301   AVEIPTDNIKGNTDPWRLCTVTQVEELKSIIRLLPVWASGIVFATVYSQMSTMFVLQGNT  360

Query  1383  MNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             ++ ++G  FKIP ASLS+FDTLSVI W P+YDR+IVP ARKFTG + G T LQRMG+GL 
Sbjct  361   LDQHMGPHFKIPSASLSLFDTLSVIFWAPVYDRVIVPYARKFTGRERGFTQLQRMGIGLV  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI +M+ A +LE++RL +V+R+N YD+  +P S+FWQVPQYF++GCAEVFTFIGQLEFF
Sbjct  421   ISIFSMLVAGILEVIRLGIVRRNNYYDLEYIPTSIFWQVPQYFLVGCAEVFTFIGQLEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  +TT+NGK GW+ +NLN GHLDYF+
Sbjct  481   YDQAPDAMRSLCSALSLTTVALGNYLSTLLVTIVTKVTTQNGKLGWIPDNLNRGHLDYFY  540

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA+LS++N  V++ +AK YTYKKA
Sbjct  541   WLLAILSLLNFLVYLWIAKCYTYKKA  566



>gb|KGN47104.1| hypothetical protein Csa_6G187970 [Cucumis sativus]
Length=608

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/568 (69%), Positives = 479/568 (84%), Gaps = 3/568 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EED +YT+DGT+DYR  PA + +TGTW+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  41    EEDSIYTQDGTVDYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKDHLN  100

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q + +ASKN++NW GTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  101   QHSATASKNVNNWIGTCYITPLIGAFLADAYLGRYRTIAAFSILYVFGMTLLTLSASVPG  160

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTC++ + C  T   + +CF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSS
Sbjct  161   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKSS  220

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFY SIN+G L+ASS++VW+Q+ VSWGWGFG+PA+AMA+AV  FFSGTRLYR QKPG
Sbjct  221   FFNWFYLSINVGGLIASSVLVWVQENVSWGWGFGIPAIAMAIAVVSFFSGTRLYRNQKPG  280

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-  1208
             GSPFTR+ QVIVAS RK KVKVP  K+ L+ET+  ES+I GSRKL HT++ RFFDKAAV 
Sbjct  281   GSPFTRICQVIVASFRKYKVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  339

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +ESD+  KGS   W+LCTVTQVEELK+IIRLLP+WATGI F+ VY Q+ST FV Q   M+
Sbjct  340   LESDQMLKGSVDRWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQISTLFVLQGDRMD  399

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI WVP+YDR+IVP+ARK+TGH +G+T LQRMG+GLFIS
Sbjct  400   PHIGPNFEIPAASLSIFDTLSVIFWVPVYDRIIVPVARKYTGHSNGITQLQRMGIGLFIS  459

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             ILAM+SAA+LE+VRL  V+RHN Y++  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY+
Sbjct  460   ILAMLSAAILELVRLQDVRRHNYYELKHMPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYE  519

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL SALSLTT A+GNYLSS LVTIV   +T+ G+ GW+ +NLNYGH+ YFF+L
Sbjct  520   QAPDAMRSLGSALSLTTVALGNYLSSLLVTIVNKASTKGGRLGWIPDNLNYGHVHYFFFL  579

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LA+LS+ NL  F V+AK Y YK+ I  +
Sbjct  580   LAILSIKNLIAFFVIAKWYKYKRPIGTL  607



>ref|XP_004490642.1| PREDICTED: peptide transporter PTR1-like [Cicer arietinum]
Length=570

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/566 (71%), Positives = 469/566 (83%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDDV TKDGT+DY   PANK KTGTW+ACPFILGNEC ERLA+YGMS+NL+ YF+ +L
Sbjct  1     MAEDDVCTKDGTVDYLGNPANKRKTGTWRACPFILGNECCERLAFYGMSTNLVRYFKYQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q + +ASKN ++W GTCYI PL+GAF+ADAYLGR+WTI  FSI+YVIGMTL+TLSA+V 
Sbjct  61    HQHSATASKNAADWGGTCYITPLIGAFVADAYLGRFWTIFCFSIVYVIGMTLLTLSASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC A + C  T   + VCF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GLKPTCYAKDDCHATHEQSAVCFVALYLIALGTGGIKPCVSSFGADQFDDADEVEKEHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+A+SL+VWIQ  VSWG GFG+PA    +AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIAASLLVWIQDNVSWGLGFGIPAXXXXIAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS+RK  V+VP DKSLL+ET    S+IQGSRKL  +N LRFFDKAAV
Sbjct  241   GGSPVTRICQVIVASVRKYNVEVPDDKSLLYETDETVSSIQGSRKLERSNGLRFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +E+ +  K S +PWRLC +TQVEELK+IIRLLPIWATGIIF+TVYGQMS  FV Q   MN
Sbjct  301   LENPDNAKDSTNPWRLCPITQVEELKAIIRLLPIWATGIIFATVYGQMSNYFVLQGETMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             T++G   F+IP ASLS+FDTLSVI WVPIYDR+IVP+ARKF+GHK+GLT LQRMG+GLFI
Sbjct  361   THIGNSNFQIPPASLSIFDTLSVIFWVPIYDRIIVPIARKFSGHKNGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +M+ A  LE  RL MVKRHN YD  EVP+S+FWQVP YFIIGCAEVFTFIGQLEFFY
Sbjct  421   SIFSMLYALTLEYFRLKMVKRHNYYDFKEVPMSIFWQVPPYFIIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRSLCSALSL T A+G YLSS LVT+V  +TT NG PGWL +NLNYG LD FFW
Sbjct  481   EQAPDAMRSLCSALSLLTVALGQYLSSLLVTVVTKVTTLNGGPGWLPDNLNYGRLDCFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLA LSV+N   F+VV++ YTYKK +
Sbjct  541   LLAGLSVVNFVAFLVVSRFYTYKKPV  566



>ref|XP_004160177.1| PREDICTED: LOW QUALITY PROTEIN: peptide transporter PTR1-like 
[Cucumis sativus]
Length=570

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/568 (69%), Positives = 478/568 (84%), Gaps = 3/568 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EED +YT+DGT+DYR  PA + +TGTW+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  3     EEDSIYTQDGTVDYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKDHLN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q + +ASKN++NW GTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  63    QHSATASKNVNNWIGTCYITPLIGAFLADAYLGRYRTIAAFSILYVFGMTLLTLSASVPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTC++ + C  T   + +CF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSS
Sbjct  123   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFY SIN+G L+ASS++VW+Q+ VSWGWGFG+PA+AMA+AV  FFSGTRLYR QKPG
Sbjct  183   FFNWFYLSINVGGLIASSVLVWVQENVSWGWGFGIPAIAMAIAVVSFFSGTRLYRNQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-  1208
             GSPFTR+ QVIVAS RK KVKVP  K+ L+ET+  ES+I GSRKL HT++ RFFDKAAV 
Sbjct  243   GSPFTRICQVIVASFRKYKVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  301

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +ESD+  KGS   W+LCTVTQVEELK+IIRLLP+WATGI F+ VY Q+ST FV Q   M+
Sbjct  302   LESDQMLKGSVDRWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQISTLFVLQGDRMD  361

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI WVP+YDR+IVP+ARK+TGH +G+T LQRMG+GLFIS
Sbjct  362   PHIGPNFEIPAASLSIFDTLSVIFWVPVYDRIIVPVARKYTGHSNGITQLQRMGIGLFIS  421

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             ILAM+SAA+LE+VRL  V+RHN Y++  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY+
Sbjct  422   ILAMLSAAILELVRLQDVRRHNYYELKHMPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYE  481

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL SALSLTT A+GNYLSS LVTIV   +T+ G+ GW+ +NLNYGH+ YFF L
Sbjct  482   QAPDAMRSLGSALSLTTVALGNYLSSLLVTIVNKASTKGGRLGWIPDNLNYGHVHYFFXL  541

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LA+LS+ NL  F+ +AK Y YK+ I  +
Sbjct  542   LAILSIKNLIAFLXIAKWYKYKRPIGTL  569



>gb|KDO66792.1| hypothetical protein CISIN_1g0086231mg, partial [Citrus sinensis]
Length=547

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/545 (72%), Positives = 463/545 (85%), Gaps = 7/545 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE+D+YTKDGTLDY+  PA+K KTGTWKACPFILGNEC ERLAYYGMS+NL+ YF+ +L+
Sbjct  3     EEEDIYTKDGTLDYKGNPADKTKTGTWKACPFILGNECCERLAYYGMSTNLVRYFKHQLD  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             QS+ +ASKN+ +WSGTCYI PL+GAFLADAYLGRYWTIA FSIIYVIGMT +T++A+V G
Sbjct  63    QSSSTASKNVLDWSGTCYITPLIGAFLADAYLGRYWTIAIFSIIYVIGMTFLTVTASVSG  122

Query  672   ISPTCIA---HEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             + P C      E C VT   +   F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KH
Sbjct  123   LKPVCHGPRGEETCQVTDAQSATFFVALYLIALGTGGIKPCVSSYGADQFDDADEAEKKH  182

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGAL+ASS++VWIQ    WGWGFG+PAVAMA+AV  FFSGTRL+R Q
Sbjct  183   KSSFFNWFYFSINIGALIASSVLVWIQDNEGWGWGFGIPAVAMAIAVVSFFSGTRLFRNQ  242

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QV+ AS+RK KV++P DKSLL+ET+  ESNI GSRKL HT +  FFDKA
Sbjct  243   KPGGSPLTRICQVVAASIRKHKVELPADKSLLYETADAESNITGSRKLDHTKDFSFFDKA  302

Query  1203  AV-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AV ++SD  K+ S +PWRLCTVTQVEELK+I+RLLPIWATGIIFS VY QMS+ FV Q  
Sbjct  303   AVEIQSDNIKE-SVNPWRLCTVTQVEELKAIVRLLPIWATGIIFSAVYSQMSSLFVLQGE  361

Query  1380  GMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              M+T+VG  +FKIP ASLS+FDTLSVI WVPIYDR IVP+ RKFTGHK+GLT LQRMG+G
Sbjct  362   RMDTHVGNSSFKIPPASLSIFDTLSVIFWVPIYDRFIVPVTRKFTGHKNGLTQLQRMGIG  421

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             LFISIL+M++AAVLE++RL MV+ HN YD+ E+P+S+ WQVPQYF+IGCAEVFTFIGQLE
Sbjct  422   LFISILSMIAAAVLELIRLRMVREHNYYDLPEMPMSIMWQVPQYFLIGCAEVFTFIGQLE  481

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+QAPD+MRSLCSALSLTT A+GNYLSS LVTIV  I+T+NG  GW+ +NLN GHL Y
Sbjct  482   FFYEQAPDAMRSLCSALSLTTVALGNYLSSLLVTIVTSISTKNGNLGWIPDNLNRGHLHY  541

Query  1914  FFWLL  1928
             FFWLL
Sbjct  542   FFWLL  546



>ref|XP_010033021.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 gb|KCW52547.1| hypothetical protein EUGRSUZ_J01932 [Eucalyptus grandis]
Length=570

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/566 (69%), Positives = 466/566 (82%), Gaps = 2/566 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE+DVYTKDGT+DY+  PA+K KTGTWKACPFILGNEC ERLA+YGM +NL++YF+  L
Sbjct  1     MEEEDVYTKDGTVDYKGDPADKRKTGTWKACPFILGNECCERLAFYGMGANLVLYFKLHL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q   +AS NL+NW+GTCYI  L+GAF ADAYLGRYWTIA FSIIYV GMTL+TLSA+V 
Sbjct  61    HQHGTTASNNLTNWAGTCYITTLIGAFFADAYLGRYWTIACFSIIYVFGMTLLTLSASVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  T   + VCFIALYL+ALG+GGIKPCVSSYGADQFDD DE E+K K 
Sbjct  121   GLKPSCTGKDNCHATNIQSAVCFIALYLIALGSGGIKPCVSSYGADQFDDADEAEKKRKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+A  ++V+IQ  V W  GFG+PA AMA+AV  FFSGTRLYR Q P
Sbjct  181   SFFNWFYLSINIGALIAEFVLVYIQDNVGWALGFGIPAAAMAIAVATFFSGTRLYRNQNP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VAS RK +V+VP DKSLL+ET+  +S I+GSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRLCQVVVASFRKYRVEVPADKSLLYETADAKSAIKGSRKLDHTQDLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K   +PWRLCTVTQVEELK IIRLLP+WA+ I+F TVY QM T FV Q   M+
Sbjct  301   ETQTDHIKEPVNPWRLCTVTQVEELKVIIRLLPVWASQIVFVTVYNQMGTLFVLQGSTMD  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              +VG  TFKIP AS  +FD LSV+ WVP+YDR+IVP+AR+FTGHKSGLT LQRMG+GLFI
Sbjct  361   PHVGNSTFKIPAASFFIFDILSVLFWVPVYDRIIVPVARRFTGHKSGLTQLQRMGIGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI A++SAA+LE++RL MV+RH+ YD   VP+S+FWQVPQYF++GCAEVFTFIGQLEFFY
Sbjct  421   SIFALISAAILEVIRLKMVRRHDYYDYKYVPMSIFWQVPQYFLMGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRS+CSALSL T A+ NYLSS LVTIV  I+TR+GK GW+ +NLNYGHLDYFFW
Sbjct  481   EQAPDAMRSMCSALSLATIALRNYLSSLLVTIVTRISTRHGKLGWIPDNLNYGHLDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLAVLSV+NL  F++VA+ YTYKKA+
Sbjct  541   LLAVLSVINLRAFLLVARRYTYKKAV  566



>ref|XP_010104684.1| Peptide transporter [Morus notabilis]
 gb|EXC01490.1| Peptide transporter [Morus notabilis]
Length=588

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/584 (66%), Positives = 473/584 (81%), Gaps = 20/584 (3%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ME+DDVYTKDGT+D+R  PANK +TGTWKACPFILGNE  ERLAYYGMSSNL+ YF+ RL
Sbjct  1     MEDDDVYTKDGTIDHRGNPANKKETGTWKACPFILGNEFCERLAYYGMSSNLVTYFKERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
              Q + +A+ N  NWSGTCYI PL+GAFLAD+YLGRYWTIA FS IYV GMT +TL+A+VP
Sbjct  61    GQHSSTAANNTLNWSGTCYITPLIGAFLADSYLGRYWTIAIFSTIYVTGMTFLTLTASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC  ++ C  T        +ALY +ALGTGGIKPCVSSYGADQFDD DE E+KHK+
Sbjct  121   GLKPTCHGNDGCHATDSQKAAFILALYTIALGTGGIKPCVSSYGADQFDDADEVEKKHKA  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+ASS++VW+Q+ VSWG GFG+PA  MA+A+  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINVGALIASSVLVWVQENVSWGLGFGIPAATMAVAIVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNE---------  1181
             GGSP  R+ QV+VA++RKR V+VP DK+LL+E +  ES I+GSRKL HT +         
Sbjct  241   GGSPLIRIAQVVVAAMRKRWVEVPADKALLYEVADAESVIKGSRKLDHTQDFRQVSQLES  300

Query  1182  ---------LRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFS  1334
                      LRFFDKAAV    ++ K S +PW LCTVTQVEELK+IIRLLPIWATGI+FS
Sbjct  301   LTRVYYTCSLRFFDKAAVEIQTDHIKDSVNPWMLCTVTQVEELKAIIRLLPIWATGIMFS  360

Query  1335  TVYGQMSTQFVSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFT  1508
              VY QM + FV Q + M+  +   +FKIP ASLS+FDT+SVI+WVPIYDR+IVP+ARKFT
Sbjct  361   AVYSQMGSLFVLQGLTMDRRLAPSSFKIPSASLSIFDTISVIIWVPIYDRIIVPVARKFT  420

Query  1509  GHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYF  1688
             GHK+G+T LQRMG+GLFISI AM+SA V+E+VRL +V+RHN Y++  +P+S+FWQVPQYF
Sbjct  421   GHKNGITQLQRMGIGLFISIFAMLSAGVVELVRLRIVRRHNYYELDSIPMSIFWQVPQYF  480

Query  1689  IIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGK  1868
             +IGCAEVFTFIGQLEFFY+QAPD+ RSLCSALSLTT A+GNYLSS LVTIV  ++TR+GK
Sbjct  481   LIGCAEVFTFIGQLEFFYEQAPDATRSLCSALSLTTVALGNYLSSLLVTIVTKVSTRHGK  540

Query  1869  PGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
              GW+ +NLNYGHL YFFWLLA+LSV+NLG F+V++K Y YK+++
Sbjct  541   RGWIPDNLNYGHLHYFFWLLAILSVINLGAFLVISKWYKYKRSM  584



>emb|CDP09152.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/559 (73%), Positives = 462/559 (83%), Gaps = 3/559 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ME DD YTKDGT+DYR  PA+K KTGTWKACP+ILGNEC ERLAYYGMSSNLMIYF  +L
Sbjct  1     MEADDYYTKDGTVDYRKNPADKRKTGTWKACPYILGNECCERLAYYGMSSNLMIYFTKQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ T  AS+N+SNWSGTCYIMPL+GAFLAD+ LGRYWTIA+FSIIY IGMTL+TLSA+VP
Sbjct  61    NQHTAEASRNVSNWSGTCYIMPLLGAFLADSCLGRYWTIASFSIIYFIGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C A + C  T   T V F+ALYLVALGTGGIKPCVSSYGADQFDD DE E+  KS
Sbjct  121   GLKPACSAEDVCDPTSIQTTVSFLALYLVALGTGGIKPCVSSYGADQFDDADETEKNFKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS +V+IQ  V WGWGFG+PA AMA+AV  FFSGTR+YRYQ P
Sbjct  181   SFFNWFYFSINIGALVASSFLVYIQLHVGWGWGFGIPAAAMAIAVVSFFSGTRIYRYQIP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TRL QV+VASLRK  V +P DKS L+E +   S I GSRKL HT    FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASLRKYDVPLPADKSQLYEVADETSAIVGSRKLEHTKAFSFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               ESD   +   S WRLCTVTQVEELKSI+RLLP+WATGII S VY QM   FVSQA  M
Sbjct  301   ETESDRTNESKVSAWRLCTVTQVEELKSILRLLPVWATGIIVSAVYSQMGNLFVSQAEVM  360

Query  1386  NTYVGT--FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             +T++G   FKIPEASLSVFDTLSVIVWVPIYD++I P ARK TG K+GLT LQRMG+G+ 
Sbjct  361   DTHLGNTRFKIPEASLSVFDTLSVIVWVPIYDKIITPFARKITGQKNGLTQLQRMGIGMV  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             I+ILAMV+AAVLE+VRL +V+RHNLYD   +PISVFWQVPQYFIIGCAEVF FIGQLEFF
Sbjct  421   IAILAMVTAAVLEIVRLGIVRRHNLYDAKLIPISVFWQVPQYFIIGCAEVFIFIGQLEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPDS+RSLC+ALSLTT ++G+YLSS LV IV   +TR GKPGW+A+NLNYGHLDYFF
Sbjct  481   YEQAPDSIRSLCAALSLTTGSLGSYLSSLLVQIVTKASTRGGKPGWIADNLNYGHLDYFF  540

Query  1920  WLLAVLSVMNLGVFVVVAK  1976
             WLL+ L V+N GVF+ VA+
Sbjct  541   WLLSGLGVLNFGVFLAVAQ  559



>ref|XP_008464060.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Cucumis melo]
Length=570

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/565 (69%), Positives = 480/565 (85%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EED +YT+DGT++YR  PA + +TGTW+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  3     EEDSIYTQDGTVNYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKHHLN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q + +ASKN++NWSGTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  63    QDSATASKNVNNWSGTCYITPLIGAFLADAYLGRYRTIAAFSIVYVFGMTLLTLSASVPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + PTC++ + C  T   + +CF+ALYL+ALGTGGIKPCVSSYGADQFDD +E E+KHKSS
Sbjct  123   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDANETEKKHKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFY SINIGAL+ASS++VW+Q+ VSWGWGFG+PA+AMA+A+  FFSGTRLYR QKPG
Sbjct  183   FFNWFYLSINIGALIASSVLVWVQENVSWGWGFGIPAIAMAIAIVSFFSGTRLYRNQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-  1208
             GSPFTR+ QV+VA+ RK  VKVP  K+ L+ET+  ES+I GSRKL HT++ RFFDKAAV 
Sbjct  243   GSPFTRICQVVVATFRKYNVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  301

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +ESD+  KGS  PW+LCTVTQVEELK+IIRLLP+WATGI F+ VY QMS+ FV Q   M+
Sbjct  302   LESDQMLKGSVDPWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQMSSLFVLQGDRMD  361

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G TF+IP ASLS+FDTLSVI WVP+YDR+IVPMARK+TGH +G+T LQRMG+GLFIS
Sbjct  362   PHIGPTFEIPAASLSIFDTLSVIFWVPVYDRIIVPMARKYTGHPNGITQLQRMGIGLFIS  421

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             ILAM+SAA+LE+VRL  V+RH+ Y++  +P+S+FWQVPQYF+IGCAEVFT IGQLEFFY+
Sbjct  422   ILAMLSAAILELVRLREVRRHDYYELKHMPMSIFWQVPQYFLIGCAEVFTLIGQLEFFYE  481

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL SALSLTT A+GNYLSS LVTIV   +T+ G+ GW+ +NLNYGH+ YFF+L
Sbjct  482   QAPDAMRSLGSALSLTTIALGNYLSSLLVTIVNKASTKGGRLGWIPDNLNYGHVHYFFFL  541

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA+LSV NL  F+ +AK Y YK+ I
Sbjct  542   LAILSVKNLIAFLFIAKWYKYKRPI  566



>ref|XP_011090498.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=568

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/566 (69%), Positives = 467/566 (83%), Gaps = 2/566 (0%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E M  +D YTKDGTLD+R+ PANKNKTG WKA PFILGN+C ERLA+YGMSSNL++Y+ T
Sbjct  2     EVMGNEDKYTKDGTLDFRSNPANKNKTGAWKASPFILGNQCCERLAFYGMSSNLLLYYTT  61

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +LNQ + +ASKNLSNW GTCY++PL GAFLADAYLGRYWTIA FS+IYV+GMTL+TLSA+
Sbjct  62    QLNQHSATASKNLSNWLGTCYVLPLFGAFLADAYLGRYWTIAGFSVIYVLGMTLLTLSAS  121

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ PTC   ++C  T   T VC +ALYLVALG GG+KPCVSSYGADQFDD DE E+ H
Sbjct  122   VPGLRPTCYKKDECYATNSQTTVCTVALYLVALGFGGMKPCVSSYGADQFDDADEVEKGH  181

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNW YFS+N+G L+  S+ VWIQ  + WGWG+GV AVAMA+ V FFF GTRLYRYQ
Sbjct  182   KSSFFNWLYFSMNVGMLIGCSVPVWIQVNIGWGWGYGVSAVAMAIGVAFFFLGTRLYRYQ  241

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPG +P TRL QV+VASLRK +V+VP DKSLL+ET+  +S I GS KL HTN+  F DKA
Sbjct  242   KPGSNPLTRLCQVLVASLRKYRVEVPSDKSLLYETADADSTIVGSHKLDHTNQFCFLDKA  301

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV +  ++ KGS +PW LCTVTQVEELK IIRLLP+ ATGIIF+TV+GQMS  F+ QA  
Sbjct  302   AVEKESDHSKGSVNPWTLCTVTQVEELKWIIRLLPVLATGIIFNTVFGQMSNLFLLQAEY  361

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+  +G   FK+P ASL+VF+ +SVI WVP+YDR I+PM RKFTGHK+GLT LQR+G GL
Sbjct  362   MDARLGRSNFKVPVASLAVFNPISVIFWVPVYDRFIIPMTRKFTGHKNGLTQLQRIGTGL  421

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FIS+ AM+SA +LE+ RL +V+R+N Y V E PIS+FWQVPQ+FIIGCAEVFT IGQ+EF
Sbjct  422   FISVFAMISAGILEIFRLRIVRRNNSYKVMETPISIFWQVPQHFIIGCAEVFTNIGQMEF  481

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY++APDSMRS+C+ALSLTT A+GNYLSS LV IV  I+TR+G+PGW+ +NLNYGHL YF
Sbjct  482   FYEEAPDSMRSVCAALSLTTTALGNYLSSLLVAIVMAISTRDGRPGWIPDNLNYGHLHYF  541

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             F LLA LSV+NLGVF+VVAK Y+YKK
Sbjct  542   FLLLAALSVLNLGVFLVVAKRYSYKK  567



>ref|XP_009774291.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=569

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/569 (69%), Positives = 465/569 (82%), Gaps = 1/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD Y KDGT+DYRN PA K +TGTW+ACP+ILGNEC ERLAYYG+++NL+ Y + ++
Sbjct  1     MAEDDKYVKDGTVDYRNNPAIKKETGTWRACPYILGNECCERLAYYGINTNLVNYLKFQM  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N+S++ A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMT++TLSA+V 
Sbjct  61    NESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTVLTLSASVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C  +  C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  121   GLKPPCDDNNTCHPKGIQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVAS+++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAVAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVAS RK KVK+P D SLL+ET   ES +QGSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVASFRKFKVKIPRDSSLLYETVDEESAVQGSRKLDHTEQLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS +PW LCTVTQVEELKSIIRLLPIWATGIIFS+VY QM T FV Q   M+
Sbjct  301   ETQSDKIKGSVNPWSLCTVTQVEELKSIIRLLPIWATGIIFSSVYSQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++  +F+IP ASLS+FDT+SVI WVP+YDR+IV +ARKFTGHK+G T LQR+ +GL IS
Sbjct  361   LHMTNSFEIPSASLSLFDTISVIFWVPVYDRVIVALARKFTGHKNGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A  LEMVRL  V  HN Y++  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLIAGTLEMVRLRTVGEHNYYEMKHIPMSIFWQVPQYFVIGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSL T A+GNYLS+ LV IV D++TRNG  GW+ +NLNYGHL YFFWL
Sbjct  481   QAPDAMRSLCSALSLITTALGNYLSTLLVNIVTDMSTRNGGHGWIPDNLNYGHLHYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             LAVLSV+N G F+ VAK YTYKKAI   S
Sbjct  541   LAVLSVLNFGFFLFVAKFYTYKKAIGPSS  569



>ref|XP_010654192.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Vitis vinifera]
 emb|CAN72572.1| hypothetical protein VITISV_034788 [Vitis vinifera]
Length=568

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/567 (68%), Positives = 466/567 (82%), Gaps = 2/567 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT++  N+PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLADAY GR+W IA FSIIY  GM L+T++A++ 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADAYFGRFWIIAIFSIIYFCGMVLLTMTASIK  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C     C  T   + VCFIALYL+ALGTGGIKPCVSS+GADQFD  DE E+K KS
Sbjct  121   GLRPSC-DDNGCDPTKLQSAVCFIALYLIALGTGGIKPCVSSFGADQFDVNDEAEKKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+ASS++VWIQ  V WGWGFG+PAVAMA+AV  FFSG+R+YR QKP
Sbjct  180   SFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVVSFFSGSRMYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  VKVP +KSLL+ET   ESNI+GS KL HT +LRFFDKAAV
Sbjct  240   GGSPLTRICQVLVASTRKYHVKVPNNKSLLYETKDAESNIKGSCKLEHTEKLRFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K S +PW+LCTVTQVEELKSI+RLLP+WATGI+FSTVY QMST FV Q   M+
Sbjct  300   EVESDHVKSSNNPWKLCTVTQVEELKSILRLLPVWATGILFSTVYSQMSTMFVLQGNTMD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  360   QHMGPNFKIPSASLSLFDTLSVIFWAPVYDRIIVPFARKFTGHERGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I++M+ A +LE++RL  V++HN YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQLEF+YD
Sbjct  420   IISMIVAGILEVIRLNYVRKHNYYDLEYIPMSIFWQVPQYFLIGCAEVFTFIGQLEFYYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+ RSLCSALSLTTNA+GNYLS+ LVTIV  +TTRNGK GW+ +N+N GHLDYF+WL
Sbjct  480   QAPDATRSLCSALSLTTNALGNYLSTLLVTIVNKVTTRNGKMGWIPDNMNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LA+LS++N  V++ +AK YTYKK   +
Sbjct  540   LAILSLLNFLVYLWIAKWYTYKKVTGR  566



>ref|XP_010528782.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Tarenaya hassleriana]
Length=570

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/568 (67%), Positives = 469/568 (83%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y + R+
Sbjct  1     MEEKDVYTQDGTVDINKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLEKRM  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P+    + C  T     VCF+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E+K KS
Sbjct  121   GIRPSNCTGDTCHPTSGQVAVCFVALYLIALGTGGIKPCVSSFGADQFDENDEAEKKKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFG+PAVAMA+AV FFF+G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGIPAVAMAIAVIFFFAGSRYYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK  VKVP DKSLL+ET+  ESNI+GSRKL+HT++L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMSVKVPEDKSLLYETADEESNIKGSRKLAHTDKLKFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K G  + WRLCTVTQVEELKSIIRLLP+WA+GI+F+TVY QM+T FV Q   M
Sbjct  301   ETQSDSIKDGQINLWRLCTVTQVEELKSIIRLLPVWASGIVFATVYSQMNTMFVLQGNTM  360

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD++IVP ARK+TGH+ G T LQRMG+GL I
Sbjct  361   DQHMGKHFEIPSASLSLFDTVSVLFWTPVYDQVIVPFARKYTGHERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE++RL  V+ H+ +D  ++P+S+FWQVPQYF++GCAEVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVIRLDYVRTHHAFDEKQIPMSIFWQVPQYFLVGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  IT +NGK GW+ +NLN GHLDYFF+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVTKITRKNGKQGWIPDNLNNGHLDYFFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLAVLS +N  V++ +AK Y YKKA+ +
Sbjct  541   LLAVLSFLNFLVYLWIAKRYKYKKAVGR  568



>gb|KHN40046.1| Peptide transporter PTR1 [Glycine soja]
Length=571

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/567 (69%), Positives = 462/567 (81%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DYR   ANK +TGTW+ACPFILGNEC ERLAYYGMS+NL+ YF T+L
Sbjct  1     MAEEDVYTKDGTVDYRGNRANKKETGTWRACPFILGNECCERLAYYGMSTNLVTYFNTKL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS  +ASKN +NW GTCYI PL+GAF+ADAYLGRY TI  FSI+YVIGMTL+TLSA+VP
Sbjct  61    NQSGPTASKNNANWGGTCYITPLIGAFVADAYLGRYLTILCFSIVYVIGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P+C     C  T   + VCF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GIKPSCDDQGNCHATQAQSAVCFVALYLIALGTGGIKPCVSSFGADQFDDADEAEKEHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+A+S++VW+Q  VSWGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINIGALIAASVLVWVQTNVSWGWGFGIPAVAMAIAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHE-TSGLESNIQGSRKLSHTNELRFFDKAA  1205
             GGSP TR+ QVIVAS+RK  V+VP DKS L+E     ES I+GSRKL HTN LRF DKAA
Sbjct  241   GGSPLTRMCQVIVASIRKSDVQVPNDKSGLYEIEEDSESAIEGSRKLDHTNGLRFLDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V+   +  K   +PWRLCTVTQVEELK+IIRLLPIWATGIIFSTVY QM + F+ Q   M
Sbjct  301   VLGDSDNVKDPVNPWRLCTVTQVEELKAIIRLLPIWATGIIFSTVYSQMGSYFILQGDTM  360

Query  1386  NTYVGTFK--IPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             N  VG  K  I  A+LSVFDT+SVI WVP+YDR+IVP+ARKFTG K+G+T LQRMG+GLF
Sbjct  361   NNRVGNIKLHISPATLSVFDTISVIFWVPVYDRIIVPVARKFTGRKNGITQLQRMGIGLF  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI AMV + +LE +RL MV+RHN YD  +VP+S++ Q+P YFIIGCAEVFTFIGQLEFF
Sbjct  421   ISIFAMVYSVILESMRLKMVRRHNYYDREQVPMSLYLQIPPYFIIGCAEVFTFIGQLEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPD+MRS CSAL L T + G+YLSS L+TIV  +TTRNG PGWL + LNYGHLDYFF
Sbjct  481   YEQAPDAMRSTCSALQLLTVSFGSYLSSLLITIVTKVTTRNGGPGWLPDKLNYGHLDYFF  540

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
              LL VLSV+N   F+ V+K+Y+YK ++
Sbjct  541   LLLTVLSVLNFVAFLQVSKLYSYKNSV  567



>gb|KHG08248.1| Peptide transporter PTR1 -like protein [Gossypium arboreum]
Length=569

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/560 (68%), Positives = 467/560 (83%), Gaps = 2/560 (0%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             DD+YTKDGT+D   +PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y Q +LNQ 
Sbjct  5     DDIYTKDGTVDINKKPANKKKTGNWKACSFILGNECCERLAYYGMGTNLVNYLQEQLNQG  64

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
              ++AS N++NWSGTCYI PL+GAF+ADAYLGRYWTIA FSIIY  GMTL+TLS+++PG+ 
Sbjct  65    NVAASNNVTNWSGTCYITPLIGAFVADAYLGRYWTIAIFSIIYFFGMTLLTLSSSIPGLK  124

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P+C   + C  T     V F+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KSSFF
Sbjct  125   PSCTG-DVCHPTQEQIAVFFVALYMIALGTGGIKPCVSSFGADQFDETDEVERKRKSSFF  183

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGALVASS++VWIQ  V W WGFG+PAVAMA+AV FFF+G+R YR QKPGGS
Sbjct  184   NWFYFSINIGALVASSVLVWIQMNVGWDWGFGIPAVAMAIAVVFFFAGSRTYRLQKPGGS  243

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QVIVAS +K  VKVP DKSLL+E +  ESNIQGSRKL HT++L+FFDKAAV   
Sbjct  244   PLTRIAQVIVASFKKLNVKVPADKSLLYEVADNESNIQGSRKLEHTDKLKFFDKAAVETE  303

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
             +++ K S +PWRLCTVTQVEELKS+IRLLP+WA+GIIF+TVY QM+T FV Q   M+ ++
Sbjct  304   NDHDKESLNPWRLCTVTQVEELKSVIRLLPVWASGIIFATVYSQMNTMFVLQGNTMDQHM  363

Query  1398  G-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G  FKIP ASLS+FDTLSVI W P+YD++IVP ARKFTG + G T LQRMG+GL ISI A
Sbjct  364   GPNFKIPSASLSLFDTLSVIFWAPVYDKIIVPCARKFTGKERGFTTLQRMGIGLVISIFA  423

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             M++A +LE+VRL +V+++N YD+  +P+S+FWQVP+YF++GCAEVFTF+GQ+EFFYDQAP
Sbjct  424   MITAGILEVVRLQIVRKNNYYDLKSIPMSIFWQVPEYFLVGCAEVFTFVGQIEFFYDQAP  483

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRSL SALSLTT A+GNYLS+ LVT V  ITT+NGK GW+ +NLN GHLDYFFWLLA+
Sbjct  484   DAMRSLSSALSLTTVALGNYLSTLLVTAVTKITTQNGKLGWIPDNLNRGHLDYFFWLLAI  543

Query  1935  LSVMNLGVFVVVAKMYTYKK  1994
             LS++N  V++ +AK YTYKK
Sbjct  544   LSLLNFIVYLWIAKWYTYKK  563



>ref|XP_003544872.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Glycine 
max]
 ref|XP_006596417.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
Length=571

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/567 (69%), Positives = 461/567 (81%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DYR   ANK +TGTW+ACPFILGNEC ERLAYYGMS+NL+ YF T+L
Sbjct  1     MAEEDVYTKDGTVDYRGNRANKKETGTWRACPFILGNECCERLAYYGMSTNLVTYFNTKL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS  +ASKN +NW GTCYI PL+GAF+ADAYLGRY TI  FSI+YVIGMTL+TLSA+VP
Sbjct  61    NQSGPTASKNNANWGGTCYITPLIGAFVADAYLGRYLTILCFSIVYVIGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P+C     C  T   + VCF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GIKPSCDDQGNCHATQAQSAVCFVALYLIALGTGGIKPCVSSFGADQFDDADEAEKEHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+A+S++VW+Q  VSWGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINIGALIAASVLVWVQTNVSWGWGFGIPAVAMAIAVVSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHE-TSGLESNIQGSRKLSHTNELRFFDKAA  1205
             GGSP TR+ QVIVAS+RK  V+VP DKS L+E     ES I+GSRKL HTN LRF DKAA
Sbjct  241   GGSPLTRMCQVIVASIRKSDVQVPNDKSGLYEIEEDSESAIEGSRKLDHTNGLRFLDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V+   +  K   +PWRLCTVTQVEELK+IIRLLPIWATGIIFSTVY QM + F+ Q   M
Sbjct  301   VLGDSDNVKDPVNPWRLCTVTQVEELKAIIRLLPIWATGIIFSTVYSQMGSYFILQGDTM  360

Query  1386  NTYVGTFK--IPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             N  VG  K  I  A+LSVFDT+SVI WVP+YDR+IVP+ARKFTG K+G+T LQRMG+GLF
Sbjct  361   NNRVGNIKLHISPATLSVFDTISVIFWVPVYDRIIVPVARKFTGRKNGITQLQRMGIGLF  420

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI AMV + +LE +RL MV+RHN YD  +VP+S++ Q+P YFIIGCAEVFTFIGQLEFF
Sbjct  421   ISIFAMVYSVILESMRLKMVRRHNYYDREQVPMSLYLQIPPYFIIGCAEVFTFIGQLEFF  480

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             Y+QAPD+MRS CSAL L T + G+YLSS L+TIV  +TTRNG PGWL + LNYGHLDYFF
Sbjct  481   YEQAPDAMRSTCSALQLLTVSFGSYLSSLLITIVTKVTTRNGGPGWLPDKLNYGHLDYFF  540

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
              LL VLSV+N   F+ V+K+Y+YK  +
Sbjct  541   LLLTVLSVLNFVAFLQVSKLYSYKNPV  567



>gb|KDP24485.1| hypothetical protein JCGZ_25049 [Jatropha curcas]
Length=565

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/565 (68%), Positives = 463/565 (82%), Gaps = 1/565 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E D+YT+DGT+D+   PA+K KTGTWKACP ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MAEQDIYTRDGTIDFHGNPADKKKTGTWKACPCILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS++ A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA+V 
Sbjct  61    NQSSVEAINNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSASVK  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C     C  TG +T V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  121   GLKPSCNHSNVCHPTGTETSVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKQKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFG+PAVAMA+AV  FFSGT+ YR  KP
Sbjct  181   SFFNWFYFSINIGALIASSILVWIQTNVGWGWGFGIPAVAMAIAVMSFFSGTKFYRNLKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR  QVIVASLRK +V+VP D+SLL ETS  ES ++GSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRTCQVIVASLRKFRVQVPDDESLLFETSDEESAVKGSRKLHHTKQLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS  PWRLCTVTQVEELKSIIRLLPIWATGIIFS VY QM T FV Q   M+
Sbjct  301   ETESDRVKGSIHPWRLCTVTQVEELKSIIRLLPIWATGIIFSAVYTQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
               +  +F+IP ASLS+FDT+SVI WVPIYDR+IVP+ARKFT  K+G T LQR+ +GL IS
Sbjct  361   LQITSSFQIPSASLSLFDTVSVIFWVPIYDRMIVPIARKFTKQKNGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +M  A  LEM RL  V+++N Y++  +P+SVFWQVPQYFIIGCAEVFTF+GQLEFFY+
Sbjct  421   IFSMAVAGTLEMARLHQVRKYNYYELKHIPMSVFWQVPQYFIIGCAEVFTFVGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             Q PD+MRSLCSALSLTT A+GNYLS+FLV  V D +TR GK GW+ +NLNYGHL+YFFWL
Sbjct  481   QGPDAMRSLCSALSLTTAALGNYLSTFLVNAVTDFSTRGGKEGWIPDNLNYGHLNYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             L  LS++N GV+++VA+ YTYKK I
Sbjct  541   LGGLSLVNFGVYLLVARSYTYKKTI  565



>ref|XP_003518298.1| PREDICTED: peptide transporter PTR1-like [Glycine max]
 gb|KHN46171.1| Peptide transporter PTR1 [Glycine soja]
Length=573

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/572 (69%), Positives = 463/572 (81%), Gaps = 5/572 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+DVYTKDGT+DYR   ANKN+TGTW+ACPFILGNECSERLAYYGMS+NL+ YF T+L
Sbjct  1     MTEEDVYTKDGTVDYRGNRANKNETGTWRACPFILGNECSERLAYYGMSTNLVTYFNTKL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS  +ASKN +NW GTCYI PL+GAF+ADAYLGRY TI  FSI+YVIGMTL+TLSA+VP
Sbjct  61    NQSGPTASKNNANWGGTCYITPLIGAFVADAYLGRYRTILYFSIVYVIGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P+C     C  T   + +CF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GIKPSCDDQGNCHATEAQSAMCFVALYLIALGTGGIKPCVSSFGADQFDDADEAEKEHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIG LVA+SL+VW+Q  VSWGWGFG+PAVAMA+AV  F SGTRLYR QKP
Sbjct  181   SFFNWFYLSINIGGLVAASLLVWVQTTVSWGWGFGIPAVAMAIAVVSFLSGTRLYRIQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVP-IDKSLLHE-TSGLESNIQGSRKLSHTNELRFFDKA  1202
             GGSP TR+ QVIVAS+RK KV+V   D+S  +E     ES IQGSRKL HTN L FFDKA
Sbjct  241   GGSPLTRMCQVIVASIRKSKVQVTNDDRSAFYEIEQDSESAIQGSRKLEHTNGLSFFDKA  300

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV+   +  K   +PWRLCTVTQVEELK+IIRLLPIWATGIIFSTVY QM + F+ Q   
Sbjct  301   AVIRDSDNVKDPINPWRLCTVTQVEELKAIIRLLPIWATGIIFSTVYSQMGSYFILQGDT  360

Query  1383  MNTYVGTFK---IPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
             M+  +G+ K   I  A+LSVFDT+SVI WV +YDR+IVP+ARKFTG ++GLT LQRMG G
Sbjct  361   MDNRLGSNKKLHISPATLSVFDTISVIFWVLVYDRIIVPVARKFTGRENGLTQLQRMGTG  420

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             LFISI AMV + +LE +RL MV+RHN YD+ +VP+S+F Q+P YFIIGCAEVFTFIGQLE
Sbjct  421   LFISIFAMVYSVILENIRLKMVRRHNYYDLNQVPMSLFLQIPPYFIIGCAEVFTFIGQLE  480

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+QAPD+MRS CSAL L T A G+YLSS L+TIV  IT RNG PGWL + LNYGHLDY
Sbjct  481   FFYEQAPDAMRSTCSALQLLTVAFGSYLSSLLITIVTKITARNGSPGWLPDKLNYGHLDY  540

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             FF LL VLSV+N  VF++V+K+YTYKK +  +
Sbjct  541   FFLLLTVLSVLNFVVFLLVSKLYTYKKPVGNL  572



>ref|XP_011090404.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=568

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/566 (68%), Positives = 463/566 (82%), Gaps = 2/566 (0%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E M  +D YTKDGT D+RN PANKNKTG WKA PFILGN+C ERLA+YGMSSNL++Y+ T
Sbjct  2     EVMGNEDKYTKDGTSDFRNNPANKNKTGAWKASPFILGNQCCERLAFYGMSSNLLLYYTT  61

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +LNQ + +ASKNLSNW GTCY++PL GAFLADAYLGRYWTIA FS+IYV+GMTL+TLSA+
Sbjct  62    QLNQHSATASKNLSNWLGTCYVLPLFGAFLADAYLGRYWTIAGFSVIYVLGMTLLTLSAS  121

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG+ P C    +C  T   T V  +ALYLVALG+GG+KPCVSSYGADQFDD DE E+  
Sbjct  122   VPGLRPRCYKKVECYETDSQTAVFSLALYLVALGSGGMKPCVSSYGADQFDDGDEVEKGQ  181

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFS NIG L+  S+ V IQ  + WGWGFGV AVAMA+AV FF SG+R+YRYQ
Sbjct  182   KSSFFNWFYFSTNIGVLIGCSIPVLIQVNIGWGWGFGVSAVAMAIAVAFFISGSRVYRYQ  241

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
              PGG+P TRL QV+VASLRK +V+VP DKS+L+ET+  ES I GSRKL HTN+ RF DKA
Sbjct  242   NPGGNPLTRLCQVLVASLRKYRVEVPGDKSILYETADAESAIVGSRKLDHTNQFRFLDKA  301

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AV ++ ++  GS +PWRLCTV+QVEELK IIRLLP+ ATGIIF+TV+GQMS  F+ QA  
Sbjct  302   AVEKASDHSNGSVNPWRLCTVSQVEELKWIIRLLPVLATGIIFNTVFGQMSNLFLLQAEY  361

Query  1383  MNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             M+  +G   FKIP ASL++F+++SVI WVP+YDR I+PM RKFTGHK GLT LQR+G GL
Sbjct  362   MDARLGLSNFKIPIASLAIFNSISVIFWVPVYDRFIIPMTRKFTGHKKGLTQLQRIGTGL  421

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             FIS+  M+SA +LEM+RL  V+RH+ Y V E PISVFWQVPQ+ I+GCAEVFT IGQ+EF
Sbjct  422   FISVFGMISAGILEMLRLGTVRRHSSYKVMEAPISVFWQVPQHVIVGCAEVFTNIGQMEF  481

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FY+QAPDSMRSLC+ALSLTT A+GNYLSS +V IV  I+TR+G+PGW+ +NLNYGHL YF
Sbjct  482   FYEQAPDSMRSLCAALSLTTIALGNYLSSLIVAIVMAISTRDGRPGWIPDNLNYGHLHYF  541

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             F LLA LSV+NLGVF+VVAK Y+Y K
Sbjct  542   FLLLAGLSVLNLGVFIVVAKRYSYNK  567



>ref|XP_011003666.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Populus euphratica]
Length=568

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/562 (68%), Positives = 465/562 (83%), Gaps = 1/562 (0%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             +D +TKDG  D+R  PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +LNQS
Sbjct  3     EDGFTKDGATDFRGNPAIKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQLNQS  62

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
                A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV GMTL+TLSA++ G+ 
Sbjct  63    NAVAVNNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVFGMTLLTLSASIHGLK  122

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P+C     C  TG  T V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSSFF
Sbjct  123   PSCDRTNVCHTTGLRTSVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDENEKKKKSSFF  182

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGAL+A+S++VWIQ  V WGWGFG+PAVAMA++V  FFSGTRLYR Q+ GGS
Sbjct  183   NWFYFSINIGALIAASVLVWIQTNVGWGWGFGIPAVAMAVSVVSFFSGTRLYRNQRLGGS  242

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VAS RK  V+VP DKSLL ET+  ES + GSRKL HT++L F DKAAV   
Sbjct  243   PLTRMCQVLVASFRKFHVEVPHDKSLLFETADHESAVIGSRKLDHTDQLSFLDKAAVETP  302

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
              +  KGS + W+LCTVTQVEE KSIIRLLP+WATGIIF+ VY QM T FV Q   M+  +
Sbjct  303   SDRLKGSANQWKLCTVTQVEEFKSIIRLLPVWATGIIFAAVYSQMGTLFVLQGNTMDLRM  362

Query  1398  G-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G +F+IP ASLS+FDT+SVI WVPIYDR IVP AR+FTGHK+G T LQR+ +GL ISI A
Sbjct  363   GKSFEIPSASLSLFDTISVIFWVPIYDRAIVPFARRFTGHKNGFTQLQRIAIGLVISIFA  422

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             M+ A  LE+VRL  V++HN Y++  VP+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+QAP
Sbjct  423   MLVAGTLELVRLREVRKHNYYELKHVPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYEQAP  482

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRSLCSALSLTT A+GNYLS+FLV IV D++TR+GKPGW+ +NLN+GHL YFFWLLAV
Sbjct  483   DAMRSLCSALSLTTAALGNYLSTFLVNIVRDMSTRHGKPGWIPDNLNHGHLHYFFWLLAV  542

Query  1935  LSVMNLGVFVVVAKMYTYKKAI  2000
             LSV+NLGV++++A+ YTYKKA+
Sbjct  543   LSVLNLGVYLLIARWYTYKKAV  564



>ref|XP_009624729.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Nicotiana tomentosiformis]
Length=579

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/573 (67%), Positives = 463/573 (81%), Gaps = 4/573 (1%)
 Frame = +3

Query  297   RSEAMEEDDV--YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMI  470
             R   ME DD   YTKDGT+D   +PANK KTGTWKACPFILG+E  ERLAYYGMS+NL+ 
Sbjct  3     REARMERDDDEDYTKDGTVDIYKKPANKKKTGTWKACPFILGDEGCERLAYYGMSTNLVN  62

Query  471   YFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMT  650
             Y Q +LN +  ++S++++NW GTCY+ PL+GAFLADAYLGRYWTIATFS +Y+IGM  +T
Sbjct  63    YIQQKLNLNNAASSRSVTNWQGTCYVTPLLGAFLADAYLGRYWTIATFSTLYIIGMAFLT  122

Query  651   LSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  830
             +SA++ G+ P C  +E C  TG      F+A+YL+A GTGGIKPCVSS+GADQFDD DE 
Sbjct  123   MSASISGLKPAC-DNESCNPTGSQKTAFFVAIYLIAFGTGGIKPCVSSFGADQFDDNDET  181

Query  831   ERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRL  1010
             E+K KSSFFNWFY SINIGAL+ASS++VWIQ  V WGWGFGVPAVAMA+A+ FFFSGTRL
Sbjct  182   EKKSKSSFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGVPAVAMAIALVFFFSGTRL  241

Query  1011  YRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRF  1190
             YR Q PGGSP TR+ QV VAS+RK  VK P D+SLL+ETS +ESNI+GSRKL H+ E RF
Sbjct  242   YRLQPPGGSPLTRILQVFVASIRKCNVKPPPDESLLYETSDVESNIKGSRKLEHSEEFRF  301

Query  1191  FDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVS  1370
             FDKAAV    +   GS +PW+LCTVTQVEE+KSIIRLLP+WATGI+FS VY QMST FV 
Sbjct  302   FDKAAVETGSDKVNGSVNPWKLCTVTQVEEVKSIIRLLPVWATGIVFSCVYSQMSTMFVL  361

Query  1371  QAIGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMG  1547
             Q   M+ ++GT F IP A LS+FDTLSVI W PIYD +I+P+ARK TGH+ G T LQRMG
Sbjct  362   QGNIMDQHIGTNFTIPSACLSIFDTLSVIFWAPIYDLVIIPLARKLTGHERGFTQLQRMG  421

Query  1548  VGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQ  1727
             +GL ISI AMV+A VLE++RL  V+R+N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQ
Sbjct  422   IGLVISIFAMVAAGVLEVIRLDYVRRNNYYDLKTIPMSIFWQVPQYFLIGCAEVFTFIGQ  481

Query  1728  LEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHL  1907
             LEFFYDQAPD+MRSLCSAL LTT A+GNYLSS +VTIV ++TTR+GK GW+ +NLN GHL
Sbjct  482   LEFFYDQAPDAMRSLCSALCLTTTALGNYLSSLIVTIVTNVTTRHGKLGWIPDNLNRGHL  541

Query  1908  DYFFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             DYF+WLLA+LS +N  V++ +AK YTYKK   K
Sbjct  542   DYFYWLLAILSFINFFVYLWIAKWYTYKKVTGK  574



>ref|XP_009795638.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=578

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/573 (67%), Positives = 463/573 (81%), Gaps = 2/573 (0%)
 Frame = +3

Query  291   QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMI  470
              I +    +DD YTKDGT+D   +PANK KTGTWKACPFILG+E  ERLAYYGMS+NL+ 
Sbjct  2     DIEARMERDDDDYTKDGTVDIYKKPANKKKTGTWKACPFILGDEGCERLAYYGMSTNLVN  61

Query  471   YFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMT  650
             Y Q +LN S  ++S++++NW GTCY+ PL+GAFLADAYLGRYWTIATFS +Y+IG+  +T
Sbjct  62    YIQQKLNLSNAASSRSVTNWQGTCYVTPLLGAFLADAYLGRYWTIATFSTLYIIGIAFLT  121

Query  651   LSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  830
             +SA++ G+ P C  +  C  TG      F+A+YL+A GTGGIKPCVSS+GADQFDD DE 
Sbjct  122   MSASIGGLKPAC-DNGSCHPTGSQKTAFFVAIYLIAFGTGGIKPCVSSFGADQFDDNDET  180

Query  831   ERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRL  1010
             E+K KSSFFNWFY SIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+A+ FFFSGTRL
Sbjct  181   EKKSKSSFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGVPAVAMAIALVFFFSGTRL  240

Query  1011  YRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRF  1190
             YR Q PGGSP TR+ QV VAS+RK  VK P D+SLL+ETS +ESNI+GSRKL H+ E RF
Sbjct  241   YRLQPPGGSPLTRILQVFVASIRKCNVKPPRDESLLYETSDVESNIKGSRKLEHSEEFRF  300

Query  1191  FDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVS  1370
             FDKAAV    +   GS +PW+LCTVTQVEE+KSIIRLLP+WATGI+FS VY QMST FV 
Sbjct  301   FDKAAVETGSDKVNGSVNPWKLCTVTQVEEVKSIIRLLPVWATGIVFSCVYSQMSTMFVL  360

Query  1371  QAIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMG  1547
             Q   M+ ++G  F IP A LS+FDTLSVI W PIYD +I+P+ARKFTGH+ G T LQRMG
Sbjct  361   QGNIMDQHIGPNFTIPSACLSIFDTLSVIFWAPIYDLVIIPLARKFTGHERGFTQLQRMG  420

Query  1548  VGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQ  1727
             +GL ISI AMV+A VLE++RL  V+R+N YD+T +P+S+FWQVPQYF+IGCAEVFTFIGQ
Sbjct  421   IGLVISIFAMVAAGVLEVIRLDYVRRNNYYDLTTIPMSIFWQVPQYFLIGCAEVFTFIGQ  480

Query  1728  LEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHL  1907
             LEFFYDQAPD+MRSLCSAL LTT A+GNYLSS +VTIV ++TTRNGK GW+ +NLN GHL
Sbjct  481   LEFFYDQAPDAMRSLCSALCLTTTALGNYLSSLIVTIVINVTTRNGKLGWIPDNLNRGHL  540

Query  1908  DYFFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             DYF+WLLA+LS +N  V++ +AK YTYKK   K
Sbjct  541   DYFYWLLAILSFINFFVYLWIAKWYTYKKVSGK  573



>ref|XP_004308641.1| PREDICTED: peptide transporter PTR5-like [Fragaria vesca subsp. 
vesca]
Length=586

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/569 (68%), Positives = 473/569 (83%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             + EDD+YTKDGT+DYR  PANKN TGTWKACPFILGNE  ERLA+YG+S+NL++YF+  L
Sbjct  17    IAEDDLYTKDGTVDYRGNPANKNVTGTWKACPFILGNEFCERLAFYGLSANLVLYFKNHL  76

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +QS+ +A+K++SNW+GTCY+ PL+GAFLADAYLGRY TIA+F+IIYVIGM L+T+S +VP
Sbjct  77    HQSSAAAAKSISNWTGTCYLTPLIGAFLADAYLGRYKTIASFTIIYVIGMALLTMSTSVP  136

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC+  + C VT   +  C++ALYL+AL TGGIKPCVS+YGADQFD+ DE E+KHKS
Sbjct  137   GLKPTCVLEDDCYVTPGQSAACYVALYLIALATGGIKPCVSAYGADQFDEDDEVEKKHKS  196

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYF +N+GAL+ASSL+VWIQ    W WGFG+PAVAMA+AV  FF GTRLYR QKP
Sbjct  197   SFFNWFYFVVNVGALIASSLLVWIQTNKGWEWGFGIPAVAMAIAVVSFFLGTRLYRNQKP  256

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS+RK KVKVP DKS+ +ET+  ES I+GSRKL HTNE RFFDKA V
Sbjct  257   GGSPITRIVQVVVASVRKYKVKVPEDKSVFYETADAESAIKGSRKLEHTNEFRFFDKAVV  316

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KG  +PWRLCTVTQVEELKSIIRLLP+WATGIIF+ V+ QM   FV Q   M+
Sbjct  317   ELPTDNIKGFKNPWRLCTVTQVEELKSIIRLLPVWATGIIFAAVFSQMGNFFVLQGSLMD  376

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
              +VG  +F+IP A LSVFDTLSVI+W+PIYDRLIVP +RKFTGHK+G+T LQRMG+GLFI
Sbjct  377   LHVGSSSFEIPAACLSVFDTLSVIIWIPIYDRLIVPFSRKFTGHKNGITSLQRMGIGLFI  436

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +M+ AA+LE +RL  V+ HN YD+  +P+SVFWQVPQYF+IG AEVFT IGQ++FFY
Sbjct  437   SIFSMICAAILEHIRLQKVREHNYYDLEHMPMSVFWQVPQYFLIGAAEVFTVIGQVDFFY  496

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSL SAL+L+T A+GNY +S LVTIVA++TT+N K GWL +NLNYGHLDYFF 
Sbjct  497   DQAPDAMRSLSSALALSTVALGNYFNSLLVTIVANVTTKNNKAGWLPDNLNYGHLDYFFC  556

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
              LAVLSV+NLG F++++K YTYKK +  +
Sbjct  557   FLAVLSVLNLGAFLLISKWYTYKKTLGSM  585



>ref|XP_006373974.1| hypothetical protein POPTR_0016s11940g [Populus trichocarpa]
 gb|ERP51771.1| hypothetical protein POPTR_0016s11940g [Populus trichocarpa]
Length=568

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/562 (69%), Positives = 469/562 (83%), Gaps = 1/562 (0%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             +D +TKDG  D+R  PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +LNQS
Sbjct  3     EDGFTKDGAADFRGNPAIKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQLNQS  62

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
              + A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV GMTL+TLSA++ G+ 
Sbjct  63    NVVAVNNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVFGMTLLTLSASIHGLK  122

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P+C     C  TG  T V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSSFF
Sbjct  123   PSCDRTNVCHTTGLQTSVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDEDEKKRKSSFF  182

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGAL+A+S++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR Q+ GGS
Sbjct  183   NWFYFSINIGALIAASVLVWIQTNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQRLGGS  242

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VAS RK +V+VP DKSLL ET+  ES + GSRKL HT++L FFDKAAV   
Sbjct  243   PLTRMCQVLVASFRKFRVEVPNDKSLLFETADHESAVMGSRKLDHTDQLSFFDKAAVETP  302

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
              +  KGS + W+LCTVTQVEELKSIIRLLP+WATGIIFS VY QM T FV Q   M+  +
Sbjct  303   SDRLKGSANQWKLCTVTQVEELKSIIRLLPVWATGIIFSAVYSQMGTLFVLQGNTMDLRM  362

Query  1398  G-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G +F+IP ASLS+FDT+SVI WVPIYDR IVP AR+FTGHK+G T LQR+ +GL ISI A
Sbjct  363   GKSFEIPSASLSLFDTISVIFWVPIYDRAIVPFARRFTGHKNGFTQLQRIAIGLVISIFA  422

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             M+ A  LE+VRL  V++HN Y++  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+QAP
Sbjct  423   MLVAGTLELVRLREVRKHNYYELKHIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYEQAP  482

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRSLCSALSLTT A+GNYLS+FLV IV D++TR+GKPGW+ +NLN+GHL YFFWLLAV
Sbjct  483   DAMRSLCSALSLTTAALGNYLSTFLVNIVTDMSTRHGKPGWIPDNLNHGHLHYFFWLLAV  542

Query  1935  LSVMNLGVFVVVAKMYTYKKAI  2000
             LSV+NLGV+++VA+ YTYKKA+
Sbjct  543   LSVLNLGVYLLVARWYTYKKAV  564



>ref|XP_002877959.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54218.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=570

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/568 (66%), Positives = 461/568 (81%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTQDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAF+ADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFIADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P     + C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNADTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKIKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFLGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK +VKVP DKSLL ET+  ESNI+GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLKFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
              ++SD  K G  +PWRLC+VTQVEELKSII LLP+WATGI+F+TVY QM+T FV Q   M
Sbjct  301   EIQSDSIKDGEVNPWRLCSVTQVEELKSIISLLPVWATGIVFATVYSQMNTMFVLQGNTM  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ I+P+ARKFT ++ G T LQRMG+GL +
Sbjct  361   DQHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIIPLARKFTRNERGFTQLQRMGIGLVV  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE+VRL  VK HN YD  ++P+S+FWQ+PQY +IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVVRLDYVKSHNAYDQKQIPMSIFWQIPQYLLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  IT +NGKPGW+ +NLN GHLDYFF+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKITKKNGKPGWIPDNLNRGHLDYFFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LL  LS +N  V++ ++K Y YKKA+ +
Sbjct  541   LLETLSFLNFLVYLWISKRYKYKKAVGR  568



>ref|XP_011019153.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Populus euphratica]
Length=567

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/567 (68%), Positives = 465/567 (82%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M +DD Y+ DGT+D +  PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MAQDD-YSNDGTVDIKGNPANKEKTGKWKACRFILGNECCERLAYYGMSTNLVNYLEDRL  59

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+F +IY+IGMTL+TLSA+VP
Sbjct  60    NQGNVAASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFVVIYIIGMTLLTLSASVP  119

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G++P+C   + C  T   T   F+ALY +ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLAPSC-DKDSCHPTTGQTAAFFVALYFIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+ASS++VWIQ  V WGWGFG+PAV MA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGIPAVVMAVAVVFFFLGSKLYRIQKP  238

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK +V+VP DKSLL+ET+G  S IQGSRKL HT++ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASSRKYRVQVPADKSLLYETTGEGSQIQGSRKLEHTDKFKFFDKAAV  298

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+F+TVY QMST FV Q   M+
Sbjct  299   ETQTDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFATVYSQMSTMFVLQGNTMD  358

Query  1389  TY-VGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              + V  FKIP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  359   QHMVPHFKIPSASLSLFDTLSVIFWAPVYDRIIVPYARKFTGHERGFTQLQRMGIGLVIS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I++M+ A VLE+VRL  V+ +N YD+  +PI++FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  419   IISMIVAGVLEVVRLNFVRENNYYDLEYIPITIFWQVPQYFLIGCAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  +TTR GK GW+ +NLN GHLDYF+WL
Sbjct  479   QAPDAMRSLCSALSLTTVALGNYLSTLLVTIVTKVTTRGGKLGWIPDNLNRGHLDYFYWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LA+LS +N   ++ ++K Y YKKA  +
Sbjct  539   LAILSFLNFAAYLWISKWYAYKKATER  565



>ref|XP_002323559.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF05320.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=569

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/564 (69%), Positives = 467/564 (83%), Gaps = 3/564 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E D YT +GT+D    PANK KTG WK+C FILGNEC ERLAYYGMS+NL+ Y   RL
Sbjct  1     MAETD-YTNNGTVDIEGNPANKKKTGNWKSCRFILGNECCERLAYYGMSTNLVNYLGDRL  59

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++A+ N++NWSGTCY+ PL+GAFLAD+YLGRYWTIA+F IIY+IGMTL+TLSA+V 
Sbjct  60    NQGNVAAANNVTNWSGTCYVTPLIGAFLADSYLGRYWTIASFVIIYIIGMTLLTLSASVT  119

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  T   T  CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLKPSC-DKDSCHPTTGQTAACFVALYMIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGALVASS++VWIQ  V WGWGFGVPAVAMA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGVPAVAMAVAVVFFFLGSKLYRIQKP  238

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK  V+VP DKSLL+ET+  ES IQGSRKL HTN+ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASFRKSNVQVPADKSLLYETAEEESQIQGSRKLEHTNKFKFFDKAAV  298

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                D+  KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+FSTVY QMST FV Q   M+
Sbjct  299   KTQDDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFSTVYSQMSTMFVLQGNTMD  358

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  359   QHMGPHFQIPSASLSLFDTLSVIFWAPVYDRIIVPYARKFTGHERGFTQLQRMGIGLVIS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I++M++A +LE+VRL  V+++N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  419   IVSMITAGILEVVRLNFVQKNNYYDLKYIPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  ITTR GK GW+ +N+N GHLDYF+WL
Sbjct  479   QAPDAMRSLCSALSLTTVALGNYLSTLLVTIVTKITTRGGKLGWIPDNMNRGHLDYFYWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA+LS +N  +++ ++K +TYKKA
Sbjct  539   LAILSFLNFILYLWISKWFTYKKA  562



>ref|NP_195738.1| peptide transporter PTR5 [Arabidopsis thaliana]
 sp|Q9LFB8.1|PTR5_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 8.2; Short=AtNPF8.2; AltName: 
Full=Peptide transporter PTR5 [Arabidopsis thaliana]
 emb|CAB69846.1| oligopeptide transporter-like protein [Arabidopsis thaliana]
 gb|AED90307.1| peptide transporter PTR5 [Arabidopsis thaliana]
Length=570

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/565 (67%), Positives = 460/565 (81%), Gaps = 4/565 (1%)
 Frame = +3

Query  309   MEED-DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             ME+D D+YTKDGTLD   +PANKNKTGTWKAC FILG EC ERLAYYGMS+NL+ Y + +
Sbjct  1     MEDDKDIYTKDGTLDIHKKPANKNKTGTWKACRFILGTECCERLAYYGMSTNLINYLEKQ  60

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             +N   +SASK++SNWSGTCY  PL+GAF+ADAYLGRYWTIA+F +IY+ GMTL+T+SA+V
Sbjct  61    MNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISASV  120

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
             PG++PTC + E C  T   T + FIALYL+ALGTGGIKPCVSS+GADQFDDTDEKE++ K
Sbjct  121   PGLTPTC-SGETCHATAGQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKESK  179

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP VAMA+AV FFF+G+  YR QK
Sbjct  180   SSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMAIAVVFFFAGSNFYRLQK  239

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QVIVAS RK KVK+P D+SLL+E    ES+I GSRKL HT  L FFDKAA
Sbjct  240   PGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSIIGSRKLEHTKILTFFDKAA  299

Query  1206  V-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V  ESD       S W+LCTVTQVEELK++IRLLPIWATGI+F++VY QM T FV Q   
Sbjct  300   VETESDNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGIVFASVYSQMGTVFVLQGNT  359

Query  1383  MNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             ++ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP ARK+TGH+ G T LQR+G+GL 
Sbjct  360   LDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFARKYTGHERGFTQLQRIGIGLV  419

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI +MVSA +LE+ RL  V+ HNLY+   +P+++FWQVPQYF++GCAEVFTFIGQLEFF
Sbjct  420   ISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQVPQYFLVGCAEVFTFIGQLEFF  479

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQAPD+MRSLCSALSLT  A GNYLS+FLVT+V  +T   G+PGW+A NLN GHLDYFF
Sbjct  480   YDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYFF  539

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKK  1994
             WLLA LS +N  V++ +AK YTYKK
Sbjct  540   WLLAGLSFLNFLVYLWIAKWYTYKK  564



>ref|XP_002870939.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47198.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=570

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/565 (67%), Positives = 460/565 (81%), Gaps = 4/565 (1%)
 Frame = +3

Query  309   MEED-DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             MEED D+YT+DGTLD   +PANKNKTGTWKAC FILG EC ERLAYYGMS+NL+ Y + +
Sbjct  1     MEEDKDIYTQDGTLDIHKKPANKNKTGTWKACRFILGTECCERLAYYGMSTNLVNYLEKQ  60

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             +N  T++AS +++NWSGTCY  PL+GAF+ADAYLGRYWTIA+F +IY+ GMTL+T+SA+V
Sbjct  61    MNMETVTASNSVTNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYISGMTLLTISASV  120

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
             PG++PTC +   C  T   T V FIALYL+ALGTGGIKPCVSS+GADQFDDTDEKE++ K
Sbjct  121   PGLTPTC-SGNSCHATASQTAVTFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKESK  179

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP VAM +AV FFF+G++ YR QK
Sbjct  180   SSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMGVAVVFFFAGSKFYRLQK  239

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QVIVAS RK KVKVP D+SLL+E    ES+I GSRKL HT  L FFDKAA
Sbjct  240   PGGSPLTRMLQVIVASCRKSKVKVPEDESLLYENQDAESSIIGSRKLEHTKILTFFDKAA  299

Query  1206  V-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V  ESD       S W+LCTVTQVEELK++IRLLPIWATGI+F++VY QM T FV Q   
Sbjct  300   VQTESDNKGAAKSSLWKLCTVTQVEELKALIRLLPIWATGIVFASVYSQMGTVFVLQGNT  359

Query  1383  MNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             ++ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP ARK+TGH+ G T LQR+G+GL 
Sbjct  360   LDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFARKYTGHERGFTQLQRIGIGLV  419

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             ISI AMVSA +LE+ RL  V+ HNLY+   +P+++FWQVPQYF +GCAEVFTF+GQLEFF
Sbjct  420   ISIFAMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQVPQYFFVGCAEVFTFVGQLEFF  479

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQAPD+MRSLCSALSLTT A GNYLS+FLVT++ +IT   G+PGW+A NLN GHLDYFF
Sbjct  480   YDQAPDAMRSLCSALSLTTVAFGNYLSTFLVTLITNITRSGGRPGWIAKNLNNGHLDYFF  539

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKK  1994
             WLLA LS +N  +F+ +AK YTYKK
Sbjct  540   WLLAGLSFLNFLIFLWIAKWYTYKK  564



>ref|XP_006403613.1| hypothetical protein EUTSA_v10010246mg [Eutrema salsugineum]
 gb|ESQ45066.1| hypothetical protein EUTSA_v10010246mg [Eutrema salsugineum]
Length=570

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/568 (67%), Positives = 459/568 (81%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTEDGTVDINKNPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAF+ADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFVADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+    + C      T V F+ALY++ALGTGGIKPCVSS+GADQFDD DE E+  KS
Sbjct  121   GLRPSNCNGDTCHPNTGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDDNDEAEKLKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GALVA++++VWIQ  V WGWGFGVP VAM +AVTFFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALVAATVLVWIQMNVGWGWGFGVPTVAMVIAVTFFFMGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVAS RK  VKVP DKSLL ET+  ESNI GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVASFRKVSVKVPEDKSLLFETADDESNITGSRKLEHTDNLKFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K+G  +PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM+T FV Q   +
Sbjct  301   ESQSDSIKEGEVNPWRLCSVTQVEELKSIITLLPVWASGILFATVYSQMNTMFVLQGNTL  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT H+ G T LQRMG+GL I
Sbjct  361   DQHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRHERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE+VRL  VK HN YD  ++P+S+FWQVPQY ++GCAEVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVVRLDYVKTHNAYDQKKIPMSIFWQVPQYLLVGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NGKPGW+ +NLN GHLDY+F+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMRLTKKNGKPGWIPDNLNRGHLDYYFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKK I +
Sbjct  541   LLATLSFLNFLVYLWISKRYKYKKVIGR  568



>ref|XP_011003660.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X1 [Populus 
euphratica]
Length=576

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/570 (68%), Positives = 470/570 (82%), Gaps = 3/570 (1%)
 Frame = +3

Query  291   QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMI  470
             ++R E M E D YT +GT+D +  PA+K KTG WK+C FILGNEC ERLAYYGMS+NL+ 
Sbjct  2     KVRKETMAEAD-YTNNGTVDIKGNPADKKKTGNWKSCRFILGNECCERLAYYGMSTNLVN  60

Query  471   YFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMT  650
             Y   RLNQ  ++A+ N++NWSGTCY+ PL+GAFLAD+YLGRYWTIA+F IIY++GMTL+T
Sbjct  61    YLGDRLNQGNVAAANNVTNWSGTCYVTPLIGAFLADSYLGRYWTIASFVIIYIVGMTLLT  120

Query  651   LSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  830
             LSA+V G+ P+C   + C  T   T  CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE 
Sbjct  121   LSASVTGLKPSC-NKDSCYPTTGQTAACFVALYMIALGTGGIKPCVSSFGADQFDETDET  179

Query  831   ERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRL  1010
             ER+ KSSFFNWFY SINIGALVASS++VWIQ  V WGWGFGVPAV MA+AV FFF G++L
Sbjct  180   EREKKSSFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGVPAVVMAVAVVFFFLGSKL  239

Query  1011  YRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRF  1190
             YR QKPGGSP TR+ QVIVAS RK  V+VP DKSLL+ET   ES IQGSRKL HTN+ +F
Sbjct  240   YRIQKPGGSPITRIVQVIVASFRKSNVQVPADKSLLYETVEEESQIQGSRKLEHTNKFKF  299

Query  1191  FDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVS  1370
             FDKAAV   D+  KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+FSTVY QMST FV 
Sbjct  300   FDKAAVKTQDDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFSTVYSQMSTMFVL  359

Query  1371  QAIGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMG  1547
             Q   M+ ++G  F+IP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG
Sbjct  360   QGNTMDQHLGPHFQIPSASLSLFDTLSVIFWAPVYDRIIVPYARKFTGHERGFTQLQRMG  419

Query  1548  VGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQ  1727
             +GL ISI++M++A +LE+VRL  V+++N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQ
Sbjct  420   IGLVISIVSMITAGILEVVRLNFVQKNNYYDLKYIPMSIFWQVPQYFLIGCAEVFTFIGQ  479

Query  1728  LEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHL  1907
             LEFFYDQAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  ITTR GK GW+ +N+N GHL
Sbjct  480   LEFFYDQAPDAMRSLCSALSLTTVALGNYLSTLLVTIVTKITTRGGKLGWIPDNMNRGHL  539

Query  1908  DYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             DYF+WLLA+LS +N  +++ ++K +TYKKA
Sbjct  540   DYFYWLLAILSFLNFILYLWISKWFTYKKA  569



>ref|NP_190982.1| peptide transporter PTR1 [Arabidopsis thaliana]
 sp|Q9M390.1|PTR1_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 8.1; Short=AtNPF8.1; AltName: 
Full=Peptide transporter PTR1 [Arabidopsis thaliana]
 gb|AAK25865.1|AF360155_1 putative peptide transport protein [Arabidopsis thaliana]
 emb|CAB70988.1| peptide transport-like protein [Arabidopsis thaliana]
 gb|AAM44932.1| putative peptide transport protein [Arabidopsis thaliana]
 gb|AAM61341.1| peptide transport-like protein [Arabidopsis thaliana]
 gb|AEE79192.1| peptide transporter PTR1 [Arabidopsis thaliana]
Length=570

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/568 (66%), Positives = 459/568 (81%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTQDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAF+ADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFIADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P     + C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNADTCHPNSSQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDENEKIKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFFGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK  VKVP DKSLL ET+  ESNI+GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKISVKVPEDKSLLFETADDESNIKGSRKLVHTDNLKFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K G  +PWRLC+VTQVEELKSII LLP+WATGI+F+TVY QMST FV Q   M
Sbjct  301   ESQSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWATGIVFATVYSQMSTMFVLQGNTM  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ I+P+ARKFT ++ G T LQRMG+GL +
Sbjct  361   DQHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIIPLARKFTRNERGFTQLQRMGIGLVV  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE+VRL  VK HN YD  ++ +S+FWQ+PQY +IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVVRLDYVKTHNAYDQKQIHMSIFWQIPQYLLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  IT +NGKPGW+ +NLN GHLDYFF+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKITKKNGKPGWIPDNLNRGHLDYFFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKKA+ +
Sbjct  541   LLATLSFLNFLVYLWISKRYKYKKAVGR  568



>ref|XP_006287367.1| hypothetical protein CARUB_v10000567mg [Capsella rubella]
 gb|EOA20265.1| hypothetical protein CARUB_v10000567mg [Capsella rubella]
Length=577

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/564 (66%), Positives = 462/564 (82%), Gaps = 3/564 (1%)
 Frame = +3

Query  312   EED-DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             EED D+YT+DGTLD   +PANK KTGTWKAC FILG EC ERLAYYGMS+NL+ Y + ++
Sbjct  10    EEDMDIYTQDGTLDIYKKPANKKKTGTWKACRFILGTECCERLAYYGMSTNLVNYLEKQM  69

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N   ++A+ ++SNWSGTCY  PL+GAF+ADAYLGRYWTI+TF +IY+ GMTL+T+SA+VP
Sbjct  70    NMENVTATTSVSNWSGTCYATPLIGAFIADAYLGRYWTISTFVVIYIAGMTLLTMSASVP  129

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G++PTC   +KC  T   T + FIALYL+ALGTGGIKPCVSS+GADQFDDTDE+E++ KS
Sbjct  130   GLTPTCNG-DKCHATSAQTALTFIALYLIALGTGGIKPCVSSFGADQFDDTDEEEKESKS  188

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYF IN+GA++ASS++VWIQ  V WGWG G+P VAMA+AV FFF+G++ YR QKP
Sbjct  189   SFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGIPTVAMAIAVVFFFAGSKFYRLQKP  248

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK KV+VP D+SLL+E    ES+I+GSRKL HT  L FFDKAAV
Sbjct  249   GGSPLTRMLQVIVASCRKSKVRVPEDESLLYENQDAESSIRGSRKLEHTKILTFFDKAAV  308

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 + K  + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QM T FV Q   M+
Sbjct  309   ETESDNKAAATSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTVFVLQGNTMD  368

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP+ARK+TGH+ G T LQRMG+GL IS
Sbjct  369   QHMGPNFKIPSASLSLFDTLSVLFWTPVYDQLIVPLARKYTGHERGFTQLQRMGIGLVIS  428

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +M+SA +LE++RL+ V+ HNLY+   VP+++FWQVPQYF +GCAEVFTFIGQLEFFYD
Sbjct  429   IFSMISAGILEVIRLSYVRTHNLYNEETVPMTIFWQVPQYFFVGCAEVFTFIGQLEFFYD  488

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A GNYLS+ LVT+V ++T   G+PGW+A NLN GHLDYFFWL
Sbjct  489   QAPDAMRSLCSALSLTTVAFGNYLSTLLVTVVTNVTRSGGRPGWIAKNLNNGHLDYFFWL  548

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA LS +N  V++ +AK YTYKKA
Sbjct  549   LAGLSFLNFLVYLWIAKWYTYKKA  572



>ref|XP_006292488.1| hypothetical protein CARUB_v10018717mg [Capsella rubella]
 gb|EOA25386.1| hypothetical protein CARUB_v10018717mg [Capsella rubella]
Length=570

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/568 (66%), Positives = 459/568 (81%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P       C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFLGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK +VKVP DKSLL ET+  ESNI+GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKIRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLKFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K G  +PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM+T FV Q   +
Sbjct  301   ESQSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNTL  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT H+ G T LQRMG+GL I
Sbjct  361   DQHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRHERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AMV+A VLE+VRL  V+ HN YD  ++P+S+FWQ+PQY +IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMVTAGVLEVVRLDYVRSHNAYDQKQIPMSIFWQIPQYLLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NGKPGW+ +NLN GHLDY+F+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKVTKKNGKPGWIPDNLNRGHLDYYFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKKA+ +
Sbjct  541   LLATLSFLNFLVYLWISKRYKYKKAVGR  568



>ref|XP_008442465.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 8.1 
[Cucumis melo]
Length=569

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/564 (67%), Positives = 463/564 (82%), Gaps = 3/564 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT+D   +PA K KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGTVDIHKKPAVKXKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N   ++AS  +++WSGTCY+ PL+GAFLADAYLGR+WTIA+FSIIYV GMTL+TL+A++P
Sbjct  61    NMDNVAASNTVTSWSGTCYLTPLIGAFLADAYLGRFWTIASFSIIYVFGMTLLTLAASIP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C +   C  +G  T   FIALYL+ALGTGGIKPCVSS+GADQFD+ DE ERK KS
Sbjct  121   GLKPSCDS-SGCHPSGGQTAATFIALYLIALGTGGIKPCVSSFGADQFDENDEAERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GA++ASS++VWIQ  V WGWGFGVPAVAMA+AV FFFSG+ LYR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPAVAMAIAVVFFFSGSSLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSG-LESNIQGSRKLSHTNELRFFDKAA  1205
              GSP TR+ QVIVA+ RK +V+VP DKSLLHET+  +ES I+GSRKL HTN  +F DKA 
Sbjct  240   AGSPLTRILQVIVAACRKHRVQVPEDKSLLHETADDIESKIEGSRKLEHTNNFKFLDKAC  299

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   ++  KG  + WRLCTVTQVEELKSI+RLLP+WA+GI+F+ VY QMST FV Q   +
Sbjct  300   VETENDRIKGLQNEWRLCTVTQVEELKSIVRLLPVWASGIVFAAVYSQMSTMFVLQGNTL  359

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G +FKIP ASLS+FDT+SV+ W P+YDR IVP+ARKFT ++ G T LQRMG+GL I
Sbjct  360   DQHIGPSFKIPSASLSIFDTISVLFWAPVYDRFIVPIARKFTNNERGFTQLQRMGIGLAI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ +MV+A  LE+VRL  V+ +NLYDV  +P+S+FWQVPQYF IGCAEVFTFIGQLEFFY
Sbjct  420   SVFSMVTAGALEVVRLNYVRVNNLYDVENIPMSIFWQVPQYFFIGCAEVFTFIGQLEFFY  479

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRS+ +ALSLTT  +GNYLS+ LVTIV  +TTR+GK GW+ +NLN GHLDYFFW
Sbjct  480   DQAPDAMRSMMAALSLTTVGLGNYLSTLLVTIVTKVTTRHGKLGWIPSNLNMGHLDYFFW  539

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKK  1994
             LLA+LSV+N  V+++VAK Y+YK+
Sbjct  540   LLAILSVVNFFVYLLVAKCYSYKR  563



>ref|XP_002533893.1| peptide transporter, putative [Ricinus communis]
 gb|EEF28493.1| peptide transporter, putative [Ricinus communis]
Length=1121

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/573 (69%), Positives = 475/573 (83%), Gaps = 2/573 (0%)
 Frame = +3

Query  291   QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMI  470
             QI  E M EDD+YTKDGTL+ +  PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ 
Sbjct  548   QIPEETMAEDDIYTKDGTLNIKGEPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVN  607

Query  471   YFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMT  650
             Y Q RLNQ  ++AS N++NWSGTCYI PL+GAFLADAY GRYWTIA+F +IY+ GM L+T
Sbjct  608   YLQDRLNQGNVAASNNVTNWSGTCYITPLIGAFLADAYFGRYWTIASFVMIYIFGMALLT  667

Query  651   LSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  830
             +SA+ PG+ P C  H  C  T   T V F ALYL+ALGTGGIKPCVSS+GADQFD+TD+ 
Sbjct  668   ISASAPGLKPFCDKHS-CHPTKTQTAVTFAALYLIALGTGGIKPCVSSFGADQFDETDDD  726

Query  831   ERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRL  1010
             E+K KSSFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV FFF+G++L
Sbjct  727   EKKKKSSFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPAVAMAIAVVFFFAGSKL  786

Query  1011  YRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRF  1190
             YR Q+PGGSP TRL QVIVAS RK  V+VP DKSLL+ET+  ES IQGSRKL HT++L+F
Sbjct  787   YRLQRPGGSPITRLLQVIVASFRKLNVQVPDDKSLLYETTDEESQIQGSRKLEHTDKLKF  846

Query  1191  FDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVS  1370
             FDKAAV    +  K S +PWRLCTVTQVEELK+IIRLLP+WA+GI+F+TVYGQMST FV 
Sbjct  847   FDKAAVETQTDSVKDSTNPWRLCTVTQVEELKAIIRLLPVWASGIVFATVYGQMSTMFVL  906

Query  1371  QAIGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMG  1547
             Q   MN ++G  FKIP ASLS+FDTLSVI W P+YDRLIVP ARK+TG++ G T LQRMG
Sbjct  907   QGNTMNQHMGPHFKIPSASLSLFDTLSVIFWTPVYDRLIVPYARKYTGNERGFTQLQRMG  966

Query  1548  VGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQ  1727
             +GL ISI +M++A VLE+VRL  V+R+N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQ
Sbjct  967   IGLVISIFSMITAGVLEVVRLNYVQRNNYYDLEYIPMSIFWQVPQYFLIGCAEVFTFIGQ  1026

Query  1728  LEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHL  1907
             LEFFYDQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +TTR+GK GW+ +NLN GHL
Sbjct  1027  LEFFYDQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVTKVTTRHGKLGWIPDNLNRGHL  1086

Query  1908  DYFFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             DYF+WLLA+LS++N  V++ +AK YTYKKA  +
Sbjct  1087  DYFYWLLAILSLLNFFVYLWIAKWYTYKKATGR  1119


 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/580 (66%), Positives = 469/580 (81%), Gaps = 2/580 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ME++D+YTKDGT+D+   PA K KTGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEQEDIYTKDGTIDFSGNPAIKKKTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ ++ A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA++ 
Sbjct  61    NQGSVQAVNNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSASLH  120

Query  669   GISPTCIAHEK-CTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
             G+ P+C  H   C  TG+ T V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  121   GLMPSCDNHTNVCNPTGKQTAVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDEAEKKKK  180

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYFSINIGALVASS++VWIQ  V WGWGFG+PAVAMA+AV  FFSG +LYR Q+
Sbjct  181   SSFFNWFYFSINIGALVASSVLVWIQTNVGWGWGFGIPAVAMAIAVMTFFSGIKLYRNQR  240

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QVIVASLRK +V+VP D+SLL ETS  ES ++GSRKL HT +L FFDKAA
Sbjct  241   PGGSPLTRICQVIVASLRKFRVQVPKDESLLFETSDEESAVKGSRKLDHTEQLSFFDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    +  KGS + W LCTVTQVEELKS+IRLLPIWATGIIFS VY QM T FV Q   M
Sbjct  301   VETPSDCVKGSVNKWSLCTVTQVEELKSVIRLLPIWATGIIFSAVYSQMGTLFVLQGNTM  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             +  +  +F+IP ASLS+FDT+SVI WVPIYDR+IVP+AR+FTGHK+G T LQR+ +GL I
Sbjct  361   DLQMSRSFEIPSASLSLFDTISVIFWVPIYDRVIVPIARRFTGHKNGFTQLQRIAIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI+AM+ A  LEMVRL  V++HN Y +  +PIS+FWQVPQYFIIGCAEVFTFIGQLEFFY
Sbjct  421   SIVAMMVAGTLEMVRLRQVRKHNYYKLKHIPISIFWQVPQYFIIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRSLCSALSLTT A+GNYLS+ LV +V D++TR+G PGW+ +NLNYGHL YFFW
Sbjct  481   EQAPDAMRSLCSALSLTTAALGNYLSTLLVNVVTDLSTRHGSPGWIPDNLNYGHLHYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAENGS  2042
             LLAVLS+      +    +YT    +N   +   + + G+
Sbjct  541   LLAVLSLQIPEETMAEDDIYTKDGTLNIKGEPANKKKTGN  580



>ref|XP_010504206.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Camelina sativa]
Length=570

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/568 (66%), Positives = 457/568 (80%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M+E DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MDEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P       C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVGFFFLGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK +VKVP DKSLL ET+  ESNI+GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLNFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K G  +PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM+T FV Q   +
Sbjct  301   ESQSDSIKGGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNTL  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT H+ G T LQRMG+GL I
Sbjct  361   DQHMGPNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRHERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE+VRL  VK HN YD  ++P+S+FWQ+PQY +IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVVRLDYVKSHNAYDQKQIPMSIFWQIPQYLLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NGKPGW+ +NLN GHLDYFF+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKVTKKNGKPGWIPDNLNRGHLDYFFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKKA+ +
Sbjct  541   LLATLSFLNFLVYLWISKRYKYKKAVGR  568



>ref|XP_010923125.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923126.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923127.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923129.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923130.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
Length=574

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/564 (68%), Positives = 458/564 (81%), Gaps = 3/564 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             +D YTKDGT D R  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y + RLNQ 
Sbjct  6     EDKYTKDGTTDLRGNPAVKKDTGNWRACPYILANECCERLAYYGMSTNLVNYMKERLNQG  65

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
               +AS N++NWSGTCYIMPL+GAFLADAYLGRYWTIA+F ++Y+ G+TL+T++A+V G+ 
Sbjct  66    NTTASNNVTNWSGTCYIMPLLGAFLADAYLGRYWTIASFMMVYISGLTLLTMTASVKGLK  125

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P+C  H+ C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K KSSFF
Sbjct  126   PSC-DHDVCDPTNSQTAVVFVALYLIALGTGGIKPCVSSFGADQFDESDESEKKRKSSFF  184

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGALVASS++VWIQ  V WGWGFG+PAV MA+AV  FF GT LYR+QKPGGS
Sbjct  185   NWFYFSINIGALVASSVLVWIQDNVGWGWGFGIPAVVMAIAVASFFVGTALYRHQKPGGS  244

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VAS RK  VKVP DKSLL+E S  ES IQGSRKL HT + +F DKAAV   
Sbjct  245   PLTRIAQVVVASFRKSGVKVPADKSLLYEISEKESVIQGSRKLEHTEKFKFLDKAAVATQ  304

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
             D+  K    PWRLCTVTQVEELKS++R+LPIWA+GIIFSTVY QMST FV Q   ++ ++
Sbjct  305   DDKMKDPVDPWRLCTVTQVEELKSVVRILPIWASGIIFSTVYSQMSTMFVLQGDTLDPHM  364

Query  1398  GT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G  FKIP ASLS+FDT+SVIVWVPIYDR+IVP+ARK TGH  G T L RMG+GL ISI +
Sbjct  365   GPHFKIPPASLSIFDTISVIVWVPIYDRIIVPVARKLTGHDRGFTQLTRMGIGLVISIFS  424

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             M++A +LE+VRL ++ R+NLYD    +P+S+FWQVPQYFIIG AEVFTFIGQLEFFYDQA
Sbjct  425   MLAAGILEVVRLRIIARNNLYDYDGSLPMSIFWQVPQYFIIGAAEVFTFIGQLEFFYDQA  484

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSL SALSLTT A+GNYLS+ LVTIV  +TT+NGK GW+ +NLN GHLDYFFWLLA
Sbjct  485   PDAMRSLLSALSLTTVALGNYLSTLLVTIVTHVTTKNGKLGWIPDNLNRGHLDYFFWLLA  544

Query  1932  VLSVMNLGVFVVVAKMYTYKKAIN  2003
              LS++N  V++ +AK YTYKK  +
Sbjct  545   GLSLLNFVVYLWIAKWYTYKKTAD  568



>ref|XP_004137914.1| PREDICTED: peptide transporter PTR5-like [Cucumis sativus]
 gb|KGN58792.1| hypothetical protein Csa_3G732500 [Cucumis sativus]
Length=569

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/564 (66%), Positives = 463/564 (82%), Gaps = 3/564 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT+D   +PA K KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGTVDVHKKPAIKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N   ++AS ++++WSGTCY+ PL+GAFLADAYLGR+WTIA+FSIIY  GMTL+T++A++P
Sbjct  61    NMDNVTASNSVTSWSGTCYLTPLIGAFLADAYLGRFWTIASFSIIYAFGMTLLTMAASIP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C +   C  +G  T   F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE ERK KS
Sbjct  121   GLKPSCDS-SGCHPSGGQTAATFVALYLIALGTGGIKPCVSSFGADQFDENDEVERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GA++ASS++VWIQ  V WGWGFGVPAVAMA+AV FFFSG+ LYR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPAVAMAIAVVFFFSGSSLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSG-LESNIQGSRKLSHTNELRFFDKAA  1205
              GSP TR+ QVIVA+ RK +V VP DKSLLHET+  +ES I+GSRKL HTN  +F DKA+
Sbjct  240   AGSPLTRILQVIVAACRKHQVHVPEDKSLLHETADDIESKIEGSRKLEHTNNFKFLDKAS  299

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   ++  KG  + WRLCTVTQVEELKSI+RLLP+WA+GI+F+ VY QMST FV Q   +
Sbjct  300   VETENDRIKGLPNEWRLCTVTQVEELKSIVRLLPVWASGIVFAAVYSQMSTMFVLQGNTL  359

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G +FKIP ASLS+FDT+SV+ W P+YDRLIVP+ARKFT ++ G T LQRMG+GL I
Sbjct  360   DQHIGPSFKIPSASLSIFDTISVLFWAPVYDRLIVPIARKFTNNERGFTQLQRMGIGLAI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ +MV+A  LE+ RL  V+ +NLYDV  +P+S+FWQVPQYF IGCAEVFTFIGQLEFFY
Sbjct  420   SVFSMVTAGALEVARLNYVRVNNLYDVETIPMSIFWQVPQYFFIGCAEVFTFIGQLEFFY  479

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRS+ +ALSLTT  +GNYLS+ LVTIV  +TTR+GK GW+ +NLN GHLDYFFW
Sbjct  480   DQAPDAMRSMMAALSLTTVGLGNYLSTLLVTIVTKVTTRHGKLGWIPSNLNMGHLDYFFW  539

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKK  1994
             LLA+LSV+N  V+++VAK YTYK+
Sbjct  540   LLAILSVVNFFVYLLVAKCYTYKR  563



>ref|XP_010515930.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Camelina sativa]
 ref|XP_010515931.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Camelina sativa]
Length=570

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/568 (66%), Positives = 457/568 (80%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M+E DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MDEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P       C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMLIAVFFFFLGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK +VKVP DKSLL ET+  ESNI+GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMRVKVPDDKSLLFETADDESNIKGSRKLVHTDNLNFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K G  +PWRLC+VTQVEELKS+I LLP+WA+GI+F+TVY QM+T FV Q   +
Sbjct  301   ESQSDSIKDGEVNPWRLCSVTQVEELKSVITLLPVWASGIVFATVYSQMNTMFVLQGNTL  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT H+ G T LQRMG+GL I
Sbjct  361   DQHMGPNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRHERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AMV+A VLE+VRL  VK HN YD  ++P+S+FWQ+PQY +IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMVTAGVLEVVRLDYVKSHNAYDQKQIPMSIFWQIPQYLLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NGKPGW+ +NLN GHLDY+F+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKVTKKNGKPGWIPDNLNRGHLDYYFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKKA+ +
Sbjct  541   LLATLSFLNFLVYLWISKRYKYKKAVGR  568



>ref|XP_006363097.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=570

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/563 (67%), Positives = 463/563 (82%), Gaps = 5/563 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E+D+ + KDGT+DY+N PA KN+TGTW+ACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  3     EDDNKFVKDGTVDYKNNPAIKNQTGTWRACPYILGNECCERLAYYGINTNLVNYLKYQMN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +S++ A  N++NWSGTCY+ PL+GAFLADAYLGR+WTIA FSIIYV GMT++TLSA++ G
Sbjct  63    ESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRFWTIAAFSIIYVFGMTVLTLSASIHG  122

Query  672   ISPTCIA-HEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P C   +  C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  123   LKPPCDHDNNSCHPKGLQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKKKS  182

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVAS+++VWIQ  V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  183   SFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAIAVVSFFSGTKLYRNQKP  242

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQV+VAS RK KVK   D S+L ET+  ES +QGSRKL HT +L FFDKAAV
Sbjct  243   GGSPLTRIFQVVVASFRKIKVK---DTSVLFETNDEESVVQGSRKLDHTQQLSFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 E  KGS +PW LCTVTQVEELKSIIRLLPIWATGIIFS+VY QM T FV Q   M+
Sbjct  300   ETQSEKIKGSINPWSLCTVTQVEELKSIIRLLPIWATGIIFSSVYSQMGTLFVLQGNTMD  359

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++  +F+IP ASLS+FDT+SVI WVP+YDR+IVP AR+ TGH++G T LQRM +GL IS
Sbjct  360   LHMTKSFEIPSASLSLFDTISVIFWVPVYDRVIVPSARRITGHRNGFTQLQRMAIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A  LE+VRL  VK+HN Y++  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY+
Sbjct  420   IFAMMIAGTLELVRLTSVKQHNYYEMKHIPMSIFWQVPQYFVIGCAEVFTFIGQLEFFYE  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSL T A+GNYLS+FLV +V D++TR+G  GW+ +NLNYGHL YFFWL
Sbjct  480   QAPDAMRSLCSALSLITTALGNYLSTFLVNVVTDMSTRHGGAGWIPDNLNYGHLHYFFWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKK  1994
             LAVLSV+N G F+ VAK YTYKK
Sbjct  540   LAVLSVINFGFFLFVAKFYTYKK  562



>ref|XP_010427083.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Camelina sativa]
Length=570

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/568 (66%), Positives = 456/568 (80%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M+E DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MDEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P       C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+A++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFLGSRFYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK +VKVP DKSLL ET+  ESNI+GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKIRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLNFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD  K G  +PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM+T FV Q   +
Sbjct  301   ESQSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNTL  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT H  G T LQRMG+GL I
Sbjct  361   DQHMGPNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRHDRGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE+VRL  VK HN YD  ++P+S+FWQVPQY +IGCAEVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVVRLDYVKSHNAYDEKQIPMSIFWQVPQYLLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NGKPGW+ +NLN GHLDY+F+
Sbjct  481   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKVTKKNGKPGWIPDNLNRGHLDYYFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKKA+ +
Sbjct  541   LLATLSFLNFLVYLWISKRYKYKKAVGR  568



>ref|XP_004163862.1| PREDICTED: LOW QUALITY PROTEIN: peptide transporter PTR1-like 
[Cucumis sativus]
Length=569

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/564 (66%), Positives = 462/564 (82%), Gaps = 3/564 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT+D   +PA   KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGTVDVHKKPAIXEKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N   ++AS ++++WSGTCY+ PL+GAFLADAYLGR+WTIA+FSIIY  GMTL+TL+A++P
Sbjct  61    NMDNVTASNSVTSWSGTCYLTPLIGAFLADAYLGRFWTIASFSIIYAFGMTLLTLAASIP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C +   C  +G  T   F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE ERK KS
Sbjct  121   GLKPSCDS-SGCHPSGGQTAATFVALYLIALGTGGIKPCVSSFGADQFDENDEVERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GA++ASS++VWIQ  V WGWGFGVPAVAMA+AV FFFSG+ LYR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPAVAMAIAVVFFFSGSSLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSG-LESNIQGSRKLSHTNELRFFDKAA  1205
              GSP TR+ QVIVA+ RK +V VP DKSLLHET+  +ES I+GSRKL HTN  +F DKA+
Sbjct  240   AGSPLTRILQVIVAACRKHQVHVPEDKSLLHETADDIESKIEGSRKLEHTNNFKFLDKAS  299

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   ++  KG  + WRLCTVTQVEELKSI+RLLP+WA+GI+F+ VY QMST FV Q   +
Sbjct  300   VETENDRIKGLPNEWRLCTVTQVEELKSIVRLLPVWASGIVFAAVYSQMSTMFVLQGNTL  359

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G +FKIP ASLS+FDT+SV+ W P+YDRLIVP+ARKFT ++ G T LQRMG+GL I
Sbjct  360   DQHIGPSFKIPSASLSIFDTISVLFWAPVYDRLIVPIARKFTNNERGFTQLQRMGIGLAI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ +MV+A  LE+ RL  V+ +NLYDV  +P+S+FWQVPQYF IGCAEVFTFIGQLEFFY
Sbjct  420   SVFSMVTAGALEVARLNYVRVNNLYDVETIPMSIFWQVPQYFFIGCAEVFTFIGQLEFFY  479

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRS+ +ALSLTT  +GNYLS+ LVTIV  +TTR+GK GW+ +NLN GHLDYFFW
Sbjct  480   DQAPDAMRSMMAALSLTTVGLGNYLSTLLVTIVTKVTTRHGKLGWIPSNLNMGHLDYFFW  539

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKK  1994
             LLA+LSV+N  V+++VAK YTYK+
Sbjct  540   LLAILSVVNFFVYLLVAKCYTYKR  563



>ref|XP_011003661.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X2 [Populus 
euphratica]
Length=569

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/564 (68%), Positives = 466/564 (83%), Gaps = 3/564 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E D YT +GT+D +  PA+K KTG WK+C FILGNEC ERLAYYGMS+NL+ Y   RL
Sbjct  1     MAEAD-YTNNGTVDIKGNPADKKKTGNWKSCRFILGNECCERLAYYGMSTNLVNYLGDRL  59

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++A+ N++NWSGTCY+ PL+GAFLAD+YLGRYWTIA+F IIY++GMTL+TLSA+V 
Sbjct  60    NQGNVAAANNVTNWSGTCYVTPLIGAFLADSYLGRYWTIASFVIIYIVGMTLLTLSASVT  119

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  T   T  CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ER+ KS
Sbjct  120   GLKPSC-NKDSCYPTTGQTAACFVALYMIALGTGGIKPCVSSFGADQFDETDETEREKKS  178

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGALVASS++VWIQ  V WGWGFGVPAV MA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGVPAVVMAVAVVFFFLGSKLYRIQKP  238

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK  V+VP DKSLL+ET   ES IQGSRKL HTN+ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASFRKSNVQVPADKSLLYETVEEESQIQGSRKLEHTNKFKFFDKAAV  298

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                D+  KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+FSTVY QMST FV Q   M+
Sbjct  299   KTQDDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFSTVYSQMSTMFVLQGNTMD  358

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  359   QHLGPHFQIPSASLSLFDTLSVIFWAPVYDRIIVPYARKFTGHERGFTQLQRMGIGLVIS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I++M++A +LE+VRL  V+++N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  419   IVSMITAGILEVVRLNFVQKNNYYDLKYIPMSIFWQVPQYFLIGCAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  ITTR GK GW+ +N+N GHLDYF+WL
Sbjct  479   QAPDAMRSLCSALSLTTVALGNYLSTLLVTIVTKITTRGGKLGWIPDNMNRGHLDYFYWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA+LS +N  +++ ++K +TYKKA
Sbjct  539   LAILSFLNFILYLWISKWFTYKKA  562



>ref|XP_009405847.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405848.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405849.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405850.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/579 (65%), Positives = 465/579 (80%), Gaps = 5/579 (1%)
 Frame = +3

Query  309   MEE-DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             ME+  D YT+DGT D    PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y + R
Sbjct  1     MEDIKDEYTQDGTTDIHGNPAIKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKDR  60

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L+Q  ++A+ N++NWSGTCYIMPL+GAF+ADAY+GRYWTI++F I+Y++G+TL+T++A+V
Sbjct  61    LHQGNVTAANNVTNWSGTCYIMPLLGAFIADAYIGRYWTISSFMIVYILGLTLLTMTASV  120

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              G+ P+C  +  C  T   T   F ALYL+ALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  121   KGLKPSC-QNGVCDPTRAQTAAVFTALYLIALGTGGIKPCVSSFGADQFDDSDESEKKRK  179

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYFSINIGAL+ASS++VWIQ +V WGWGFG+PAV MA+AV  FF GTRLYR+QK
Sbjct  180   SSFFNWFYFSINIGALIASSVLVWIQTDVGWGWGFGIPAVVMAIAVVSFFMGTRLYRHQK  239

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VASLRK  VKVP DKSLL+E +  ES IQGSRKL HT++ +F DKAA
Sbjct  240   PGGSPLTRIAQVMVASLRKAGVKVPADKSLLYEITQKESAIQGSRKLDHTDQFKFLDKAA  299

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   ++  +   +PWRLCT+TQVEELKSI+R+LP+WA+GI+FSTVY QMST FV Q   +
Sbjct  300   VETQEDKARSPVNPWRLCTITQVEELKSILRILPVWASGIVFSTVYSQMSTMFVLQGNTL  359

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SVIVWVPIYDR+IVP  R+ TG + G T L RMG+GL I
Sbjct  360   DRHMGPHFQIPSASLSIFDTISVIVWVPIYDRIIVPAVRRSTGRERGFTQLTRMGIGLVI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTE--VPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             SI +MV+A +LE+ RL  V RH LYDVT   VP+S+FWQVPQYFI+G AE+FTFIGQLEF
Sbjct  420   SIFSMVAAGILEVARLRTVARHGLYDVTSGYVPMSIFWQVPQYFIVGAAEIFTFIGQLEF  479

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRS+CSALSLTT A+GNYLS+ LVTIV  ITTRN K GW+ +NLN GHLDYF
Sbjct  480   FYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTSITTRNRKLGWIPDNLNRGHLDYF  539

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAE  2033
             FWLLAVLS++N GV++++AK YTYKK +        + E
Sbjct  540   FWLLAVLSLLNFGVYLLIAKCYTYKKTVEDEKTTTNDVE  578



>ref|XP_009139262.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brassica rapa]
Length=571

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/567 (67%), Positives = 454/567 (80%), Gaps = 2/567 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             EE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RLN
Sbjct  3     EEKDVYTEDGTVDIHKNPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRLN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIATF  IYV GMTL+TLSA+VPG
Sbjct  63    QGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIATFVFIYVSGMTLLTLSASVPG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P     + C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KSS
Sbjct  123   LKPGNCNGDTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKLKKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSIN+GALVA++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+PG
Sbjct  183   FFNWFYFSINVGALVAATVLVWIQMNVGWGWGFGVPTVAMVIAVVFFFLGSRYYRLQRPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-  1208
             GSP TR+FQVIVA+ RK  V VP DKSLL ET+  ESNI GSRKL HT+ L+FFDKAAV 
Sbjct  243   GSPLTRIFQVIVAAFRKVSVTVPEDKSLLFETADDESNITGSRKLEHTDNLKFFDKAAVE  302

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
               SD  K G  +PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM+T FV Q   M+
Sbjct  303   SHSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNTMD  362

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT  + G T LQRMG+GL IS
Sbjct  363   QHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRQERGFTQLQRMGIGLVIS  422

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AMV+A VLE+VRL  VK HN YD  ++P+S+FWQ+PQY ++GCAEVFTFIGQLEFFYD
Sbjct  423   IFAMVTAGVLEVVRLDYVKSHNAYDDKKIPMSIFWQIPQYLLVGCAEVFTFIGQLEFFYD  482

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T + GKPGW+ +NLN GHLDYFF+L
Sbjct  483   QAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKMTKKKGKPGWIPDNLNRGHLDYFFYL  542

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LAVLS +N  V++ ++K Y YKKAI +
Sbjct  543   LAVLSFLNFLVYLWISKRYKYKKAIGR  569



>ref|XP_010490600.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Camelina sativa]
Length=575

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/568 (66%), Positives = 459/568 (81%), Gaps = 3/568 (1%)
 Frame = +3

Query  297   RSEAMEED-DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIY  473
             + E ++ D D YT+DGTL+   +PANK  TGTWKAC FILG EC ERLAYYGMS+NL+ Y
Sbjct  3     KGEDIDMDLDTYTQDGTLNIYKKPANKKTTGTWKACRFILGTECCERLAYYGMSTNLVNY  62

Query  474   FQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTL  653
              + ++N   ++AS ++SNWSGTCY  PL+GAF+ADAYLGRYWTIA F  IY+ GMTL+T+
Sbjct  63    LEKQMNMENVTASTSVSNWSGTCYATPLIGAFVADAYLGRYWTIAIFVAIYIAGMTLLTM  122

Query  654   SATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKE  833
             SA+VPG++PTC + + C  TG    + F+ALYL+ALGTGGIKPCVSS+GADQFDDTDEKE
Sbjct  123   SASVPGLTPTC-SGDTCHATGGQIALTFVALYLIALGTGGIKPCVSSFGADQFDDTDEKE  181

Query  834   RKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLY  1013
             ++ KSSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP V MA+AV FFF+G++ Y
Sbjct  182   KESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVTMAIAVVFFFAGSKFY  241

Query  1014  RYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFF  1193
             R QKPGGSP TR+ QVIVAS RK KV+VP DKSLL+E    ES+I+GSRKL HT  L FF
Sbjct  242   RLQKPGGSPLTRMLQVIVASCRKSKVRVPEDKSLLYENQDAESSIRGSRKLEHTKILTFF  301

Query  1194  DKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             DKAAV    + K+ + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QM T FV Q
Sbjct  302   DKAAVETESDNKEAAPSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTVFVLQ  361

Query  1374  AIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
                M+ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP+ARK+TGH+ G T LQRMG+
Sbjct  362   GNTMDQHMGPNFKIPSASLSLFDTLSVLFWTPVYDQLIVPLARKYTGHERGFTQLQRMGI  421

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GL +SI +MVSA +LE++RL+ V+ HNLYD   VP+++FWQVPQYF +GCAEVFTFIGQL
Sbjct  422   GLVVSIFSMVSAGILEVIRLSYVRTHNLYDEETVPMTIFWQVPQYFFVGCAEVFTFIGQL  481

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRSLCSALSLTT A GNYLS+ LVT+V ++T   G+PGW+A NLN GHLD
Sbjct  482   EFFYDQAPDAMRSLCSALSLTTVAFGNYLSTLLVTVVTNVTRSGGRPGWIAINLNRGHLD  541

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             YFFWLLA LS +N  V++ +AK YTYKK
Sbjct  542   YFFWLLAALSFLNFLVYLWIAKWYTYKK  569



>ref|XP_010452016.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Camelina sativa]
 ref|XP_010452017.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Camelina sativa]
Length=575

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/568 (66%), Positives = 457/568 (80%), Gaps = 3/568 (1%)
 Frame = +3

Query  297   RSEAMEED-DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIY  473
             + E M+ D D YT DGTLD   +PANK  TGTWKAC FILG EC ERLAYYGMS+NL+ Y
Sbjct  3     KGEDMDMDLDTYTLDGTLDIYKKPANKKTTGTWKACRFILGTECCERLAYYGMSTNLVNY  62

Query  474   FQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTL  653
              + ++N   ++AS ++SNWSGTCY  PL+GAF+ADAYLGRYWTIA F  IY+ GMTL+T+
Sbjct  63    LEKQMNMENVTASTSVSNWSGTCYATPLIGAFVADAYLGRYWTIAIFVAIYIAGMTLLTM  122

Query  654   SATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKE  833
             +A+VPG++PTC + + C  TG    + FIALYL+ALGTGGIKPCVSS+GADQFDDTDE E
Sbjct  123   TASVPGLTPTC-SGDTCHATGGQIALTFIALYLIALGTGGIKPCVSSFGADQFDDTDEVE  181

Query  834   RKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLY  1013
             ++ KSSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP V MA++V FFF+G++ Y
Sbjct  182   KESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVTMAISVVFFFAGSKFY  241

Query  1014  RYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFF  1193
             R QKPGGSP TR+ QVIVAS RK KV+VP DKSLL+E    ES+I+GSRKL HT  L FF
Sbjct  242   RLQKPGGSPLTRMLQVIVASCRKSKVRVPEDKSLLYENQDAESSIRGSRKLEHTKILTFF  301

Query  1194  DKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             DKAAV    + K+ + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QM T FV Q
Sbjct  302   DKAAVETESDNKEAAPSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTVFVLQ  361

Query  1374  AIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
                M+ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP+ARK+TGH+ G T LQRMG+
Sbjct  362   GNTMDQHMGPNFKIPSASLSLFDTLSVLFWTPVYDQLIVPLARKYTGHERGFTQLQRMGI  421

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GL +SI +MVSA +LE++RL+ V+ HNLYD   VP+++FWQVPQYF +GCAEVFTFIGQL
Sbjct  422   GLVVSIFSMVSAGILEVIRLSYVRTHNLYDEETVPMTIFWQVPQYFFVGCAEVFTFIGQL  481

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRSLCSALSLTT A GNYLS+ LVT+V ++T   G+PGW+A NLN GHLD
Sbjct  482   EFFYDQAPDAMRSLCSALSLTTVAFGNYLSTLLVTVVTNVTRSGGRPGWIAINLNRGHLD  541

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             YFFWLLA LS +N  V++ +AK YTYKK
Sbjct  542   YFFWLLAGLSFLNFLVYLWIAKWYTYKK  569



>ref|XP_010423917.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Camelina sativa]
 ref|XP_010423918.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Camelina sativa]
Length=573

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/567 (66%), Positives = 458/567 (81%), Gaps = 3/567 (1%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             + E M+ D  YT+DGTLD   +PANK  TGTWKAC FILG EC ERLAYYGMS+NL+ Y 
Sbjct  3     KGEDMDMD-TYTQDGTLDIYKKPANKKTTGTWKACRFILGTECCERLAYYGMSTNLVNYL  61

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             + ++N   ++AS ++SNWSGTCY  PL+GAF+ADAYLGRYWTIA F  IY+ GMTL+T+S
Sbjct  62    EKQMNMENVTASTSVSNWSGTCYATPLIGAFVADAYLGRYWTIAIFVAIYIAGMTLLTMS  121

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A+VPG++PTC + + C  TG    + FIALYL+ALGTGGIKPCVSS+GADQFDDTDE+E+
Sbjct  122   ASVPGLTPTC-SGDTCHATGGQIALTFIALYLIALGTGGIKPCVSSFGADQFDDTDEEEK  180

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             + KSSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP V MA+AV FFF+G++ YR
Sbjct  181   ESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVTMAIAVVFFFAGSKFYR  240

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              QKPGGSP TR+ QVIVAS RK KV+VP DKSLL+E    ES+I+GSRKL HT  L FFD
Sbjct  241   LQKPGGSPLTRMLQVIVASCRKSKVRVPEDKSLLYENQDAESSIRGSRKLEHTKILTFFD  300

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAAV    + K+ + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QM T FV Q 
Sbjct  301   KAAVETESDNKEAAPSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTVFVLQG  360

Query  1377  IGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
               M+ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP+ARK+TGH+ G T LQRMG+G
Sbjct  361   NTMDQHMGPNFKIPSASLSLFDTLSVLFWTPVYDQLIVPLARKYTGHERGFTQLQRMGIG  420

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             L +SI +MVSA +LE++RL+ V+ HNLY+   +P+++FWQVPQYF +GCAEVFTFIGQLE
Sbjct  421   LVVSIFSMVSAGILEVIRLSYVRTHNLYEEETIPMTIFWQVPQYFFVGCAEVFTFIGQLE  480

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFYDQAPD+MRSLCSALSLTT A GNYLS+ LVT+V ++T   G+PGW+A NLN GHLDY
Sbjct  481   FFYDQAPDAMRSLCSALSLTTVAFGNYLSTLLVTVVTNVTRSGGRPGWIAINLNRGHLDY  540

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             FFWLLA LS +N  V++ +AK YTYKK
Sbjct  541   FFWLLAGLSFLNFLVYLWIAKWYTYKK  567



>ref|XP_006398647.1| hypothetical protein EUTSA_v10013125mg [Eutrema salsugineum]
 gb|ESQ40100.1| hypothetical protein EUTSA_v10013125mg [Eutrema salsugineum]
Length=565

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/560 (66%), Positives = 454/560 (81%), Gaps = 2/560 (0%)
 Frame = +3

Query  321   DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  500
             D++T+DGTLD   +PANK KTGTWKAC FILG EC ERLAYYGMS NL+ Y +  L+   
Sbjct  2     DMFTQDGTLDIHKKPANKEKTGTWKACRFILGTECCERLAYYGMSINLVNYVEKHLSMGN  61

Query  501   ISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP  680
             ++AS +++NWSGTCY  PL+GAFLADAYLGRY+TIA+F I+Y+ GMTL+TLSA+VPG++P
Sbjct  62    VAASNSVTNWSGTCYATPLIGAFLADAYLGRYFTIASFVIVYICGMTLLTLSASVPGLTP  121

Query  681   TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  860
             TC   E C  TG  T + F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE ER+ KSSFFN
Sbjct  122   TCNG-EDCHATGGQTAITFVALYLIALGTGGIKPCVSSFGADQFDDTDEVERESKSSFFN  180

Query  861   WFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSP  1040
             WFYF IN+GA++ASS++VWIQ  + WGWGFG+P VAMA+AV  FF+G++ YR QKPGGSP
Sbjct  181   WFYFVINVGAMIASSVLVWIQMNIGWGWGFGIPTVAMALAVLLFFAGSKFYRLQKPGGSP  240

Query  1041  FTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESD  1220
              TR+ QVIVAS RK KVK+P D+SLL+E    ESNIQGSRKL HT +L FFDKAAV    
Sbjct  241   ITRMLQVIVASFRKSKVKLPEDESLLYEIQDAESNIQGSRKLEHTTKLTFFDKAAVETES  300

Query  1221  EYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
             + K  + S W+LCTVTQVEELK++I LLP+WA+GI+F+ VY QMST FV Q   M+  +G
Sbjct  301   DKKDAAKSAWKLCTVTQVEELKALIGLLPVWASGIVFAAVYSQMSTMFVLQGNTMDKRMG  360

Query  1401  T-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
               F IP ASLS+FD LSV+ W P+YD+LIVP+ARK TGH  G T LQR+G+GL IS+ +M
Sbjct  361   PHFTIPSASLSLFDILSVLFWTPVYDQLIVPLARKVTGHDRGFTQLQRIGIGLVISVFSM  420

Query  1578  VSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +SA VLE+ RL+ ++ H+LYD   VPIS+FWQVPQYF +GCAEVFTFIGQLEFFYDQAPD
Sbjct  421   ISAGVLEVQRLSYIRTHSLYDEETVPISIFWQVPQYFFVGCAEVFTFIGQLEFFYDQAPD  480

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSALSLTT A+GNYLS+ LVT+V  ITT  G+PGW+A+NLN GHLDYF+WLLAVL
Sbjct  481   AMRSLCSALSLTTVALGNYLSTLLVTVVTKITTSGGRPGWIADNLNRGHLDYFYWLLAVL  540

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +N  V++ +AK YTYKKA
Sbjct  541   SFLNFFVYLWIAKRYTYKKA  560



>ref|XP_008242154.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Prunus mume]
Length=569

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/565 (68%), Positives = 461/565 (82%), Gaps = 1/565 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE+D++TKDGT DY+NRPA K  TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEEEDIHTKDGTTDYQNRPAIKKNTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  + A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA++ 
Sbjct  61    NQRNVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTLLTLSASLQ  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C  +  C  TG    V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K+K 
Sbjct  121   GLKPPCDTNNVCHPTGLQAGVFFMGLYLIALGTGGIKPCVSSFGADQFDDSDEAEKKNKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V W WGFG+PAVAMA+AV  FFSGTRLYR Q+P
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQTNVGWSWGFGIPAVAMALAVVSFFSGTRLYRNQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV VAS RK +VKVP DKSLL+ET+  ES ++GSRKL HT EL   DKAAV
Sbjct  241   GGSPLTRICQVFVASFRKFRVKVPGDKSLLYETADEESVVKGSRKLDHTEELSLLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS   WRLCTVTQVEELKS++RLLPIWATGIIFS VY QM T FV Q   M+
Sbjct  301   ETPSDKIKGSVMAWRLCTVTQVEELKSLVRLLPIWATGIIFSAVYSQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              +V  +F+IP ASLS+FDT+SVI WVP+YDRLIVP  RKFT   +G T LQR+ +GL IS
Sbjct  361   LHVTKSFEIPSASLSLFDTISVIFWVPVYDRLIVPFVRKFTKRNNGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM++A  LE+VRL  V++HN YD+  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLAAGTLELVRLNEVRKHNYYDLKHMPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL SALSLTT A+G+YLS+ LV IV D++TR+GK GW+ +NLNYGHL YFFWL
Sbjct  481   QAPDAMRSLSSALSLTTAALGSYLSTMLVNIVTDVSTRDGKVGWIPDNLNYGHLHYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA LSV+NLG +++VA+ YTYK+A+
Sbjct  541   LACLSVINLGFYLLVARWYTYKRAV  565



>gb|KHN06246.1| Peptide transporter PTR1 [Glycine soja]
Length=525

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/521 (72%), Positives = 448/521 (86%), Gaps = 4/521 (1%)
 Frame = +3

Query  450   MSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYV  629
             MS+NL++YF+ RLNQ + +ASKN+SNWSGTCYI PL+GA+LAD+YLGRYWTIA FSIIY 
Sbjct  1     MSTNLVLYFKNRLNQHSATASKNVSNWSGTCYITPLIGAYLADSYLGRYWTIAVFSIIYA  60

Query  630   IGMTLMTLSATVPGISPTCIAH--EKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGA  803
             IGMTL+TLSA+VPGI PTC  H  E C  T  ++ VCF+ALYL+ALGTGGIKPCVSSYGA
Sbjct  61    IGMTLLTLSASVPGIKPTCHGHGDENCRATTLESAVCFLALYLIALGTGGIKPCVSSYGA  120

Query  804   DQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamav  983
             DQFDDTD  E++ KSSFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV
Sbjct  121   DQFDDTDSAEKERKSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAV  180

Query  984   TFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRK  1163
               FFSGTRLYR QKPGGS  TR+ QV++AS+RK  V+VP D+SLL+ET+  ES I+GSRK
Sbjct  181   VSFFSGTRLYRNQKPGGSAITRICQVVMASIRKYNVEVPADESLLYETAETESAIKGSRK  240

Query  1164  LSHTNELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVY  1343
             L HTNELRFFDKAAV+   +  K S +PWRLCTVTQVEELKSI+R+LP+WATGIIFSTVY
Sbjct  241   LDHTNELRFFDKAAVLAQSDKVKESKNPWRLCTVTQVEELKSILRILPVWATGIIFSTVY  300

Query  1344  GQMSTQFVSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHK  1517
             GQMST FV Q   M+T VG  TFKIP ASLS+FDTLSVI WVP+YDR+IVP+A KFTG+K
Sbjct  301   GQMSTLFVLQGQTMDTRVGNSTFKIPPASLSIFDTLSVIFWVPVYDRIIVPIATKFTGNK  360

Query  1518  SGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIG  1697
             +GLT LQRMG+GLFISI +MV+AA+LE++RL MV+RHN Y + E+P+++FWQVPQYFIIG
Sbjct  361   NGLTQLQRMGIGLFISIFSMVAAAILELIRLRMVRRHNYYQLEEIPMTIFWQVPQYFIIG  420

Query  1698  CAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGW  1877
             CAEVF FIGQLEFFY+QAPD+MRS CSALSLTT A+G YLSS LVTIV  I+TRNG PGW
Sbjct  421   CAEVFYFIGQLEFFYEQAPDAMRSFCSALSLTTVALGQYLSSLLVTIVTKISTRNGSPGW  480

Query  1878  LANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             + +NLN+GH+DYFFWLLA+LSV+NL  F+VV+ +YTYK+ +
Sbjct  481   IPDNLNFGHIDYFFWLLALLSVVNLIAFLVVSMLYTYKRPV  521



>ref|XP_003529142.1| PREDICTED: peptide transporter PTR1-like isoformX1 [Glycine max]
 ref|XP_006583629.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
 gb|KHN22722.1| Peptide transporter PTR1 [Glycine soja]
Length=568

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/563 (67%), Positives = 452/563 (80%), Gaps = 2/563 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YT+DGT+    +PANK KTG WKAC FILGNECSERLAYYGMS+NL+ Y + R 
Sbjct  1     MAEDDIYTQDGTITISKKPANKKKTGNWKACYFILGNECSERLAYYGMSTNLVNYLRERF  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++ WSGTCYI PL+GAFLAD+YLGRYWTI++FSI+YVIGM L+TLSA+ P
Sbjct  61    NQGNATAANNVTTWSGTCYITPLIGAFLADSYLGRYWTISSFSIVYVIGMILLTLSASAP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C A+  C  T   T  CFIALYL+ALGTGGIKPCVS++GADQFDD+DEKE+  KS
Sbjct  121   GLKPSCDAN-GCHPTSAQTATCFIALYLIALGTGGIKPCVSAFGADQFDDSDEKEKIKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V WGWGFGVPAVAM +A+ FFF G+RLYR Q P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQMNVGWGWGFGVPAVAMVIAIIFFFGGSRLYRLQIP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVA+LRK  ++VP DKSLLHET  LES I+GSRKL HTN  +  DKAAV
Sbjct  240   GGSPLTRICQVIVAALRKIGLQVPNDKSLLHETIDLESVIKGSRKLDHTNRFKCLDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K   +PWRLCTVTQVEELKS+I LLP+WA+ I F+TVYGQMST FV Q   M+
Sbjct  300   ETESDHTKDLSNPWRLCTVTQVEELKSVISLLPVWASLIAFATVYGQMSTMFVLQGNTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
               +G  FKIP ASL++FDTLSVI W P+YDR IVP A K+TGHK G T LQRMG+GL IS
Sbjct  360   QRIGPHFKIPSASLTIFDTLSVIFWAPVYDRFIVPFASKYTGHKQGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
              +AMV A +LE+ RL +V+++N YDV  +P+S+FWQVPQYF++GCAEVFT IG LEFFY 
Sbjct  420   TIAMVVAGILEVYRLGIVRKNNYYDVETIPLSIFWQVPQYFLVGCAEVFTNIGSLEFFYG  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL  ALSLTTNA+GNY+S+ LV IV  +TTR+GK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLGMALSLTTNALGNYISTLLVIIVTKVTTRHGKLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKK  1994
             L VLS +N  V++ VAK Y YKK
Sbjct  540   LTVLSFLNFLVYLWVAKRYRYKK  562



>ref|XP_008785424.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785425.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785426.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785427.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785428.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
Length=574

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/570 (67%), Positives = 461/570 (81%), Gaps = 5/570 (1%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             EA E  D YTKDGT D R  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y + 
Sbjct  3     EAAE--DKYTKDGTTDIRGNPAVKKDTGNWRACPYILANECCERLAYYGMSTNLVNYMKD  60

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RL+Q+  +A+ N++NWSGTCYIMPL+GAFLADAYLGRYWTIA+F I+Y+ G+TL+T++++
Sbjct  61    RLHQNNTTAANNVTNWSGTCYIMPLLGAFLADAYLGRYWTIASFMIVYISGLTLLTMTSS  120

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             V G+ P+C  +  C  T   T V FIALYL+ALGTGGIKPCVSS+GADQFD++DE E+K 
Sbjct  121   VNGLKPSC-DNGVCDPTNAQTAVVFIALYLIALGTGGIKPCVSSFGADQFDESDESEKKR  179

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYFSINIGALVASS++VWIQ  V WGWGFG+PAV MA+AV  FF GT LYR+Q
Sbjct  180   KSSFFNWFYFSINIGALVASSVLVWIQNNVGWGWGFGIPAVVMAIAVVSFFLGTALYRHQ  239

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QV+VAS RK  V +P DKS L+E S  ES IQGSRKL HT++ +F DKA
Sbjct  240   KPGGSPLTRIAQVVVASFRKYGVNLPHDKSSLYEISEKESVIQGSRKLEHTDQFKFLDKA  299

Query  1203  AVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             AVV  D+  K    PWRLCTVTQVEELKS++R+LPIWATGIIFSTVY QMST FV Q   
Sbjct  300   AVVTQDDKMKDPVDPWRLCTVTQVEELKSVVRILPIWATGIIFSTVYSQMSTMFVLQGNT  359

Query  1383  MNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             ++ ++G  FKIP ASLS+FDT+SVIVWVPIYDR+IV +ARK TGH+ G T L RMG+GL 
Sbjct  360   LDPHMGPHFKIPSASLSIFDTISVIVWVPIYDRVIVSVARKLTGHERGFTQLTRMGIGLA  419

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             ISI +M++A +LE+VRL +V R  LYD    VP+S+FWQ+PQYFIIG AEVFTFIGQLEF
Sbjct  420   ISIFSMLAAGILEVVRLRIVGRDGLYDYDGYVPMSIFWQIPQYFIIGAAEVFTFIGQLEF  479

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRSL SALSLTT ++GNYLS+ LVTIV DITT+NG+ GW+  NLN GHLDYF
Sbjct  480   FYDQAPDAMRSLLSALSLTTVSLGNYLSTLLVTIVTDITTKNGRLGWIPENLNRGHLDYF  539

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             FWLLA+LS++N GV++ +AK YTYKK  +K
Sbjct  540   FWLLAILSLLNFGVYLWIAKWYTYKKTTDK  569



>gb|KEH23143.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=568

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/565 (67%), Positives = 455/565 (81%), Gaps = 2/565 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YT+DGT+D   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y   R 
Sbjct  1     MAEEDIYTQDGTIDIYRKPANKKKTGNWKACWFILGNECCERLAYYGMSTNLVNYLGERF  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+K+++ WSGTCYI PL+GAFLAD+YLGRYWTIA+FS+IYVIGM L+TLSATVP
Sbjct  61    NQGNAAAAKSVTTWSGTCYITPLLGAFLADSYLGRYWTIASFSVIYVIGMVLLTLSATVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C  +  C  T   T   +IALYL+ALGTGGIKPCVSS+GADQFD+TDEKERK KS
Sbjct  121   GLKPSCDGN-VCHPTSAQTAAMYIALYLIALGTGGIKPCVSSFGADQFDETDEKERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFGVPAVAM +AV FFF G+ LYR Q P
Sbjct  180   SFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPAVAMVLAVIFFFGGSVLYRLQIP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+ RK +++VP DK+LLHET  +ES I+GSRKL HTN LR  DKAA+
Sbjct  240   GGSPLTRICQVLVAACRKLRLQVPEDKNLLHETIDVESVIKGSRKLDHTNNLRCLDKAAI  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K   +PWRLCTVTQVEELKSII LLP+WAT I F+TVY QM+T FV Q   M+
Sbjct  300   ETQTDRTKELTNPWRLCTVTQVEELKSIINLLPVWATLIAFATVYSQMNTMFVLQGNTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL +S
Sbjct  360   QHIGPHFQIPSASLSLFDTLSVIFWAPVYDRIIVPYARKFTGHEHGFTQLQRMGIGLVLS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +M+ A +LE+VRL M++++N YD   +P+S+FWQVPQYF++GCAEVFT IGQLEFFY 
Sbjct  420   IFSMIIAGILEVVRLDMIRKNNYYDAKTIPMSIFWQVPQYFLVGCAEVFTNIGQLEFFYG  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL  ALSLTTNAIGNY+S+ LVTIV  +TTRNG  GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLGVALSLTTNAIGNYISTLLVTIVTKVTTRNGNLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             L +LS +N  VF+ +AK Y YKK +
Sbjct  540   LTILSFLNFLVFLWIAKRYKYKKVV  564



>ref|XP_008345515.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Malus domestica]
Length=568

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/567 (67%), Positives = 462/567 (81%), Gaps = 2/567 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M + D+YT DGT+D   +PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y + RL
Sbjct  1     MADSDLYTNDGTVDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLEKRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
                T  A+ ++SNWSGTCY  PL+GAFLADAYLGRYWTIA FSI+YV+GMTL+TL+A++ 
Sbjct  61    GMGTAKAATSVSNWSGTCYATPLIGAFLADAYLGRYWTIAIFSIVYVLGMTLLTLTASIN  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C +   C  T      CF+ALYL+A+GTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GLKPHCDS-SGCNATASQRAACFVALYLIAIGTGGIKPCVSSFGADQFDETDETERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+AS+++VW+Q  V W WGFGVPAVAMA+AV FFFSG++LYR QKP
Sbjct  180   SFFNWFYMSINVGALIASTVLVWMQMNVGWNWGFGVPAVAMAIAVVFFFSGSKLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS+RK KVK+P +KSLL+ET+  E NIQGSRKL HTN+L FFDKAAV
Sbjct  240   GGSPLTRIAQVVVASIRKCKVKIPANKSLLYETADEECNIQGSRKLEHTNKLGFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K   SPW LCTVTQVEELKS+IRLLPIWA+GI+F+TVYGQMST FV Q   ++
Sbjct  300   ESETDRAKELPSPWSLCTVTQVEELKSVIRLLPIWASGIVFATVYGQMSTMFVLQGNTLD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLSVFDT SV+ W PIYD+L+VP+AR+FTGH+ G T LQRMG+GL +S
Sbjct  360   QHMGPNFKIPSASLSVFDTASVLFWAPIYDKLLVPLARRFTGHERGFTTLQRMGIGLALS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV A +LE+VRL  V+++N YD+  +P+S+FWQVPQYFIIGCAEVFTFIGQ+EFFYD
Sbjct  420   IFSMVVAGILEVVRLGTVRKNNYYDLEYIPMSIFWQVPQYFIIGCAEVFTFIGQMEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NG  GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLCSALSLTTVALGNYLSTLLVTVVTKVTKKNGNLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LAVLSV+N  V++ +AK +TYKKA  +
Sbjct  540   LAVLSVINFLVYLWIAKWFTYKKATGR  566



>ref|XP_008388132.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=568

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/563 (68%), Positives = 457/563 (81%), Gaps = 2/563 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M  DD YT DGTLD   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MVGDDFYTNDGTLDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLEKRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
                 ++A+ ++SNWSGTCY  PL+GAFLADAYLGRYWTIA FSI+YV+GMTL+TL+A++ 
Sbjct  61    GMGNVTAATSVSNWSGTCYATPLIGAFLADAYLGRYWTIAIFSIVYVLGMTLLTLTASIN  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C +   C  T      CF+ALYL+A+GTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GLKPHCDS-SGCNSTSSQRATCFVALYLIAVGTGGIKPCVSSFGADQFDETDETERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+AS+++VW+Q  V W WGFGVPAVAM +AV FFF G++LYR QKP
Sbjct  180   SFFNWFYMSINVGALIASTVLVWMQMNVGWNWGFGVPAVAMGIAVVFFFLGSKLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+ AS+RK KVKVP DKSLL+ET+  E NIQGSRKL HTN L FFDKAAV
Sbjct  240   GGSPLTRIAQVVAASIRKXKVKVPADKSLLYETADEECNIQGSRKLEHTNXLGFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                    K   SPW LCTVTQVEELKSIIRLLPIWA+GI+F+TVYGQMST FV Q   ++
Sbjct  300   ESETNRAKELPSPWSLCTVTQVEELKSIIRLLPIWASGIVFATVYGQMSTMFVLQGNTLD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDT+SVI W PIYDRLIVP+AR FTGH+ G   LQRMG+GL +S
Sbjct  360   QHMGPNFKIPSASLSLFDTVSVIFWAPIYDRLIVPLARHFTGHERGFRTLQRMGIGLALS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV A VLE+VRLA VK++N YD+  +P+S+FWQVPQYFIIGCAEVFTFIGQ+EFFYD
Sbjct  420   IFSMVVAGVLEVVRLATVKKYNYYDLEYIPMSIFWQVPQYFIIGCAEVFTFIGQMEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +TT+NG  GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLCSALSLTTVALGNYLSTLLVTVVTKVTTKNGNLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKK  1994
             LA+LSV+N  V++ +AK YTYKK
Sbjct  540   LAILSVINFLVYLWIAKWYTYKK  562



>ref|XP_009421313.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421314.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421315.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421316.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/577 (66%), Positives = 461/577 (80%), Gaps = 5/577 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             D  YT+DGT D   RPA +  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y + RLNQ 
Sbjct  5     DKRYTEDGTTDVHGRPAVRKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKDRLNQG  64

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
                A+ N++NWSGTCYI PL+GAF+ADAYLGRY TIA+F I+Y+IG+ L+T++A+V G+ 
Sbjct  65    NAKAANNVTNWSGTCYITPLLGAFIADAYLGRYRTIASFMIVYIIGLILLTMTASVEGLK  124

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
               C  H  C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K KSSFF
Sbjct  125   APC-NHGVCDPTTAQTAVVFVALYLIALGTGGIKPCVSSFGADQFDESDESEKKRKSSFF  183

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGAL+ASS++VWIQ  V WGWGFG+PAV M++AV  FF GT LYR+QKPGGS
Sbjct  184   NWFYFSINIGALIASSVLVWIQNNVGWGWGFGIPAVVMSIAVVSFFLGTPLYRHQKPGGS  243

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QVIVASLRK  + VP DKSLL+E +  ES IQGSRKL HT+E +F DKAA+V  
Sbjct  244   PITRVAQVIVASLRKSGMDVPDDKSLLYEVADKESVIQGSRKLGHTDEFKFLDKAAIVTQ  303

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
             ++  K   SPW+LCTVTQVEELKS++RLLPIWATGI+FSTVYGQM T FV Q   ++ Y+
Sbjct  304   ED--KNPVSPWKLCTVTQVEELKSVVRLLPIWATGIVFSTVYGQMGTMFVLQGNTLDPYM  361

Query  1398  GT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G  FKIP ASLS+FDT+SVIVWVPIYDR+IVP+AR+ TG + G T L RMG+GL ISI +
Sbjct  362   GPHFKIPAASLSIFDTISVIVWVPIYDRIIVPLARRSTGRERGFTQLTRMGIGLVISIFS  421

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             MV+A +LE+VRL +V  HN+YD    +PIS+FWQ+PQYFI+G AEVFTFIGQLEFFYDQA
Sbjct  422   MVAAGILEVVRLRIVANHNMYDSQAYLPISIFWQIPQYFIVGAAEVFTFIGQLEFFYDQA  481

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSLCSALSLTT A+GNYLS+ LVT+V  ITTRNGK GW+ +NLN GHLDYFFWLLA
Sbjct  482   PDAMRSLCSALSLTTVALGNYLSTVLVTVVTGITTRNGKLGWIPDNLNRGHLDYFFWLLA  541

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAENGS  2042
             VLS++N   ++++AK YTYKK  ++  D    +E G+
Sbjct  542   VLSLVNFVAYLLIAKWYTYKKTTDEEFDYGSSSELGT  578



>ref|XP_011077583.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
 ref|XP_011077584.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
 ref|XP_011077585.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=575

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/563 (69%), Positives = 456/563 (81%), Gaps = 2/563 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D YT+DGT++   +PANK KTG WKAC FIL  EC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MGEEDTYTRDGTVNIHKKPANKLKTGNWKACRFILVTECCERLAYYGMSTNLVNYLKIRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+F  +YVIGMTL+TLSA+V 
Sbjct  61    NQENATASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFCTVYVIGMTLLTLSASVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  T   T +CF+ALYLVALGTGGIKPCVSS+GADQFDD DEKE+K KS
Sbjct  121   GLKPEC-DKNGCHPTTSQTAICFLALYLVALGTGGIKPCVSSFGADQFDDNDEKEKKRKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+ASS++VWIQ  V W WGFG+PAVAMA+AV FFF G+RLYR Q+P
Sbjct  180   SFFNWFYLSINIGALIASSVLVWIQMNVGWSWGFGIPAVAMAIAVAFFFFGSRLYRIQRP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VASLRK  VKVP DKSLL+ET+   S+IQG RKL HT + RF D+AAV
Sbjct  240   GGSPLTRIVQVLVASLRKFNVKVPADKSLLYETTDSGSDIQGCRKLEHTEKFRFLDRAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                    KG  +PWRLCTVTQVEE KSIIRLLPIWATGI+FSTVY QMST FV Q   M+
Sbjct  300   QTEPINVKGVVNPWRLCTVTQVEEFKSIIRLLPIWATGIVFSTVYSQMSTMFVLQGDTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G+ FKIP ASLS+FDTLSVI W P+YD +I+ +ARK+TGH+ G T LQRMG+GL IS
Sbjct  360   QHIGSKFKIPSASLSLFDTLSVIFWAPVYDLVIIRIARKYTGHERGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A VLE+ RL  V+R+N YD+  +PIS+FWQVPQYF++GCAEVFTFIGQLEFFYD
Sbjct  420   IFAMIVAGVLEVFRLNYVRRNNYYDLEIIPISIFWQVPQYFLVGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD MRSLCSALSLTT A+GNYLS+ LVTIV  +TTR+GK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDGMRSLCSALSLTTTALGNYLSTLLVTIVTTVTTRHGKLGWIPDNLNKGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKK  1994
             LAVLS +N   +V++AK YTYKK
Sbjct  540   LAVLSFINFLAYVLIAKWYTYKK  562



>emb|CBI30424.3| unnamed protein product [Vitis vinifera]
Length=1454

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/553 (70%), Positives = 455/553 (82%), Gaps = 1/553 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YTKDGT+D+R+ PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MAEEDIYTKDGTIDFRSNPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  + A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA+  
Sbjct  61    NQRNVVAINNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAGFSIIYVFGMTLLTLSASAH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  TG  T V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE ERK KS
Sbjct  121   GLKPLCDGQNVCYPTGLQTAVFFVGLYLIALGTGGIKPCVSSFGADQFDDSDETERKSKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VW+Q  V WGWGFG+PAVAM +AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALLASSVLVWVQTNVGWGWGFGIPAVAMGIAVMSFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVASLRK +V+VP DK LL+ET+  ES + GSRKL HT  L FFDKAAV
Sbjct  241   GGSPLTRICQVIVASLRKFQVEVPADKCLLYETADSESAVTGSRKLDHTKHLSFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS   WRLCTVTQVEELKSIIRLLPIWATGI+FS VY QM T FV Q   M+
Sbjct  301   ETHIDAIKGSVDSWRLCTVTQVEELKSIIRLLPIWATGIVFSAVYSQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++ G+F+IP ASLS+FDT+SVI WVPIYDRLIVP ARKFTGHKSG T LQR+ +GL IS
Sbjct  361   LHITGSFQIPSASLSLFDTISVIFWVPIYDRLIVPFARKFTGHKSGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM+ A  LE++RL MV+ HN Y++  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLVAGTLELLRLRMVREHNYYELKHIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LV +V D++TR GKPGW+ +NLNYGHL YFFWL
Sbjct  481   QAPDAMRSLCSALSLTTAALGNYLSTLLVNVVTDVSTRGGKPGWIPDNLNYGHLHYFFWL  540

Query  1926  LAVLSVMNLGVFV  1964
             LA LSV NLGV++
Sbjct  541   LAALSVFNLGVYL  553


 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/565 (66%), Positives = 443/565 (78%), Gaps = 30/565 (5%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDGT++  N+PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  663   MAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  722

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLADAY GR+W IA FSIIY  GM L+T++A++ 
Sbjct  723   NQGNVTASNNVTNWSGTCYITPLIGAFLADAYFGRFWIIAIFSIIYFCGMVLLTMTASIK  782

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C     C  T   + VCFIALYL+ALGTGGIKPCVSS+GADQFD  DE E+K KS
Sbjct  783   GLRPSC-DDNGCDPTKLQSAVCFIALYLIALGTGGIKPCVSSFGADQFDVNDEAEKKKKS  841

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+ASS++VWIQ  V WGWGFG+PAVAMA+AV  FFSG+R+YR QKP
Sbjct  842   SFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVVSFFSGSRMYRLQKP  901

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  VKVP +KSLL+ET   ESNI+GS KL HT +LRFFDKAAV
Sbjct  902   GGSPLTRICQVLVASTRKYHVKVPNNKSLLYETKDAESNIKGSCKLEHTEKLRFFDKAAV  961

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K S +PW+LCTVTQVEELKSI+RLLP+WATGI+FSTVY QMST FV Q   M+
Sbjct  962   EVESDHVKSSNNPWKLCTVTQVEELKSILRLLPVWATGILFSTVYSQMSTMFVLQGNTMD  1021

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  1022  QHMGPNFKIPSASLSLFDTLSVIFWAPVYDRIIVPFARKFTGHERGFTQLQRMGIGLVIS  1081

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I++M+ A +LE                            YF+IGCAEVFTFIGQLEF+YD
Sbjct  1082  IISMIVAGILE----------------------------YFLIGCAEVFTFIGQLEFYYD  1113

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+ RSLCSALSLTTNA+GNYLS+ LVTIV  +TTRNGK GW+ +N+N GHLDYF+WL
Sbjct  1114  QAPDATRSLCSALSLTTNALGNYLSTLLVTIVNKVTTRNGKMGWIPDNMNRGHLDYFYWL  1173

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA+LS++N  V++ +AK YTYKK I
Sbjct  1174  LAILSLLNFLVYLWIAKWYTYKKMI  1198



>ref|XP_006363053.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=566

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/568 (66%), Positives = 453/568 (80%), Gaps = 3/568 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M  DD YTKDGT+D   +PANK KTGTWKACP+ILG+E  ERLAYYGMS+NL+ Y   RL
Sbjct  1     MNSDDDYTKDGTVDIYKKPANKKKTGTWKACPYILGDEACERLAYYGMSTNLVNYIHKRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N    ++SK ++NWSGTCY+ PL+GAFLADAYLGRYWTIA FS +Y+IGMTL+TLSA+V 
Sbjct  61    NLGVAASSKAVNNWSGTCYVTPLIGAFLADAYLGRYWTIAGFSFLYIIGMTLLTLSASVK  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P    +  C  T       F+++YL+A GTGGIKPCVSS+GADQFDD DE E+K KS
Sbjct  121   GIRPC--NNGTCNPTSSQKTAFFVSIYLIAFGTGGIKPCVSSFGADQFDDNDENEKKKKS  178

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SIN+GAL+ASS +V+IQ  V WG GFGVPAVAMA+A+ FFFSGTRLYR Q P
Sbjct  179   SFFNWFYLSINVGALIASSALVYIQSNVGWGLGFGVPAVAMAIALVFFFSGTRLYRLQPP  238

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
              GSP TR+ QV VAS+RK  VK P D++LL+ET+  ES I  SRKL H++E RFFDKAAV
Sbjct  239   AGSPLTRIVQVFVASIRKCHVKTPHDETLLYETADTESIIVASRKLEHSDEFRFFDKAAV  298

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +   GS +PWRLCTVTQVEE+KSIIRLLPIWATGI+FS VYGQMST FV+Q   M+
Sbjct  299   EGESDKVNGSVNPWRLCTVTQVEEVKSIIRLLPIWATGIVFSCVYGQMSTMFVNQGNIMD  358

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              Y+G  F+IP A LS+FDT+SVI W P+YDR+IVPMARK+TGH+ G T LQRMG+GL IS
Sbjct  359   NYIGPHFRIPSACLSIFDTVSVIFWAPVYDRVIVPMARKYTGHERGFTQLQRMGIGLVIS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             + AM  AAVLE +RL MV+++N YD+  VP+S+FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  419   VFAMACAAVLETIRLDMVRKNNYYDLEYVPLSIFWQVPQYFLIGCAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSAL LTT A+G+YLSS LVTIV   TTR+GK GW+ ++LN GHLDYF+WL
Sbjct  479   QAPDAMRSLCSALCLTTTALGSYLSSLLVTIVMKTTTRHGKFGWIPDDLNRGHLDYFYWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKV  2009
             LA LS++N  V++ ++K YTYKK   K+
Sbjct  539   LAFLSIINFFVYLWISKWYTYKKVTGKI  566



>gb|ACJ85720.1| unknown [Medicago truncatula]
Length=517

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/517 (74%), Positives = 444/517 (86%), Gaps = 2/517 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE++VYTKDGT+DY   PAN+ KTGTWKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEEENVYTKDGTVDYLGNPANRKKTGTWKACPFILGNECCERLAYYGMSTNLVLYFKERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q +  ASKN+SNW+GTCYI PL+GAF+AD+YLGRYWTIA+FSI+YVIGMTL+TLSA V 
Sbjct  61    HQHSAVASKNVSNWAGTCYITPLIGAFVADSYLGRYWTIASFSILYVIGMTLLTLSAPVS  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P C   + C  T   + VCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GIKPECQGKDNCHATTLQSAVCFLALYLIALGTGGIKPCVSSYGADQFDDDDEDEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASSL+VWIQ  V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTKLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS+RK +V  P DKSLL+E +  ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSPLTRIAQVIVASIRKYRVDAPTDKSLLYEIADTESAIKGSRKLDHTNELRFFDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K S +PWRLCTVTQVEELKSI+RLLP+WATGIIF+TVYGQMST FV Q   MN
Sbjct  301   QGESDNLKESINPWRLCTVTQVEELKSILRLLPVWATGIIFATVYGQMSTLFVLQGQTMN  360

Query  1389  TYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             T+VG  +FKIP ASLS+FDT+SVI WVP+YDR+IVP+ARKFTGHK+GLT LQRMGVGLFI
Sbjct  361   THVGNSSFKIPPASLSIFDTISVIFWVPVYDRIIVPIARKFTGHKNGLTQLQRMGVGLFI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +MV+AA LE+VRL  V+R+N Y++ E+P+++FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  421   SIFSMVAAAFLELVRLRTVRRNNYYELEEIPMTIFWQVPQYFLIGCAEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADIT  1853
             +QAPD+MRSLCSALSL T A G YLSS LVTIV +I+
Sbjct  481   EQAPDAMRSLCSALSLLTVAFGQYLSSLLVTIVTNIS  517



>ref|XP_009374284.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
Length=541

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/532 (72%), Positives = 444/532 (83%), Gaps = 2/532 (0%)
 Frame = +3

Query  411   LGNECSERLAYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLG  590
              GNEC ERLAYYGMSSN +IYF+T+LNQ++  A+KN SNWSGTCY+ PL+GAFLADAYLG
Sbjct  6     FGNECCERLAYYGMSSNRVIYFKTQLNQTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLG  65

Query  591   RYWTIATFSIIYVIGMTLMTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTG  770
             RY TIA+FSIIY IGMTL+T+SA+VPG+ PTC++ + C   G  T   FIALYL+ALGTG
Sbjct  66    RYKTIASFSIIYFIGMTLLTMSASVPGMKPTCVSKDDCHANGGQTAATFIALYLIALGTG  125

Query  771   GIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGF  950
             GIKPCVSSYGADQFDD DE E+KHK+SFFNWFYFSIN+GAL+ASS++VWIQ  V WGWGF
Sbjct  126   GIKPCVSSYGADQFDDDDEVEKKHKASFFNWFYFSINVGALIASSVLVWIQDNVGWGWGF  185

Query  951   GVPavamamavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETS  1130
             GVPAVAMA+AV  FFSGTRLYR QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET+
Sbjct  186   GVPAVAMAIAVLSFFSGTRLYRNQKPGGSPVTRIIQVVVASVRKYKVKVPEDKSLLYETA  245

Query  1131  GLESNIQGSRKLSHTNELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPI  1310
               ES+IQGSRKL HTNE RFFDKAAV   D+  K S SPWRL TVTQVEELKSIIRLLPI
Sbjct  246   DAESSIQGSRKLDHTNEFRFFDKAAVEVQDDNIKDSKSPWRLTTVTQVEELKSIIRLLPI  305

Query  1311  WATGIIFSTVYGQMSTQFVSQAIGMNTYVG--TFKIPEASLSVFDTLSVIVWVPIYDRLI  1484
             WA GIIF+    QMS  FV Q   M+  VG  +FKIP ASL VFDTLSVI WVPIYDR+I
Sbjct  306   WAAGIIFAAACNQMSNFFVLQGTLMDVRVGHSSFKIPAASLIVFDTLSVIFWVPIYDRII  365

Query  1485  VPMARKFTGHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISV  1664
             VP ARK TGHK+GLT LQRMG+GLFISI +MV A VLE++RL  V+++N Y+   +P+SV
Sbjct  366   VPAARKHTGHKNGLTTLQRMGIGLFISIFSMVCATVLELIRLRSVRQNNYYEYEHMPMSV  425

Query  1665  FWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVA  1844
             FWQVPQYF+IG AEVFT IGQLEFFYDQAPD+MRSLCSALSL+T A+GNY +S LV+IV 
Sbjct  426   FWQVPQYFLIGAAEVFTCIGQLEFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVSIVT  485

Query  1845  DITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
               TT++G PGW+ +NLNYGHLDYFFWLLA+LSV+NL V++ ++K YTYKK +
Sbjct  486   KTTTKDGNPGWIPDNLNYGHLDYFFWLLAMLSVLNLVVYLFISKWYTYKKTV  537



>ref|XP_010676231.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676232.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676233.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676234.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/565 (67%), Positives = 458/565 (81%), Gaps = 14/565 (2%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             DD   +DGT++   +PA+K KTG WKAC FILGNEC ERLAYYGMS+NL+ YF  R++Q 
Sbjct  6     DDSIVQDGTVNIHGQPADKKKTGNWKACYFILGNECCERLAYYGMSTNLVNYFIERMHQG  65

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
               +A+KN++NWSGTCYIMPL+GAFLADAYLGRYW IA FS+IYVIGMTL+T+SA+V  + 
Sbjct  66    NATAAKNVNNWSGTCYIMPLLGAFLADAYLGRYWVIAIFSMIYVIGMTLLTVSASVNALK  125

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
                              V F+ALYL+ALGTGGIKPCVSS+GADQFD+TDEKER+ KSSFF
Sbjct  126   -------------NSVAVAFVALYLIALGTGGIKPCVSSFGADQFDETDEKEREKKSSFF  172

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV  FFSG+ LYR QKPGGS
Sbjct  173   NWFYFSINVGALIASSVLVWIQTNVGWGWGFGVPAVAMAIAVVSFFSGSVLYRLQKPGGS  232

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VAS RK  VKVP DK++L+ET    SNI GSRKL HT++LR FDKAAV   
Sbjct  233   PLTRIAQVLVASFRKINVKVPADKTILYETPDDGSNIVGSRKLEHTDKLRCFDKAAVPTG  292

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
              +  KG+ + WRLCTVTQVEELK+II++LPIWATGI+FS VY QMST FV Q   M+ ++
Sbjct  293   SDDIKGTPNSWRLCTVTQVEELKAIIKILPIWATGIVFSAVYSQMSTMFVLQGNTMDQHI  352

Query  1398  GT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G  FKIP ASLS+FDTLSV+ WVPIYD+LIVP ARKFTG++ G T LQRMG+GL IS+ +
Sbjct  353   GPHFKIPSASLSLFDTLSVLFWVPIYDKLIVPFARKFTGNERGFTQLQRMGIGLVISVFS  412

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             MV A +LE+VRL MV++HN YD+  +PIS+FWQVPQYF+IGCAEVFTFIGQ+EFFYDQAP
Sbjct  413   MVIAGILEVVRLNMVRKHNYYDMETLPISIFWQVPQYFLIGCAEVFTFIGQIEFFYDQAP  472

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRSLCSALSLTTNA+GNYL S LVTIV D+TTR+GK GW+ +NLN GHLDYF+W+LA+
Sbjct  473   DAMRSLCSALSLTTNALGNYLCSLLVTIVMDMTTRHGKLGWIPDNLNRGHLDYFYWVLAI  532

Query  1935  LSVMNLGVFVVVAKMYTYKKAINKV  2009
             LSV+N   ++ ++  YTYKKA   V
Sbjct  533   LSVLNFFAYLWISMKYTYKKATGHV  557



>ref|XP_006848107.1| hypothetical protein AMTR_s00029p00214340 [Amborella trichopoda]
 gb|ERN09688.1| hypothetical protein AMTR_s00029p00214340 [Amborella trichopoda]
Length=567

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/563 (68%), Positives = 469/563 (83%), Gaps = 3/563 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M +  +YT+DGT+D+  +PA K+KTG WKACPFILGNEC ERLAYYGM +NL+ Y + RL
Sbjct  1     MSDPAIYTQDGTVDHTGKPAIKDKTGNWKACPFILGNECCERLAYYGMGTNLVNYMKYRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ + +A+ +++NWSGTCYI+PLVGAF+ADAY GRY  IA FS IYV+GMTL+TLSA+V 
Sbjct  61    NQPSATAANSVTNWSGTCYILPLVGAFVADAYWGRYKVIAVFSAIYVVGMTLLTLSASVG  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+SPTC + + C VT     V F++LYL+ALGTGGIKPCVSS+GADQFD+ DE E+K KS
Sbjct  121   GLSPTCHSGQ-CHVTSGQVAVFFVSLYLIALGTGGIKPCVSSFGADQFDEADEYEKKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASSL+VWIQ+ V WGWGFG+PAVAMA+A+  F +GTRLYR QKP
Sbjct  180   SFFNWFYFSINIGALIASSLLVWIQENVGWGWGFGIPAVAMAIAIFSFLAGTRLYRNQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV VAS+RK  V VP DKSLL+ET+  ES IQGSRKL HTNE  FFDKAAV
Sbjct  240   GGSPITRIAQVFVASIRKSSVTVPSDKSLLYETAEQESVIQGSRKLDHTNEFIFFDKAAV  299

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               E+D++K G  +PW+LCTVTQVEE K+IIR+LPIWA+GIIF+TVY QM+T FV Q   M
Sbjct  300   ETEADKFK-GIPNPWKLCTVTQVEEWKAIIRILPIWASGIIFATVYSQMNTMFVLQGDTM  358

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             + ++G+FKIP ASLS+FDTLSVI WVP+YDRLIVPMAR+FTGH  G T LQRMG+GL IS
Sbjct  359   DPHMGSFKIPAASLSLFDTLSVIFWVPVYDRLIVPMARRFTGHDRGFTQLQRMGIGLVIS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             +LAM  AA++E+ RL  V+ HN Y++  +P+S+FWQVPQYF++G AEVFTFIGQLEFFYD
Sbjct  419   VLAMGLAAIVEIKRLEQVRIHNYYELDTIPMSIFWQVPQYFVVGAAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRS+CSALSLTT A+GNYLS+ LVT+V  +TT+ GKPGW+ +NLNYGH+DYFFWL
Sbjct  479   QAPDAMRSMCSALSLTTVALGNYLSTLLVTVVTHVTTKGGKPGWIPDNLNYGHVDYFFWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKK  1994
             LA+LSV+N  V++ +A  YTYK+
Sbjct  539   LAILSVINFVVYLGIANWYTYKR  561



>ref|XP_010558361.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Tarenaya hassleriana]
Length=570

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/566 (67%), Positives = 467/566 (83%), Gaps = 4/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E+D+YT+DGT+D R RPANK +TG WKAC FILGNEC ERLAYYGM +NL+ Y +  L
Sbjct  1     MTEEDIYTQDGTVDIRKRPANKKETGNWKACRFILGNECCERLAYYGMGTNLVNYLEKNL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++A+ +++NWSGTCY  PL+GAFLADAYLGRYWTIA+F IIYV GMTL+TLSA+VP
Sbjct  61    NQGNVAAANSVTNWSGTCYATPLLGAFLADAYLGRYWTIASFVIIYVFGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C   + C  T   T+V FIALY++ALGTGGIKPCVSS+GADQFD++D+ E+K KS
Sbjct  121   GLKPSC-QGDVCNPTTGQTVVFFIALYMIALGTGGIKPCVSSFGADQFDESDDAEKKRKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GA++ASS++VWIQ  V WGWGFGVP VAM +AV FFF+G++ YR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPTVAMVIAVMFFFAGSKYYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVA+ +K KVKVP DKSLL+E    ES I+GSRKL HT++L FFDKAAV
Sbjct  240   GGSPITRILQVIVAAFKKSKVKVPDDKSLLYEVEDAESTIKGSRKLEHTDKLTFFDKAAV  299

Query  1209  V-ESDEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
               ESD  K  S  +PWRLCTVTQVEELK++IRLLP+WA+GI+F+TVY QMST FV Q   
Sbjct  300   YSESDNPKTSSPPNPWRLCTVTQVEELKALIRLLPVWASGIVFATVYSQMSTMFVLQGNT  359

Query  1383  MNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             M+ ++G  F IP ASLS+FDTLSV+ W PIYD+ IVP ARKFTGH+ G T LQRMG+GL 
Sbjct  360   MDQHMGPHFTIPSASLSLFDTLSVLFWAPIYDQFIVPFARKFTGHERGFTQLQRMGIGLV  419

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             IS+ +M++A +LE+VRL  V+ HNLYD   VP+++FWQVPQYF++GCAEVFTFIGQLEFF
Sbjct  420   ISVFSMITAGILEVVRLNYVRTHNLYDQETVPMTIFWQVPQYFLVGCAEVFTFIGQLEFF  479

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +TT  G+ GW+ +NLN GHLDYF+
Sbjct  480   YDQAPDAMRSLCSALSLTTVALGNYLSTLLVTVVTSVTTSGGRLGWIPDNLNRGHLDYFY  539

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA+LS++N  V+++++K YTYKKA
Sbjct  540   WLLAILSLLNFLVYLLISKWYTYKKA  565



>ref|XP_002309120.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE92643.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=567

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/567 (67%), Positives = 458/567 (81%), Gaps = 3/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M +DD Y+ DGT+D +  PANK KTG WKA  FILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MAQDD-YSNDGTVDIKGNPANKKKTGNWKAGRFILGNECCERLAYYGMSTNLVNYLEDRL  59

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+F +IY+IGMTL+TLSA+VP
Sbjct  60    NQGNVAASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFVVIYIIGMTLLTLSASVP  119

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+  +C   + C  T   T   F+ALY +ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLESSC-DKDSCHPTTGQTTAFFVALYFIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+ASS++VWIQ  V WGWGFG+PAVAMA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGIPAVAMAVAVVFFFLGSKLYRIQKP  238

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS RK  V+VP DKSLL+ET+  ES IQGSRKL HT++ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASFRKYHVQVPADKSLLYETAEEESQIQGSRKLEHTDKFKFFDKAAV  298

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K   +PWRLCTVTQVEELKSI+RLLP+WA+GI+F+TVY QMS  FV Q   M+
Sbjct  299   ETQTDNIKDLTNPWRLCTVTQVEELKSIVRLLPVWASGIVFATVYSQMSIMFVLQGNTMD  358

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+F  LSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+GL IS
Sbjct  359   QHMGPHFKIPSASLSLFGYLSVIFWAPVYDRIIVPYARKFTGHERGFTQLQRMGIGLVIS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I++M+ A VLE VRL  V+ +N YD+  +P+++FWQVPQYF+IGCAEVFTFIGQLEFFYD
Sbjct  419   IVSMIVAGVLEAVRLNFVRENNYYDLEYIPMTIFWQVPQYFLIGCAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  +TTR GK GW+ +NLN GHLDYF+WL
Sbjct  479   QAPDAMRSLCSALSLTTVALGNYLSTLLVTIVTKVTTRGGKLGWIPDNLNRGHLDYFYWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LA+LS +N   ++ ++K Y YKKA  +
Sbjct  539   LAILSFLNFTAYLWISKWYAYKKATER  565



>ref|XP_009358875.1| PREDICTED: uncharacterized protein LOC103949485 [Pyrus x bretschneideri]
Length=1143

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/579 (67%), Positives = 473/579 (82%), Gaps = 3/579 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE+D++TKDGT DY+NRPA K  TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEEEDIHTKDGTTDYQNRPAIKKNTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  + A  N++NWSGTCY+ PL+GAFLADAY+GRYWTIA FSIIYV GMTL+TLSA++ 
Sbjct  61    NQRNVVAVNNVTNWSGTCYVTPLLGAFLADAYMGRYWTIAAFSIIYVFGMTLLTLSASIQ  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C  +  C  TG  T V F  LYL+ALGTGGIKPCVSS+GADQFDD+D+ E+K+KS
Sbjct  121   GLKPPCDNNNVCHPTGLQTGVFFTGLYLIALGTGGIKPCVSSFGADQFDDSDDAEKKNKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V W WGFG+PAVAMA+AV  FFSGTRLYR Q P
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQTNVGWSWGFGIPAVAMALAVVSFFSGTRLYRTQIP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK +V+VP DKSLL+ET+  ES ++GSRKL HT++L F DKAAV
Sbjct  241   GGSPLTRICQVLVASFRKFRVRVPRDKSLLYETADQESVVKGSRKLDHTDQLSFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  KGS  PWRLC+VTQVEE KS+IRLLPIWATGIIFS VY QM T FV Q   M+
Sbjct  301   ETQSDKVKGSAMPWRLCSVTQVEEHKSLIRLLPIWATGIIFSAVYSQMGTLFVLQGNTMD  360

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              +V  +F+IP ASLS+FDT+SVI WVP+YDR+IVP  R+FTG  SG T LQR+ VGL IS
Sbjct  361   LHVSKSFEIPSASLSLFDTVSVIFWVPVYDRVIVPFVRRFTGRNSGFTQLQRIAVGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM++A  LE+VRL  V++HN YD+  VP+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+
Sbjct  421   IFAMLAAGALELVRLREVRKHNHYDLKHVPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYE  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LV IV D++T++GKPGW+ +NLNYGHL YFFWL
Sbjct  481   QAPDAMRSLCSALSLTTAALGNYLSTMLVNIVTDVSTKDGKPGWIPDNLNYGHLHYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA--INKVSDLVEEAEN  2036
             LA+LSV+NLG +++VA+ YTYK+A   +   D V  A++
Sbjct  541   LALLSVVNLGFYLLVARWYTYKRAPVCDDDGDFVAMADD  579


 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/564 (68%), Positives = 461/564 (82%), Gaps = 2/564 (0%)
 Frame = +3

Query  306   AMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             AM +DD+YT DGTLD   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y + R
Sbjct  575   AMADDDLYTNDGTLDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLEKR  634

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L    ++A+ ++SNWSGTCY  PL+GAFLADAYLGRYWTIA FSI+YV+GMTL+TL+A++
Sbjct  635   LGMGNVTAATSVSNWSGTCYATPLIGAFLADAYLGRYWTIAIFSIVYVLGMTLLTLTASI  694

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              G+ P C     C  T      CF+ALYL+A+GTGGIKPCVSS+GADQFD+TDE ERK K
Sbjct  695   NGLKPHCDI-SGCNTTSSQRAACFVALYLIAVGTGGIKPCVSSFGADQFDETDETERKKK  753

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFY SIN+GAL+AS+++VW+Q  V W WGFGVPAVAM +AV FFF G++LYR QK
Sbjct  754   SSFFNWFYMSINVGALIASTVLVWMQMNVGWNWGFGVPAVAMGIAVAFFFLGSKLYRLQK  813

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+ AS+RK KVKVP DKSLL+ET+  E NIQGSRKL HTN+L FFDKAA
Sbjct  814   PGGSPLTRIAQVVAASIRKCKVKVPADKSLLYETADEECNIQGSRKLEHTNKLGFFDKAA  873

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V       K   SPW LCTVTQVEELKSIIR+LPIWA+GI+F+TVYGQMST FV Q   +
Sbjct  874   VESETNRAKELPSPWSLCTVTQVEELKSIIRVLPIWASGIVFATVYGQMSTMFVLQGNTL  933

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  FKIP ASLS+FDT+SVI W PIYDRLIVP+AR FTGH+ G T LQRMG+GL +
Sbjct  934   DQHMGPNFKIPSASLSLFDTVSVIFWAPIYDRLIVPLARHFTGHERGFTTLQRMGIGLAL  993

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI +MV A VLE+VRLA VK++N YD+  +P+S+FWQVPQYFIIGCAEVFTFIGQ+EFFY
Sbjct  994   SIFSMVVAGVLEVVRLATVKKYNYYDLEYIPMSIFWQVPQYFIIGCAEVFTFIGQMEFFY  1053

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +TT+NG  GW+ +NLN GHLDYF+W
Sbjct  1054  DQAPDAMRSLCSALSLTTVALGNYLSTLLVTVVTKVTTKNGNLGWIPDNLNRGHLDYFYW  1113

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKK  1994
             LLA+LSV+N  V++ +AK YTYKK
Sbjct  1114  LLAILSVINFLVYLWIAKWYTYKK  1137



>ref|XP_010262762.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262763.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262764.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
Length=568

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/565 (68%), Positives = 463/565 (82%), Gaps = 2/565 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YTKDG+ D   +PA +  TG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGSTDIHKKPAIRRTTGNWKACFFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQS ++AS N++NW+GTCYI PLVGAFLADAYLGRYWTIA+FSIIY +GMTL+TLSA+VP
Sbjct  61    NQSNVTASNNVTNWAGTCYITPLVGAFLADAYLGRYWTIASFSIIYFLGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C     C  TG  +++CF+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E+K KS
Sbjct  121   GLKPSCDGMV-CHPTGSQSVICFLALYLIALGTGGIKPCVSSFGADQFDENDEDEKKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFN+FYFSINIGAL+ASS++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR+Q P
Sbjct  180   SFFNFFYFSINIGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVMSFFSGTRLYRHQNP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGS  TR+ QV+VAS RK K K+P D +LL+ET+G ES I GSRKL HT  +RF DKAAV
Sbjct  240   GGSALTRICQVLVASFRKIKEKIPDDGNLLYETTGAESAIIGSRKLDHTKGMRFLDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K S  PWRLCTVTQVEELKSIIRLLPIWA+GI FSTVY Q+ST FV Q   M+
Sbjct  300   ETQTDKIKASVDPWRLCTVTQVEELKSIIRLLPIWASGIAFSTVYSQISTMFVLQGNTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDT+SV  W PIYDR+IVP+ARK T HK+G T LQRMG+GL IS
Sbjct  360   PHMGPHFQIPSASLSIFDTISVTFWTPIYDRIIVPLARKHTSHKNGFTQLQRMGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM++A +LE+VRL MVK+HN YD   +P+S+FWQ+PQYF+IGCAEVFTFIGQLEFFYD
Sbjct  420   IFAMLAAGILEVVRLNMVKKHNYYDNQFLPMSIFWQIPQYFLIGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRS+ SALSLTT A+GNYLS+ LVTI+  +TTRNGK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSMSSALSLTTVAVGNYLSTLLVTIITKVTTRNGKVGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LAVLSV+N  V++ +A  + YK+ +
Sbjct  540   LAVLSVINFVVYLWIANGFKYKRVV  564



>gb|EYU41841.1| hypothetical protein MIMGU_mgv1a017650mg [Erythranthe guttata]
Length=568

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/571 (66%), Positives = 462/571 (81%), Gaps = 10/571 (2%)
 Frame = +3

Query  309   MEED--DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             ME+D  D+YTKDGT+D+  +PANK+KTGTWKAC FIL  EC ERLAYYGM +NL+ Y  T
Sbjct  1     MEDDKADIYTKDGTVDFYKKPANKDKTGTWKACRFILVTECCERLAYYGMGTNLVNYLTT  60

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             RL    ++AS +++NWSGTCYI PL+GAFLAD+YLGRYWTIATFS IYV+GM L+T+SA+
Sbjct  61    RLGLGNVAASNSVTNWSGTCYITPLLGAFLADSYLGRYWTIATFSSIYVLGMALLTMSAS  120

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             +PG+ P C+  + C  T   T   F ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K 
Sbjct  121   IPGLKPECV-DDVCHPTSSQTATFFAALYLIALGTGGIKPCVSSFGADQFDESDETEKKK  179

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFN+FY SINIGA++ASS++VWIQ  V WGWGFGVPAV+MA+AV FFF GT LYR Q
Sbjct  180   KSSFFNYFYLSINIGAMIASSVLVWIQMNVGWGWGFGVPAVSMAVAVIFFFVGTSLYRIQ  239

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
              PGGSP TR+ QV+VA ++K  V+VP+DKSLL+ET   ESNIQGSRKL HT++ RF DKA
Sbjct  240   LPGGSPLTRICQVLVACMKKVNVEVPMDKSLLYETDDNESNIQGSRKLEHTDKFRFLDKA  299

Query  1203  AVV-ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AV  ESDE  K    PW LCTVTQVEE KS++RLLPIWATGI+FSTVY QMST FV Q  
Sbjct  300   AVATESDENVK----PWSLCTVTQVEEFKSVLRLLPIWATGIVFSTVYSQMSTMFVLQGD  355

Query  1380  GMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
              M+ ++G  FKIP ASLS+FDTLSVI W P+YD +I+P+ARK+T ++ G T LQRMG+GL
Sbjct  356   TMDQHLGRNFKIPAASLSLFDTLSVIFWAPVYDLIIIPIARKYTKNERGFTQLQRMGIGL  415

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
              ISI AMV A  LE+ RL  V+++NLYD   VP+++FWQVPQYF++GCAEVFTFIGQLEF
Sbjct  416   VISIFAMVVAGSLEVSRLNYVRKNNLYDEKTVPMTIFWQVPQYFLVGCAEVFTFIGQLEF  475

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLAN-NLNYGHLDY  1913
             FYDQAPD+MRSLC+ALSL+TNA+GNYL + LVTIVA++TTRNG  GW+ + NLN GHLDY
Sbjct  476   FYDQAPDAMRSLCAALSLSTNALGNYLCTALVTIVANVTTRNGGLGWIPDKNLNRGHLDY  535

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             F+WLLA+LS++N   ++ +A  YTYKK + K
Sbjct  536   FYWLLAILSLINFFAYLFIANWYTYKKVVGK  566



>ref|XP_008239599.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Prunus mume]
Length=568

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/569 (66%), Positives = 453/569 (80%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD YT DGT+D    PANK KTG W+AC FILGNEC ERLAYYGMS+NL+ Y   RL
Sbjct  1     MGEDDDYTNDGTVDIHKNPANKKKTGNWRACRFILGNECCERLAYYGMSTNLVNYLGKRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +   ++AS  ++NWSGTCY  PL+GAFLADAYLGRYWTIA FS+IY +GMT +TL+A++ 
Sbjct  61    SMGNVAASTTVTNWSGTCYATPLIGAFLADAYLGRYWTIAIFSVIYALGMTFLTLTASIK  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  T      CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GLKPRC-DKSGCQATSSQRAACFVALYMIALGTGGIKPCVSSFGADQFDETDETERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+AS+++VW Q  V W WGFG+PAVAMA+AV FFF G++LYR QKP
Sbjct  180   SFFNWFYLSINIGALIASTVLVWTQMTVGWNWGFGIPAVAMAIAVVFFFLGSKLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVI AS+RK  VKVP DKSLL ET   E NIQGSRKL HT++LRFFDKAAV
Sbjct  240   GGSPLTRIIQVIFASIRKCNVKVPADKSLLFETPDEECNIQGSRKLEHTDKLRFFDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K   +PWRLCTVTQVEELKSIIRLLPIWA+GI+F+ VY QMST FV Q   M+
Sbjct  300   ESETDHAKDLPNPWRLCTVTQVEELKSIIRLLPIWASGIVFAAVYSQMSTMFVLQGNTMD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDT+SVI W  IYD++IV +AR+FTGH+ G T LQRMG+GL +S
Sbjct  360   QHMGPNFKIPSASLSLFDTVSVIFWALIYDQVIVKLARRFTGHERGFTQLQRMGIGLGLS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV A +LE+ RL +V+++N YD+  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFYD
Sbjct  420   IFSMVVAGILEVARLGIVRKNNYYDLEYIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYD  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLSS LVT+V  +TTRNG  GW+ NNLN GHLDYF+WL
Sbjct  480   QAPDAMRSLCSALSLTTVALGNYLSSLLVTVVTKVTTRNGHLGWIPNNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             LA LS++N  V++ +AK YTYKK   + +
Sbjct  540   LAALSIINFFVYLWIAKWYTYKKVTGRTN  568



>emb|CDY13185.1| BnaC04g26500D [Brassica napus]
Length=559

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/568 (66%), Positives = 449/568 (79%), Gaps = 13/568 (2%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTEDGTVDIHKNPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P     + C      T V F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNGDTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKLKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GALVA++++VWIQ  V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALVAATVLVWIQMNVGWGWGFGVPTVAMVIAVVFFFLGSRYYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQVIVA+ RK  VKVP DKSLL ET+  ESNI GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKVSVKVPEDKSLLFETADDESNITGSRKLEHTDNLMFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
                SD  K G  +PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM+T FV Q   M
Sbjct  301   ESHSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNTM  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP ASLS+FDT+SV+ W P+YD+ IVP ARKFT  + G T LQRMG+GL I
Sbjct  361   DQHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIVPFARKFTRQERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AMV+A VLE+VRL             +P+S+FWQ+PQY ++GCAEVFTFIGQLEFFY
Sbjct  421   SIFAMVTAGVLEVVRLDY-----------IPMSIFWQIPQYLLVGCAEVFTFIGQLEFFY  469

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +T +NGKPGW+ +NLN GHLDYFF+
Sbjct  470   DQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKLTKKNGKPGWIPDNLNRGHLDYFFY  529

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLAVLS +N  V++ ++K Y YKKAI +
Sbjct  530   LLAVLSFLNFLVYLWISKRYKYKKAIGR  557



>ref|XP_006429308.1| hypothetical protein CICLE_v10013821mg [Citrus clementina]
 gb|ESR42548.1| hypothetical protein CICLE_v10013821mg [Citrus clementina]
Length=550

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/537 (68%), Positives = 439/537 (82%), Gaps = 1/537 (0%)
 Frame = +3

Query  315   EDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  494
             E+D++  DGT+D+ N+PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y +  LNQ
Sbjct  4     EEDIHINDGTIDFGNKPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLRFELNQ  63

Query  495   STISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGI  674
               + A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYVIGMT++T+SA+V G+
Sbjct  64    GNVQAVNNVTNWSGTCYVMPLIGAFLADAYLGRYWTIASFSIIYVIGMTILTMSASVHGL  123

Query  675   SPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  854
              P C     C  TG    V F+ LYL+ALGTGGIKPCVSS+GADQFDD DE E+K KSSF
Sbjct  124   KPLCDKRNVCHPTGLQIAVFFVGLYLIALGTGGIKPCVSSFGADQFDDYDEAEKKKKSSF  183

Query  855   FNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGG  1034
             FNWFYFSINIGALVA+S +VWIQ  V WGWGFG+PAVAMA+AV  FF+G+RLYRYQKPGG
Sbjct  184   FNWFYFSINIGALVAASCLVWIQTNVGWGWGFGIPAVAMAIAVVSFFAGSRLYRYQKPGG  243

Query  1035  SPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVE  1214
             SP TR+ QV+VAS RK ++KVP DKSLL+ET+  E  + GS KL HT +L F DKAAV  
Sbjct  244   SPLTRICQVLVASFRKFRIKVPADKSLLYETADTEFAVIGSHKLDHTKQLSFLDKAAVET  303

Query  1215  SDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
               +  KGS + WRLCTVTQVEE KSIIRLLPIWA GI+FS VY QM T FV Q   M+ +
Sbjct  304   PSDCVKGSVNAWRLCTVTQVEEFKSIIRLLPIWAIGIVFSAVYSQMGTLFVLQGNTMDLH  363

Query  1395  V-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             +  +F+IP ASLS+FDT+SVI WVPIYDRLIVP+ARKFTGHK+G T LQR+ +GL ISI 
Sbjct  364   IDNSFEIPSASLSLFDTISVIFWVPIYDRLIVPLARKFTGHKNGFTQLQRIAIGLVISIF  423

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             AM++A  LE+VRL  VK+HN Y++  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+QA
Sbjct  424   AMLTAGTLELVRLREVKKHNYYELKHIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYEQA  483

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             PD+MRSLCSALSLTT A+GNYLS+ LV IV D +T +GKPGW+ +NLNYGHL YFFW
Sbjct  484   PDAMRSLCSALSLTTAALGNYLSTLLVNIVTDFSTMHGKPGWIPDNLNYGHLHYFFW  540



>ref|XP_010101811.1| Peptide transporter [Morus notabilis]
 gb|EXB89948.1| Peptide transporter [Morus notabilis]
Length=569

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/568 (68%), Positives = 472/568 (83%), Gaps = 3/568 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEEDD+YTKDGTLD    PANK  TG WKAC +ILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MEEDDIYTKDGTLDINKNPANKKTTGHWKACRYILGNECCERLAYYGMSTNLVNYLEERL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             N    +A+ N++NW+GTCYI PL+GAFLAD+YLGRYWTIA+FSIIYV GMTL+TLS++VP
Sbjct  61    NMGNAAAANNVTNWAGTCYITPLIGAFLADSYLGRYWTIASFSIIYVFGMTLLTLSSSVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C     C      T V FIALY++AL TGGIKPCVSS+GADQFD+TDEKERK KS
Sbjct  121   GLKPSC-DKAGCHPKTLQTAVGFIALYMIALATGGIKPCVSSFGADQFDETDEKERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSIN+GAL+ASS++VWIQ  V WGWGFG+PAVAMA+AV FFFSG+RLYR QKP
Sbjct  180   SFFNWFYFSINVGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVVFFFSGSRLYRLQKP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVI+AS RK   +VP DKSLL+ET+  E +IQGSRKL HT++L FFDKAAV
Sbjct  240   GGSPLTRIVQVIIASFRKFNAQVPEDKSLLYETADEECDIQGSRKLEHTDKLTFFDKAAV  299

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               E+D  K G  +PW LCT++QVEELKS+IRLLPIWA+GI+FSTVY QM+T FV Q   +
Sbjct  300   QTETDHIKGGLANPWLLCTISQVEELKSVIRLLPIWASGIVFSTVYSQMNTMFVLQGNTL  359

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G+ F+IP ASLS+FDTLSV+ W P+YDR+IVP ARKFTGH+ G T LQRMG+GL I
Sbjct  360   DQHMGSHFEIPSASLSLFDTLSVLFWAPLYDRIIVPYARKFTGHERGFTQLQRMGIGLVI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM+SA +LE++RL++V+  N YD+  +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  420   SIFAMISAGILEVIRLSIVRGKNYYDLKTIPMSIFWQVPQYFLIGCAEVFTFIGQLEFFY  479

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRS+CSALSLTT A+GNYLS+ LVT+V ++TT NG  GW+ +NLN GHLDYF+W
Sbjct  480   DQAPDAMRSMCSALSLTTVALGNYLSTVLVTVVTNVTTNNGSLGWIPDNLNRGHLDYFYW  539

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA+LS++N  V++ +AK YTYKKA+ +
Sbjct  540   LLAILSLLNFFVYLGIAKRYTYKKAVGR  567



>ref|XP_007140383.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 ref|XP_007140384.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 ref|XP_007140385.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 gb|ESW12377.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 gb|ESW12378.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 gb|ESW12379.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
Length=566

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/567 (66%), Positives = 450/567 (79%), Gaps = 2/567 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD+YT+DGT+    +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q R 
Sbjct  1     MAEDDIYTQDGTITISKKPANKKKTGNWKACYFILGNECCERLAYYGMSTNLVNYLQERF  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  ++A+ N++ WSGTCY+ PL+GAFLAD+YLGRYWTIA+FS+IYVIGM L+TLSA+ P
Sbjct  61    NQGNVTAANNVTTWSGTCYLTPLIGAFLADSYLGRYWTIASFSVIYVIGMILLTLSASAP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P+C A+  C  T   T  CFIALYLVALGTGGIKPCVS++GADQFDD+D+KE   KS
Sbjct  121   GIKPSCDAN-GCHPTSAQTSACFIALYLVALGTGGIKPCVSAFGADQFDDSDKKETIRKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V WGWGFGVPAVAM +A+ FFF G+RLYR Q P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQINVGWGWGFGVPAVAMVIAIIFFFGGSRLYRLQIP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVA LRK  ++VP DKSLLHET  +ES I+GSRKL HTN  +  DKAAV
Sbjct  240   GGSPLTRICQVIVAVLRKISLQVPDDKSLLHETVDVESVIKGSRKLDHTNRFKCLDKAAV  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++     +PWRLCTVTQVEE+KSII LLP+WA+ I FSTVYGQM T FV Q   M+
Sbjct  300   ETQSDHTTRLPNPWRLCTVTQVEEVKSIISLLPVWASLIAFSTVYGQMGTMFVLQGNTMD  359

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              +VG  FKIP ASL++FDTLSVI W P YDR+IVP A +FTGHK G T LQR+G+GL IS
Sbjct  360   QHVGPHFKIPSASLTIFDTLSVIFWAPFYDRIIVPYASRFTGHKHGFTQLQRIGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
              +AMV A +LE+VRL +++++N YD   +P+S+FWQVPQYF++GCAEVFT IG L+FFY 
Sbjct  420   TIAMVVAGILEVVRLDIIRKNNYYDFQTIPLSIFWQVPQYFLVGCAEVFTNIGSLQFFYS  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             +APD+MRS   ALSLTTNA+G+Y+S+ LVTIV  ITTR+G  GW+ +NLN GHLDYF+WL
Sbjct  480   EAPDAMRSFGMALSLTTNAVGSYVSTLLVTIVTKITTRHGSVGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             L +LS +N  VF+ +AK Y+YKK   K
Sbjct  540   LTILSFLNFIVFLWIAKRYSYKKVAAK  566



>gb|KDO53230.1| hypothetical protein CISIN_1g0083672mg [Citrus sinensis]
Length=543

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/538 (69%), Positives = 446/538 (83%), Gaps = 2/538 (0%)
 Frame = +3

Query  402   PFILGNECSERLAYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADA  581
             P I GNEC ERLAYYGMS+NL+ Y Q +LNQ  ++AS N++NWSGTCYI PL+GAFLAD+
Sbjct  7     PLISGNECCERLAYYGMSTNLVNYLQKQLNQGNVTASNNVTNWSGTCYITPLIGAFLADS  66

Query  582   YLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVAL  761
             Y+GR+WTIA+FSIIY +GMTL+TL+A+V G+ P+C   + C  TG  T V F+ALYL+AL
Sbjct  67    YMGRFWTIASFSIIYCLGMTLLTLTASVSGLKPSC-DKDACHPTGAQTAVTFVALYLIAL  125

Query  762   GTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWG  941
             GTGGIKPCVSS+GADQFD+TD+ ER+ KSSFFNWFY SINIGALVASS++VWIQ  V WG
Sbjct  126   GTGGIKPCVSSFGADQFDETDDGEREKKSSFFNWFYLSINIGALVASSVLVWIQMNVGWG  185

Query  942   WGFGVPavamamavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLH  1121
             WGFG+PAVAMA+AV FFFSG+RLYR QKPGGSP TR+ QVIVAS RK  V VP DKSLL+
Sbjct  186   WGFGIPAVAMAIAVVFFFSGSRLYRIQKPGGSPLTRIMQVIVASFRKSNVVVPADKSLLY  245

Query  1122  ETSGLESNIQGSRKLSHTNELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRL  1301
             ET+  E NIQGSRKL  T++ +FFDKAAV    +  KGS  PWRLCTVTQVEELK+IIRL
Sbjct  246   ETADEECNIQGSRKLESTSKFKFFDKAAVETQTDRVKGSADPWRLCTVTQVEELKAIIRL  305

Query  1302  LPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDR  1478
             LP+WA+GI+F+TVY QMST FV Q   M+ ++G  FKIP ASLS+FDTLSVI W PIYD 
Sbjct  306   LPVWASGIVFATVYSQMSTMFVLQGNTMDQHMGPNFKIPSASLSLFDTLSVIFWAPIYDI  365

Query  1479  LIVPMARKFTGHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPI  1658
             +IVP ARK TGH+ G T LQRMG+GL ISI +MV+A +LE+VRL +VKR+N YD+  +P+
Sbjct  366   VIVPFARKLTGHERGFTQLQRMGIGLLISIFSMVAAGILEVVRLNIVKRNNYYDIETIPM  425

Query  1659  SVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTI  1838
             ++FWQVPQYFI+GCAEVFTFIGQLEFFYDQAPD+MRSLCSALSLTT A+GNYLS+ LVTI
Sbjct  426   TIFWQVPQYFIVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTTVAVGNYLSTLLVTI  485

Query  1839  VADITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             V  +TT+NGK GW+ +NLN GHLDYF+WLL +LSV+N  V++ +AK +TYKKA  + +
Sbjct  486   VTKVTTKNGKLGWIPDNLNRGHLDYFYWLLTILSVLNFLVYLWIAKWFTYKKATGRAN  543



>ref|XP_010326140.1| PREDICTED: uncharacterized protein LOC101268606 [Solanum lycopersicum]
Length=1134

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/564 (67%), Positives = 463/564 (82%), Gaps = 4/564 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E+D+ + KDGT+DY+N PA KN+TGTW+ACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  3     EDDNKFVKDGTVDYKNNPAIKNQTGTWRACPYILGNECCERLAYYGINTNLVNYLKNQMN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +S++ A  N++NWSGTCY+ PL+GAFLADAYLGR+WTIA FSIIYV GMT++TLSA++ G
Sbjct  63    ESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRFWTIAVFSIIYVFGMTVLTLSASIHG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C  +  C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSS
Sbjct  123   LKPPCDDNNSCEPKGLQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKKKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVAS+++VWIQ  V W WGFG+PAVAMA+AV  FFSGT+LYR QKPG
Sbjct  183   FFNWFYFSINIGALVASTVLVWIQTNVGWSWGFGIPAVAMAIAVVSFFSGTKLYRNQKPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+FQV+VAS RK KVK   D S+L ETS  ES +QGSRKL HT +L FFDKAAV 
Sbjct  243   GSPLTRIFQVVVASFRKIKVK---DTSVLFETSDEESLVQGSRKLDHTQQLSFFDKAAVE  299

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
                +  KGS + W LCTVTQVEELKSI+RLLPIWATGIIFS+VY QM T FV Q   M+ 
Sbjct  300   TESDKIKGSINGWSLCTVTQVEELKSILRLLPIWATGIIFSSVYSQMGTLFVLQGNTMDL  359

Query  1392  YV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
             ++  +F+IP ASLS+FDT+SVI WVPIYDR+IVP+AR+ TGH++G T LQR+ +GL ISI
Sbjct  360   HMTKSFEIPSASLSLFDTISVIFWVPIYDRVIVPLARRITGHRNGFTQLQRIAIGLIISI  419

Query  1569  LAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQ  1748
              AM+ A  LEMVRL  VK+HN Y+   +P+S+FWQVPQYF+IGCAEVFTFIGQLEFFY+Q
Sbjct  420   FAMLIAGTLEMVRLESVKQHNYYEKKHIPMSIFWQVPQYFVIGCAEVFTFIGQLEFFYEQ  479

Query  1749  APDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLL  1928
             APD+MRSLCSALSL T A+GNYLS+FLV +V D++TR+G  GW+ +NLNYGHL YFFWLL
Sbjct  480   APDAMRSLCSALSLITTALGNYLSTFLVNVVTDMSTRHGGAGWIPDNLNYGHLHYFFWLL  539

Query  1929  AVLSVMNLGVFVVVAKMYTYKKAI  2000
             AVLSV+N G F+ VAK YTYKKAI
Sbjct  540   AVLSVINFGFFLFVAKFYTYKKAI  563


 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/572 (66%), Positives = 453/572 (79%), Gaps = 3/572 (1%)
 Frame = +3

Query  294   IRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIY  473
             I   +M+ DD YTKDGT+D   RPANK KTGTWKACP+ILG+E  ERLAYYGMS+NL+ Y
Sbjct  564   IGPSSMDSDDDYTKDGTMDIYKRPANKKKTGTWKACPYILGDEACERLAYYGMSTNLVNY  623

Query  474   FQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTL  653
              Q RLN    S+SK ++NWSGTCY+ PL+GAFLADAYLGRYWTIA FS +Y+IGMTL+TL
Sbjct  624   IQKRLNLGVASSSKAVNNWSGTCYVTPLIGAFLADAYLGRYWTIAGFSFLYIIGMTLLTL  683

Query  654   SATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKE  833
             SA+V GI P    +  C  T       F+++YL+A GTGGIKPCVSS+GADQFDD DE E
Sbjct  684   SASVKGIRPC--NNGTCNPTSSQRAAFFVSIYLIAFGTGGIKPCVSSFGADQFDDNDENE  741

Query  834   RKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLY  1013
             +K KSSFFNWFY SIN+GAL+ASS++V+IQ  V WG GFGVPAVAMA+A+ FFFSGTRLY
Sbjct  742   KKKKSSFFNWFYLSINVGALIASSVLVYIQSNVGWGLGFGVPAVAMAIALVFFFSGTRLY  801

Query  1014  RYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFF  1193
             R Q P GSP TR+FQV VA +RK  VK P D +LL+ET+  ES I  SRKL H++E RFF
Sbjct  802   RLQPPAGSPLTRIFQVFVAFIRKCHVKTPHDDTLLYETADTESIIVASRKLEHSDEFRFF  861

Query  1194  DKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             DKAAV    +   G  +PWRLCTVTQVEE+KSIIRLLPIWATGI+FS VYGQMST FV+Q
Sbjct  862   DKAAVEAESDKVDGLVNPWRLCTVTQVEEVKSIIRLLPIWATGIVFSCVYGQMSTMFVNQ  921

Query  1374  AIGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
                M+ ++G  F+IP A LS+FDT+SVI W P+YD  IVP+ARK+TG++ G T LQRMG+
Sbjct  922   GNVMDNHIGPHFRIPSACLSIFDTVSVIFWAPVYDLFIVPLARKYTGNERGFTQLQRMGI  981

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GL IS+ AM  AAVLE +RL MV+++N YD   VP+S+FWQVPQYF+IGCAEVFTFIGQL
Sbjct  982   GLVISVFAMACAAVLETIRLDMVRKNNYYDSEYVPLSIFWQVPQYFLIGCAEVFTFIGQL  1041

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRSLCSAL LTT A+GNYLSS LVTIV ++TTR+GK GW+ + LN GHLD
Sbjct  1042  EFFYDQAPDAMRSLCSALCLTTTALGNYLSSLLVTIVMNVTTRHGKFGWIPDELNRGHLD  1101

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             YF+WLLA LS++N  +++ ++K YTYKK   K
Sbjct  1102  YFYWLLAFLSIINFFIYLWISKWYTYKKIAGK  1133



>gb|EYU41851.1| hypothetical protein MIMGU_mgv1a020985mg [Erythranthe guttata]
Length=576

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/566 (67%), Positives = 459/566 (81%), Gaps = 3/566 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +E D YT DGT DYRN PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  7     DEVDKYTNDGTTDYRNNPAIKQETGTWKACPYILGNECCERLAYYGINTNLVNYLKIQMN  66

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             ++ ++A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIATFS IYV GMT++TLSA+V G
Sbjct  67    ENNVAAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIATFSTIYVFGMTVLTLSASVNG  126

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C     C+  G    V +  +YL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSS
Sbjct  127   LKPICDDKNVCSPNGLQKAVFYTGMYLIALGTGGIKPCVSSFGADQFDDSDESEKKSKSS  186

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFY SINIGALVA++++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR Q+PG
Sbjct  187   FFNWFYLSINIGALVAATVLVWIQTNVGWGWGFGIPAVAMALAVVSFFSGTRLYRKQRPG  246

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHET-SGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GSP TR+ QVIVAS RK  V VP DK  L+ET    ES I+GSRKL HT +L FFDKAAV
Sbjct  247   GSPLTRICQVIVASFRKVGVDVPKDKFDLYETEEEQESAIKGSRKLEHTEKLSFFDKAAV  306

Query  1209  VESDEYKKGS-FSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
                 + K GS  +PWR+CTVTQVEELK+II LLPIWATGIIFS VY QM T FV Q   M
Sbjct  307   ETQSDRKNGSKINPWRVCTVTQVEELKAIINLLPIWATGIIFSAVYSQMGTLFVLQGNTM  366

Query  1386  NTYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             N +V  +F+IP A+LS+FDT+SVI WVP+YD++IVP ARK+TG+K+G T LQRM +GL I
Sbjct  367   NLHVIKSFEIPSATLSLFDTVSVIFWVPVYDKIIVPFARKYTGNKNGFTQLQRMAIGLVI  426

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SILAM  A  LEM+RL MV+ ++ Y+   VP+S+FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  427   SILAMAIAGTLEMIRLNMVRENDYYEFKHVPLSIFWQVPQYFVIGCAEVFTFIGQLEFFY  486

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +QAPD+MRSLCSALSLTT A GNYLS+ LV+IV  ++TRNG PGW+ +NLNYG LDYFFW
Sbjct  487   EQAPDAMRSLCSALSLTTAAFGNYLSTLLVSIVVHVSTRNGGPGWIPDNLNYGRLDYFFW  546

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LLAVLSV NLGV+++VAK YTYKKA+
Sbjct  547   LLAVLSVFNLGVYLLVAKWYTYKKAL  572



>ref|XP_008775060.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
Length=576

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/568 (66%), Positives = 452/568 (80%), Gaps = 7/568 (1%)
 Frame = +3

Query  309   MEE-DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             MEE +D YTKDGT D    PA +  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y +  
Sbjct  1     MEEAEDKYTKDGTTDIHGNPAVRKGTGNWRACPYILANECCERLAYYGMSTNLVNYLKDH  60

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L+Q   +A+ N++NWSGTCYI+PL+GAFLADAYLGRYWTIA+F IIY+ G+TL+TL+A+V
Sbjct  61    LHQGNSTAANNVTNWSGTCYILPLLGAFLADAYLGRYWTIASFMIIYIFGLTLLTLTASV  120

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              G+ P C  +  C  T   + V F+ALYLVALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  121   GGLKPAC-RNGVCDPTNAQSAVFFVALYLVALGTGGIKPCVSSFGADQFDDSDESEKKRK  179

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYFSINIGALVA+ ++VWIQ+   WGWGFG+PAV M++AV  FFSGT LYR+QK
Sbjct  180   SSFFNWFYFSINIGALVAALVLVWIQENKGWGWGFGIPAVVMSIAVVSFFSGTALYRHQK  239

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK   KVP DKSLL+E    ES IQGSRKL HTN+  F DKAA
Sbjct  240   PGGSPLTRIAQVVVASFRKSGAKVPADKSLLYEIPEKESAIQGSRKLEHTNQFEFLDKAA  299

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   DE   G   PW LCTVTQVEELKS++R+LPIWA+GI+F+TVY QM T FV Q   +
Sbjct  300   VRSQDEKIGGPADPWMLCTVTQVEELKSVLRILPIWASGIVFATVYSQMGTMFVLQGDTL  359

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             +  +G  FKIP AS+SVFDT+SVIVWVPIYDR+IVP+ARKFTG + G T L RMG+GL I
Sbjct  360   DRRMGPHFKIPAASVSVFDTISVIVWVPIYDRIIVPVARKFTGRERGFTQLTRMGIGLVI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTE----VPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             SI +M++A  LE+VRL +V R NLYD       VP+SVFWQVPQYFI+G AEV+TFIGQL
Sbjct  420   SIFSMLAAGTLEIVRLRIVARDNLYDRDGDNDYVPLSVFWQVPQYFIVGAAEVYTFIGQL  479

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQAPD+MRS+ SALSLTT A+GNYLS+ LVTIV  ITTRNGK GW+ +NLN GHLD
Sbjct  480   EFFYDQAPDAMRSMLSALSLTTVALGNYLSTLLVTIVTHITTRNGKLGWIPDNLNRGHLD  539

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             YFFWLLA+LSV+N  V++++AK Y+YKK
Sbjct  540   YFFWLLAILSVVNFLVYLLIAKWYSYKK  567



>ref|XP_004492413.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Cicer arietinum]
 ref|XP_004492414.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Cicer arietinum]
Length=568

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/569 (65%), Positives = 455/569 (80%), Gaps = 2/569 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M ED +YT+DGT++   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y   R 
Sbjct  1     MAEDAIYTQDGTINIYKKPANKKKTGNWKACWFILGNECCERLAYYGMSTNLVNYLGQRY  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ +++ WSGTCYI PL+GAF+AD+Y GRYWTIA+FSIIYVIGM ++TLSA+VP
Sbjct  61    NQGNAAAANSVTTWSGTCYITPLLGAFVADSYFGRYWTIASFSIIYVIGMVILTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P+C A+  C  T   T VC+IALYLVALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GVKPSCDAN-GCHPTSAQTAVCYIALYLVALGTGGIKPCVSSFGADQFDETDENERKKKS  179

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V W WGFGVPAVAM +A+ FFF G+ LYR Q P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQMNVGWEWGFGVPAVAMIIAIIFFFGGSPLYRIQVP  239

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVA+ RK  ++VP DKSLLHET  +ES I+GSRKL HTN LR  DKAA+
Sbjct  240   GGSPLTRICQVIVAACRKLSLQVPDDKSLLHETIDVESVIKGSRKLDHTNNLRCLDKAAI  299

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  +   +PWRLCTVTQVEELKSII LLP+WA+ I F+TVY QM+T FV Q   M+
Sbjct  300   ETQSDRVRNLSNPWRLCTVTQVEELKSIIYLLPVWASLIAFATVYCQMNTMFVLQGNTMD  359

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQR+G+GL IS
Sbjct  360   QHIGPNFQIPSASLSLFDTLSVIFWAPVYDRIIVPFARKFTGHEQGFTQLQRIGIGLVIS  419

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV A +LE++RL M++++N YD+  +P+S+FWQVPQYF++GC+EVF+ IGQLEFFY 
Sbjct  420   IFSMVIAGILEVIRLHMIRKNNYYDLKTIPMSIFWQVPQYFLVGCSEVFSNIGQLEFFYG  479

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSL  ALSLTTNA+GNY+S+ LVTIV  +TTR+GK GW+ +NLN GHLDYF+WL
Sbjct  480   QAPDAMRSLGVALSLTTNALGNYISTLLVTIVTKVTTRHGKLGWIPDNLNRGHLDYFYWL  539

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             L+++S +N  V++ +AK Y YKK    V 
Sbjct  540   LSIISFLNFLVYLWIAKRYRYKKVSGNVD  568



>ref|XP_003604615.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES86812.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=577

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/571 (64%), Positives = 453/571 (79%), Gaps = 2/571 (0%)
 Frame = +3

Query  285   D*QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNL  464
             D  I++   EED +YT+DGT+D    PANK KTG WKAC FILGNEC ERLAYYGMS+NL
Sbjct  3     DVNIKAGVNEEDGLYTEDGTIDIHKNPANKKKTGNWKACRFILGNECCERLAYYGMSTNL  62

Query  465   MIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTL  644
             + Y + R      +A+  ++ WSGTCYI PL+GAFLADAYLGRYWTIA+FS IYVIGM L
Sbjct  63    VNYLEDRYGLGNAAAANTVTTWSGTCYITPLLGAFLADAYLGRYWTIASFSSIYVIGMGL  122

Query  645   MTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  824
             +T SA  PG+ P+C   + C  T   T   FIALYL+ALGTGGIKPCVSS+GADQFD+ D
Sbjct  123   LTFSAIAPGLKPSC-DTDGCHPTSGQTAALFIALYLIALGTGGIKPCVSSFGADQFDEND  181

Query  825   EKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGT  1004
             E ERK KSSFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFGVP VAM +A+ FFF G+
Sbjct  182   ETERKKKSSFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPGVAMVIAIIFFFIGS  241

Query  1005  RLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNEL  1184
             R YR Q PGGSP TR+ QVIVA+ +K   +VP DKSLL+ET+ +ESNI+GSRKL HTNEL
Sbjct  242   RWYRLQIPGGSPLTRICQVIVAAFKKLGQQVPDDKSLLYETTDVESNIKGSRKLEHTNEL  301

Query  1185  RFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQF  1364
             +  DKAAV    +  K   +PWRLCTVTQVEELKS++RLLP+WA+ I F+TVY QM T F
Sbjct  302   KCLDKAAVETESDRIKDLPNPWRLCTVTQVEELKSVVRLLPVWASLIAFATVYSQMGTMF  361

Query  1365  VSQAIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQR  1541
             V Q   M+ ++G  FKIP ASLS+FDTLSVI W P+YDRLIVP ARK+TG++ G T LQR
Sbjct  362   VLQGNTMDQHIGPKFKIPSASLSLFDTLSVIFWAPVYDRLIVPFARKYTGNEHGFTQLQR  421

Query  1542  MGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFI  1721
             +G+GL ISI++M+ A +LE++RL +V+++N YD+  +P+S+FWQVPQYF+IG AEVFT I
Sbjct  422   IGIGLVISIISMIVAGILEVIRLDIVRKNNYYDLETIPMSIFWQVPQYFLIGAAEVFTNI  481

Query  1722  GQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYG  1901
             GQ+EFFY QAPD+MRSLC+ALSLTTNA+GNY+S+ LVTIV  +TTRNG  GW+ +N+N G
Sbjct  482   GQMEFFYGQAPDAMRSLCAALSLTTNALGNYVSTLLVTIVTKVTTRNGSLGWIPDNMNRG  541

Query  1902  HLDYFFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             HLDYF+WLL +LS++N  V++++AK YTYKK
Sbjct  542   HLDYFYWLLTILSLINFIVYLLIAKRYTYKK  572



>ref|XP_009405229.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/577 (66%), Positives = 468/577 (81%), Gaps = 6/577 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E +D+YTKDGT D    PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y + RL+
Sbjct  3     EGEDIYTKDGTTDLHGNPAIKKDTGNWRACPYILANECCERLAYYGMSTNLVNYMKDRLH  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q   +A+ N+++WSGTCY+MPL+GAF+ADAY GRYWTIA+F IIY++G+TL+TL+A+V G
Sbjct  63    QGNATAANNVTDWSGTCYVMPLLGAFIADAYAGRYWTIASFMIIYILGLTLLTLTASVKG  122

Query  672   ISPTCIAHEK-CTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + PTC  H   C  T   T V F +LYL+AL TGGIKPCVSS+GADQFD+TDE E+K KS
Sbjct  123   LEPTC--HSGVCDPTRAQTAVVFTSLYLIALATGGIKPCVSSFGADQFDETDESEKKRKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIG+LVA+S +VWIQ  V WGWGFG+PAVAMA+AV  FF GT LYR+QKP
Sbjct  181   SFFNWFYFSINIGSLVAASALVWIQTNVGWGWGFGIPAVAMAVAVVSFFLGTPLYRHQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VASLRK  VK+P +KSLL+E +   S I+GSRK+ HT++L+F DKAAV
Sbjct  241   GGSPLTRIAQVMVASLRKSGVKLPANKSLLYEITREYSAIRGSRKMDHTDQLKFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                ++   G+ +PWRLCTVTQVEELKSI+RLLPIWA+GI+FSTVY QM T FV Q   ++
Sbjct  301   QTQEDRINGAVNPWRLCTVTQVEELKSIVRLLPIWASGIVFSTVYSQMGTMFVLQGNTLD  360

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  F+IP ASLS+FDT+SVIVWVPIYDR++VP+AR+FTG + G THL RMGVGL IS
Sbjct  361   RHMGPRFEIPSASLSIFDTISVIVWVPIYDRVVVPVARRFTGRERGFTHLTRMGVGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM SA VLE+ RL +V RH  YD   VP+SVFWQVPQY I+G AEVFTFIGQLEFFYD
Sbjct  421   IFAMSSAGVLEVARLRVVARHKRYDGVYVPMSVFWQVPQYVIVGAAEVFTFIGQLEFFYD  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRS+CSALSLTT A+GNYLSS LVTIV+ ITT+NGKPGW+ ++L+ GHLDYFF L
Sbjct  481   QAPDAMRSMCSALSLTTAALGNYLSSLLVTIVSRITTKNGKPGWIPDDLDRGHLDYFFGL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAEN  2036
             LAVLS++N GV++V+AK YTYKKAI+  ++   EA N
Sbjct  541   LAVLSLVNFGVYLVMAKWYTYKKAID--NETKAEAPN  575



>ref|XP_007207074.1| hypothetical protein PRUPE_ppa025891mg [Prunus persica]
 gb|EMJ08273.1| hypothetical protein PRUPE_ppa025891mg [Prunus persica]
Length=568

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/569 (66%), Positives = 455/569 (80%), Gaps = 3/569 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M  DD YT DGT+D    PANK KTG W+AC FILGNEC ERLAYYGMS+NL+ Y    L
Sbjct  1     MAYDD-YTNDGTVDIHKNPANKKKTGNWRACGFILGNECCERLAYYGMSTNLVNYLGKHL  59

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +   ++AS  ++NWSGTCY  PL+GAFLADAYLGRYWTIA FS+IY +GMT +TL+A++ 
Sbjct  60    SMGNVAASTTVTNWSGTCYATPLIGAFLADAYLGRYWTIAIFSVIYALGMTFLTLTASIK  119

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C     C  T      CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLKPWC-DKSGCQATSSQRAACFVALYMIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+AS+++VWIQ  V W WGFG+PAVAMA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALIASTVLVWIQMTVGWNWGFGIPAVAMAIAVVFFFFGSKLYRLQKP  238

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QVIVAS+RK  VKVP DKSLL+ET   E NIQGSRKL HT++LRFFDKAAV
Sbjct  239   GGSPLTRIIQVIVASIRKCNVKVPADKSLLYETPDEECNIQGSRKLEHTDKLRFFDKAAV  298

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 ++ K   +PWRLCTVTQVEELKSIIRLLPIWA+GI+F+ VY QMST FV Q   M+
Sbjct  299   ESETDHAKDLPNPWRLCTVTQVEELKSIIRLLPIWASGIVFAAVYSQMSTMFVLQGNTMD  358

Query  1389  TYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              ++G  FKIP ASLS+FDT+SVI W PIYD++IV +AR+FTGH+ G T LQRMG+GL +S
Sbjct  359   QHMGPNFKIPSASLSLFDTVSVIFWAPIYDQVIVKLARRFTGHERGFTQLQRMGIGLGLS  418

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I +MV A +LE+ RL +V+++N YD+  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFYD
Sbjct  419   IFSMVVAGILEVARLGIVRKNNYYDLEYIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYD  478

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVT+V  +TTRNG  GW+ +NLN GHLDYF+WL
Sbjct  479   QAPDAMRSLCSALSLTTVALGNYLSTLLVTVVTKVTTRNGHLGWIPDNLNRGHLDYFYWL  538

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAINKVS  2012
             LA LS++N  V++ +AK YTYKK   + +
Sbjct  539   LAALSIINFFVYLWIAKWYTYKKVTGQTN  567



>emb|CDY10485.1| BnaCnng03860D [Brassica napus]
Length=567

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/562 (66%), Positives = 456/562 (81%), Gaps = 3/562 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             D  YT+DGTLD   +PANKNKTGTWKAC FIL  EC ERLAYYGMS+NL+ Y +  L+  
Sbjct  2     DSEYTQDGTLDIHKKPANKNKTGTWKACRFILVTECCERLAYYGMSTNLVNYIEKHLSMG  61

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
              ++AS +++NWSGTCY  PL+GAFLADAYLGRYWTIA+F +IY+ GMTL+TLSA+VPG++
Sbjct  62    NVAASNSVTNWSGTCYATPLIGAFLADAYLGRYWTIASFVVIYICGMTLLTLSASVPGLT  121

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             PTC   E C  T     + F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE+E++ KSSFF
Sbjct  122   PTCHG-ENCHATEFQIAITFVALYLIALGTGGIKPCVSSFGADQFDDTDEEEKESKSSFF  180

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYF IN+GA+ ASS++VWIQ  V WGWGFGVP VAMA+AV  FF+G++ YR QKPGGS
Sbjct  181   NWFYFVINVGAMFASSVLVWIQMNVGWGWGFGVPTVAMAVAVLLFFAGSKFYRLQKPGGS  240

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-VE  1214
             P TR+ QVIVAS RK KV+VP D +LL+E    ES+IQGSRKL HT +L FFDKAAV  E
Sbjct  241   PITRMLQVIVASFRKSKVRVPEDAALLYEIHDAESSIQGSRKLEHTPKLTFFDKAAVETE  300

Query  1215  SDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
             +DE K+ + S W+LCTVTQVEELK++I LLP+WA+GI+F+ VY QMST FV Q   M+  
Sbjct  301   TDENKEAAKSGWKLCTVTQVEELKALISLLPVWASGIVFAAVYSQMSTVFVLQGNTMDQS  360

Query  1395  VG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             +G  F IP ASL++FD LSV+ W P+YD+LIVP+ARKFTGH+ G T LQR+G+GL ISI 
Sbjct  361   MGPNFTIPSASLALFDILSVLFWTPVYDQLIVPLARKFTGHERGFTQLQRIGIGLLISIF  420

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             +MVSA +LE+ RL  V+ H+LYD  EVP+S+FWQVPQYF +GCAEVFTFIGQLEFFYDQA
Sbjct  421   SMVSAGILEVARLRYVRTHDLYDAKEVPMSIFWQVPQYFFVGCAEVFTFIGQLEFFYDQA  480

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSLCSAL+LTT A+GNYLS+ LVT+V  +TT  G+ GW+A+NLN GHLDY++WLLA
Sbjct  481   PDAMRSLCSALALTTVALGNYLSTLLVTVVTKVTTTGGRAGWIADNLNRGHLDYYYWLLA  540

Query  1932  VLSVMNLGVFVVVAKMYTYKKA  1997
             VLS +N  V++ +AK YTYKKA
Sbjct  541   VLSFLNFFVYLWIAKSYTYKKA  562



>ref|XP_004506789.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Cicer arietinum]
 ref|XP_004506790.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Cicer arietinum]
 ref|XP_004506791.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Cicer arietinum]
Length=578

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/567 (64%), Positives = 447/567 (79%), Gaps = 2/567 (0%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             + E +E D  YT+DGT+D   +PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y 
Sbjct  7     KYEVVERDGSYTEDGTIDIHKKPANKKKTGNWKACSFILGNECCERLAYYGMSTNLVNYL  66

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             Q    Q   +A+  ++ WSGTCY+ PL+GAFLAD+Y GRYWTIA FS IYV+GM L+T S
Sbjct  67    QDHYGQGNATAANTVTTWSGTCYLTPLLGAFLADSYFGRYWTIAGFSCIYVLGMALLTFS  126

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A  PG+ P+C A+  C  T   T  C+IALYL+ALGTGGIKPCVSS+GADQFD+ D+ ER
Sbjct  127   AVAPGLIPSCDAN-GCKPTSGQTAACYIALYLIALGTGGIKPCVSSFGADQFDENDQTER  185

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             K KSSFFNWFYFSINIGAL+ASS++VWIQ  V WGWGFGVP VAM +A+ FFF G++ YR
Sbjct  186   KKKSSFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPGVAMVIAIIFFFIGSQWYR  245

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              Q PGGSP TR+ QV VA+ +K  ++VP DKSLL+ET+  ESNI+GSRKL HTNE++  D
Sbjct  246   LQVPGGSPLTRICQVTVAAFKKLGLQVPDDKSLLYETADAESNIKGSRKLEHTNEMKCLD  305

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAAV    +  K   +PWRLCTVTQVEELKSIIRLLP+WA+ I F+TVY QM T FV Q 
Sbjct  306   KAAVETESDRSKAVPNPWRLCTVTQVEELKSIIRLLPVWASMIAFATVYSQMGTMFVLQG  365

Query  1377  IGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
               M+ ++G  FKIP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQRMG+G
Sbjct  366   NTMDQHIGPHFKIPSASLSLFDTLSVIFWAPVYDRVIVPFARKFTGHEHGFTELQRMGIG  425

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             L ISI++M+ A +LE+VRL +V+++N YD+  +P+S+FWQVPQYF+IG AEVF  IGQ+E
Sbjct  426   LVISIISMIVAGILEVVRLDIVRKNNYYDLETIPLSIFWQVPQYFLIGAAEVFANIGQME  485

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY QAPD+MRSLCSALSLTTNA+GNY+S+ LV IV  +TTRNG  GW+ +N+N GHLDY
Sbjct  486   FFYSQAPDAMRSLCSALSLTTNALGNYVSTLLVMIVTKVTTRNGSLGWIPDNMNRGHLDY  545

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             F+WLL +LSV+N  V++ +AK Y+YKK
Sbjct  546   FYWLLTILSVLNFIVYLWIAKKYSYKK  572



>gb|KHN42300.1| Peptide transporter PTR1 [Glycine soja]
Length=576

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/567 (65%), Positives = 456/567 (80%), Gaps = 3/567 (1%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             +S    ED +YT+DGT+D   +PA K KTG WKAC FILGNEC ERLAYYGMS+NL+ Y 
Sbjct  6     KSHDEAEDSLYTEDGTVDIYKKPAIKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYL  65

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             QTR +Q   +A+ N+S WSGTCYI PL+GAFLAD+Y+GRYWTIA+FS IYVIGM+L+T S
Sbjct  66    QTRFHQGNATAATNVSTWSGTCYITPLLGAFLADSYMGRYWTIASFSTIYVIGMSLLTFS  125

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A  PG+ P+C A+  C  T   T  CFIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ER
Sbjct  126   AIAPGLKPSCGAN-GCYPTSGQTTACFIALYLIALGTGGIKPCVSSFGADQFDENDDFER  184

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             K KSSFFNWFYFSINIG+L+ASS++VWIQ  V WGWGFGVP VAM +A+TFFF G++ YR
Sbjct  185   KKKSSFFNWFYFSINIGSLIASSVLVWIQMNVGWGWGFGVPTVAMVIAITFFFIGSKWYR  244

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              Q PGGSP TR+ QVIVA+ RK +++VP +KSLL+ET+ +ESNI+GSRKL HTNEL+  D
Sbjct  245   LQLPGGSPLTRICQVIVAASRKARLQVPDNKSLLYETADVESNIKGSRKLGHTNELKCLD  304

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAA+ E++       + WRLCTVTQVEELKSII LLP+WAT I F+TVY QMST FV Q 
Sbjct  305   KAAI-ETESDHTNWPNSWRLCTVTQVEELKSIIHLLPVWATMIAFATVYSQMSTMFVLQG  363

Query  1377  IGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
               M+ ++G  F IP ASLS+FDTLSVI W P+YDR+IVP ARKFTGH+ G T LQR+G+G
Sbjct  364   NKMDQHIGQHFTIPSASLSLFDTLSVIFWAPVYDRMIVPFARKFTGHEQGFTQLQRIGIG  423

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             L ISI++M+ A +LE+VRL +++++N YD+  VP+S+FWQVPQYF+IG AEVFT IGQ+E
Sbjct  424   LVISIISMIVAGILEVVRLDIIRKNNYYDLETVPLSIFWQVPQYFLIGAAEVFTNIGQME  483

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY +APD+MRSLCSAL LTTNA+GNY+S+ LV IV  +TT +G+ GW+A+NLN GHLDY
Sbjct  484   FFYGEAPDAMRSLCSALQLTTNALGNYVSTLLVLIVTKVTTSHGRIGWIADNLNKGHLDY  543

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             F+WLL VLS++N  V++ +AK Y YKK
Sbjct  544   FYWLLTVLSLLNFLVYLWIAKRYKYKK  570



>ref|XP_009122828.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Brassica rapa]
 emb|CDY40315.1| BnaA10g27530D [Brassica napus]
Length=567

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/562 (66%), Positives = 455/562 (81%), Gaps = 3/562 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             D  YT+DGTLD   +PANKNKTGTWKAC FIL  EC ERLAYYGMS+NL+ Y +  L+  
Sbjct  2     DSEYTQDGTLDIHKKPANKNKTGTWKACRFILVTECCERLAYYGMSTNLVNYIEKHLSMG  61

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
              ++AS +++NWSGTCY  PL+GAFLADAYLGRYWTIA+F +IY+ GMTL+TLSA+VPG++
Sbjct  62    NVAASNSVTNWSGTCYATPLIGAFLADAYLGRYWTIASFVVIYICGMTLLTLSASVPGLT  121

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             PTC   E C  T     + F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE+E++ KSSFF
Sbjct  122   PTCHG-ENCHATEFQIAITFVALYLIALGTGGIKPCVSSFGADQFDDTDEEEKESKSSFF  180

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYF IN+GA+ ASS++VWIQ  V WGWGFGVP VAMA+AV  FF+G++ YR QKPGGS
Sbjct  181   NWFYFVINVGAMFASSVLVWIQMNVGWGWGFGVPTVAMAVAVLLFFAGSKFYRLQKPGGS  240

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-VE  1214
             P TR+ QVIVAS RK KV+VP D +LL+E    ES+IQGSRKL HT +L FFDKAAV  E
Sbjct  241   PITRMLQVIVASFRKSKVRVPEDAALLYEIHDAESSIQGSRKLEHTPKLTFFDKAAVETE  300

Query  1215  SDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
             +DE K+ + S W+LCTVTQVEELK++I LLP+WA+GI+F+ VY QMST FV Q   M+  
Sbjct  301   TDENKEAAKSGWKLCTVTQVEELKALISLLPVWASGIVFAAVYSQMSTVFVLQGNTMDQS  360

Query  1395  VG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             +G  F IP ASL++FD LSV+ W P+YD+LIVP+ARKFTGH+ G T LQR+G+GL ISI 
Sbjct  361   MGPNFTIPSASLALFDILSVLFWTPVYDQLIVPLARKFTGHERGFTQLQRIGIGLLISIF  420

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             +MVSA +LE+ RL  V+ HNLYD   VP+S+FWQVPQYF +GCAEVFTFIGQLEFFYDQA
Sbjct  421   SMVSAGILEVARLRYVRTHNLYDAKVVPMSIFWQVPQYFFVGCAEVFTFIGQLEFFYDQA  480

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSLCSAL+LTT A+GNYLS+ LVT+V  +TT  G+ GW+A+NLN GHLDY++WLLA
Sbjct  481   PDAMRSLCSALALTTVALGNYLSTLLVTVVTKVTTTGGRAGWIADNLNRGHLDYYYWLLA  540

Query  1932  VLSVMNLGVFVVVAKMYTYKKA  1997
             VLS +N  V++ +AK YTYKKA
Sbjct  541   VLSFLNFLVYLWIAKSYTYKKA  562



>ref|XP_003516940.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Glycine 
max]
 ref|XP_006573342.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
Length=576

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/567 (65%), Positives = 456/567 (80%), Gaps = 3/567 (1%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             +S  + ED +YT+DGT+D   +PA K KTG WKAC FILGNEC ERLAYYGMS+NL+ Y 
Sbjct  6     KSHDVGEDSLYTEDGTVDIYKKPAIKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYL  65

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             QTR +Q   +A+ N+S WSGTCYI PL+GAFLAD+Y+GRYWTIA+FS IYVIGM+L+T S
Sbjct  66    QTRFHQGNATAATNVSTWSGTCYITPLLGAFLADSYMGRYWTIASFSTIYVIGMSLLTFS  125

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             A  PG+ P+C A+  C  T   T  CFIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ER
Sbjct  126   AIAPGLKPSCGAN-GCYPTSGQTTACFIALYLIALGTGGIKPCVSSFGADQFDENDDFER  184

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             K KSSFFNWFYFSINIG+L+ASS++VWIQ  V WGWGFGVP VAM +AVTFFF G++ YR
Sbjct  185   KKKSSFFNWFYFSINIGSLIASSVLVWIQMNVGWGWGFGVPTVAMVIAVTFFFIGSKWYR  244

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              Q PGGSP TR+ QVIVA+ RK +++VP +KSLL+ET+ +ESNI+GSRKL HTNEL+  D
Sbjct  245   LQLPGGSPLTRICQVIVAASRKARLQVPDNKSLLYETADVESNIKGSRKLGHTNELKCLD  304

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAA+ E++       + WRLCTVTQVEELKSII LLP+WAT I F+TVY QMST FV Q 
Sbjct  305   KAAI-ETESDHTNWPNSWRLCTVTQVEELKSIIHLLPVWATMIAFATVYSQMSTMFVLQG  363

Query  1377  IGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
               M+ ++G  F IP ASLS+FDTLSVI W P+YDR+IVP ARKF GH+ G T LQR+G+G
Sbjct  364   NKMDQHIGQHFTIPSASLSLFDTLSVIFWAPVYDRMIVPFARKFIGHEQGFTQLQRIGIG  423

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             L ISI++M+ A +LE+VRL +++++N YD+  VP+S+FWQVPQYF+IG AEVFT IGQ+E
Sbjct  424   LVISIISMIVAGILEVVRLDIIRKNNYYDLETVPLSIFWQVPQYFLIGAAEVFTNIGQME  483

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY +APD+MRSLCSAL LTTNA+GNY+S+ LV IV  +TT +G+ GW+A+NLN GHLDY
Sbjct  484   FFYGEAPDAMRSLCSALQLTTNALGNYVSTLLVLIVTKVTTSHGRIGWIADNLNKGHLDY  543

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             F+WLL VLS++N  V++ +AK Y YKK
Sbjct  544   FYWLLTVLSLLNFLVYLWIAKRYKYKK  570



>ref|XP_004305145.1| PREDICTED: peptide transporter PTR5-like [Fragaria vesca subsp. 
vesca]
Length=1113

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/551 (68%), Positives = 448/551 (81%), Gaps = 2/551 (0%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E D+VYTKDGT DYRN+PA KNKTGTWKACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  3     EIDNVYTKDGTTDYRNQPAMKNKTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQMN  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q  + A  N++NWSGTCY+ PL+GAFLADAYLGRY+TI  FSI+YV+GMTL+TLSA+V G
Sbjct  63    QRNVEAVNNVTNWSGTCYVTPLLGAFLADAYLGRYYTIVAFSIVYVLGMTLLTLSASVQG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C  +  C+ T       F  LYL+ALGTGGIKPCVSS+GADQFDDTDE E+K+K S
Sbjct  123   LKPPCDKNNVCSPTQFQAGAFFTGLYLIALGTGGIKPCVSSFGADQFDDTDEAEKKNKGS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVASS++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR  +P 
Sbjct  183   FFNWFYFSINIGALVASSVLVWIQTNVGWGWGFGIPAVAMALAVVSFFSGTRLYRNLRPS  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VAS RK K +VP DKSLL ET+  ES ++GSRKL HT +L F DKAAVV
Sbjct  243   GSPLTRICQVMVASFRKYKEQVPRDKSLLFETAEDESAVKGSRKLDHTEQLSFLDKAAVV  302

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
                +  KGS   WRLCTVTQVEELKSIIRLLPIWATGIIFS VY QM T FV Q   M+ 
Sbjct  303   TQSDRTKGSVMAWRLCTVTQVEELKSIIRLLPIWATGIIFSAVYSQMGTLFVLQGNTMDL  362

Query  1392  YVG--TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             ++G  +F+IP ASLS+FDT+SVI WVP+YDR+IVP  RKFTGHK+G T LQR+G+G  IS
Sbjct  363   HLGNTSFEIPSASLSLFDTISVIFWVPVYDRIIVPFVRKFTGHKNGFTQLQRIGIGFVIS  422

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             + AM++AA LE++RL  VK+HN YD+  +P+S+FWQVPQYFIIGC EVFTFIGQ EFFY+
Sbjct  423   VFAMLAAATLELLRLNEVKKHNYYDLKHIPMSIFWQVPQYFIIGCGEVFTFIGQSEFFYE  482

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSAL+L T A+GNYLS+FLV +V D++TRNGK GW+ +NLNYG LDYFFWL
Sbjct  483   QAPDAMRSLCSALALITTALGNYLSTFLVNVVTDVSTRNGKAGWIPDNLNYGRLDYFFWL  542

Query  1926  LAVLSVMNLGV  1958
             LAVLS   + +
Sbjct  543   LAVLSCQKMAL  553


 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/567 (65%), Positives = 458/567 (81%), Gaps = 7/567 (1%)
 Frame = +3

Query  306   AMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             A+ EDD YT DGT+D R  PANK KTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q +
Sbjct  552   ALAEDD-YTNDGTVDIRKNPANKRKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQKQ  610

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L+    +A+ N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GM  ++L+A++
Sbjct  611   LSMGNAAAANNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAIFSIIYVFGMGFLSLTASI  670

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              G+ P+C +   C  T      CF+ALY++ALGTGGIKPCVSS+GADQFD+TD+ E++ K
Sbjct  671   NGLKPSCDS-SGCHATSSQIAACFVALYMIALGTGGIKPCVSSFGADQFDETDDTEKEKK  729

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFY SIN+GA++ASS++V+IQ  V W WGFG+PAVAMA+AV FFF G+ LYR QK
Sbjct  730   SSFFNWFYMSINVGAMIASSVLVYIQMNVGWDWGFGIPAVAMAIAVVFFFVGSSLYRLQK  789

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QVIVAS R   VKVP DKSLL+ET   ES+IQGSRKL HT++L FFDKAA
Sbjct  790   PGGSPITRIIQVIVASCRNFNVKVPDDKSLLYETRDAESSIQGSRKLEHTDKLSFFDKAA  849

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    E  K   +PW++CTVTQVEELK++IRLLP+WA+GI+F+ VY QMST FV Q   +
Sbjct  850   V----EDLKSLENPWKVCTVTQVEELKAVIRLLPVWASGIVFAAVYSQMSTMFVLQGNTL  905

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  FKIP ASLS+FDT+SV++W PIYD +IVP ARKFTGH  G T LQRMG+GL I
Sbjct  906   DQHMGPNFKIPSASLSLFDTVSVLIWAPIYDLVIVPFARKFTGHPRGFTQLQRMGIGLVI  965

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             S+ +MV A +LE+VRL +V+++N YD   +P+++FWQVPQYF+IGCAEVFTFIGQLEFFY
Sbjct  966   SVFSMVVAGILEVVRLRIVQKNNYYDREYIPMTIFWQVPQYFLIGCAEVFTFIGQLEFFY  1025

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTT A+GNYLS+ LVTIV   TTRNGK GW+ +NLN GHLDY++W
Sbjct  1026  DQAPDAMRSLCSALSLTTIALGNYLSTLLVTIVTKTTTRNGKLGWIPDNLNRGHLDYYYW  1085

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAIN  2003
             +L +LS++N  V++++AK YTYKK ++
Sbjct  1086  VLTLLSIINFLVYLLIAKWYTYKKTVD  1112



>ref|NP_001041994.1| Os01g0142800 [Oryza sativa Japonica Group]
 dbj|BAB16458.1| putative peptide transport protein [Oryza sativa Japonica Group]
 dbj|BAB40113.1| putative peptide transport protein [Oryza sativa Japonica Group]
 dbj|BAF03908.1| Os01g0142800 [Oryza sativa Japonica Group]
 gb|EAY72488.1| hypothetical protein OsI_00345 [Oryza sativa Indica Group]
 gb|EAZ10494.1| hypothetical protein OsJ_00327 [Oryza sativa Japonica Group]
 dbj|BAG86793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/573 (64%), Positives = 450/573 (79%), Gaps = 3/573 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             +D+YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL Q 
Sbjct  6     EDIYTQDGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLGQE  65

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
             +  A+ N++NWSGTCYI PL+GAFLADAY+GR+WTIA+F IIY++G+ L+T++++V G+ 
Sbjct  66    SAIAANNVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMASSVKGLV  125

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E++ KSSFF
Sbjct  126   PACDGG-ACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSSFF  184

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGALVASS++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PGGS
Sbjct  185   NWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVASFFVGTPLYRHQRPGGS  244

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VAS RK  V+VP D S LHET   ES I+GSRKL HT +    D+AAV   
Sbjct  245   PLTRIAQVLVASARKWGVEVPADGSRLHETLDRESGIEGSRKLEHTGQFACLDRAAVETP  304

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
             ++    + S WRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQMST FV Q   ++  +
Sbjct  305   EDRSAANASAWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDASM  364

Query  1398  GT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G  F IP ASLS+FDTLSVIVWVP+YDRLIVP  R  TG   G T LQRMG+GL IS+ +
Sbjct  365   GPHFSIPAASLSIFDTLSVIVWVPVYDRLIVPAVRAVTGRPRGFTQLQRMGIGLVISVFS  424

Query  1575  MVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             M++A VL++VRL  + RH LY D   VPIS+FWQVPQYFIIG AEVFTF+GQLEFFYDQA
Sbjct  425   MLAAGVLDVVRLRAIARHGLYGDKDVVPISIFWQVPQYFIIGAAEVFTFVGQLEFFYDQA  484

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRS+CSALSLTT A+GNYLS+ LVTIV  +TTRNG  GW+ +NLN GHLDYFFWLLA
Sbjct  485   PDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVTTRNGAVGWIPDNLNRGHLDYFFWLLA  544

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEA  2030
             VLS++N GV++V+A  YTYKK  +   D  E A
Sbjct  545   VLSLINFGVYLVIASWYTYKKTADSPDDKAEHA  577



>ref|XP_007016185.1| Peptide transporter 1 [Theobroma cacao]
 gb|EOY33804.1| Peptide transporter 1 [Theobroma cacao]
Length=575

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/596 (65%), Positives = 451/596 (76%), Gaps = 57/596 (10%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M EDD YTKDGT+DYR  PANK KTGTWKACPFI+GNEC ERLAY GMSSNL+ YF+ RL
Sbjct  1     MAEDDFYTKDGTVDYRGNPANKKKTGTWKACPFIIGNECCERLAYNGMSSNLVRYFKHRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ +  A++N  NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ LSATV 
Sbjct  61    NQHSSVATRNNQNWSGTCYITPLIGAFLADAYLGRYWTIAFFSIIYVFGMTLLALSATVH  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             GI P C A + C  T   +   F+ALY+VALGTGGIKPCVSSYGADQFDDTDE E+KHKS
Sbjct  121   GIRPRCYAEDNCNPTVTQSAAFFVALYMVALGTGGIKPCVSSYGADQFDDTDEAEKKHKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL+ASS++VW+Q  VSWGWGFG+PA+AMA+AVTFFFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVSWGWGFGIPAIAMAVAVTFFFSGTRLYRNQKP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELR-------  1187
             GGSP TRL QV+VAS RK ++ VP DKSLL+ET+  ESNI+GSRK+ HT + R       
Sbjct  241   GGSPLTRLCQVLVASFRKFRLAVPADKSLLYETADAESNIRGSRKIEHTQDFRLSRCSVH  300

Query  1188  -----------------------FFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIR  1298
                                    FFDKAAV  + ++KKGS                    
Sbjct  301   VGRILSCLLIPCSSSKAAVLIFSFFDKAAVETASDHKKGS--------------------  340

Query  1299  LLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVGT--FKIPEASLSVFDTLSVIVWVPIY  1472
                  ATGIIF+ VY QMS  FV Q   MNT+VG   FKIP ASLS+FD LSVI WVPIY
Sbjct  341   -----ATGIIFAAVYSQMSNLFVLQGERMNTHVGNSAFKIPPASLSIFDNLSVIFWVPIY  395

Query  1473  DRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEV  1652
             DR+IVP+ RKFTG K+GLT LQRMG+GLFISI AMV+AA+LE+ RL  V+RH  Y++ E+
Sbjct  396   DRIIVPVTRKFTGQKNGLTQLQRMGIGLFISIFAMVAAAILELERLRRVRRHKYYELKEM  455

Query  1653  PISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLV  1832
             P+++FWQVPQY + GCAEVFTFIGQLEF Y+QAPD+MRS CSAL LTT A+GNYLSS L+
Sbjct  456   PMTIFWQVPQYVLTGCAEVFTFIGQLEFVYEQAPDAMRSFCSALQLTTIALGNYLSSLLM  515

Query  1833  TIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             TIV  ITTRNG+ GW+ +NLNYGH+ YFFWLLAVLS +NLG F+++AK YTYK+ +
Sbjct  516   TIVTSITTRNGRLGWIPDNLNYGHVHYFFWLLAVLSGLNLGAFLLIAKWYTYKRPL  571



>dbj|BAG91734.1| unnamed protein product [Oryza sativa Japonica Group]
Length=581

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/573 (64%), Positives = 450/573 (79%), Gaps = 3/573 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             +D+YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL Q 
Sbjct  6     EDIYTQDGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLGQE  65

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
             +  A+ N++NWSGTCYI PL+GAFLADAY+GR+WTIA+F IIY++G+ L+T++++V G+ 
Sbjct  66    SAIAANNVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMASSVKGLV  125

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E++ KSSFF
Sbjct  126   PACDGG-ACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSSFF  184

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGALVASS++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PGGS
Sbjct  185   NWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVASFFVGTPLYRHQRPGGS  244

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VAS RK  V+VP D S LHET   ES I+GSRKL HT +    D+AAV   
Sbjct  245   PLTRIAQVLVASARKWGVEVPADGSRLHETLDRESGIEGSRKLEHTGQFACLDRAAVETP  304

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
             ++    + S WRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQMST FV Q   ++  +
Sbjct  305   EDRSAANASAWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDASM  364

Query  1398  GT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             G  F IP ASLS+FDTLSVIVWVP+YDRLIVP  R  TG   G T LQRMG+GL IS+ +
Sbjct  365   GPHFSIPAASLSIFDTLSVIVWVPVYDRLIVPAVRAVTGRPRGFTQLQRMGIGLVISVFS  424

Query  1575  MVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             M++A VL++VRL  + RH LY D   VPIS+FWQVPQYFIIG AEVFTF+GQLEFFYDQA
Sbjct  425   MLAAGVLDVVRLRAIARHGLYGDKDVVPISIFWQVPQYFIIGAAEVFTFVGQLEFFYDQA  484

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRS+CSALSLTT A+GNYLS+ LVTIV  +TTRNG  GW+ +NLN GHLDYFFWLLA
Sbjct  485   PDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVTTRNGAVGWIPDNLNRGHLDYFFWLLA  544

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEA  2030
             VLS++N GV++V+A  YTYKK  +   D  E A
Sbjct  545   VLSLINFGVYLVIASWYTYKKTADSPDDKAEHA  577



>ref|XP_009392698.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/579 (64%), Positives = 454/579 (78%), Gaps = 5/579 (1%)
 Frame = +3

Query  309   MEED-DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             ME++ DVYTKDGT D    P  K  TG W+ACP+IL NEC ERLAYYGMS+N++ Y +  
Sbjct  1     MEDNKDVYTKDGTTDLHGNPVIKKNTGNWRACPYILANECCERLAYYGMSTNMVNYMKDH  60

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L+Q   +A+KN +NWSGTCYI PL+GAF+ADAYLGRYWTIA F IIY++G+TL+T++A+V
Sbjct  61    LHQENATAAKNNTNWSGTCYITPLLGAFIADAYLGRYWTIAGFMIIYILGLTLLTMTASV  120

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              G+ P C  +  C  T   +   F+ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K K
Sbjct  121   TGLKPPC-QNGVCDPTTAQSAAFFVALYLIALGTGGIKPCVSSFGADQFDESDESEKKRK  179

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFYFSIN+G+LVASS+IVW+Q  V WGWGFG+PAV MA+AV  FF GT LYR+QK
Sbjct  180   SSFFNWFYFSINVGSLVASSVIVWVQTNVGWGWGFGIPAVVMAVAVASFFFGTPLYRHQK  239

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK   KVP DKSLL+E +  ES I+GSRKL HT++ +F DKAA
Sbjct  240   PGGSPLTRIAQVVVASWRKFGAKVPDDKSLLYEITEKESAIRGSRKLDHTDQFKFLDKAA  299

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    +   G  +PW LCTVTQVEELKSI+RLLP+WA+GI+FS VY QM   FV Q   M
Sbjct  300   VETQADKLTGPVNPWGLCTVTQVEELKSILRLLPVWASGIVFSAVYSQMGNMFVLQGDTM  359

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F++P ASLS+ DT+ VI+WVPIYDR+IVP  R++TG + G T L RMG+GL I
Sbjct  360   DRHMGPHFEVPAASLSMADTIGVIMWVPIYDRIIVPAVRRWTGRERGFTQLTRMGIGLVI  419

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTE--VPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             SI  M++A  LE+VRL    RHNLYD  +  VPIS+FWQVPQYFI+G AEVFTFIGQLEF
Sbjct  420   SIFPMLAAGALEVVRLRTAARHNLYDDPDAYVPISIFWQVPQYFIVGVAEVFTFIGQLEF  479

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRS+CSALSLTT A+GNYLSS LVTIVA +TTRNGK GW+ ++LN GHLDYF
Sbjct  480   FYDQAPDAMRSMCSALSLTTVALGNYLSSLLVTIVAAVTTRNGKLGWIPDDLNRGHLDYF  539

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAE  2033
             FWLLAVLS++N GV++++AK YTYKK I+       +AE
Sbjct  540   FWLLAVLSLLNFGVYLLIAKCYTYKKTIDDEMTTANDAE  578



>gb|KDO53231.1| hypothetical protein CISIN_1g008792mg [Citrus sinensis]
Length=553

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/563 (66%), Positives = 451/563 (80%), Gaps = 18/563 (3%)
 Frame = +3

Query  315   EDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  494
             E+D++T DGT+D+ N+PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y +  LNQ
Sbjct  4     EEDIHTNDGTIDFGNKPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLRFELNQ  63

Query  495   STISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGI  674
               + A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYVIGMT++T+SA+V G+
Sbjct  64    GNVQAVNNVTNWSGTCYVMPLIGAFLADAYLGRYWTIASFSIIYVIGMTILTMSASVHGL  123

Query  675   SPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  854
              P C     C  TG    V F+ LYL+ALGTGGIKPCVSS+GADQFDD DE E+K KSSF
Sbjct  124   KPLCDKRNVCHPTGLQIAVFFVGLYLIALGTGGIKPCVSSFGADQFDDYDEAEKKKKSSF  183

Query  855   FNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGG  1034
             FNWFYFSINIGALVA+S +VWIQ  V WGWGFG+PAVAMA+AV  FF+G+RLYRYQKPGG
Sbjct  184   FNWFYFSINIGALVAASCLVWIQTNVGWGWGFGIPAVAMAIAVVSFFAGSRLYRYQKPGG  243

Query  1035  SPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVE  1214
             SP TR+ Q                 SLL+ET+  E  + GS KL HT +L F DKAAV  
Sbjct  244   SPLTRICQ-----------------SLLYETADAEFAVIGSHKLDHTKQLSFLDKAAVET  286

Query  1215  SDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
               +  KGS + WRLCTVTQVEE KSIIRLLPIWA GI+FS VY QM T FV Q   M+ +
Sbjct  287   PSDCVKGSVNAWRLCTVTQVEEFKSIIRLLPIWAIGIVFSAVYSQMGTLFVLQGNTMDLH  346

Query  1395  V-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             +  +F+IP ASLS+FDT+SVI WVPIYDRLIVP+ARKFTGHK+G T LQR+ +GL ISI 
Sbjct  347   IDNSFEIPSASLSLFDTISVIFWVPIYDRLIVPLARKFTGHKNGFTQLQRIAIGLVISIF  406

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             AM++A  LE+VRL  VK+HN Y++  +P+S+FWQVPQYFIIGCAEVFTFIGQLEFFY+QA
Sbjct  407   AMLTAGTLELVRLREVKKHNYYELKHIPMSIFWQVPQYFIIGCAEVFTFIGQLEFFYEQA  466

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSLCSALSLTT A+GNYLS+ LV IV D +TR+GKPGW+ +NLNYG+L YFFWLLA
Sbjct  467   PDAMRSLCSALSLTTAALGNYLSTLLVNIVTDFSTRHGKPGWIPDNLNYGNLHYFFWLLA  526

Query  1932  VLSVMNLGVFVVVAKMYTYKKAI  2000
             +LSV+NLGV+++VA+ YTYKK +
Sbjct  527   LLSVLNLGVYLMVARCYTYKKLV  549



>ref|XP_004968169.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Setaria 
italica]
 ref|XP_004968170.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Setaria 
italica]
 ref|XP_004968171.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Setaria 
italica]
 ref|XP_004968172.1| PREDICTED: peptide transporter PTR1-like isoform X4 [Setaria 
italica]
Length=578

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/566 (65%), Positives = 450/566 (80%), Gaps = 4/566 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E  D+YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL 
Sbjct  3     EVADMYTQDGTVDIKGNPAVKKGTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLG  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q    A+ N++NWSGTCYI PL+GAFLADAY+GRYWTIA+F IIY+IG+ L+T++++V G
Sbjct  63    QGNSIAANNVTNWSGTCYITPLIGAFLADAYMGRYWTIASFMIIYIIGLALLTMASSVKG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P+C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ D KE+K KSS
Sbjct  123   LVPSCDISGTCHPTEPQTAVVFVALYLIALGTGGIKPCVSSFGADQFDENDAKEQKSKSS  182

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVAS+++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PG
Sbjct  183   FFNWFYFSINIGALVASTVLVYVQTYVGWGWGFGIPAVVMAIAVVSFFIGTPLYRHQRPG  242

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VAS RK  V VP DKSLLHET   E  I+GSRKL HT++    DKAAV 
Sbjct  243   GSPITRIAQVLVASARKWSVAVPADKSLLHETPDGECGIKGSRKLEHTDQFGCLDKAAVE  302

Query  1212  ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
              + +  + + SPWRLCTVTQVEELKS++RLLPIWATGI+F+TVYGQM T FV Q   ++ 
Sbjct  303   TAAD--RTAASPWRLCTVTQVEELKSVVRLLPIWATGIVFATVYGQMGTMFVLQGNTLDQ  360

Query  1392  YVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
              +G  F +P A+LS+ DT+SVI+WVPIYDR+IVP+ R +TG   G T LQRMG+GL ISI
Sbjct  361   RMGPKFSVPSATLSMVDTISVIIWVPIYDRIIVPVVRSYTGRPRGFTQLQRMGIGLVISI  420

Query  1569  LAMVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
              +MV+A VL++VRL  V RH LY D   VPIS+FWQ+PQYFIIGCAEVFTF+GQLEFFYD
Sbjct  421   FSMVAAGVLDIVRLRAVARHGLYGDKDVVPISIFWQIPQYFIIGCAEVFTFVGQLEFFYD  480

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+GNYLS+ LVTIV  ITTR+GK GW+ +NLN GHLDYFFWL
Sbjct  481   QAPDAMRSLCSALSLTTVALGNYLSTVLVTIVTRITTRHGKLGWIPDNLNLGHLDYFFWL  540

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAIN  2003
             LAVLS++N  V++V+A  Y YKK  +
Sbjct  541   LAVLSLLNFLVYLVIASWYKYKKTAD  566



>ref|XP_006848110.1| hypothetical protein AMTR_s00029p00215100 [Amborella trichopoda]
 gb|ERN09691.1| hypothetical protein AMTR_s00029p00215100 [Amborella trichopoda]
Length=600

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/562 (64%), Positives = 448/562 (80%), Gaps = 1/562 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M +  +YT+DGT+D+  +PA K KTGTW+ACPFILGNE  ERLAYYGMS+NL+ Y + RL
Sbjct  34    MSDPAIYTQDGTVDHTGKPAIKAKTGTWRACPFILGNEGCERLAYYGMSTNLVNYMKYRL  93

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +QS   A+ N++NW+GTCYIMPL+GAF+ADA+LGRY  IA FS IYV+GMTL+TLSA+V 
Sbjct  94    HQSNAVAANNVTNWTGTCYIMPLLGAFVADAFLGRYRVIAVFSAIYVVGMTLLTLSASVG  153

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ PTC    +C        V F++LYL+ALGTGGIKPCV S+GADQFDD DE E+K KS
Sbjct  154   GLRPTC-HDNQCHANDGQVAVFFMSLYLIALGTGGIKPCVLSFGADQFDDADEYEKKKKS  212

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFY SINIGAL+ASSL+VWIQ+ + WGWGFG+P VAMA+A+  F +GTRLYR QKP
Sbjct  213   SFFNWFYLSINIGALIASSLLVWIQENIGWGWGFGIPTVAMAIAIISFLAGTRLYRNQKP  272

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS+RK +V VP DKSLL+ET+  ES I GSRKL  T+E  FFDKAAV
Sbjct  273   GGSPLTRIAQVLVASIRKSRVLVPSDKSLLYETAEEESAIPGSRKLESTDEFTFFDKAAV  332

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K    PW+LC+VTQVEE KSIIR+LPIWATGIIF+TVY QMST F+ Q   M+
Sbjct  333   ETEADKIKTHPDPWKLCSVTQVEEWKSIIRILPIWATGIIFATVYSQMSTMFILQGDKMD  392

Query  1389  TYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
               VG+FKIP A+LS+ DTLSVI WVP+YDRLIVPMAR+FTGH  G T LQR+G+GL ISI
Sbjct  393   RRVGSFKIPAAALSLVDTLSVIFWVPVYDRLIVPMARRFTGHDQGFTQLQRIGIGLVISI  452

Query  1569  LAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQ  1748
             +A+ + AV+E+ RL  V+ H+ YD+  +P+S+FWQ+PQYFIIG AEVFT IG LEFFYDQ
Sbjct  453   IAIATVAVVEIKRLEQVRIHDDYDLDSIPMSIFWQLPQYFIIGAAEVFTVIGHLEFFYDQ  512

Query  1749  APDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLL  1928
             APD+MRS+C+AL+LT +A+G+Y S+ LV IV  ITT NGKPGW+ +NLNYGH+DY FWLL
Sbjct  513   APDAMRSMCNALALTISALGSYSSTLLVIIVTHITTTNGKPGWIPDNLNYGHIDYLFWLL  572

Query  1929  AVLSVMNLGVFVVVAKMYTYKK  1994
             A+LS++N  V++ +A  Y YK+
Sbjct  573   AILSLINFVVYLFIANWYKYKR  594



>gb|EPS69660.1| hypothetical protein M569_05105, partial [Genlisea aurea]
Length=578

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/573 (64%), Positives = 447/573 (78%), Gaps = 4/573 (1%)
 Frame = +3

Query  291   QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMI  470
             Q     M EDD YT DGTLD    PA K+KTGTWKAC FIL  EC ERLAYYGM +NL+ 
Sbjct  3     QSEIHKMGEDDTYTTDGTLDIHKNPAIKSKTGTWKACRFILVTECCERLAYYGMGTNLVN  62

Query  471   YFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMT  650
             + +TRL    ++AS +++NWSGTCY  PL+GAFLAD+YLGRYWTI  F IIY++GMTL+T
Sbjct  63    FLKTRLGMGNVAASNSVTNWSGTCYFTPLIGAFLADSYLGRYWTIFNFCIIYILGMTLLT  122

Query  651   LSATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  830
             L+A+V G+ P C + E C  T   T +CF+ALYL+ALGTGGIKPCVSS+GADQFDD DEK
Sbjct  123   LTASVHGLIPRCDS-EGCHPTRFQTAMCFVALYLIALGTGGIKPCVSSFGADQFDDNDEK  181

Query  831   ERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRL  1010
             E+  K+SFFNWFY SIN+GAL+ASS++VWIQ  V W WGFG+PA AMA+AV FF  G+R 
Sbjct  182   EKPKKASFFNWFYLSINVGALIASSVLVWIQMNVGWSWGFGIPAAAMAVAVAFFLFGSRR  241

Query  1011  YRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRF  1190
             YR+QKPGGSP TR+ QV+VAS RK  + VP D+SLL+  S  ES+I GSRKLSHT++ RF
Sbjct  242   YRFQKPGGSPLTRIAQVVVASFRKAGMDVPRDESLLYGNSDKESDIPGSRKLSHTDKFRF  301

Query  1191  FDKAAVVESDE--YKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQF  1364
              DKAAV    +  ++ G  +PWRLC+VTQVEE KSII +LPIWA+GI+FSTVY QM+T F
Sbjct  302   LDKAAVERDGDGAFENGGVNPWRLCSVTQVEEFKSIISILPIWASGILFSTVYSQMNTMF  361

Query  1365  VSQAIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQR  1541
             V Q   M+ ++G +F+IP ASLS+FDTLSVI W P YDR+IVP AR+FTGH+ G T LQR
Sbjct  362   VLQGNTMDQHMGRSFEIPAASLSLFDTLSVIFWAPFYDRVIVPAARRFTGHERGFTPLQR  421

Query  1542  MGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFI  1721
             MG+GL IS+ AMV A VLE+ RL  V+RH  YD   +P+S+FWQVPQYF++GCAEVFTFI
Sbjct  422   MGMGLVISVAAMVVAGVLEVFRLDYVRRHGYYDRATIPMSIFWQVPQYFLVGCAEVFTFI  481

Query  1722  GQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYG  1901
             GQLEFFYD+APD+MRSLCSA+SLTT A+GNYLS+ LVT+V   TT  GK GW+ +NLN G
Sbjct  482   GQLEFFYDEAPDAMRSLCSAMSLTTTALGNYLSTVLVTVVTKATTGEGKLGWIPDNLNRG  541

Query  1902  HLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAI  2000
             HLDYF+WL+A LS +N  V+V +A+ Y YKK +
Sbjct  542   HLDYFYWLVAGLSSLNFVVYVAIARWYKYKKVV  574



>ref|XP_011094976.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105174539 
[Sesamum indicum]
Length=1141

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/590 (65%), Positives = 465/590 (79%), Gaps = 9/590 (2%)
 Frame = +3

Query  300   SEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             S  + EDD YTKDGT DYRN PA K +TGTWKACP+ILGNEC ERLAYYG+++NL+ Y +
Sbjct  9     SMMVTEDDKYTKDGTTDYRNNPAIKQETGTWKACPYILGNECCERLAYYGINTNLVNYLK  68

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
              ++N+S + A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIATFS IYV GMT++TLSA
Sbjct  69    FQMNESNVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIATFSTIYVFGMTILTLSA  128

Query  660   TVPGISPTCIAHEK-CTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             +V G+ P C  +   C  TG    V +  LYL+ALGTGGIKPCVSS+GADQFDD+DE E+
Sbjct  129   SVHGLKPFCDPNNGGCHPTGLQIGVFYAGLYLIALGTGGIKPCVSSFGADQFDDSDEVEK  188

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             K+KSSFFNWFYFSINIGALVAS+++VWIQ  V WGWGFG+PAVAMA+AV  FFSGTRLYR
Sbjct  189   KNKSSFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAIAVVSFFSGTRLYR  248

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              Q+PGGSP TR+ QV+VAS+RK  V VP DKS L+ET+  E  ++GSRKL  T +L FFD
Sbjct  249   NQRPGGSPLTRICQVVVASVRKIGVDVPKDKSALYETAEEEYAVKGSRKLELTKKLSFFD  308

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAAV    + + GS +PWRLCTVTQVEELKSIIRLLPIWATGIIFS VY QM T FV Q 
Sbjct  309   KAAVETESDARNGSVNPWRLCTVTQVEELKSIIRLLPIWATGIIFSAVYSQMGTLFVLQG  368

Query  1377  IGMNTY-VGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
               M+ + + +F+IP ASLS+FDT+SVI WVP+YD++IVP ARKFTG+K+G T LQR+ +G
Sbjct  369   NTMDLHLIRSFEIPSASLSLFDTISVIFWVPVYDQIIVPFARKFTGNKNGFTQLQRIAIG  428

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             L ISI AM+ A  LEM+RL +VK HN Y++  +P+S+FWQVPQYFIIGCAEVFTFIGQLE
Sbjct  429   LVISIFAMLVAGTLEMIRLNIVKEHNYYELKHMPLSIFWQVPQYFIIGCAEVFTFIGQLE  488

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+QAPD+MRSLCSALSLTT A+GNYLS+ LV IV DI+TR+G PGW+ +NLNYG L Y
Sbjct  489   FFYEQAPDAMRSLCSALSLTTAALGNYLSTLLVNIVTDISTRDGGPGWIPDNLNYGKLHY  548

Query  1914  FFWLLAVLSVMNLGVFVVVA-------KMYTYKKAINKVSDLVEEAENGS  2042
             FFWLLAVLS+MNLG  V           +YT    +N       +A+ GS
Sbjct  549   FFWLLAVLSLMNLGRKVXEKMAAIGEDDIYTKDGTVNIHKKPANKAKTGS  598


 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/573 (64%), Positives = 457/573 (80%), Gaps = 4/573 (1%)
 Frame = +3

Query  297   RSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYF  476
             +  A+ EDD+YTKDGT++   +PANK KTG+WKAC FIL  EC ERLAYYGMS+NL+ Y 
Sbjct  568   KMAAIGEDDIYTKDGTVNIHKKPANKAKTGSWKACRFILVTECCERLAYYGMSTNLVNYL  627

Query  477   QTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLS  656
             +TRL Q  ++AS N++NWSGTCYI PL+GAF+AD+YLGR+WTIATF+ IYVIGM L+TLS
Sbjct  628   KTRLGQGNVTASNNVTNWSGTCYITPLIGAFIADSYLGRFWTIATFATIYVIGMALLTLS  687

Query  657   ATVPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
              +V G+ P C     C  T       F+A+YL+ALGTGGIKPCVSS+GADQFDD D++E+
Sbjct  688   VSVSGLKPEC-NKNGCHPTSLQMATFFVAIYLIALGTGGIKPCVSSFGADQFDDNDKREK  746

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             + KSSFFNWFY SINIGA++ASS++VWIQ  V W WGFG PAV+MA+AV FFFSG+ LYR
Sbjct  747   RKKSSFFNWFYLSINIGAMIASSVLVWIQMNVGWNWGFGTPAVSMAIAVAFFFSGSHLYR  806

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
              Q PGGSP TR+FQV+VAS+RK  VKVP DKSLL+ET+  ES+I+GSRKL HT++ R  D
Sbjct  807   LQIPGGSPLTRIFQVLVASIRKYNVKVPTDKSLLYETADAESSIEGSRKLEHTDKFRCLD  866

Query  1197  KAAV-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             KAAV  +SD   +G  +PW LCTVTQVEELKSII LLPIWA+GI+FSTV  QM T FV Q
Sbjct  867   KAAVETDSDNSLEGVVNPWSLCTVTQVEELKSIIGLLPIWASGIVFSTVSSQMGTMFVLQ  926

Query  1374  AIGMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGV  1550
                M+  +G  FKIP ASLS+F+TLSVI W P+YD++I+P+ARK+T ++ G T LQRMG+
Sbjct  927   GNTMDQQMGPNFKIPSASLSLFNTLSVIFWAPVYDQVIIPLARKYTHNERGFTQLQRMGI  986

Query  1551  GLFISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             GL IS +AM+ A VLE+ RL  V+R+N Y+   +P+S+FWQVPQYF++GCAEVFT IGQL
Sbjct  987   GLVISTIAMIVAGVLEVARLDYVRRNNYYNQPTIPMSIFWQVPQYFLVGCAEVFTNIGQL  1046

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWL-ANNLNYGHL  1907
             EFFYDQAPD+MRSLCSAL+LTT+A+G+YLSS LV +V  +TT++G  GW+   NLN GHL
Sbjct  1047  EFFYDQAPDAMRSLCSALALTTHAVGHYLSSALVIVVTKLTTKHGHLGWIPKENLNRGHL  1106

Query  1908  DYFFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             DYF+WLLA+LS MN  V++++AK Y YKKA+ K
Sbjct  1107  DYFYWLLAILSSMNFFVYLLIAKWYVYKKAVVK  1139



>ref|XP_010907628.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010907629.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
Length=601

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/560 (65%), Positives = 445/560 (79%), Gaps = 3/560 (1%)
 Frame = +3

Query  321   DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  500
             D+YTKDGT D    PA +  TG W+ACP+IL NEC ERLAYYGMSSNL+ Y + RL+Q  
Sbjct  34    DIYTKDGTTDIHGNPAVRKDTGNWRACPYILANECCERLAYYGMSSNLVNYMKYRLHQGN  93

Query  501   ISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP  680
              +A+KN S+W+GTCYIM L+GAFLADAYLGRYWTIA F I+Y+ G+TL+TL+A++PG+ P
Sbjct  94    ATAAKNNSDWTGTCYIMSLLGAFLADAYLGRYWTIAIFVIVYIFGLTLLTLTASIPGLRP  153

Query  681   TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  860
              C  +  C  T   +   F ALYL+ALGTGGIKPCVSS+GADQFD++ E E+K KSSFFN
Sbjct  154   AC-ENGACNPTDAQSAAFFAALYLIALGTGGIKPCVSSFGADQFDESHESEKKRKSSFFN  212

Query  861   WFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSP  1040
             WFYFSINIGALVASS++VWIQ  V WG GFG+PAVAMA+AV  FF GT LYR+QKPGGSP
Sbjct  213   WFYFSINIGALVASSVLVWIQDNVGWGLGFGIPAVAMAIAVASFFWGTPLYRHQKPGGSP  272

Query  1041  FTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESD  1220
              TR+ QV+VAS RK  VKVP D SLL+E S  ES IQGSRKL HT++ +F DKAAV   D
Sbjct  273   LTRVAQVVVASFRKSGVKVPADNSLLYEISEKESAIQGSRKLEHTDQFKFLDKAAVRTRD  332

Query  1221  EYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
             +   G   PW LCTVTQVEE+KS++R+LPIWATGIIFS VY QMS  FV Q   ++T +G
Sbjct  333   DKINGPADPWMLCTVTQVEEVKSVVRILPIWATGIIFSAVYSQMSNMFVIQGDTLDTKMG  392

Query  1401  T-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
               FKIP ASLS+ DT+SVI+ VPIYDR++VP+AR+FTG++ GLT L RMG+GL ISI +M
Sbjct  393   PHFKIPPASLSMVDTISVILCVPIYDRIVVPVARRFTGNERGLTQLTRMGIGLVISIFSM  452

Query  1578  VSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             ++A +LE+VRL ++ R +LYD    VP+S+FWQ PQYFI+G AEVFTFIGQLEF+YDQAP
Sbjct  453   LAAGILEVVRLRIIARDDLYDSDAIVPLSIFWQAPQYFIVGVAEVFTFIGQLEFYYDQAP  512

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRS+ SAL LTT A+GNYLSS LVTIV  ITTRNGK GW+ +N N  H+DYFFWLLA+
Sbjct  513   DAMRSMLSALPLTTVALGNYLSSLLVTIVTAITTRNGKLGWIPDNTNRAHIDYFFWLLAI  572

Query  1935  LSVMNLGVFVVVAKMYTYKK  1994
             LS+ N GV++++AK YTYKK
Sbjct  573   LSLANFGVYLLIAKWYTYKK  592



>gb|EYU26644.1| hypothetical protein MIMGU_mgv1a003683mg [Erythranthe guttata]
Length=570

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/567 (65%), Positives = 463/567 (82%), Gaps = 3/567 (1%)
 Frame = +3

Query  306   AMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             AMEED +YT+DGT++   +PANK KTG WKAC FIL  EC ERLAYYGMS+NL+ Y + R
Sbjct  3     AMEED-IYTRDGTVNIHKKPANKTKTGNWKACRFILVTECCERLAYYGMSTNLVNYLKIR  61

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             LN++  SAS  ++NWSGTCY+ PL+GAF+AD++LGRY TIA+F  IYV+GMTL+TLSA+V
Sbjct  62    LNEANASASTIVTNWSGTCYVTPLIGAFIADSFLGRYLTIASFCTIYVLGMTLLTLSASV  121

Query  666   PGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              G+ P C ++  C  T     + F A+YL+A GTGGIKPCVSS+GADQFDD DEKE+K K
Sbjct  122   HGLKPDC-SNGHCHPTASQKGIFFAAIYLIAFGTGGIKPCVSSFGADQFDDNDEKEKKKK  180

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             SSFFNWFY SIN+GAL+ASS++VWIQ  V WGWGFGVPAVAMA+AV FFF G+ LYR QK
Sbjct  181   SSFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGVPAVAMAIAVGFFFFGSSLYRLQK  240

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS+RK +V++P DK+LL+ETS + S IQGSRKL HT + RF DKAA
Sbjct  241   PGGSPLTRIAQVLVASVRKYRVEIPSDKTLLYETSDVGSFIQGSRKLVHTEKFRFLDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   D+  KG+ +PW+LCTVTQVEE KSIIR+LPIWATGI+FS VY QM+T F+ Q   +
Sbjct  301   VETEDDSHKGAVNPWKLCTVTQVEEFKSIIRVLPIWATGIVFSAVYSQMNTMFILQGDTL  360

Query  1386  NTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  FKIP ASLS+FDTLSVI W  +YD++IV +A+K+T ++ G T LQRMG+GL I
Sbjct  361   DQHMGPNFKIPAASLSLFDTLSVIFWALVYDQVIVRVAKKYTKNERGFTQLQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM+SA +LE+ RL  V+R+N YD+  +P+++FWQVPQYF++GCAEVFTFIGQ+EFFY
Sbjct  421   SIFAMISAGILEVARLNYVRRNNYYDLEVIPMTIFWQVPQYFLVGCAEVFTFIGQMEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRSLCSALSLTTNA+GNYLS+ LV +V  +TTRNGK GW+ +NLN GHLDYF+W
Sbjct  481   DQAPDAMRSLCSALSLTTNALGNYLSTLLVIVVTKVTTRNGKLGWIPDNLNEGHLDYFYW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAIN  2003
             LLAVLS++N  V+++++K YTYKK ++
Sbjct  541   LLAVLSLINFFVYLMISKWYTYKKVVS  567



>ref|NP_001131161.1| uncharacterized protein LOC100192469 [Zea mays]
 ref|XP_008654285.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654286.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654287.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654289.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654290.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654291.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654292.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654293.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654294.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 gb|ACF79457.1| unknown [Zea mays]
 gb|ACL52512.1| unknown [Zea mays]
 gb|ACL52938.1| unknown [Zea mays]
 gb|ACN28114.1| unknown [Zea mays]
 gb|ACN28705.1| unknown [Zea mays]
 gb|ACN28818.1| unknown [Zea mays]
 gb|ACN28892.1| unknown [Zea mays]
 gb|AFW80023.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80024.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80025.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80026.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80027.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80028.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80029.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80030.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80031.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
Length=580

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/568 (63%), Positives = 445/568 (78%), Gaps = 5/568 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E +D+YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL 
Sbjct  3     EVEDMYTQDGTVDMKGNPAVKKGTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLG  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q    AS N++NW GTCYI PL+GAF ADAY+GR+WTIA F IIY+ G+ L+T++++V G
Sbjct  63    QVNSVASNNVTNWQGTCYITPLIGAFFADAYMGRFWTIAIFMIIYIFGLALLTMASSVKG  122

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + PT C   + C  T     V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE+E+K KS
Sbjct  123   LVPTSCGDKDVCHPTDAQAAVVFVALYLIALGTGGIKPCVSSFGADQFDENDEREKKSKS  182

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVAS+++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+QKP
Sbjct  183   SFFNWFYFSINIGALVASTVLVYVQTHVGWGWGFGIPAVVMAIAVGSFFVGTPLYRHQKP  242

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA  RK  V VP DKS LHET   ES I+GSRKL H+ +L   D+AAV
Sbjct  243   GGSPLTRIAQVLVACARKWNVAVPADKSRLHETVDGESVIEGSRKLEHSEQLACLDRAAV  302

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             V +++  +   SPWRLC+VTQVEELKS+IRLLPIWA+GI+F+ VY QMST FV Q   ++
Sbjct  303   VTAEDGAEA--SPWRLCSVTQVEELKSVIRLLPIWASGIVFAAVYSQMSTMFVLQGNTLD  360

Query  1389  TYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
               +G  FKIP A+LS+ DT+SVIVWVP+YDR IVP+ R +TG   G T LQRMG+GL +S
Sbjct  361   QSMGPRFKIPSATLSMVDTISVIVWVPVYDRAIVPLVRSYTGRPRGFTQLQRMGIGLVVS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             I +MV+A VL++VRL  + RH LY   + VPIS+FWQ+PQYFIIGCAEVFTF+GQLEFFY
Sbjct  421   IFSMVAAGVLDIVRLRAIARHGLYGEDDIVPISIFWQIPQYFIIGCAEVFTFVGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAPD+MRS+CSALSLTT A+GNYLS+ LVTIV  ITTR+G+ GW+  NLN GHLDYFFW
Sbjct  481   DQAPDAMRSMCSALSLTTVALGNYLSTVLVTIVTHITTRHGRIGWIPENLNRGHLDYFFW  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLAVLS++N   ++V+A  Y YKK  + 
Sbjct  541   LLAVLSLLNFLAYLVIASWYKYKKTADD  568



>ref|XP_006643742.1| PREDICTED: peptide transporter PTR1-like [Oryza brachyantha]
Length=582

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/572 (63%), Positives = 445/572 (78%), Gaps = 5/572 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E  D+YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL 
Sbjct  3     EVADMYTQDGTVDVKGNPAEKKSTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLG  62

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q +  A+ N++NWSGTCYI PL+GAFLADAY+GR+WTIA+F IIY++G+ L+T++++V G
Sbjct  63    QESAIAANNVTNWSGTCYITPLIGAFLADAYMGRFWTIASFMIIYILGLALLTMASSVRG  122

Query  672   ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
             + P C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E++ KSS
Sbjct  123   LVPACDGG-TCHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSS  181

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGALVASS++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PG
Sbjct  182   FFNWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVVSFFVGTPLYRHQRPG  241

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VAS RK  V VP DKS LHET   ES I+GSRKL HT +    D+AAV 
Sbjct  242   GSPVTRIAQVLVASARKWGVAVPADKSRLHETVDKESGIEGSRKLEHTEQFACLDRAAVE  301

Query  1212  ESDEYKKGS-FSPWRLCTVTQVEELK-SIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               ++   G+  SPWRLCTVTQVEELK S++R LPIWA+GI+F+TVYGQMST FV Q   +
Sbjct  302   TPEDRAAGAGRSPWRLCTVTQVEELKSSVVRRLPIWASGIVFATVYGQMSTMFVLQGNTL  361

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             +  +G  F IP ASLS+FDTLSVI WVP+YDRLIVP  R   G   G T LQRMG+GL I
Sbjct  362   DASMGPHFSIPAASLSIFDTLSVIAWVPVYDRLIVPAGRALPGRPRGFTQLQRMGIGLVI  421

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             SI +M++A VL+++ L  + RH LY D   VPIS+FWQVPQYFIIG AEVFTF+GQLEFF
Sbjct  422   SIFSMLAAGVLDVISLRAIARHGLYGDKDIVPISIFWQVPQYFIIGAAEVFTFVGQLEFF  481

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQAPD+MRS+CSALSLTT A+GNYLS+ LVTIV  +TT+NG  GW+ +NLN GHLDYFF
Sbjct  482   YDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVTTKNGAVGWIPDNLNRGHLDYFF  541

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKAINKVSD  2015
             WLLAVLS++N  V++V+A  YTYKK  +   D
Sbjct  542   WLLAVLSLINFVVYLVIASWYTYKKTADSPDD  573



>gb|AIL30501.1| oligopeptide transporter 1 [Nicotiana tabacum]
Length=584

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/565 (62%), Positives = 439/565 (78%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT DG++D +  P  K++TG W+ACPFILGNEC ERLAYYG+++NL+ Y  T+L+
Sbjct  19    ENSGLYTGDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIATNLVTYLTTKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W+GTCY+ PL+GA LADAY GRYWTIATFS IY IGM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWAGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  138

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P       C   T    ++ F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   FKPPECMDSVCPAATPAQYVILFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ+   WG GFG+PA+ M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPALFMGIAIASFFFGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  259   GGSPLTRMCQVLVAAFHKWNLSVPEDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  319   VSDVELKTGDYSNTWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGSVM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+FKIP ASLS FDT+SVIVWVP+YDR+IVP+AR+FTG + G + LQRMG+GLF+S
Sbjct  379   DTAIGSFKIPAASLSTFDTISVIVWVPVYDRVIVPIARRFTGKERGFSELQRMGIGLFLS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL + +  +L D    VP+S+FWQ+PQYFI+G AE+FTFIGQLEFFY
Sbjct  439   MLCMSAAAIVEIKRLQLARDLDLVDEAVAVPLSIFWQIPQYFILGAAEIFTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSSF++T+V  ITT+ GKPGW+ NNLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLMTTSLGNYLSSFILTLVTSITTQGGKPGWIPNNLNSGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS  NL ++V  AKMY  K+A
Sbjct  559   LLAALSFCNLVIYVFCAKMYKSKRA  583



>ref|XP_009116102.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brassica rapa]
Length=570

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/568 (62%), Positives = 437/568 (77%), Gaps = 2/568 (0%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE DVYT+DGT+D    PANK  TG WKAC FIL N C ER AYYGMS NL+ Y ++RL
Sbjct  1     MEESDVYTEDGTVDIHKNPANKKTTGNWKACRFILVNVCCERFAYYGMSKNLVDYLKSRL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ   +A+ N++NW GTCYI PL+GAFLADAYLGRYWTIATF  IYV G+TL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWFGTCYITPLIGAFLADAYLGRYWTIATFVFIYVFGLTLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P     + C  +   T V F+ALY++ALG GGI+PCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNSDTCHPSSDQTAVFFVALYMIALGIGGIEPCVSSFGADQFDENDEAEKLKKS  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFS N+GA VA+++I WIQ  + WGWGFGVP VAM +AV FFFSG+R YR Q+P
Sbjct  181   SFFNWFYFSANVGAFVATTVISWIQMNIGWGWGFGVPTVAMVIAVMFFFSGSRYYRLQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
              G+P TR+FQVIVA+LRK  V+VP DKS L E +   SNI GSRKL HT+ L+FFDKAAV
Sbjct  241   QGNPLTRIFQVIVAALRKMSVEVPEDKSQLFEIADDASNITGSRKLEHTDNLKFFDKAAV  300

Query  1209  -VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
               +SD    G  +PWRLC+VTQVEELK II LLP WA+GI+F+TVY Q++T FV Q   M
Sbjct  301   ESQSDSINDGEVNPWRLCSVTQVEELKCIITLLPFWASGIVFATVYSQLNTLFVLQGNTM  360

Query  1386  NTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             + ++G  F+IP  SLS+F T+SV+    +YD+ IVP ARKFT  + G T +QRMG+GL I
Sbjct  361   DQHMGKHFEIPSDSLSLFTTVSVLFCTLVYDQFIVPFARKFTRQERGFTQIQRMGIGLVI  420

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             SI AM++A VLE+VRL  VK HN YD  ++PIS+FWQ+PQY ++GC EVFTFIGQLEFFY
Sbjct  421   SIFAMITAGVLEVVRLDYVKTHNAYDAKKIPISIFWQIPQYLLVGCVEVFTFIGQLEFFY  480

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQAP++M SLCSALSLTT A+GNYLS+ LVT+V  +T + GKPGW+ +NLN GHLDYFF+
Sbjct  481   DQAPEAMISLCSALSLTTKALGNYLSTVLVTVVMKMTKKKGKPGWIPDNLNRGHLDYFFY  540

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
             LLA LS +N  V++ ++K Y YKKAI +
Sbjct  541   LLAALSFLNFLVYLWISKRYKYKKAIGR  568



>dbj|BAJ95903.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/567 (62%), Positives = 443/567 (78%), Gaps = 4/567 (1%)
 Frame = +3

Query  321   DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  500
             ++YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ + + R+  + 
Sbjct  7     EMYTQDGTVDIKGNPALKKDTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRMGMAN  66

Query  501   ISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP  680
              +A+ N++NW GTCYI PL+GAFLADAYLGR+WTIA+F IIY+ G+ L+T++ +V G+ P
Sbjct  67    AAAANNVTNWGGTCYITPLIGAFLADAYLGRFWTIASFMIIYIFGLGLLTMATSVHGLVP  126

Query  681   TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  860
              C +   C  T   +   FIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ERK KSSFFN
Sbjct  127   ACASKGVCDPTPGQSAAVFIALYLIALGTGGIKPCVSSFGADQFDEHDDVERKSKSSFFN  186

Query  861   WFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSP  1040
             WFYFSINIGALVASS++V++Q  V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP
Sbjct  187   WFYFSINIGALVASSVLVYVQTHVGWSWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSP  246

Query  1041  FTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESD  1220
              TR+ QV+VA+   RK+ V +D S L+ET+  ES I+GSRKL HT + RF DKAAV    
Sbjct  247   LTRIAQVLVAA--TRKLGVAVDGSALYETADKESGIEGSRKLEHTRQFRFLDKAAVETQA  304

Query  1221  EYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
             +    + SPWRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQMST FV Q   ++  +G
Sbjct  305   DRTAAAPSPWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDASMG  364

Query  1401  -TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
               FKIP ASLS+FDTLSVI WVP+YDR++VP  R  TG   G T LQRMG+GL +S+ AM
Sbjct  365   PKFKIPSASLSIFDTLSVIAWVPVYDRILVPAVRSVTGRPRGFTQLQRMGIGLVVSMFAM  424

Query  1578  VSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             ++A VLE+VRL  + +H LY   + VPIS+FWQVPQYFIIGCAEVFTF+GQLEFFYDQAP
Sbjct  425   LAAGVLELVRLRTIAQHGLYGEKDVVPISIFWQVPQYFIIGCAEVFTFVGQLEFFYDQAP  484

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRS+CSALSLTT A+GNYLS+ LVT+VA +TTR GK GW+ +NLN GHLDYFFWLLA 
Sbjct  485   DAMRSMCSALSLTTVALGNYLSTLLVTVVAKVTTRGGKQGWIPDNLNVGHLDYFFWLLAA  544

Query  1935  LSVMNLGVFVVVAKMYTYKKAINKVSD  2015
             LS++N  V++++A  YTYKK      D
Sbjct  545   LSLVNFAVYLLIASWYTYKKTAEDSPD  571



>gb|AAC32034.1| peptide transporter [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/574 (62%), Positives = 445/574 (78%), Gaps = 4/574 (1%)
 Frame = +3

Query  321   DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  500
             ++YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ + + R+  + 
Sbjct  7     EMYTQDGTVDIKGNPALKKDTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRMGMAN  66

Query  501   ISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP  680
              +A+ N++NW GTCYI PL+GAFLADAYLGR+WTIA+F IIY+ G+ L+T++ +V G+ P
Sbjct  67    AAAANNVTNWGGTCYITPLIGAFLADAYLGRFWTIASFMIIYIFGLGLLTMATSVHGLVP  126

Query  681   TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  860
              C +   C  T   +   FIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ERK KSSFFN
Sbjct  127   ACASKGVCDPTPGQSAAVFIALYLIALGTGGIKPCVSSFGADQFDEHDDVERKSKSSFFN  186

Query  861   WFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSP  1040
             WFYFSINIGALVASS++V++Q  V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP
Sbjct  187   WFYFSINIGALVASSVLVYVQTHVGWSWGFGIPAVVMAIAVGSFFVGTSLYRHQRPGGSP  246

Query  1041  FTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESD  1220
              TR+ QV+VA+   RK+ V +D S L+ET+  ES I+GSRKL HT + RF DKAAV    
Sbjct  247   LTRIAQVLVAA--TRKLGVAVDGSALYETADKESGIEGSRKLEHTRQFRFLDKAAVETHA  304

Query  1221  EYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
             +    + SPWRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQMST FV Q   ++  +G
Sbjct  305   DRTAAAPSPWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDASMG  364

Query  1401  -TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
               FKIP ASLS+FDTLSVI WVP+YDR++VP  R  TG   G T LQRMG+GL +S+ AM
Sbjct  365   PKFKIPSASLSIFDTLSVIAWVPVYDRILVPAVRSVTGRPRGFTQLQRMGIGLVVSMFAM  424

Query  1578  VSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             ++A VLE+VRL  + +H LY   + VPIS+FWQVPQYFIIGCAEVFTF+GQLEFFYDQAP
Sbjct  425   LAAGVLELVRLRTIAQHGLYGEKDVVPISIFWQVPQYFIIGCAEVFTFVGQLEFFYDQAP  484

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRS+CSALSLTT A+GNYLS+ LVT+VA +TTR GK GW+ +NLN GHLDYFFWLLA 
Sbjct  485   DAMRSMCSALSLTTVALGNYLSTLLVTVVAKVTTRGGKQGWIPDNLNVGHLDYFFWLLAA  544

Query  1935  LSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAEN  2036
             LS++N  V++++A  YTYKK      D    A +
Sbjct  545   LSLVNFAVYLLIASWYTYKKTAGDSPDAKGGAHD  578



>ref|XP_009803584.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009803585.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like isoform X2 [Nicotiana 
sylvestris]
Length=584

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/573 (62%), Positives = 444/573 (77%), Gaps = 5/573 (1%)
 Frame = +3

Query  294   IRSEAMEEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLM  467
             +  E +E+++  +YT DG++D +  P  K++TG W+ACPFILGNEC ERLAYYG+++NL+
Sbjct  11    LEDEILEDENSGLYTGDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIATNLV  70

Query  468   IYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLM  647
              Y  T+ ++  +SA++N++ W+GTCY+ PL+GA LADAY GRYWTIATFS IY IGM  +
Sbjct  71    TYLTTKFHEGNVSAARNVTTWAGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTL  130

Query  648   TLSATVPGISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  824
             TLSA+VP   P       C   T    ++ F+ LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPAFKPPECMDSVCPAATPAQYVILFLGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  825   EKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGT  1004
              KER  K SFFNWFYFSINIGAL++SSLIVWIQ+   WG GFG+PA+ M +A+  FF GT
Sbjct  191   PKERVKKGSFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPALFMGIAIASFFFGT  250

Query  1005  RLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNEL  1184
              LYR+QKPGGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+EL
Sbjct  251   PLYRFQKPGGSPLTRMCQVLVAAFHKWNLSVPEDSTLLYETPDKSSAIEGSRKLLHTDEL  310

Query  1185  RFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQ  1361
             R  DKAAVV   E K G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST 
Sbjct  311   RCLDKAAVVSDVELKTGDYSNTWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTM  370

Query  1362  FVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQR  1541
             FV Q   M+T +G+FKIP ASLS FDT+SVIVWVP+YDR+IVP+AR+FTG + G + LQR
Sbjct  371   FVEQGSVMDTAIGSFKIPAASLSTFDTISVIVWVPVYDRVIVPIARRFTGKERGFSELQR  430

Query  1542  MGVGLFISILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTF  1718
             MG+GLF+S+L M +AA++E+ RL + +  +L D    VP+S+FWQ+PQYFI+G AE+FTF
Sbjct  431   MGIGLFLSMLCMSAAAIVEIKRLQLARDLDLVDEAVAVPLSIFWQIPQYFILGAAEIFTF  490

Query  1719  IGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNY  1898
             IGQLEFFYDQ+PD+MRSLCSALSL T ++GNYLSSF++T+V  ITT+ GKPGW+ NNLN 
Sbjct  491   IGQLEFFYDQSPDAMRSLCSALSLMTTSLGNYLSSFILTLVTSITTQGGKPGWIPNNLNS  550

Query  1899  GHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GHLDYFFWLLA LS  NL V+V  AK+Y  K+A
Sbjct  551   GHLDYFFWLLAALSFCNLVVYVFCAKVYKSKRA  583



>ref|XP_006365835.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum]
Length=585

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/565 (62%), Positives = 437/565 (77%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT+DG++D +  P  K++TG W+ACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  20    ESSGLYTRDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIAANLVTYLTRKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCYI PL+GA LADAY GRYWTIATFS IY IGM  +TLSA+VP 
Sbjct  80    EGNVSAARNVTTWQGTCYITPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  139

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     + +     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  140   FKPPECVGSVCPSASPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ+   WG GFG+PAV M +A+  FF GT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPAVFMGIAIASFFFGTPLYRFQKP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  260   GGSPLTRMCQVLVAAFHKWNLSVPDDSALLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E   G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  320   VSDTELNTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T VG+FKIP ASLS FDT+SVIVWVP+YD+++VP+AR+FTG + G + LQRMG+GLF+S
Sbjct  380   DTAVGSFKIPAASLSTFDTISVIVWVPVYDKILVPIARRFTGKERGFSELQRMGIGLFLS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL + +   L D    VP+S+FWQ+PQYFI+G AE+FTFIGQLEFFY
Sbjct  440   VLCMSAAAIVEIRRLQLARELGLVDEAVAVPLSIFWQIPQYFILGAAEIFTFIGQLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  ITT+ GKPGW+ NNLN GHLDYFFW
Sbjct  500   DQSPDAMRSLCSALSLLTTALGNYLSSFILTVVTSITTQGGKPGWIPNNLNGGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS  NL +++  AKMY  KKA
Sbjct  560   LLAALSFCNLVIYIYCAKMYKSKKA  584



>ref|XP_009591011.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nicotiana tomentosiformis]
Length=584

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/565 (62%), Positives = 437/565 (77%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT DG++D +  P  K++TG W+ACPFILGNEC ERLAYYG+++NL+ Y  T+L+
Sbjct  19    ENSGLYTGDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIATNLVTYLTTKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W+GTCY+ PL+GA LADAY GRYWTIATFS IY IGM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWAGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  138

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P       C   T    ++ F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   FKPPECMDSVCPAATPAQYVILFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ+   WG GFG+PA+ M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPALFMGIAIASFFFGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  259   GGSPLTRMCQVLVAAFHKWNLSVPEDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  319   VSDAELKTGDYSNTWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGSVM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+FKIP ASLS FDT+SVIVWVP+YDR+IVP+AR+FTG + G + LQRMG+GLF+S
Sbjct  379   DTTIGSFKIPAASLSTFDTISVIVWVPVYDRVIVPIARRFTGKERGFSELQRMGIGLFLS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M  AA++E+ RL + +  +L D    VP+S+FWQ+PQYFI+G AE+FTFIGQLEFFY
Sbjct  439   VLCMSVAAIVEIKRLQLARDLDLVDEAVAVPLSIFWQIPQYFILGAAEIFTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSSF++T+V  ITT+ GKPGW+ NNLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLMTTSLGNYLSSFILTLVTSITTQGGKPGWIPNNLNSGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA L   NL ++V  AKMY  K+A
Sbjct  559   LLAALRFCNLVIYVFCAKMYKSKRA  583



>ref|NP_001233998.1| oligopeptide transporter 1 [Solanum lycopersicum]
 gb|AAD01600.1| LeOPT1 [Solanum lycopersicum]
Length=580

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/565 (62%), Positives = 437/565 (77%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT+DG++D +  P  K++TG W+ACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  15    ENSGLYTRDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIAANLVTYLTKKLH  74

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCYI PL+GA LADAY GRYWTIATFS IY IGM  +TLSA+VP 
Sbjct  75    EGNVSAARNVTTWQGTCYITPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  134

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     + +     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  135   FKPPQCVGSVCPSASPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  194

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ+   WG GFG+PAV M +A+  FF GT LYR+QKP
Sbjct  195   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPAVFMGIAIASFFFGTPLYRFQKP  254

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA   K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  255   GGSPLTRMCQVLVAVFHKWNLSVPDDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  314

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V  +E   G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  315   VSDNELTTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVM  374

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T VG+FKIP ASLS FDT+SVIVWVP+YD+++VP+AR+FTG + G + LQRMG+GLF+S
Sbjct  375   DTAVGSFKIPAASLSTFDTISVIVWVPVYDKILVPIARRFTGIERGFSELQRMGIGLFLS  434

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL + +   L D    VP+S+FWQ+PQYFI+G AE+FTFIGQLEFFY
Sbjct  435   MLCMSAAAIVEIRRLQLARDLGLVDEAVSVPLSIFWQIPQYFILGAAEIFTFIGQLEFFY  494

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  ITTR GKPGW+ NNLN GHLDYFFW
Sbjct  495   DQSPDAMRSLCSALSLLTTALGNYLSSFILTVVTSITTRGGKPGWIPNNLNGGHLDYFFW  554

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS  NL ++V + +MY  KKA
Sbjct  555   LLAALSFFNLVIYVFLCQMYKSKKA  579



>ref|XP_003524837.1| PREDICTED: peptide transporter PTR2-like [Glycine max]
 gb|KHN25956.1| Peptide transporter PTR2 [Glycine soja]
Length=584

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/574 (61%), Positives = 442/574 (77%), Gaps = 6/574 (1%)
 Frame = +3

Query  294   IRSEAMEEDD---VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNL  464
             +  EA+ +DD    YT DG++D++ RP  K  TG WKACPFILGNEC ERLAYYG+++NL
Sbjct  10    LAEEALLQDDESKQYTGDGSVDFKGRPVLKRNTGNWKACPFILGNECCERLAYYGIATNL  69

Query  465   MIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTL  644
             + Y   +L++  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  
Sbjct  70    VTYLTQKLHEGNVSAARNVTTWQGTCYLAPLIGAVLADAYWGRYWTIAIFSTIYFIGMGT  129

Query  645   MTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDT  821
             +TLSA+VP + P  C+       T     V F  LYL+ALGTGGIKPCVSS+GADQFDDT
Sbjct  130   LTLSASVPALKPAECLGPACPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDT  189

Query  822   DEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSG  1001
             D  ER  K SFFNWFYFSINIGALV+S+ IVWIQ+   WG GFG+PA+ MA+A+  FF G
Sbjct  190   DPGERIKKGSFFNWFYFSINIGALVSSTFIVWIQENAGWGLGFGIPALFMALAIGSFFLG  249

Query  1002  TRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNE  1181
             T LYR+QKPGGSP TR+ QV+VAS+RKR + VP D SLL+ET    S I+GSRKL H++E
Sbjct  250   TPLYRFQKPGGSPITRMCQVVVASVRKRNLVVPEDSSLLYETPDKSSAIEGSRKLEHSDE  309

Query  1182  LRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMST  1358
             L+  D+AAV  + E K G +S  WRLCTVTQVEELK +IR+ P+WAT I+F+ VY QMST
Sbjct  310   LKCLDRAAVASAAESKSGDYSNKWRLCTVTQVEELKILIRMFPVWATVIVFAAVYAQMST  369

Query  1359  QFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQ  1538
              FV Q   MNT VG+FKIP ASLS FD +SVIVWVP+YDR+IVP+ARKFTG++ G + LQ
Sbjct  370   LFVEQGTMMNTNVGSFKIPPASLSSFDVISVIVWVPVYDRIIVPIARKFTGNERGFSELQ  429

Query  1539  RMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFT  1715
             RMG+GLFIS+L M +AA++E+VRL + K H L D    VP+++FWQ+PQYF++G AEVFT
Sbjct  430   RMGIGLFISVLCMSAAAIVEIVRLQLAKEHGLVDEPVPVPLNIFWQIPQYFLLGAAEVFT  489

Query  1716  FIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLN  1895
             FIGQLEFFYDQ+PD+MRSLCSAL+L T ++GNYLSSF++T++   TT+ G PGW+ +NLN
Sbjct  490   FIGQLEFFYDQSPDAMRSLCSALALLTTSLGNYLSSFILTVMTYFTTQGGNPGWIPDNLN  549

Query  1896  YGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
              GHLDYFFWLLA LS +N+ V++V AK Y  KK+
Sbjct  550   KGHLDYFFWLLAGLSFLNMFVYIVAAKRYKEKKS  583



>ref|XP_007045395.1| Peptide transporter 2 isoform 1 [Theobroma cacao]
 gb|EOY01227.1| Peptide transporter 2 isoform 1 [Theobroma cacao]
Length=584

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/565 (62%), Positives = 433/565 (77%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT DG++D+  +P  K  TG WKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ESSGLYTGDGSVDFDGKPVLKQNTGNWKACPFILGNECCERLAYYGIATNLVTYLTKKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASIPA  138

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P       C + T     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   LKPAECVDSICPSATPAQYAVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSL+VWIQ    WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQDNAGWGLGFGIPALFMGLAIASFFSGTPLYRFQRP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  +KVP D SLL+ET    S I+GSRKL H++EL+  DKAA+
Sbjct  259   GGSPITRMCQVLVASFRKWNLKVPEDSSLLYETGDKHSAIEGSRKLEHSDELKCLDKAAI  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G FS PWRLCTVTQVEE K +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  319   LTDAEIKSGDFSNPWRLCTVTQVEEFKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYDR+IVP+ARKFTG + G + LQRMG+GLFIS
Sbjct  379   DTSIGSFTIPPASLSTFDVISVIFWVPIYDRIIVPIARKFTGKERGFSELQRMGIGLFIS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + K   L D    VP+S+FWQ+PQYF++G AEV TFIGQLEFFY
Sbjct  439   VLCMSAAAVVEIRRLQLAKELGLVDKDVAVPLSIFWQIPQYFLLGAAEVCTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSA SL T ++GNYLSSF++T+V   TTR+G+ GW+ NNLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSAFSLLTTSLGNYLSSFILTLVTYFTTRDGQTGWIPNNLNKGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+ V+ V AK Y  KKA
Sbjct  559   LLAGLSFLNMLVYTVCAKKYKQKKA  583



>ref|XP_006365609.1| PREDICTED: peptide transporter PTR5-like [Solanum tuberosum]
Length=562

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/563 (64%), Positives = 445/563 (79%), Gaps = 6/563 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             DDVYTKDGT D    PANK KTGTWKAC FILG E SERLAY+G S+NL+ Y    L  +
Sbjct  5     DDVYTKDGTTDINKAPANKKKTGTWKACFFILGEEISERLAYFGTSANLVNYLHQMLGLN  64

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
               +ASK ++N+ GTCY+ PL GAFLADAYLGRYWTIA FSIIY++GMTL+T+SA++ GI 
Sbjct  65    NAAASKVVTNFQGTCYVTPLFGAFLADAYLGRYWTIAIFSIIYIMGMTLLTMSASIVGIK  124

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P+C  +  C  T  +    +IA+YL+ALGTGGIKPCVSS+GADQFDD DE E++ KSSFF
Sbjct  125   PSC-HNGICHPTELEKTTFYIAIYLIALGTGGIKPCVSSFGADQFDDNDEVEKRRKSSFF  183

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFY SINIG+L+ASS++VWIQ  V WGWGFG+PAVAMA+A+ FFF+GTR YR Q PGGS
Sbjct  184   NWFYLSINIGSLIASSVLVWIQTSVGWGWGFGIPAVAMAIALMFFFAGTRFYRLQTPGGS  243

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P  R+ QV+VAS+RK  VK P DKSLL+ET+  ES+I GSRKL+HT++  F DK+AV  +
Sbjct  244   PLIRMLQVLVASMRKWDVKPPADKSLLYETANEESSILGSRKLAHTDKFSFLDKSAVETT  303

Query  1218  DEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
              +   GS +PWRLCTVTQVEE+KSIIRLLP+WA  I+F+T Y QM+T FV Q   M+ ++
Sbjct  304   HDKVNGSVNPWRLCTVTQVEEIKSIIRLLPVWACCIMFTTAYSQMNTTFVLQGNTMDRHM  363

Query  1398  -GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
              G FKIP ASL+VF+T+SVI+WV IYD+LI+P ARK+TGH  G T LQR+G+GL ISIL+
Sbjct  364   GGHFKIPSASLTVFETISVILWVLIYDQLIIPFARKYTGHARGFTQLQRIGIGLVISILS  423

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             MV+A V+E+VRL  +K+   YDV  +P+S+FWQVPQYF IGCA VFT IGQ+EFFYDQAP
Sbjct  424   MVAAGVVEVVRLDYIKQKGYYDVKTIPMSIFWQVPQYFFIGCAGVFTLIGQVEFFYDQAP  483

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D+MRSLCSAL L   A+G+YLSSFLVTIV    TRN K GW+  NLN GHLDYFFWLL +
Sbjct  484   DAMRSLCSALLLMAAALGSYLSSFLVTIV----TRNKKFGWITENLNKGHLDYFFWLLVI  539

Query  1935  LSVMNLGVFVVVAKMYTYKKAIN  2003
             LS++N  VF++V+++Y YKK I+
Sbjct  540   LSIINFMVFLLVSRLYVYKKVIH  562



>ref|XP_004246936.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Solanum lycopersicum]
Length=562

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/564 (64%), Positives = 444/564 (79%), Gaps = 8/564 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             DDVYTKDGT D    PANK KTGTWKAC FILG E SERLAY+G S+NL+ Y    L  +
Sbjct  5     DDVYTKDGTTDITKAPANKKKTGTWKACFFILGEEISERLAYFGTSTNLVNYLHQMLGLN  64

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
               +ASK ++N+ GTCY+ PL+GAFLADAYLGRYWTIA FSIIY++GMTL+T+SA++ GI 
Sbjct  65    NAAASKVVTNFQGTCYVSPLLGAFLADAYLGRYWTIAIFSIIYIMGMTLLTMSASIVGIK  124

Query  678   PTCIAHEK-CTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  854
             P+C  H+  C     +    +IA+YL+ALGTGGIKPCVSS+GADQFDD DE E++ KSSF
Sbjct  125   PSC--HDGICHPRELEKTTFYIAIYLIALGTGGIKPCVSSFGADQFDDNDEVEKRKKSSF  182

Query  855   FNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGG  1034
             FNWFY SI+IGAL+ASS++VWIQ  V WGWGFG+PAVAMA+A+ FFF GTR YR Q PGG
Sbjct  183   FNWFYLSISIGALIASSVLVWIQTSVGWGWGFGIPAVAMAIALMFFFVGTRFYRLQTPGG  242

Query  1035  SPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVE  1214
             SP  R+ QV+VAS+RK  VK P DKSLL+ET+  ESNI+GSRKL+HT++  F DK+AV  
Sbjct  243   SPLIRMLQVLVASMRKWDVKPPADKSLLYETANEESNIKGSRKLTHTDKFSFLDKSAVET  302

Query  1215  SDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
             + +   GS +PWRLCTVTQVEE+KSIIRLLP+WA  I+F+T Y QM+T FV Q   M+ Y
Sbjct  303   ARDKVNGSVNPWRLCTVTQVEEIKSIIRLLPVWACCIMFTTAYSQMNTTFVLQGNTMDRY  362

Query  1395  V-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISIL  1571
             + G FKIP ASL VF+T+SVI+WV IYD+LI+P ARK+TGH  G T LQR+G+GL IS+L
Sbjct  363   MGGNFKIPSASLIVFETISVILWVLIYDQLIIPFARKYTGHARGFTQLQRIGIGLVISML  422

Query  1572  AMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             +MVSA V+E VRL  +K+   YDV  +P+S+FWQVPQYF IGCA VFT IGQ+EFFYDQA
Sbjct  423   SMVSAGVVEAVRLDYIKQKGYYDVKTIPMSIFWQVPQYFFIGCAGVFTLIGQVEFFYDQA  482

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSLCSAL L   A+G+YLSSFLVTIV    TRN K GW+  NLN GHLDYFFWLL 
Sbjct  483   PDAMRSLCSALLLMAAALGSYLSSFLVTIV----TRNKKFGWITENLNKGHLDYFFWLLV  538

Query  1932  VLSVMNLGVFVVVAKMYTYKKAIN  2003
             +LS++N  VF++V+++Y YKK I+
Sbjct  539   ILSIINFIVFLLVSRLYVYKKVIH  562



>ref|XP_003531124.1| PREDICTED: peptide transporter PTR2-like [Glycine max]
 gb|KHN28899.1| Peptide transporter PTR2 [Glycine soja]
Length=584

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/583 (60%), Positives = 443/583 (76%), Gaps = 6/583 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAMEEDD---VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERL  437
             +G+   +  +  EA+ +DD    YT DG++D++ RP  K  TG WKACPFILGNEC ERL
Sbjct  1     MGSTENELSLAEEALLQDDESKQYTGDGSVDFKGRPVLKRNTGNWKACPFILGNECCERL  60

Query  438   AYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFS  617
             AYYG+++NL+ Y   +L++  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS
Sbjct  61    AYYGIATNLVTYLTQKLHEGNVSAARNVTTWQGTCYLAPLIGAVLADAYWGRYWTIAIFS  120

Query  618   IIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSS  794
              IY IGM  +TLSA+VP + P  C+       T     V F  LYL+ALGTGGIKPCVSS
Sbjct  121   TIYFIGMGTLTLSASVPALKPAECLGTACPPATPAQYAVFFFGLYLIALGTGGIKPCVSS  180

Query  795   YGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavama  974
             +GADQFDDTD +ER  K SFFNWFYFSINIGALV+S+ IVWIQ+   WG GFG+PA+ MA
Sbjct  181   FGADQFDDTDPQERIKKGSFFNWFYFSINIGALVSSTFIVWIQENAGWGLGFGIPALFMA  240

Query  975   mavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQG  1154
             +A+  FF GT LYR+QKPGGSP TR+ QV+VAS+ KR + VP D +LL+ET    S I+G
Sbjct  241   LAIGSFFLGTPLYRFQKPGGSPITRMCQVVVASVWKRNLVVPEDSNLLYETPDKSSAIEG  300

Query  1155  SRKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIF  1331
             SRKL H++EL+  D+AAVV   E K G +S  WRLCTVTQVEELK +IR+ P+WATGI+F
Sbjct  301   SRKLGHSDELKCLDRAAVVSDAESKSGDYSNQWRLCTVTQVEELKILIRMFPVWATGIVF  360

Query  1332  STVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTG  1511
             + VY QMST FV Q   MNT  G+F+IP ASLS FD +SVI WVP+YDR+IVP+ARKFTG
Sbjct  361   AAVYAQMSTLFVEQGTMMNTNFGSFRIPPASLSSFDVISVIFWVPVYDRIIVPIARKFTG  420

Query  1512  HKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYF  1688
              + G + LQRMG+GLFIS+L M +AA++E+VRL + K H L D    VP+++FWQ+PQYF
Sbjct  421   KERGFSELQRMGIGLFISVLCMSAAAIVEIVRLKVAKEHGLVDEPVPVPLNIFWQIPQYF  480

Query  1689  IIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGK  1868
             ++G AEVFTF+GQLEFFYDQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT+ G 
Sbjct  481   LLGAAEVFTFVGQLEFFYDQSPDAMRSLCSALSLLTTSLGNYLSSFILTVVTYFTTQGGN  540

Query  1869  PGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             PGW+ +NLN GHLDYFFWLLA LS +N  V++V AK Y  KK+
Sbjct  541   PGWIPDNLNKGHLDYFFWLLAGLSFLNTFVYIVAAKRYKQKKS  583



>gb|KDP38200.1| hypothetical protein JCGZ_04843 [Jatropha curcas]
Length=585

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/560 (63%), Positives = 433/560 (77%), Gaps = 3/560 (1%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E  +  ++YT DG++D    PA K  TG W+ACPFILGNEC ERLAYYG+S+NL+ Y   
Sbjct  17    EENKSKELYTGDGSVDLHGNPALKQNTGNWRACPFILGNECCERLAYYGISTNLVTYLTN  76

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +L++  +SA++N+S W+GTCYI PL+GA LADA  GRYWTIA FS IY IGM  +TLSA+
Sbjct  77    KLHEGNVSAARNVSTWAGTCYITPLIGAVLADACWGRYWTIAAFSTIYFIGMCTLTLSAS  136

Query  663   VPGISPTCIAHEKCT-VTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  839
             +P + P   A   C   T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER 
Sbjct  137   IPALKPAECAGSLCPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERV  196

Query  840   HKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRY  1019
              K SFFNWFYFSINIGALV+SSL+V+IQ    WG GFG+PAV MA+A+  FFSGT LYR+
Sbjct  197   KKGSFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPAVFMAIAIGSFFSGTPLYRF  256

Query  1020  QKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDK  1199
             Q+PGGSP TR+ QV+VAS  KR ++VP D SLL+ET    S I+GSRKL H+NELR  DK
Sbjct  257   QRPGGSPITRMCQVLVASFHKRNMEVPQDSSLLYETPEGISAIEGSRKLEHSNELRCLDK  316

Query  1200  AAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             AAV+ + E K G FS PWRLCTVTQVEELK ++R+ PIWATGI+FS VY QMST FV Q 
Sbjct  317   AAVISNAEAKSGDFSNPWRLCTVTQVEELKILVRMFPIWATGIVFSAVYAQMSTMFVEQG  376

Query  1377  IGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             + M+T VG+F IP ASLS FD +SVI WVPIYDR+IVP+ARKFTG + G + LQRMG+GL
Sbjct  377   MLMDTKVGSFTIPPASLSTFDVVSVICWVPIYDRVIVPIARKFTGKERGFSELQRMGIGL  436

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             FISIL+M +AAV+E+ RL + K   L D +  VPIS+ WQ+PQY ++G AEVFTFIGQLE
Sbjct  437   FISILSMSAAAVVEIRRLQLAKELGLVDESIAVPISILWQIPQYMLVGAAEVFTFIGQLE  496

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+Q+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT+ G PGW+ +NLN GHLDY
Sbjct  497   FFYEQSPDAMRSLCSALSLLTTSLGNYLSSFILTVVTYFTTKGGNPGWIPDNLNKGHLDY  556

Query  1914  FFWLLAVLSVMNLGVFVVVA  1973
             +FWLLA LSV+N+ V++V A
Sbjct  557   YFWLLAGLSVLNMLVYIVCA  576



>ref|XP_010554363.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X1 [Tarenaya 
hassleriana]
Length=583

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/582 (60%), Positives = 437/582 (75%), Gaps = 5/582 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAMEEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLA  440
             +G+I  +  +  +++ ED   +Y +DG++D    P  K KTG WKACPFILGNEC ERLA
Sbjct  1     MGSIEEERALLDDSLVEDQPKLYAEDGSVDINGNPPLKQKTGNWKACPFILGNECCERLA  60

Query  441   YYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSI  620
             YYG++ NL+ Y   +L++  +SA++N++ W GTCYI PL+GA LADAY GRYWTI  FS 
Sbjct  61    YYGIAGNLITYLTFKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIGCFSA  120

Query  621   IYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSY  797
             IY +GM  +TLSA+VP + P  C+       T     V F  LYL+ALGTGGIKPCVSS+
Sbjct  121   IYFVGMAALTLSASVPALKPAECVGALCPPATSAQYAVFFFGLYLIALGTGGIKPCVSSF  180

Query  798   GADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamam  977
             GADQFDDTD +ER  K+SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +
Sbjct  181   GADQFDDTDSRERVKKASFFNWFYFSINIGALVSSSLLVWIQENCGWGLGFGIPTVFMGL  240

Query  978   avTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGS  1157
             A+  FF GTRLYR+QKPGGSP TR+ QV+VAS  K  + VP D SLL+ET    S I GS
Sbjct  241   AIVSFFFGTRLYRFQKPGGSPITRVCQVLVASFHKLNLNVPEDNSLLYETQDKNSAIAGS  300

Query  1158  RKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1334
             RK+ HT + +  DKAAV+  DE K G FS PWRLCTVTQVEELK +IR+ PIWA+GI+FS
Sbjct  301   RKIEHTEDYKCLDKAAVLSEDEVKSGDFSNPWRLCTVTQVEELKILIRMFPIWASGILFS  360

Query  1335  TVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGH  1514
              VY QMST FV Q   MN  +G+F++P A+L  FDT SVIVWVP+YDR+IVP+ARKFTG 
Sbjct  361   AVYAQMSTMFVQQGRSMNCKIGSFELPPATLGTFDTASVIVWVPLYDRVIVPLARKFTGV  420

Query  1515  KSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFI  1691
               G T LQRMG+GLFIS+L M +AAV+E+VRL + + + L +    VP+SVFWQ+PQYFI
Sbjct  421   GKGFTELQRMGIGLFISVLCMAAAAVVEIVRLHLAREYGLVESGAAVPMSVFWQIPQYFI  480

Query  1692  IGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKP  1871
             +G AEVF FIGQLEFFYDQ+PD+MRSLCSAL+L T A+GNYLSS ++T+V  +TTR GK 
Sbjct  481   LGAAEVFFFIGQLEFFYDQSPDAMRSLCSALALLTTALGNYLSSLILTVVTYLTTRGGKE  540

Query  1872  GWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GW+++NLN GHLDYFFWLLA LS++N+ ++V  +  Y  KK+
Sbjct  541   GWISDNLNKGHLDYFFWLLAGLSLLNMAIYVFSSVKYKQKKS  582



>ref|XP_008466778.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X1 [Cucumis melo]
Length=587

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 431/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + ++T DG++D+   P  K  TG WKACPFILGNE  ERLAYYG+S+NL+ Y   +L+
Sbjct  20    ESNALFTGDGSVDFHGNPVLKQNTGNWKACPFILGNEGCERLAYYGISTNLVTYLTNKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+VP 
Sbjct  80    QGNVSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAAFSTIYFIGMCTLTLSASVPA  139

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+       +    MV F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  140   LKPAECVGFMCPPASAAQYMVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS +VWIQ    WG GFG+PAV M +A+  FFSGT+LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPAVFMGLAIVSFFSGTKLYRFQKP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS  KR ++VP D +LL+E     S I+GSRKL H++ELR  DKAAV
Sbjct  260   GGSPITRMCQVLVASFHKRNLRVPGDSNLLYEVQDKSSAIEGSRKLEHSDELRCLDKAAV  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G +S PWRLCTVTQVEE K +IR+ PIWATGI+F+ VY QMST FV Q   +
Sbjct  320   ISDAELKSGDYSNPWRLCTVTQVEEFKILIRMFPIWATGIVFAAVYAQMSTLFVEQGTML  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +  +G+F+IP ASLS FD +SVI WVP+YDR IVP+A+KFTG + G T +QRMG+GLFIS
Sbjct  380   DKTIGSFRIPPASLSTFDVVSVIFWVPVYDRFIVPIAKKFTGKERGFTEIQRMGIGLFIS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + +  +L    E VP+S+ WQ+PQYF++G AEVFTFIGQLEFFY
Sbjct  440   VLCMSAAAVVEIKRLELARELDLVHKPEAVPLSILWQIPQYFLLGAAEVFTFIGQLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++TIV  +TTRNG+ GW+ +NLN GHLD+FFW
Sbjct  500   DQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTYLTTRNGQSGWIPDNLNEGHLDFFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +NL V+ V AK Y  KKA
Sbjct  560   LLAGLSFLNLLVYTVCAKRYRPKKA  584



>ref|XP_004972110.1| PREDICTED: peptide transporter PTR1-like [Setaria italica]
Length=584

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/559 (63%), Positives = 437/559 (78%), Gaps = 6/559 (1%)
 Frame = +3

Query  330   TKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTISA  509
             T DGT D+  +PA ++KTGTW+ACPFILGNEC ERLAYYGMSSNL+ Y   RL+Q   +A
Sbjct  19    TLDGTTDHSGKPAVRSKTGTWRACPFILGNECCERLAYYGMSSNLVNYMIDRLHQGNAAA  78

Query  510   SKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTCI  689
             + N+SNWSGTCY+MPL+GAFLADAYLGRY TIA F  +Y++G+TL+T+SA VPG+ P   
Sbjct  79    ANNVSNWSGTCYMMPLLGAFLADAYLGRYRTIAAFMGLYIVGLTLLTMSAAVPGLRPPDA  138

Query  690   AHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFY  869
             A      T   +   F ALYL+A+GTGGIKPCVSS+GADQFDD D +E + KSSFFNWFY
Sbjct  139   A--GAAPTAGQSAAFFAALYLIAVGTGGIKPCVSSFGADQFDDADPRESQSKSSFFNWFY  196

Query  870   FSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPFTR  1049
              SINIGALVASS++VWIQ  V WGWGFG+PAVAMA AV  F  G+RLYR+Q+PGGSP TR
Sbjct  197   TSINIGALVASSVLVWIQMNVGWGWGFGIPAVAMAAAVASFLLGSRLYRHQRPGGSPLTR  256

Query  1050  LFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV--ESDE  1223
             + QV+VA+ RKRK  VP D SLLHE     S IQGSRKL HT + R+ D+AAV+  E D 
Sbjct  257   MLQVVVAAWRKRKSPVPADPSLLHEAPASASAIQGSRKLEHTEQFRWLDRAAVLTEEDDT  316

Query  1224  YKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG-  1400
                   +PW+LCTVTQVEELKS++RLLP+WATGI+ S VY QMST FV Q   ++  VG 
Sbjct  317   MNNEKSNPWQLCTVTQVEELKSVVRLLPVWATGIVVSAVYSQMSTMFVLQGNTLDPSVGS  376

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
             +FKIP ASLS+FDTLSVI W P+YDRLIVP AR++TGH  G T LQRMG+GL +S+LAMV
Sbjct  377   SFKIPSASLSIFDTLSVIAWAPVYDRLIVPAARRWTGHPRGFTQLQRMGIGLAVSVLAMV  436

Query  1581  SAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +A  LE++RL +   H + D T  +PIS+ WQVPQYFIIG  EVFTFIGQ+EFFYDQAPD
Sbjct  437   AAGALEVLRLHVAASHGMLDSTAYLPISILWQVPQYFIIGAFEVFTFIGQIEFFYDQAPD  496

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRS+ +ALSLT++A+G+YLS+ LV++V  +TTRNG  GW+ +NLN GHLDYFFWLL++L
Sbjct  497   AMRSMGTALSLTSSALGSYLSALLVSVVTAVTTRNGGLGWIPDNLNRGHLDYFFWLLSLL  556

Query  1938  SVMNLGVFVVVAKMYTYKK  1994
             SV+N  V++++AK Y YK+
Sbjct  557   SVINFLVYLLIAKWYKYKQ  575



>ref|XP_008466783.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X2 [Cucumis melo]
Length=586

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/583 (60%), Positives = 438/583 (75%), Gaps = 6/583 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM---EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERL  437
             +G+   D  I  E +   E + ++T DG++D+   P  K  TG WKACPFILGNE  ERL
Sbjct  1     MGSQEDDRAILEEGLLQNESNALFTGDGSVDFHGNPVLKQNTGNWKACPFILGNEGCERL  60

Query  438   AYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFS  617
             AYYG+S+NL+ Y   +L+Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS
Sbjct  61    AYYGISTNLVTYLTNKLHQGNVSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAAFS  120

Query  618   IIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSS  794
              IY IGM  +TLSA+VP + P  C+       +    MV F+ LYL+ALGTGGIKPCVSS
Sbjct  121   TIYFIGMCTLTLSASVPALKPAECVGFMCPPASAAQYMVFFLGLYLIALGTGGIKPCVSS  180

Query  795   YGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavama  974
             +GADQFDDTD  ER  K SFFNWFYFSINIGAL++SS +VWIQ    WG GFG+PAV M 
Sbjct  181   FGADQFDDTDPAERVKKGSFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPAVFMG  240

Query  975   mavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQG  1154
             +A+  FFSGT+LYR+QKPGGSP TR+ QV+VAS  KR ++VP D +LL+E     S I+G
Sbjct  241   LAIVSFFSGTKLYRFQKPGGSPITRMCQVLVASFHKRNLRVPGDSNLLYEVQDKSSAIEG  300

Query  1155  SRKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIF  1331
             SRKL H++ELR  DKAAV+   E K G +S PWRLCTVTQVEE K +IR+ PIWATGI+F
Sbjct  301   SRKLEHSDELRCLDKAAVISDAELKSGDYSNPWRLCTVTQVEEFKILIRMFPIWATGIVF  360

Query  1332  STVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTG  1511
             + VY QMST FV Q   ++  +G+F+IP ASLS FD +SVI WVP+YDR IVP+A+KFTG
Sbjct  361   AAVYAQMSTLFVEQGTMLDKTIGSFRIPPASLSTFDVVSVIFWVPVYDRFIVPIAKKFTG  420

Query  1512  HKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYF  1688
              + G T +QRMG+GLFIS+L M +AAV+E+ RL + +  +L    E VP+S+ WQ+PQYF
Sbjct  421   KERGFTEIQRMGIGLFISVLCMSAAAVVEIKRLELARELDLVHKPEAVPLSILWQIPQYF  480

Query  1689  IIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGK  1868
             ++G AEVFTFIGQLEFFYDQ+PD+MRSLCSALSL T A+GNYLSSF++TIV  +TTRNG+
Sbjct  481   LLGAAEVFTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTYLTTRNGQ  540

Query  1869  PGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
              GW+ +NLN GHLD+FFWLLA LS +NL V+ V AK Y  KKA
Sbjct  541   SGWIPDNLNEGHLDFFFWLLAGLSFLNLLVYTVCAKRYRPKKA  583



>ref|NP_178313.1| peptide transporter PTR2 [Arabidopsis thaliana]
 sp|P46032.1|PTR2_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 8.3; Short=AtNPF8.3; AltName: 
Full=Histidine-transporting protein; AltName: Full=Peptide 
transporter PTR2 [Arabidopsis thaliana]
 gb|AAK50086.1|AF372946_1 At2g02040/F14H20.11 [Arabidopsis thaliana]
 gb|AAB00858.1| transport protein [Arabidopsis thaliana]
 gb|AAD20096.1| histidine transport protein (PTR2-B) [Arabidopsis thaliana]
 gb|AAN28893.1| At2g02040/F14H20.11 [Arabidopsis thaliana]
 gb|AEC05538.1| peptide transporter PTR2 [Arabidopsis thaliana]
Length=585

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/566 (61%), Positives = 431/566 (76%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEVKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  78    HQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VKVP D +LL+ET    S I GSRK+ HT++ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKVPEDATLLYETQDKNSAIAGSRKIEHTDDCQYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  +E K G +S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  318   VISEEESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  377

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP+ARKFTG   G T +QRMG+GLF+
Sbjct  378   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARKFTGVDKGFTEIQRMGIGLFV  437

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AA++E++RL M     L +    VPISV WQ+PQYFI+G AEVF FIGQLEFF
Sbjct  438   SVLCMAAAAIVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFF  497

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG+ GW+++NLN GHLDYFF
Sbjct  498   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFF  557

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ V+   A  Y  KKA
Sbjct  558   WLLAGLSLVNMAVYFFSAARYKQKKA  583



>ref|XP_004149470.1| PREDICTED: peptide transporter PTR2-like [Cucumis sativus]
 ref|XP_004170470.1| PREDICTED: peptide transporter PTR2-like [Cucumis sativus]
 gb|KGN49752.1| hypothetical protein Csa_5G106020 [Cucumis sativus]
Length=586

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/583 (60%), Positives = 435/583 (75%), Gaps = 6/583 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM---EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERL  437
             +G+   D  I  E +   E   +YT DG++D+   P  K  TG WKACPFILGNE  ERL
Sbjct  1     MGSQEDDRAILEEGLLQNESSTLYTGDGSVDFHGNPVLKQNTGNWKACPFILGNEGCERL  60

Query  438   AYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFS  617
             AYYG+S+NL+ Y   +L+Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS
Sbjct  61    AYYGISTNLVTYLTNKLHQGNVSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAAFS  120

Query  618   IIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSS  794
              IY IGM  +TLSA+VP + P  C+       +    MV F+ LYL+ALGTGGIKPCVSS
Sbjct  121   TIYFIGMCTLTLSASVPALKPAECVGFMCPPASAAQYMVFFLGLYLIALGTGGIKPCVSS  180

Query  795   YGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavama  974
             +GADQFDDTD  ER  K SFFNWFYFSINIGAL++SS +VWIQ    WG GFG+PAV M 
Sbjct  181   FGADQFDDTDPAERVKKGSFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPAVFMG  240

Query  975   mavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQG  1154
             +A+  FFSGT+LYR+QKPGGSP TR+ QV+VAS  KR + VP D +LL+E     S I+G
Sbjct  241   LAIVSFFSGTKLYRFQKPGGSPITRMCQVLVASFHKRNLTVPSDSNLLYEVQDKSSAIEG  300

Query  1155  SRKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIF  1331
             SRKL H++ELR  DKAAV+   E K G FS PWRLCTVTQ+EE K +IR+ PIWATGI+F
Sbjct  301   SRKLEHSDELRCLDKAAVISDAELKSGDFSDPWRLCTVTQIEEFKILIRMFPIWATGIVF  360

Query  1332  STVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTG  1511
             + VY QMST FV Q   ++  +G+F+IP ASLS FD +SVI WVP+YDR IVP+A+KFTG
Sbjct  361   AAVYAQMSTLFVEQGTMLDKTIGSFRIPPASLSTFDVVSVIFWVPVYDRFIVPIAKKFTG  420

Query  1512  HKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYF  1688
              + G T +QRMG+GLFIS+L M +AAV+E+ RL + +  +L    E VP+S+ WQ+PQYF
Sbjct  421   KERGFTEIQRMGIGLFISVLCMSAAAVVEIKRLELARELDLVHKPEAVPLSILWQIPQYF  480

Query  1689  IIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGK  1868
             ++G AEVFTFIGQLEFFYDQ+PD+MRSLCSALSL T A+GNYLSSF++TIV  +TTRNG+
Sbjct  481   LLGAAEVFTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTYLTTRNGQ  540

Query  1869  PGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
              GW+ +NLN GHLD FFWLLA LS +NL V+ V AK Y  KKA
Sbjct  541   SGWIPDNLNEGHLDLFFWLLAGLSFLNLLVYTVCAKRYRPKKA  583



>ref|XP_004504618.1| PREDICTED: peptide transporter PTR2-like [Cicer arietinum]
Length=584

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/583 (60%), Positives = 438/583 (75%), Gaps = 6/583 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM---EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERL  437
             +G+   D  +  +A+   EE   YT DG++D++ RP  K  TG WKACPFILGNEC ERL
Sbjct  1     MGSAEDDSSLLEQALIQDEESKRYTGDGSVDFKGRPVLKQNTGNWKACPFILGNECCERL  60

Query  438   AYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFS  617
             AYYG+++NL+ Y   +L++  +SA++N++ W GTCY+ PL+GA LAD+Y GRYWTIA+FS
Sbjct  61    AYYGIATNLVTYLTRKLHEGNVSAARNVTTWQGTCYLAPLIGAVLADSYWGRYWTIASFS  120

Query  618   IIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSS  794
              IY +GM  +TLSA+VP + P  C+       T     V FI LYL+ALGTGGIKPCVSS
Sbjct  121   TIYFLGMCTLTLSASVPALKPAECLGTVCPPATPAQYAVFFIGLYLIALGTGGIKPCVSS  180

Query  795   YGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavama  974
             +GADQFDDTD +ER  K SFFNWFYFSINIGALV+SS IVWIQ+   WG GFG+PA+ M 
Sbjct  181   FGADQFDDTDSQERIKKGSFFNWFYFSINIGALVSSSFIVWIQENAGWGLGFGIPALFMG  240

Query  975   mavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQG  1154
             +A+  FF GT LYR+QKPGGSP TR+ QV+ AS RKR + VP D SLL+ET    S I+G
Sbjct  241   LAIGSFFLGTPLYRFQKPGGSPLTRMCQVVAASFRKRNLAVPEDSSLLYETPDKSSAIEG  300

Query  1155  SRKLSHTNELRFFDKAAVVESDEYKKGSFSP-WRLCTVTQVEELKSIIRLLPIWATGIIF  1331
             SRKL H++ELR  D+AAVV   E K G +S  WRLCTVTQVEELK +IR+ P+WATGIIF
Sbjct  301   SRKLEHSDELRCLDRAAVVSDAERKSGDYSNLWRLCTVTQVEELKILIRMFPVWATGIIF  360

Query  1332  STVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTG  1511
             S VY QMST FV Q   MNT +G+FKIP ASLS FD +SVI WVP+YD++IVP+ARKFTG
Sbjct  361   SAVYAQMSTMFVEQGTMMNTQIGSFKIPPASLSTFDVISVIFWVPVYDKVIVPIARKFTG  420

Query  1512  HKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYF  1688
              + G + LQRMG+GLFIS+L M +AAVLE+ RL + K   L D    VP+++  Q+PQYF
Sbjct  421   KERGFSELQRMGIGLFISVLCMSAAAVLEIKRLQLAKELGLVDEPVPVPLTILLQIPQYF  480

Query  1689  IIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGK  1868
             ++G AEVFTF+GQLEFFYDQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT+ G 
Sbjct  481   LLGAAEVFTFVGQLEFFYDQSPDAMRSLCSALSLLTTSLGNYLSSFILTMVTYFTTQGGN  540

Query  1869  PGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             PGW+ +NLN G LD FFWLLA LS +N+ +++V AK Y  KKA
Sbjct  541   PGWIPDNLNKGRLDNFFWLLAGLSFLNMLLYIVAAKRYKQKKA  583



>gb|ABK24723.1| unknown [Picea sitchensis]
Length=594

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/565 (61%), Positives = 441/565 (78%), Gaps = 5/565 (1%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             +D YT DG++D+  RP+ K  TG W+ACPFILGNEC ERLAYYG+++NL+ Y   RL+Q 
Sbjct  29    EDEYTGDGSVDFWGRPSVKENTGNWRACPFILGNECCERLAYYGINTNLVTYLTKRLHQG  88

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
               +A+K+++ W+GTCY+ PL GA LADAY GRYWTIA FS IY IGM  +TLSA+V  + 
Sbjct  89    NAAAAKSVTTWAGTCYLTPLFGAVLADAYWGRYWTIAAFSTIYFIGMATLTLSASVSSLK  148

Query  678   P-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  854
             P +CI  +  T       V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KE+K K SF
Sbjct  149   PPSCIGSDCPTANLAQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKEKKKKGSF  208

Query  855   FNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGG  1034
             FNWFYFSIN+GALV+SS++VW+Q  V WGWGFG+P + M +A+  FFSGT LYR QKPGG
Sbjct  209   FNWFYFSINVGALVSSSVLVWVQDNVGWGWGFGIPTLFMGLAIGSFFSGTPLYRLQKPGG  268

Query  1035  SPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVE  1214
             SP TR+ QV+VASLRK +  VP+D S L+E     S IQGSRKL HT+E +  DK+A++ 
Sbjct  269   SPVTRMCQVVVASLRKLRKTVPLDHSHLYEVQDRNSAIQGSRKLEHTDEFKCLDKSAIIT  328

Query  1215  SDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNT  1391
              D+ +KG FS PWRLCTVTQVEE+K ++R+ PIWATGI+F+ VY Q+ST FV Q + ++T
Sbjct  329   DDDVRKGGFSNPWRLCTVTQVEEMKILLRMFPIWATGIVFAAVYSQISTMFVEQGMTLDT  388

Query  1392  YVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
              +G+ F IP ASLSVFD +SV++WVP+YDR+IVP+  K+T  + G T LQRMG+GLFISI
Sbjct  389   SIGSRFHIPPASLSVFDVVSVMIWVPVYDRVIVPIVSKYTKRERGFTELQRMGIGLFISI  448

Query  1569  LAMVSAAVLEMVRLAMVKRHNL-YDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             LAMV+AA++E+ RL +VK ++L YD  T VP+S+FWQ+PQYF++G +EVFTF+GQLEFFY
Sbjct  449   LAMVAAALVEIRRLNIVKTYDLVYDKGTPVPMSIFWQIPQYFLVGASEVFTFVGQLEFFY  508

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSS +VTIV   TT+ G  GW+ +NLN GHLDY+FW
Sbjct  509   DQSPDAMRSLCSALSLLTTALGNYLSSLIVTIVMFATTKGGNIGWIPDNLNEGHLDYYFW  568

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             +LA LSV+NL V+V  A  Y YKKA
Sbjct  569   VLASLSVLNLLVYVSCAHRYKYKKA  593



>ref|XP_010502212.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Camelina sativa]
Length=584

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/566 (61%), Positives = 428/566 (76%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  78    HQGNVSAATNVTTWQGTCYLTPLIGAILADAYWGRYWTIACFSGIYFIGMSALTLSASVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VKVP D +LL+ET    S I GSRK+ HTN+ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKSSAIAGSRKIEHTNDSKYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  318   VISEEELKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  377

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP AR+FTG   G T +QRMG+GLF+
Sbjct  378   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPFARRFTGVDKGFTEIQRMGIGLFV  437

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AAV+E++RL M     L +    VPISV WQ+PQYFI+G  EVF FIGQLEFF
Sbjct  438   SVLCMAAAAVVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAGEVFYFIGQLEFF  497

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TT NG+ GW+++NLN GHLDYFF
Sbjct  498   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTMNGQQGWISDNLNSGHLDYFF  557

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ V+   A  Y  KKA
Sbjct  558   WLLAGLSLVNMAVYYFSAARYKQKKA  583



>ref|XP_010513957.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Camelina sativa]
Length=584

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/566 (61%), Positives = 428/566 (76%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  78    HQGNVSAATNVTTWQGTCYLTPLIGAILADAYWGRYWTIACFSGIYFIGMSALTLSASVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VKVP D +LL+ET    S I GSRK+ HTN+ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKNSAIAGSRKIEHTNDSKYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  318   VISEEELKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  377

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP AR+FTG   G T +QRMG+GLF+
Sbjct  378   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPFARRFTGVDKGFTEIQRMGIGLFV  437

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AAV+E++RL M     L +    VPISV WQ+PQYFI+G  EVF FIGQLEFF
Sbjct  438   SVLCMAAAAVVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAGEVFYFIGQLEFF  497

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TT NG+ GW+++NLN GHLDYFF
Sbjct  498   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTMNGQQGWISDNLNSGHLDYFF  557

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ V+   A  Y  KKA
Sbjct  558   WLLAGLSLVNMAVYYFSAARYKQKKA  583



>ref|XP_002521890.1| peptide transporter, putative [Ricinus communis]
 gb|EEF40526.1| peptide transporter, putative [Ricinus communis]
Length=585

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/567 (61%), Positives = 436/567 (77%), Gaps = 3/567 (1%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E  + + +YT DG++D +  P  K KTG WKACPFILG EC ERLAYYG+++NL+ Y   
Sbjct  17    EENKSNGLYTGDGSVDLKGNPVLKQKTGNWKACPFILGTECCERLAYYGIATNLVTYLTN  76

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +L++  ++A++N++ W+GTCYI PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+
Sbjct  77    KLHEGNVAAARNVTTWAGTCYIAPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSAS  136

Query  663   VPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  839
             VP + P  C+     + +     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER 
Sbjct  137   VPALKPVECVGPLCPSASPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDRKERV  196

Query  840   HKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRY  1019
              K SFFNWFYFSINIGALV+SSL+V+IQ    WG GFG+PA+ M +A+  FF+GT LYR+
Sbjct  197   KKGSFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPALFMGIAIASFFAGTPLYRF  256

Query  1020  QKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDK  1199
             QKPGGSP TR+ QV+VAS  K  ++VP D SLL+ET   +S I+GSRK+ H+NEL+  DK
Sbjct  257   QKPGGSPITRMCQVLVASFHKWNLEVPSDSSLLYETQDGQSAIEGSRKMEHSNELKCLDK  316

Query  1200  AAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             AAV+   E K G FS PWRLCTVTQVEELK ++R+ PIWATGI+FS VY QMST FV Q 
Sbjct  317   AAVISETEAKTGDFSNPWRLCTVTQVEELKILVRMFPIWATGIVFSAVYAQMSTMFVEQG  376

Query  1377  IGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             + M+T +G+F IP ASLS FD +SVI WVPIYD +IVP+ARKFTG + G + LQRMG+GL
Sbjct  377   MLMDTTIGSFTIPPASLSTFDVISVICWVPIYDAVIVPIARKFTGKERGFSELQRMGIGL  436

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLE  1733
             FIS+L+M +AA++E+ RL +     L D    VP+S+FWQ+PQY ++G AEVFTFIGQLE
Sbjct  437   FISVLSMSAAALVEIRRLQLANELGLVDKDVAVPLSIFWQIPQYMLVGAAEVFTFIGQLE  496

Query  1734  FFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDY  1913
             FFY+Q+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT  GKPGW+ +NLN GHLDY
Sbjct  497   FFYEQSPDAMRSLCSALSLLTTSLGNYLSSFILTMVTYFTTVGGKPGWIPDNLNEGHLDY  556

Query  1914  FFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             FFWLLA LSV+N+ +++V AK Y +K+
Sbjct  557   FFWLLAGLSVVNMLLYIVCAKKYKHKR  583



>ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
 gb|EMJ23494.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
Length=584

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/565 (62%), Positives = 431/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT DG++D   +P  K  TG W+ACPFILG EC ERLA+YG+S+NL+ Y   +L+
Sbjct  19    ETNGLYTGDGSVDITGKPVLKQSTGNWRACPFILGTECCERLAFYGISTNLVTYLTHKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAIFSTIYFIGMCTLTLSASVPA  138

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P       C + +     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   LKPPQCVDSVCPSASPAQYGVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+S+LIVW+Q    WG GFG+PA+ M +A+  FFSGT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSTLIVWVQDNAGWGLGFGIPALFMGIAIVSFFSGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  + VP D SLL+ET    S I+GSRKL H++EL   DKAAV
Sbjct  259   GGSPLTRMCQVLVASFRKWNLDVPRDSSLLYETRDKGSAIKGSRKLEHSDELNCLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G+FS PWR+CTVTQVEELK +IR+ PIWATGI+FS VY QM+T FV Q + M
Sbjct  319   ISETETKTGNFSNPWRICTVTQVEELKILIRMFPIWATGIVFSAVYAQMATMFVEQGMMM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T VG+F IP ASLS FD +SVI WVPIYDR IVP+ARKFTG + G + LQRMG+GLF+S
Sbjct  379   DTSVGSFTIPPASLSSFDVISVIFWVPIYDRFIVPIARKFTGKERGFSELQRMGIGLFLS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+EM RL +     L D    VP+S+FWQ+PQYF++G AE+FTFIGQLEFFY
Sbjct  439   VLCMSAAAVVEMKRLQLATELGLVDKDVAVPLSIFWQIPQYFLLGAAEIFTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSS ++TIV   TT+ GK GW+ +NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLLTTSLGNYLSSLILTIVTYFTTQGGKAGWIPDNLNEGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS++N+ V++V AK Y  KKA
Sbjct  559   LLAGLSLLNMLVYIVCAKRYKKKKA  583



>ref|XP_007158832.1| hypothetical protein PHAVU_002G185700g [Phaseolus vulgaris]
 gb|ESW30826.1| hypothetical protein PHAVU_002G185700g [Phaseolus vulgaris]
Length=584

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/583 (59%), Positives = 441/583 (76%), Gaps = 6/583 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM---EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERL  437
             +G+   D  +  EA+   EE  +YT DG++D++ RP  K  TG WKACPFILGNEC ERL
Sbjct  1     MGSTENDLSLAEEALLQDEERKLYTGDGSVDFKGRPVLKKSTGNWKACPFILGNECCERL  60

Query  438   AYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFS  617
             AYYG+++NL+ Y   +L+Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS
Sbjct  61    AYYGIATNLVTYLTQKLHQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAVFS  120

Query  618   IIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSS  794
             +IYVIGM  +TLSA+VP   P  C+       T     + F  LYL+ALGTGGIKPCVSS
Sbjct  121   MIYVIGMGTLTLSASVPVFKPAECLGASCPPATPAQYALFFFGLYLIALGTGGIKPCVSS  180

Query  795   YGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavama  974
             +GADQFDDTD  ER  K SFFNWFYFSINIGA V+S+ IVWIQ+   WG GFG+PA+ M 
Sbjct  181   FGADQFDDTDSGERIKKGSFFNWFYFSINIGAFVSSTFIVWIQENAGWGLGFGIPALFMT  240

Query  975   mavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQG  1154
             +A+  FF GT LYR+QKPGGSP TR+ QV+VA+ RKR + VP D SLL+ET    S I+G
Sbjct  241   LAIGSFFLGTPLYRFQKPGGSPITRMCQVVVAATRKRNLVVPEDSSLLYETPDNSSAIKG  300

Query  1155  SRKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIF  1331
             SRKL H++EL+  D+AAVV   E K G +S  WR+C+VTQVEELK +IR+ PIW+TGI+F
Sbjct  301   SRKLEHSDELKCLDRAAVVSDAESKTGDYSNKWRICSVTQVEELKILIRMFPIWSTGIVF  360

Query  1332  STVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTG  1511
             + VY QMST FV Q   M T +G+F+IP ASLS FD +SVI WVP+YD +IVP+ARKFTG
Sbjct  361   AAVYAQMSTLFVEQGTMMKTNLGSFRIPPASLSSFDVISVIFWVPVYDSVIVPIARKFTG  420

Query  1512  HKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYF  1688
              + G + LQRMG+GLFIS+L M +AA++E+VRL + +  +L D    VP+++FWQVPQYF
Sbjct  421   KERGFSELQRMGIGLFISVLCMSAAAIVEIVRLQLAEELDLVDQPVPVPLNIFWQVPQYF  480

Query  1689  IIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGK  1868
             ++G AEVFTF+GQLEFFYDQ+PD+MRSLCSALSL T ++G+YLSSF++T+V   TT+ G 
Sbjct  481   LLGAAEVFTFVGQLEFFYDQSPDAMRSLCSALSLLTTSLGSYLSSFILTVVTYFTTKGGN  540

Query  1869  PGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             PGW+ +NLN GHLDYFFWLLA LS +N+ V+VV AK Y  K++
Sbjct  541   PGWIPDNLNEGHLDYFFWLLAGLSFLNMFVYVVAAKRYKQKRS  583



>ref|XP_010554364.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X2 [Tarenaya 
hassleriana]
Length=583

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/582 (60%), Positives = 436/582 (75%), Gaps = 5/582 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAMEEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLA  440
             +G+I  +  +  +++ ED   +Y +DG++D    P  K KTG WKACPFILGNEC ERLA
Sbjct  1     MGSIEEERALLDDSLVEDQPKLYAEDGSVDINGNPPLKQKTGNWKACPFILGNECCERLA  60

Query  441   YYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSI  620
             YYG++ NL+ Y   +L++  +SA++N++ W GTCYI PL+GA LADAY GRYWTI  FS 
Sbjct  61    YYGIAGNLITYLTFKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIGCFSA  120

Query  621   IYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSY  797
             IY +GM  +TLSA+VP + P  C+       T     V F  LYL+ALGTGGIKPCVSS+
Sbjct  121   IYFVGMAALTLSASVPALKPAECVGALCPPATSAQYAVFFFGLYLIALGTGGIKPCVSSF  180

Query  798   GADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamam  977
             GADQFDDTD +ER  K+SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +
Sbjct  181   GADQFDDTDSRERVKKASFFNWFYFSINIGALVSSSLLVWIQENCGWGLGFGIPTVFMGL  240

Query  978   avTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGS  1157
             A+  FF GTRLYR+QKPGGSP TR+ QV+VAS  K  + VP D SLL+ET    S I GS
Sbjct  241   AIVSFFFGTRLYRFQKPGGSPITRVCQVLVASFHKLNLNVPEDNSLLYETQDKNSAIAGS  300

Query  1158  RKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1334
             RK+ HT + +  DKAAV+  DE K G FS PWRLCTVTQVEELK +IR+ PIWA+GI+FS
Sbjct  301   RKIEHTEDYKCLDKAAVLSEDEVKSGDFSNPWRLCTVTQVEELKILIRMFPIWASGILFS  360

Query  1335  TVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGH  1514
              VY QMST FV Q   MN  +G+F++P A+L  FDT SVIVWVP+YDR+IVP+ARKFTG 
Sbjct  361   AVYAQMSTMFVQQGRSMNCKIGSFELPPATLGTFDTASVIVWVPLYDRVIVPLARKFTGV  420

Query  1515  KSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFI  1691
               G T LQRMG+GLFISI+   +AAV+E+VRL + + + L +    VP+SVFWQ+PQYFI
Sbjct  421   GKGFTELQRMGIGLFISIVGGAAAAVVEIVRLHLAREYGLVESGAAVPMSVFWQIPQYFI  480

Query  1692  IGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKP  1871
             +G AEVF FIGQLEFFYDQ+PD+MRSLCSAL+L T A+GNYLSS ++T+V  +TTR GK 
Sbjct  481   LGAAEVFFFIGQLEFFYDQSPDAMRSLCSALALLTTALGNYLSSLILTVVTYLTTRGGKE  540

Query  1872  GWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GW+++NLN GHLDYFFWLLA LS++N+ ++V  +  Y  KK+
Sbjct  541   GWISDNLNKGHLDYFFWLLAGLSLLNMAIYVFSSVKYKQKKS  582



>ref|XP_010424976.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Camelina sativa]
Length=584

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/566 (61%), Positives = 427/566 (75%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  78    HQGNVSAATNVTTWQGTCYLTPLIGAILADAYWGRYWTIACFSGIYFIGMSALTLSASVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VKVP D +LL+ET    S I GSRK+ HTN+ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKSSAIAGSRKIEHTNDSKYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  +E K G FS  WRLCTVTQVEELK +IR+ PIW +GIIFS VY QMST FV Q   
Sbjct  318   VISEEELKSGDFSNSWRLCTVTQVEELKILIRMFPIWVSGIIFSAVYAQMSTMFVQQGRA  377

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP AR+FTG   G T +QRMG+GLF+
Sbjct  378   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPFARRFTGVDKGFTEIQRMGIGLFV  437

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AAV+E++RL M     L +    VPISV WQ+PQYFI+G  EVF FIGQLEFF
Sbjct  438   SVLCMAAAAVVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAGEVFYFIGQLEFF  497

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TT NG+ GW+++NLN GHLDYFF
Sbjct  498   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTMNGQQGWISDNLNSGHLDYFF  557

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ V+   A  Y  KKA
Sbjct  558   WLLAGLSLVNMAVYYFSAARYKQKKA  583



>ref|XP_002875108.1| ATPTR2-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51367.1| ATPTR2-B [Arabidopsis lyrata subsp. lyrata]
Length=584

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/566 (61%), Positives = 428/566 (76%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA VP
Sbjct  78    HQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSAAVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VK+P D  LL+ET    S I GSRK+ HT++ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKLPEDPMLLYETQDKNSAIAGSRKIEHTDDCKYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  +E K G +S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  318   VISEEESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  377

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR I+P+AR+FTG   G T +QRMG+GLF+
Sbjct  378   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIIPLARRFTGVDKGFTEIQRMGIGLFV  437

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AA++E++RL M     L +    VPISV WQ+PQYFI+G AEVF FIGQLEFF
Sbjct  438   SVLCMAAAAIVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFF  497

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSALSL T A+GNYLSS ++T+V   TTRNG+ GW+++NLN GHLDYFF
Sbjct  498   YDQSPDAMRSLCSALSLLTTALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFF  557

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ V+   A  Y  KKA
Sbjct  558   WLLAGLSLVNMAVYFFSAARYKQKKA  583



>gb|EMT00809.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=612

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/568 (62%), Positives = 433/568 (76%), Gaps = 6/568 (1%)
 Frame = +3

Query  324   VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTI  503
             +YT+DGT+D +   A K+ TG W+ACP+IL NEC ERLAYYGMS+NL  +    +  +  
Sbjct  12    IYTQDGTVDIKGNRAVKSNTGNWRACPYILANECCERLAYYGMSANLGNFMLDNMGMNNT  71

Query  504   SASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPT  683
             +A+ +++NW GTCY   L+GAFLADAYLGR+WTIA+F  IY+IG+ L+T++A+V  + PT
Sbjct  72    TAANSVTNWGGTCYATTLIGAFLADAYLGRFWTIASFVTIYIIGLGLLTVAASVKALVPT  131

Query  684   CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
             C A   C  T   T   F+ LYLVALGTGGIKPCVSS+GADQFD+ D+ ER+ KSSFFNW
Sbjct  132   CAAKGVCDPTAGQTAAVFVGLYLVALGTGGIKPCVSSFGADQFDENDDGERRSKSSFFNW  191

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FY SINIGALVASS++V++Q+   WGWGFG+PAV MA+AV  FF GT LYR+Q+PGGSP 
Sbjct  192   FYLSINIGALVASSVMVYVQEHYGWGWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSPL  251

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-VESD  1220
             TR+ QV+VA+    K+ VP D S L+ET   ES I+GSRKL HT + RF DKAAV  ++D
Sbjct  252   TRIAQVLVAA--TYKLSVPDDGSALYETMDKESGIKGSRKLEHTEQFRFLDKAAVETQAD  309

Query  1221  EYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
             +      SPWRLCTVTQVEELKS++RLLPIWA+GI+F+ VYGQMST FV Q   ++  +G
Sbjct  310   KSSVSPASPWRLCTVTQVEELKSVVRLLPIWASGIVFAAVYGQMSTMFVFQGNTLDKRMG  369

Query  1401  T-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
               F IP ASLSVFDTLSVI WVP+YDRL+VP+ R FTGH  G T LQRMGVGL +SI +M
Sbjct  370   AHFSIPSASLSVFDTLSVIAWVPVYDRLLVPVVRSFTGHPRGFTQLQRMGVGLVVSIFSM  429

Query  1578  VSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             V+A VLE+VRL  V RH LY   + VPIS+FWQVPQYFIIG AEVF F+GQL+FFYDQAP
Sbjct  430   VAAGVLELVRLRTVARHGLYGEDDIVPISIFWQVPQYFIIGAAEVFVFVGQLDFFYDQAP  489

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWL-ANNLNYGHLDYFFWLLA  1931
             D+MRS+C+ALSLT  A+G Y+S+ LVT+VA +TTR GK GW+ A NLN GHLDYFFWL+ 
Sbjct  490   DAMRSMCTALSLTAIALGGYVSTLLVTVVAKVTTRGGKEGWIPAKNLNVGHLDYFFWLMT  549

Query  1932  VLSVMNLGVFVVVAKMYTYKKAINKVSD  2015
             VLSV+N  V++ +A  YTYKK      D
Sbjct  550   VLSVVNFAVYLPIANWYTYKKTAGAGDD  577



>ref|XP_004252286.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like isoform X1 [Solanum 
lycopersicum]
Length=585

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/565 (60%), Positives = 437/565 (77%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E+  +YT+DG++D    P  K++TG W+ACPFILGNEC ERLA+YG+S NL+ Y   +L+
Sbjct  20    EDSGMYTRDGSVDINGNPVLKSETGNWRACPFILGNECCERLAFYGISVNLVTYLTKKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+MPL+GA LADAY GRY TIATFSIIY +GM  +TLSA++  
Sbjct  80    EGNVSAARNVTTWQGTCYLMPLIGAVLADAYWGRYRTIATFSIIYFVGMCTLTLSASILA  139

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     + T     + F  LYL+A+GTGGIKPCVS++GADQFDDTD KER  K 
Sbjct  140   FKPPECVGSVCPSATPAQYAIFFSGLYLIAVGTGGIKPCVSAFGADQFDDTDPKERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++S+LIVWIQ+   WG GFG+PA+ M++A+  FF GT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSTLIVWIQENDGWGLGFGIPALFMSIAIASFFLGTPLYRFQKP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR++QV+VA+  KR + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  260   GGSPLTRMYQVLVAAFHKRNLSVPDDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E   G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS+VY QM+T FV Q   M
Sbjct  320   VSDTECIAGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSSVYAQMATLFVEQGTVM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F+IP ASLS+FD +SVI+WVP+YDR++VP+AR FTG++ G + LQR+G+GLF+S
Sbjct  380   DTAIGSFRIPPASLSLFDAVSVIIWVPVYDRILVPIARSFTGNERGFSKLQRIGIGLFLS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E  RL + +  +L D    VP+S+FWQ+PQYFI+G AE+FTFIGQLEFFY
Sbjct  440   VLCMSAAAIVEFKRLQLARDLHLVDEAVAVPLSIFWQIPQYFILGAAEIFTFIGQLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  ITT+ GKPGW+ NNLN GHLDYFFW
Sbjct  500   DQSPDAMRSLCSALSLLTTAMGNYLSSFILTVVTSITTQGGKPGWIPNNLNSGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS  N  V+   AKMY  +K+
Sbjct  560   LLAALSFCNFLVYFFCAKMYKSEKS  584



>ref|XP_003568460.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Brachypodium distachyon]
 ref|XP_010230444.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Brachypodium distachyon]
Length=595

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/582 (60%), Positives = 440/582 (76%), Gaps = 9/582 (2%)
 Frame = +3

Query  321   DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  500
             ++YT+DGT+D +  PA K  TG W+ACP+IL NEC ERLAYYGMS+NL+ + + RL    
Sbjct  8     EMYTQDGTVDLKGNPALKENTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRLGMEN  67

Query  501   ISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP  680
               A+ +++NWSGTCYI PL+GAFLADAYLGR+WTIA+F IIY++G+ L+T++ +V G+ P
Sbjct  68    ALAANSVTNWSGTCYITPLIGAFLADAYLGRFWTIASFMIIYILGLGLLTMATSVHGLVP  127

Query  681   TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  860
             TC     C+ T   T   F+ALYL+ALGTGGIKPCVSS+GADQFD+ D  ER+ KSSFFN
Sbjct  128   TCTGG-TCSPTSGQTAAVFVALYLIALGTGGIKPCVSSFGADQFDEHDALERRSKSSFFN  186

Query  861   WFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSP  1040
             WFYFSINIGALVASS++V++Q  V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP
Sbjct  187   WFYFSINIGALVASSVLVYVQTHVGWSWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSP  246

Query  1041  FTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV----  1208
              TR+ QV+VA+ RK  + +P D S LHET+  ES I+GSRKL HT +  F D+AA+    
Sbjct  247   LTRVAQVLVAAARKWSLPLPEDPSALHETADKESGIEGSRKLEHTPQFAFLDRAAIETDS  306

Query  1209  --VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
                 +      + S WRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQM T FV Q   
Sbjct  307   DKKSASSSPAPASSSWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMGTLFVLQGNT  366

Query  1383  MNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
             ++  +G  FKIP ASLS+FDTLSVI WVP+YD+L+VP+AR  TG   G T LQRMG+GL 
Sbjct  367   LDASMGPHFKIPSASLSIFDTLSVIAWVPVYDKLLVPLARSVTGKPRGFTQLQRMGIGLV  426

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             ISI AM++A +LE+VRL  +  H LY   + +PIS+FWQVPQYF+IG AEVFTF+GQLEF
Sbjct  427   ISIFAMLAAGILELVRLRSIAAHGLYGKKDIIPISIFWQVPQYFVIGAAEVFTFVGQLEF  486

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRS+CSAL+LTT A+G+YLS+ LVT+V+ +TT+ G  GW+ +NLN GHLDYF
Sbjct  487   FYDQAPDAMRSMCSALALTTVALGSYLSTLLVTVVSKVTTKGGNVGWIPDNLNVGHLDYF  546

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAENGS  2042
             FWLLA LSV N  V++V+A  YTYKK         E+   G 
Sbjct  547   FWLLAALSVANFAVYLVIASWYTYKKTAEDGPAPAEDKLKGE  588



>gb|KHG27963.1| Peptide transporter PTR2 -like protein [Gossypium arboreum]
Length=584

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/565 (61%), Positives = 429/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT DG++D+   P  K  TG W+ACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ESSGLYTGDGSVDFNGNPILKQNTGNWRACPFILGNECCERLAYYGIATNLVSYLTKKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY  GM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFFGMCTLTLSASIPA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGSICPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPNERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSL+VWIQ    WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQDNAGWGLGFGIPALFMGLAIGSFFSGTALYRFQRP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+FQV+VA+  KR +KVP D +LL+ET    S I+GSRKL H+ EL+  DKAA+
Sbjct  259   GGSPITRMFQVLVAAFHKRSLKVPEDSTLLYETGDKHSAIEGSRKLEHSEELKCLDKAAI  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G FS PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  319   VTDVETKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMMM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYDR+IVP+ARKFT  + G + LQRMG+GLFIS
Sbjct  379   DTKIGSFTIPPASLSTFDVISVIFWVPIYDRIIVPIARKFTRKERGFSELQRMGIGLFIS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E  RL + K  +L D    VPIS+ WQ+PQYF++G AEV TFIGQLEFFY
Sbjct  439   VLCMSAAAVVETRRLHLAKVLDLVDKQVAVPISILWQIPQYFLLGAAEVCTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT++G+ GW+++NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLLTTSLGNYLSSFILTLVTYFTTKDGQIGWISDNLNEGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+ V+ + A  Y  KKA
Sbjct  559   LLAGLSFLNMLVYTLCASRYKQKKA  583



>ref|XP_006395818.1| hypothetical protein EUTSA_v10003893mg [Eutrema salsugineum]
 gb|ACQ90598.1| putative nitrate transporter [Eutrema halophilum]
 gb|ESQ33104.1| hypothetical protein EUTSA_v10003893mg [Eutrema salsugineum]
Length=583

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/582 (60%), Positives = 436/582 (75%), Gaps = 5/582 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM--EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLA  440
             +G+I  +  +  E +  +E  +Y +DG++D    P  K KTG WKACPFILGNEC ERLA
Sbjct  1     MGSIEEERPLIEEGLISQEAKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLA  60

Query  441   YYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSI  620
             YYG++ NL+ Y  T+L+Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS 
Sbjct  61    YYGIAGNLITYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSG  120

Query  621   IYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSY  797
             IY IGM+ +TLSA+VP + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+
Sbjct  121   IYFIGMSALTLSASVPALKPAECIGDFCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSF  180

Query  798   GADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamam  977
             GADQFDDTD  ER  K+SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +
Sbjct  181   GADQFDDTDSGERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGL  240

Query  978   avTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGS  1157
             A+  FF GT LYR+QKPGGSP TR+ QV+VAS RK  +KVP D +LL+ET    S I GS
Sbjct  241   AIASFFFGTPLYRFQKPGGSPITRISQVVVASFRKSSLKVPEDATLLYETQDKNSAIAGS  300

Query  1158  RKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1334
             RK+ HTN+ ++ DKAAV+  +E K G +S  WRLCTVTQVEELK +IR+ PIWA+GIIFS
Sbjct  301   RKIVHTNDCQYLDKAAVISEEESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIFS  360

Query  1335  TVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGH  1514
              VY QMST FV Q   MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG 
Sbjct  361   AVYAQMSTMFVQQGRAMNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGV  420

Query  1515  KSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFI  1691
               G T +QRMG+GLF+S+L+M +AA +E++RL +     L +    VPISV WQ+PQYFI
Sbjct  421   DKGFTEIQRMGIGLFVSVLSMAAAATVEIIRLHVANDLGLVESGAPVPISVLWQIPQYFI  480

Query  1692  IGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKP  1871
             +G AEVF FIGQLEFFYDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+VA  TT NG+ 
Sbjct  481   LGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVAYFTTMNGQQ  540

Query  1872  GWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GW+++NLN GHLDYFFWLLA LS++N+ V+   A  Y  KKA
Sbjct  541   GWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSAAKYKQKKA  582



>ref|XP_006346628.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum]
Length=585

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/564 (61%), Positives = 430/564 (76%), Gaps = 3/564 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E+  +YT+DG++D    P  K++TG W+ACPFILGNEC ERLA+YG+S NL+ Y   +L+
Sbjct  20    EDSGLYTRDGSVDINGNPVLKSETGNWRACPFILGNECCERLAFYGISVNLVTYLTKKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+MPL+GA LADAY GRY TIATFSIIY +GM  +TLSA+VP 
Sbjct  80    EGNVSAARNVTTWQGTCYLMPLIGAVLADAYWGRYRTIATFSIIYFVGMCTLTLSASVPD  139

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     + T     + F  LYL+ALGTGGIKPCVS++GADQFDDTD KER  K 
Sbjct  140   FKPPECVGSVCPSATPAQYAIFFSGLYLIALGTGGIKPCVSAFGADQFDDTDPKERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++S+LIVWIQ+   WG GFG+PAV M++A+  FF GT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSTLIVWIQENAGWGLGFGIPAVFMSIAIASFFFGTPLYRFQKP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  260   GGSPLTRMCQVLVAAFHKWNLSVPHDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G +S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM+T FV Q   M
Sbjct  320   VSDTECKTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMATLFVEQGTVM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +GTF+IP ASLS+FD +SVI+WVPIYDR++VP+AR FTG + G + LQR+G+GL +S
Sbjct  380   DTAIGTFRIPPASLSLFDAVSVIIWVPIYDRILVPIARSFTGKERGFSKLQRIGIGLLLS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +  M +AA++E  RL + +   L D    VP+S+FWQ+PQYFI+G AE+FTFIG LEFFY
Sbjct  440   VFCMSAAAIVEFKRLQLARDLGLVDEAVAVPLSIFWQIPQYFILGAAEIFTFIGHLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  ITT  GKPGW+ NNLN GHLDYFFW
Sbjct  500   DQSPDAMRSLCSALSLLTTAMGNYLSSFILTVVTSITTIGGKPGWIPNNLNSGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKK  1994
             LLA LS  N  ++V  AKMY  KK
Sbjct  560   LLAALSFCNFVIYVFCAKMYKSKK  583



>ref|XP_006448044.1| hypothetical protein CICLE_v10014643mg [Citrus clementina]
 gb|ESR61284.1| hypothetical protein CICLE_v10014643mg [Citrus clementina]
Length=607

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 428/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +   +YT DG++D   +P  K  TG W+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  42    KSSGLYTGDGSVDISGKPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVSYLTHKLH  101

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA++P 
Sbjct  102   EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  161

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  162   LKPAECVGALCPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSNERVKKG  221

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ    WG GFG+PA+ M  A+  FFSGT LYR+Q+P
Sbjct  222   SFFNWFYFSINIGALISSSLIVWIQDNAGWGLGFGIPALFMGFAIASFFSGTSLYRFQRP  281

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  ++VP D +LL+ET    S I+GSRK+ H++ELR  DKAAV
Sbjct  282   GGSPITRMCQVLVASFRKWNLEVPNDSTLLYETQDKASAIEGSRKIEHSDELRCLDKAAV  341

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G FS PW LCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  342   VSDAEIKSGDFSNPWILCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTLFVEQGMVM  401

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYD++IVP+ARKFTG + G + LQRMG+GLF+S
Sbjct  402   DTSIGSFTIPPASLSSFDVISVIFWVPIYDKIIVPIARKFTGKERGFSELQRMGIGLFLS  461

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + +   L D    VPIS+FWQ+PQYF++G AEV TFIGQLEFFY
Sbjct  462   VLCMSAAAVVEINRLRLARELELVDQNVSVPISIFWQIPQYFLLGAAEVCTFIGQLEFFY  521

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V   TT  GK GW+ +NLN GHLDYFFW
Sbjct  522   DQSPDAMRSLCSALSLLTTALGNYLSSFILTVVTYFTTAGGKTGWIPDNLNKGHLDYFFW  581

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS+ N+ ++VV AK Y  KKA
Sbjct  582   LLAGLSIFNMLLYVVCAKKYKQKKA  606



>emb|CAA54634.1| oligopeptide transporter 1-1 [Arabidopsis thaliana]
 prf||2014244A His transporter
Length=586

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/567 (61%), Positives = 430/567 (76%), Gaps = 4/567 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEVKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  78    HQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VKVP D +LL+ET    S I GSRK+ HT++ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKVPEDATLLYETQDKNSAIAGSRKIEHTDDCQYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWR-LCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             V+  +E K G +S  W  LCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q  
Sbjct  318   VISEEESKSGDYSNSWEDLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGR  377

Query  1380  GMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
              MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP+ARKFTG   G T +QRMG+GLF
Sbjct  378   AMNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARKFTGVDKGFTEIQRMGIGLF  437

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             +S+L M +AA++E++RL M     L +    VPISV WQ+PQYFI+G AEVF FIGQLEF
Sbjct  438   VSVLCMAAAAIVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEF  497

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG+ GW+++NLN GHLDYF
Sbjct  498   FYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYF  557

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             FWLLA LS++N+ V+   A  Y  KKA
Sbjct  558   FWLLAGLSLVNMAVYFFSAARYKQKKA  584



>gb|ABR32183.1| peptide transporter [Hakea actites]
Length=583

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/573 (60%), Positives = 430/573 (75%), Gaps = 5/573 (1%)
 Frame = +3

Query  294   IRSEAMEEDDV--YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLM  467
             +  E ++ D +  YT DG++D   +P  K  TG W+ACPFILG EC ERLAYYG+++NL+
Sbjct  10    VEDEPVKNDGIGLYTGDGSVDIDGKPVLKENTGKWRACPFILGTECCERLAYYGIATNLV  69

Query  468   IYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLM  647
              Y  ++L++   SA++N++ WSGTCY+ PL+GA LAD+Y GRYWTIA FSIIY IGM  +
Sbjct  70    TYLTSKLHEGNASAARNVTTWSGTCYLAPLIGAVLADSYWGRYWTIAVFSIIYFIGMGTL  129

Query  648   TLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  824
             TLSA+V    P+ C+       T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVAAFKPSPCVGSVCPAATPAQYAVFFCGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  825   EKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGT  1004
               ER  K SFFNWFYFSINIGAL++SS +VWIQ    WG GFG+P + M +A+  FFSGT
Sbjct  190   PVERVQKGSFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPTLFMGVAIISFFSGT  249

Query  1005  RLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNEL  1184
              LYR+QKPGGSP  R+ QV VAS RK  + VP D SLL E     S I+GSRKL H++EL
Sbjct  250   PLYRFQKPGGSPLMRMCQVFVASFRKWNLDVPQDSSLLFELPDKTSAIEGSRKLEHSDEL  309

Query  1185  RFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQ  1361
             R  DKAAVV   + ++G  + PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST 
Sbjct  310   RCLDKAAVVSDLDVQQGDLTNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTM  369

Query  1362  FVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQR  1541
             FV Q + ++T +G+F IP ASLS FD LSVIVWVP+YDRL+VP+ARKFTG + G + LQR
Sbjct  370   FVEQGMVLDTTIGSFTIPPASLSTFDVLSVIVWVPMYDRLLVPLARKFTGKERGFSELQR  429

Query  1542  MGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTF  1718
             MG+GLFISIL+M +AA++E+ RL + K   L D    VP+S+ WQ+PQYF++G +E+FTF
Sbjct  430   MGIGLFISILSMTAAAIVEIRRLQIAKSLGLVDQNVAVPMSILWQIPQYFLVGASEIFTF  489

Query  1719  IGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNY  1898
             IGQLEFFYDQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  ITTR GKPGW+ +NLN 
Sbjct  490   IGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTMVTTITTRGGKPGWIPDNLNE  549

Query  1899  GHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GHLDYFFWLLA LS +NL ++V  A  Y  KKA
Sbjct  550   GHLDYFFWLLAGLSFLNLVIYVFCAARYKCKKA  582



>ref|XP_004297798.1| PREDICTED: peptide transporter PTR2-like [Fragaria vesca subsp. 
vesca]
Length=584

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/565 (61%), Positives = 430/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT DG++D    P  K  TG W+ACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  19    EGNGLYTGDGSVDIEGNPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVTYLTSKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  ++A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSAT+P 
Sbjct  79    EGNVAAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAVFSTIYFLGMCTLTLSATLPA  138

Query  672   -ISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
              I P C+       +     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   LIPPECVGSSCPAASTSQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDARERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS IV+IQ    WG GFG+PA+ MA+A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSFIVYIQDNAGWGLGFGIPALFMAVAIASFFSGTPLYRFQRP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  + VP D SLL+ET    S I+GSRKL H++EL+  DKAAV
Sbjct  259   GGSPLTRMCQVLVASFRKWNLNVPEDSSLLYETEDKVSAIEGSRKLEHSDELKCLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G FS PWRLCTVTQVEE K +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  319   ISEAEVKTGEFSNPWRLCTVTQVEEFKILIRMFPIWATGIVFSAVYAQMSTMFVEQGTMM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYDR IVP+AR+FTG + G + LQRMG+GLF+S
Sbjct  379   DTSIGSFTIPPASLSSFDVISVIFWVPIYDRFIVPIARRFTGKERGFSELQRMGIGLFLS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL +    +L D    VPIS+FWQVPQYF++G AE+FTFIGQLEFFY
Sbjct  439   VLCMSAAAVVEIYRLHIANELDLVDKEVAVPISIFWQVPQYFLLGAAEIFTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  +TT+ GK GW+ +NLN GHLDY+FW
Sbjct  499   DQSPDAMRSLCSALSLLTTALGNYLSSFILTVVTYLTTQGGKSGWIPDNLNSGHLDYYFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+ V++V A  Y +KKA
Sbjct  559   LLAGLSFINMVVYMVCAGKYKHKKA  583



>emb|CDY03084.1| BnaC07g21430D [Brassica napus]
Length=585

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/582 (60%), Positives = 436/582 (75%), Gaps = 5/582 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM--EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLA  440
             +G+I  +  +  E +  +E  +Y +DG++D    P  K KTG WKACPFILGNEC ERLA
Sbjct  1     MGSIEEESPLIEEGLISQEPKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLA  60

Query  441   YYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSI  620
             YYG++ NL+ Y  T+L+Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS 
Sbjct  61    YYGIAGNLITYLTTKLHQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSG  120

Query  621   IYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSY  797
             IY IGM+ +TLSA+VP + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+
Sbjct  121   IYFIGMSALTLSASVPALKPAECIGGFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSF  180

Query  798   GADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamam  977
             GADQFDDTD +ER  K+SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +
Sbjct  181   GADQFDDTDSRERVKKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGL  240

Query  978   avTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGS  1157
             A+  FF GT LYR+QKPGGSP TR+ QV+VAS RK  +KVP D  LL+ET    S I GS
Sbjct  241   AIASFFFGTPLYRFQKPGGSPITRISQVVVASFRKSTLKVPEDAMLLYETQDKNSAIAGS  300

Query  1158  RKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1334
             RK+ HT++ ++ DKAAV+  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS
Sbjct  301   RKIEHTDDCQYLDKAAVISEEESKAGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFS  360

Query  1335  TVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGH  1514
              VY QMST FV Q   M+  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG 
Sbjct  361   AVYAQMSTMFVQQGRAMDCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGV  420

Query  1515  KSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFI  1691
               G T +QRMGVGLF+S+L M +AAV+E++RL +     L +    VPISV WQ+PQYFI
Sbjct  421   DKGFTEIQRMGVGLFVSVLCMAAAAVVEIIRLHLANELGLVESGAPVPISVLWQIPQYFI  480

Query  1692  IGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKP  1871
             +G AEVF FIGQLEFFYDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG  
Sbjct  481   LGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGGE  540

Query  1872  GWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GW+++NLN GHLDY+FWLLA LS++N+ V+   A  Y  KKA
Sbjct  541   GWISDNLNSGHLDYYFWLLAGLSLVNMAVYFFSAARYKQKKA  582



>gb|EMS46611.1| Peptide transporter PTR5 [Triticum urartu]
Length=631

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/577 (61%), Positives = 436/577 (76%), Gaps = 8/577 (1%)
 Frame = +3

Query  324   VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTI  503
             +YT+DGT+D +  PA K+ TG W+ACP+IL NEC ERLAYYGMS+NL  +    +  +  
Sbjct  12    IYTQDGTVDIKGNPAVKSSTGNWRACPYILANECCERLAYYGMSANLSNFMLDNMGMNNS  71

Query  504   SASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPT  683
             +A+ +++NW GTCY   L+GAFLADAYLGR+ TIA+F  IY+IG+ L+T++A+V  + PT
Sbjct  72    AAANSVTNWGGTCYATTLIGAFLADAYLGRFCTIASFVTIYIIGLGLLTVAASVKTLVPT  131

Query  684   CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
             C A   C  T   T   F+ LYLVALGTGGIKPCVSS+GADQFD+ D+ ER+ KSSFFNW
Sbjct  132   CAAKGVCDPTAGQTAAMFVGLYLVALGTGGIKPCVSSFGADQFDENDDGERRSKSSFFNW  191

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FY SINIGALVASS++V++Q+   W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP 
Sbjct  192   FYLSINIGALVASSVMVYVQEHYGWSWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSPL  251

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV-VESD  1220
             TR+ QV+VA+    K+ VP+D S L+ET   ES I GSRKL HT + RF DKAAV  ++D
Sbjct  252   TRIAQVLVAA--TYKLSVPVDGSALYETMDKESGIMGSRKLEHTEQFRFLDKAAVDTQAD  309

Query  1221  EYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
             +      SPWRLCTVTQVEELKS++RLLPIWA+GI+F+ VYGQMST FV Q   ++  +G
Sbjct  310   KSSASPASPWRLCTVTQVEELKSVVRLLPIWASGIVFAAVYGQMSTMFVFQGNTLDKRMG  369

Query  1401  T-FKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
               F IP ASLSVFDTLSVI WVP+YDRL+VP  R FTGH  G T LQRMGVGL +SI +M
Sbjct  370   AHFSIPSASLSVFDTLSVIAWVPVYDRLLVPAVRSFTGHPRGFTQLQRMGVGLVVSIFSM  429

Query  1578  VSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
             V+A VLE+VRL  V RH LY   + VPIS+FWQVPQYFIIG AEVF F+GQL+FFYDQAP
Sbjct  430   VAAGVLELVRLRTVARHGLYGEKDIVPISIFWQVPQYFIIGAAEVFVFVGQLDFFYDQAP  489

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWL-ANNLNYGHLDYFFWLLA  1931
             D+MRS+C+ALSLT  A+G Y+S+ LVT+VA +TTR GK GW+ A NLN GHLDYFFWL+ 
Sbjct  490   DAMRSMCTALSLTAIALGGYVSTLLVTVVAKVTTRGGKEGWIPAKNLNVGHLDYFFWLMT  549

Query  1932  VLSVMNLGVFVVVAKMYTYKK--AINKVSDLVEEAEN  2036
             VLSV+N  +++ +A  YTYKK        D+ E A+N
Sbjct  550   VLSVLNFAIYLPIANWYTYKKTAGAGDDPDVNEVADN  586



>ref|XP_006492274.1| PREDICTED: peptide transporter PTR2-like [Citrus sinensis]
Length=584

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 428/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +   +YT DG++D   +P  K  TG W+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  19    KSSGLYTGDGSVDISGKPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVSYLTHKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGALCPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSNERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ    WG GFG+PA+ M  A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQDNAGWGLGFGIPALFMGFAIASFFSGTSLYRFQRP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  ++VP D +LL+ET    S I+GSRK+ H++ELR  DKAAV
Sbjct  259   GGSPITRMCQVLVASFRKWNLEVPNDSTLLYETQDKASAIEGSRKIEHSDELRCLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G FS PW LCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  319   VSDAEIKSGDFSNPWILCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTLFVEQGMVM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYD++IVP+ARKFTG + G + LQRMG+GLF+S
Sbjct  379   DTSIGSFTIPPASLSSFDVISVIFWVPIYDKIIVPIARKFTGKERGFSELQRMGIGLFLS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + +   L D    VPIS+FWQ+PQYF++G AEV TFIGQLEFFY
Sbjct  439   VLCMSAAAVVEINRLRLARELELVDQNVSVPISIFWQIPQYFLLGAAEVCTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V   TT  GK GW+ +NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLLTTALGNYLSSFILTVVTYFTTAGGKTGWIPDNLNKGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS+ N+ ++VV AK Y  KKA
Sbjct  559   LLAGLSIFNMLLYVVCAKKYKQKKA  583



>ref|XP_009351619.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Pyrus x bretschneideri]
Length=585

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/565 (61%), Positives = 429/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E D  YT DG++D +  P  K  TG W+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  20    EGDGRYTGDGSVDIKGNPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVTYLTHKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FSIIY IGM  +TLSA VP 
Sbjct  80    EGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAVFSIIYFIGMGTLTLSAAVPA  139

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P       C + +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD+ ER  K 
Sbjct  140   LKPPQCVDSVCPSASPAQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDKMERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVW+Q    WG GFG+P + M +A+  FFSGT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSSLIVWVQDNAGWGLGFGIPTLFMGIAIFSFFSGTPLYRFQKP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+ RK  + VP D SLL+ET    S I+GSRKL H++EL   DKAAV
Sbjct  260   GGSPVTRMCQVLVATFRKWNLDVPKDSSLLYETQDKVSAIKGSRKLEHSDELTCLDKAAV  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G FS PWR+CTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  320   ISETETKTGDFSNPWRVCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGTMM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G F IP ASLS FD +SVI WVP+YDR IVP+AR+FTG + G + LQRMG+GLF+S
Sbjct  380   DTSIGAFTIPPASLSTFDVISVIFWVPVYDRFIVPIARRFTGKERGFSELQRMGIGLFLS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + K  +L D    VP+++ WQ+PQYF++G AE+FTFIGQLEFFY
Sbjct  440   VLCMSAAAVVEINRLNLAKELDLVDKEVAVPMTILWQIPQYFLLGAAEIFTFIGQLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSS ++TIV   +T++GK GW+ +NLN GHLDYFFW
Sbjct  500   DQSPDAMRSLCSALSLLTTSLGNYLSSLILTIVTYFSTKDGKAGWIPDNLNGGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS++N+ V+VV AK Y  KKA
Sbjct  560   LLAGLSLLNMLVYVVCAKRYKKKKA  584



>gb|AAP44102.1| peptide transporter 1 [Vicia faba]
Length=584

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/584 (60%), Positives = 440/584 (75%), Gaps = 8/584 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM---EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERL  437
             +G++  D     EA+   EE  +YT DG++D++ RP  K  TG WKACPFILGNEC ERL
Sbjct  1     MGSVEDDSSRLEEALIQDEESKLYTGDGSVDFKGRPVLKKNTGNWKACPFILGNECCERL  60

Query  438   AYYGMSSNLM-IYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATF  614
             AYYG+++NL+      +L++  +SA++N++ W GTCY+ PL+GA LAD+Y GRYWTIA F
Sbjct  61    AYYGIATNLVKPILLAKLHEGNVSAARNVTTWQGTCYLAPLIGAVLADSYWGRYWTIAIF  120

Query  615   SIIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVS  791
             S+IY IGM  +TLSA++P + P  C+       T     V FI LYL+ALGTGGIKPCVS
Sbjct  121   SMIYFIGMGTLTLSASIPALKPAECLGAVCPPATPAQYAVFFIGLYLIALGTGGIKPCVS  180

Query  792   SYGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavam  971
             S+GADQFDDTD +ER  K SFFNWFYFSINIGAL++SS IVWIQ+   WG GFG+PA+ M
Sbjct  181   SFGADQFDDTDSRERVKKGSFFNWFYFSINIGALISSSFIVWIQENAGWGLGFGIPALFM  240

Query  972   amavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQ  1151
              +A+  FF GT LYR+QKPGGSP TR+ QV+ AS RKR + VP D SLL+ET    S I+
Sbjct  241   GLAIGSFFLGTPLYRFQKPGGSPLTRMCQVVAASFRKRNLTVPEDSSLLYETPDKSSAIE  300

Query  1152  GSRKLSHTNELRFFDKAAVVESDEYKKGSFSP-WRLCTVTQVEELKSIIRLLPIWATGII  1328
             GSRKL H++ELR  D+AAV+  DE K+G +S  WRLCTVTQVEELK +IR+ P+WATGI+
Sbjct  301   GSRKLQHSDELRCLDRAAVISDDERKRGDYSNLWRLCTVTQVEELKILIRMFPVWATGIV  360

Query  1329  FSTVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFT  1508
             FS VY QMST FV Q   M+T VG+FKIP ASLS FD +SVI WVP+YDR IVP+ARKFT
Sbjct  361   FSAVYAQMSTMFVEQGTMMDTSVGSFKIPAASLSTFDVISVIFWVPVYDRFIVPIARKFT  420

Query  1509  GHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQY  1685
             G + G + LQRMG+GLFIS+L M +AA++E+ RL + K  +L D    VP+++F Q+PQY
Sbjct  421   GKERGFSELQRMGIGLFISVLCMSAAAIVEIKRLQLAKELDLVDKAVPVPLTIFLQIPQY  480

Query  1686  FIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNG  1865
             F++G AEVFTF+GQLEFFYDQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TTR G
Sbjct  481   FLLGAAEVFTFVGQLEFFYDQSPDAMRSLCSALSLLTTSLGNYLSSFILTVVLYFTTRGG  540

Query  1866  KPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
              PGW+ +NLN GHLDYF   LA LS +N+ +++V AK Y  KKA
Sbjct  541   NPGWIPDNLNKGHLDYFSG-LAGLSFLNMFLYIVAAKRYKSKKA  583



>ref|XP_010043898.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Eucalyptus grandis]
 gb|KCW85918.1| hypothetical protein EUGRSUZ_B02629 [Eucalyptus grandis]
Length=584

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/565 (61%), Positives = 432/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             + + +YT DG++D + +P  K+ TG W+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  19    QSNGLYTGDGSVDVKGKPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTNKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA+ N++ W GTCY+ PL+GA LADA  GRYWTIA FS IY IGM  +TLSATVPG
Sbjct  79    EGNVSAATNVTTWQGTCYLTPLIGAILADACWGRYWTIAAFSTIYFIGMCTLTLSATVPG  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + T     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   LKPAECVDSVCPSATAAQYAVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+S+LIVWIQ+ + WG GFG+PAV M +A+  FFSGT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSTLIVWIQENMGWGLGFGIPAVFMGVAIASFFSGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV++A+  K  V+VP D SLL+ET    S I+GSRK+ H++EL+  DKAAV
Sbjct  259   GGSPITRMCQVLIAAFHKWSVEVPEDSSLLYETQEKNSAIEGSRKIEHSDELKCLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   + K G FS  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  319   VTDADTKSGDFSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGEMM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVP+YDR IVP+ARKFTG + G + LQRMG+GLFIS
Sbjct  379   DTSIGSFTIPAASLSTFDVISVIFWVPVYDRAIVPIARKFTGKERGFSELQRMGIGLFIS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL + +   L D    VP+S+ WQ PQYF++G AE+FTFIGQLEFFY
Sbjct  439   VLCMSAAAIVEIKRLQIARELGLVDEDVAVPMSILWQAPQYFLLGAAEIFTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSS ++TIV  +TT++G+ GW+ +NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLLTTSLGNYLSSLILTIVTYVTTQDGQVGWIPDNLNEGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +NL V++V A  Y  KKA
Sbjct  559   LLAGLSFLNLLVYIVCAMKYKRKKA  583



>gb|KHG06441.1| Peptide transporter PTR2 -like protein [Gossypium arboreum]
Length=584

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/565 (61%), Positives = 428/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT DG++D+   P  K  TG WKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ENSGLYTGDGSVDFNGNPVLKQNTGNWKACPFILGNECCERLAYYGIATNLVSYLTKKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA++P 
Sbjct  79    EGNASAARNVTTWQGTCYVTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + T    +V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   LKPAECVGSICPSATPAQYVVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSLIVWIQ    WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQDNAGWGLGFGIPALFMGLAIGSFFSGTSLYRFQRP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+   R +KVP D SLL+ET    S I+GSRKL H+ EL+  DKAA+
Sbjct  259   GGSPITRMCQVLVAAFHNRNLKVPEDSSLLYETGDNHSAIEGSRKLEHSEELKCLDKAAI  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E K G FS PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  319   VTDAETKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMMM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYD++IVP+ARKFT  + G + LQRMG+GLFIS
Sbjct  379   DTKIGSFTIPPASLSSFDVISVIFWVPIYDKIIVPIARKFTRKERGFSELQRMGIGLFIS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL + K  +L D    VPI++ WQ+PQYF++G AEV TFIGQLEFFY
Sbjct  439   VLCMSAAALVEIKRLQLAKELDLVDKQVAVPINILWQIPQYFLLGAAEVCTFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT+ G+ GW+ +NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALSLLTTSLGNYLSSFILTLVIYFTTKGGQIGWIPDNLNEGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+ ++ + A  Y  KKA
Sbjct  559   LLAGLSFLNMLIYTLCAAKYKQKKA  583



>ref|XP_010937011.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Elaeis guineensis]
Length=587

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/569 (61%), Positives = 428/569 (75%), Gaps = 3/569 (1%)
 Frame = +3

Query  300   SEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             SE    +  YT DG++D    P  KN TG W+ACPFILG EC ERLAYYG+++NL+ Y  
Sbjct  18    SEENRNNGPYTGDGSVDIHGHPVVKNGTGNWRACPFILGTECCERLAYYGIATNLVTYLT  77

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
              +L++  +SA++N++ W GTCYI PL+GA LADAY GRYWTIA FS IY IGM  +TLSA
Sbjct  78    GKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIAVFSTIYFIGMGTLTLSA  137

Query  660   TVPGISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             +VPG  P+      C         + F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER
Sbjct  138   SVPGFRPSSCVKSVCPEANPAQYAIFFLGLYLIALGTGGIKPCVSSFGADQFDDTDSAER  197

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
               K SFFNWFYFS+NIGAL++SS +VW+Q    WG GFG+P + MA+A+  FFSGT LYR
Sbjct  198   VKKGSFFNWFYFSVNIGALISSSFLVWVQDNYGWGLGFGIPTLFMALAIISFFSGTTLYR  257

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
             +QKPGGSP TR+ QV VASLRK K+ VP D SLL+E     S I+GSRKL HT+EL+F D
Sbjct  258   FQKPGGSPITRVCQVAVASLRKWKLDVPYDSSLLYELPEKTSAIEGSRKLEHTDELKFLD  317

Query  1197  KAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             KAA V   + K  SFS PWRLCTVTQVEELK ++R+ PIWAT I+FS VY Q+ST FV Q
Sbjct  318   KAATVSDLDLKTESFSNPWRLCTVTQVEELKILVRMFPIWATTIVFSAVYAQISTMFVEQ  377

Query  1374  AIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              + ++T +G+F IP ASL+ FD +SVIVWVP+YDR++VP+ R+FTG + G + LQRMG+G
Sbjct  378   GMVLDTTIGSFTIPPASLATFDVISVIVWVPVYDRILVPIVRRFTGKERGFSELQRMGIG  437

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNL-YDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             LFISILAM +AA++E+ RL +V+  +L +    VP+S+FWQ+PQYF++G AEVFTFIGQL
Sbjct  438   LFISILAMTAAALVEIKRLDIVRAEHLEHQEVAVPLSIFWQIPQYFLVGAAEVFTFIGQL  497

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQ+PD+MRSLCSALSL T A+GNYLSS ++TIV  ITTR GK GW+ +NLN GHLD
Sbjct  498   EFFYDQSPDAMRSLCSALSLLTTALGNYLSSLILTIVTYITTRGGKTGWIPDNLNEGHLD  557

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             YFFWLLA LS +N  V+   A  Y  KKA
Sbjct  558   YFFWLLAGLSFLNFLVYAFCAIKYKSKKA  586



>ref|XP_006292510.1| hypothetical protein CARUB_v10018740mg, partial [Capsella rubella]
 gb|EOA25408.1| hypothetical protein CARUB_v10018740mg, partial [Capsella rubella]
Length=576

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/554 (61%), Positives = 426/554 (77%), Gaps = 3/554 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D+   P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  18    LQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  77

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  ++A+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  78    HQGNVAAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVP  137

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  138   ALKPAECIGDFCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  197

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  198   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  257

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  VKVP D +LL+ET    S I GSRK+ HT++ ++ DKAA
Sbjct  258   PGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKNSAIAGSRKIEHTDDCKYLDKAA  317

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  DE K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  318   VISEDESKSGDFSNTWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  377

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG   G T +QRMG+GLF+
Sbjct  378   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGVDKGFTEIQRMGIGLFV  437

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AA++E++RL M +   L +  + VPISV WQ+PQYFI+G  EVF FIGQLEFF
Sbjct  438   SVLCMAAAAIVEIIRLHMARDLGLVESGDPVPISVLWQIPQYFILGAGEVFYFIGQLEFF  497

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TT +G+ GW+++NLN GHLDYFF
Sbjct  498   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTMDGQQGWISDNLNSGHLDYFF  557

Query  1920  WLLAVLSVMNLGVF  1961
             WLLA LS++N+ V+
Sbjct  558   WLLAGLSLVNMAVY  571



>ref|XP_009101283.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Brassica rapa]
Length=585

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/582 (59%), Positives = 436/582 (75%), Gaps = 5/582 (1%)
 Frame = +3

Query  267   LGAIVAD*QIRSEAM--EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLA  440
             +G+I  +  +  E +  +E  +Y +DG++D    P  K KTG WKACPFILGNEC ERLA
Sbjct  1     MGSIEEESPLIEEGLISQEPKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLA  60

Query  441   YYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSI  620
             YYG++ NL+ Y  T+L+Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS 
Sbjct  61    YYGIAGNLITYLTTKLHQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSG  120

Query  621   IYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSY  797
             IY IGM+ +TLSA+VP + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+
Sbjct  121   IYFIGMSALTLSASVPALKPAECIGTFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSF  180

Query  798   GADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamam  977
             GADQFDDTD +ER  K+SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +
Sbjct  181   GADQFDDTDSRERVKKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGL  240

Query  978   avTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGS  1157
             A+  FF GT LYR+QKPGGSP TR+ QV+VAS RK  + VP D  LL+ET    S I GS
Sbjct  241   AIASFFFGTPLYRFQKPGGSPITRISQVVVASFRKSTLTVPEDAMLLYETQDKNSAIAGS  300

Query  1158  RKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1334
             RK+ HT++ ++ DKAAV+  +E + G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS
Sbjct  301   RKIEHTDDCQYLDKAAVISEEESRAGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFS  360

Query  1335  TVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGH  1514
              VY QMST FV Q   M+  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG 
Sbjct  361   AVYAQMSTMFVQQGRAMDCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGV  420

Query  1515  KSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFI  1691
               G T +QRMGVGLF+S+L M +AA++E++RL +     L +    VPISV WQ+PQYFI
Sbjct  421   DKGFTEIQRMGVGLFVSVLCMAAAAIVEIIRLHLANELGLVESGAPVPISVLWQIPQYFI  480

Query  1692  IGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKP  1871
             +G AEVF FIGQLEFFYDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG+ 
Sbjct  481   LGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGEQ  540

Query  1872  GWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             GW+++NLN GHLDY+FWLLA LS++N+ V+   A  Y  KKA
Sbjct  541   GWISDNLNSGHLDYYFWLLAGLSLVNMAVYFFSAARYKQKKA  582



>gb|KDP38199.1| hypothetical protein JCGZ_04842 [Jatropha curcas]
Length=586

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/557 (62%), Positives = 428/557 (77%), Gaps = 3/557 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +  ++YT DG++D    PA K  TG W+ACPFILGNEC ERLAYYG+S+NL+ Y   +L+
Sbjct  21    KSKELYTGDGSVDLHGNPALKQNTGNWRACPFILGNECCERLAYYGISTNLVTYLTNKLH  80

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N+S W+GTCYI PL+GA LADA  GRYWTIA FS IY IGM  +TLSA++P 
Sbjct  81    EGNVSAARNVSTWAGTCYITPLIGAVLADACWGRYWTIAAFSTIYFIGMCTLTLSASIPA  140

Query  672   ISPTCIAHEKCT-VTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P   A   C   T     V F  LYL+ALGTGGI+PCV+S+GADQFDDTD KER  K 
Sbjct  141   LKPAECAGSLCPPATPAQYAVFFFCLYLIALGTGGIRPCVASFGADQFDDTDPKERVKKG  200

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+SSL+V+IQ    WG GFG+PAV MA+A+  FFSGT LYR+Q+P
Sbjct  201   SFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPAVFMAIAIGSFFSGTPLYRFQRP  260

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS  KR ++VP D SLL+ET    S I+GSRKL H+NEL+  DKAAV
Sbjct  261   GGSPITRMCQVLVASFHKRNMEVPQDSSLLYETPEGISAIEGSRKLEHSNELKCLDKAAV  320

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             + + E K G FS PWRLCTVTQVEELK + R+ PIWATGI+FS V+ QMST FV Q + M
Sbjct  321   ISNVEAKSGDFSNPWRLCTVTQVEELKILERMFPIWATGIVFSAVHAQMSTMFVEQGMLM  380

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T VG+F IP ASLS FD +SVI WVPIYDR IVP+ARKFTG + G + LQRMG+GLFIS
Sbjct  381   DTKVGSFAIPPASLSTFDVVSVICWVPIYDRFIVPIARKFTGKERGFSELQRMGIGLFIS  440

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             I +M +AA++E+ RL + K   L D +  VPIS+FWQVPQY +IG AEVFTFIGQLEFFY
Sbjct  441   IFSMSAAALVEIRRLQLAKELGLVDESIAVPISIFWQVPQYMLIGAAEVFTFIGQLEFFY  500

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +Q+PD+MRSLCSALSL T ++GNY SSF++ +V   TT+ G PGW+ +NLN GHLDY+FW
Sbjct  501   EQSPDAMRSLCSALSLLTTSLGNYFSSFILNVVTYFTTKGGNPGWILDNLNKGHLDYYFW  560

Query  1923  LLAVLSVMNLGVFVVVA  1973
             LLA LSV+N+ V++V A
Sbjct  561   LLAGLSVLNMLVYIVCA  577



>ref|XP_002285274.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Vitis vinifera]
Length=586

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/565 (61%), Positives = 433/565 (77%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E  D++T DG++D   +P  ++ TG W+ACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  21    ENSDLHTGDGSVDIHGKPVLRSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTSKLH  80

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSATVP 
Sbjct  81    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYCGRYWTIAAFSTIYFIGMCTLTLSATVPA  140

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+       T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  141   FKPADCVGSVCPPATTAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  200

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+SS +VWIQ    WG GFG+PA+ M +A+  FFSGT LYR+QKP
Sbjct  201   SFFNWFYFSINIGALVSSSFLVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQKP  260

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK K++VP D +LL+ET    S I+GSRKL H+NEL+  DKAAV
Sbjct  261   GGSPITRMCQVLVASFRKWKLEVPKDSNLLYETPDKNSAIEGSRKLEHSNELKCLDKAAV  320

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G FS PW LCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  321   ISDAEIKSGDFSNPWNLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVM  380

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVP+YDR++VP+ARKFTG + G + LQRMG+GLF+S
Sbjct  381   DTNIGSFTIPPASLSTFDVISVIFWVPVYDRILVPIARKFTGKERGFSELQRMGIGLFLS  440

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL +    +L D    VP+S+ WQ+PQYF++G AEVFTFIGQLEFFY
Sbjct  441   VLCMSAAALVEIKRLQLATALDLVDEDVAVPLSILWQIPQYFLLGAAEVFTFIGQLEFFY  500

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLS+F++T+V  +TT +GK GW+ +NLN GHLDY+FW
Sbjct  501   DQSPDAMRSLCSALSLLTTSLGNYLSAFILTVVTTLTTEDGKTGWIPDNLNKGHLDYYFW  560

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +NL V+++ AK+Y  KK 
Sbjct  561   LLAGLSFLNLLVYMICAKIYKRKKG  585



>gb|KFK33424.1| hypothetical protein AALP_AA5G011300 [Arabis alpina]
Length=584

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/565 (60%), Positives = 428/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +E  +Y +DG++D    P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L+
Sbjct  19    QEVKLYAEDGSVDIHGNPPLKKKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q  ++A+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+V  
Sbjct  79    QGNVAAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAVFSGIYFIGMSALTLSASVSA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K+
Sbjct  139   LKPAECIGEFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKA  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIVSFFFGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  V+VP D +LL+ET    S I GSRK+ HT+  ++ DKAAV
Sbjct  259   GGSPITRISQVVVASFRKSTVEVPEDATLLYETQDKNSAIAGSRKIEHTDNCQYLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GI+FS VY QMST FV Q   M
Sbjct  319   ISEEESKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIVFSAVYAQMSTMFVQQGRAM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG   G T +QRMG+GLF+S
Sbjct  379   DCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGVDKGFTEVQRMGIGLFVS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E++RL + +   L +    VPISV WQ+PQYFI+G AEVF FIGQLEFFY
Sbjct  439   VLCMAAAAIVEIIRLHVAQDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG+ GW+++NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS++N+ V+   A  Y  KKA
Sbjct  559   LLAGLSLVNMAVYFFSAAKYKQKKA  583



>ref|XP_008389126.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like, partial [Malus 
domestica]
Length=611

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/565 (60%), Positives = 430/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E D +YT DG++D +     K  TG W+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  46    EGDGLYTGDGSVDIKGNRVLKQNTGNWRACPFILGTECCERLAYYGIATNLVTYLTNKLH  105

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+VP 
Sbjct  106   EGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAVFSTIYFIGMGTLTLSASVPA  165

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + +     V F+ LYL+ALGTGGIKPCVS +GADQFDDTD+ ER  K 
Sbjct  166   LKPPECVDSVCPSASPAQYAVFFVGLYLIALGTGGIKPCVSPFGADQFDDTDKTERVKKG  225

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSL+VW+Q    WG GFG+P + M +A+  FFSGT LYR+QKP
Sbjct  226   SFFNWFYFSINIGALISSSLLVWVQDNAGWGLGFGIPTLFMGIAIFSFFSGTPLYRFQKP  285

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  + VP D SLL+ET   +S I+GSRKL H++EL   DKAAV
Sbjct  286   GGSPVTRMCQVLVASFRKWNLDVPKDSSLLYETPDKDSAIKGSRKLEHSDELTCLDKAAV  345

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G FS PWR+CTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  346   ISETETKXGDFSNPWRVCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGTMM  405

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVP+YD+ IVP+AR+FTG + G + LQRMG+GLF+S
Sbjct  406   DTSIGSFTIPPASLSTFDVISVIFWVPVYDKFIVPIARRFTGKERGFSELQRMGIGLFLS  465

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + K   L D    VP+S+ WQ+PQYF++G AE+FTFIGQLEFFY
Sbjct  466   VLCMSAAAVVEIYRLNLAKELGLVDKEVAVPMSILWQIPQYFLLGAAEIFTFIGQLEFFY  525

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSS ++TIV   +T++GK GW+ +NLN GHLDYFFW
Sbjct  526   DQSPDAMRSLCSALSLLTTSLGNYLSSLILTIVTYFSTKDGKAGWIPDNLNEGHLDYFFW  585

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS++N+ V+VV AK Y  KKA
Sbjct  586   LLAGLSLLNMLVYVVCAKRYKKKKA  610



>emb|CDY17619.1| BnaA06g34380D [Brassica napus]
Length=657

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/566 (61%), Positives = 428/566 (76%), Gaps = 3/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             M E  +Y +DG++D    P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  89    MFEPKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  148

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  149   HQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVP  208

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  209   ALKPAECIGTFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKK  268

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  269   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  328

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  + VP D  LL+ET    S I GSRK+ HT++ ++ DKAA
Sbjct  329   PGGSPITRISQVVVASFRKSTLTVPEDAMLLYETQDKNSAIAGSRKIEHTDDCQYLDKAA  388

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             V+  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  389   VISEEESKTGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  448

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             M+  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG   G T +QRMGVGLF+
Sbjct  449   MDCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGVDKGFTEIQRMGVGLFV  508

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AA++E++RL +     L +    VPISV WQ+PQYFI+G AEVF FIGQLEFF
Sbjct  509   SVLCMAAAAIVEIIRLHLANELGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFF  568

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG+ GW+++NLN GHLDY+F
Sbjct  569   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGEQGWISDNLNSGHLDYYF  628

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ V+   A  Y  KKA
Sbjct  629   WLLAGLSLVNMAVYFFSAARYKQKKA  654



>ref|XP_002315835.1| Peptide transporter PTR2-B family protein [Populus trichocarpa]
 gb|EEF02006.1| Peptide transporter PTR2-B family protein [Populus trichocarpa]
Length=584

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/565 (60%), Positives = 430/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT DG++D    P  K KTG WKACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  20    ESNGLYTGDGSVDINGNPVLKQKTGNWKACPFILGTECCERLAYYGIATNLVTYLTKKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ WSGTCY+ PL+GA LAD   GRYWTIA FS IY IGM  +TLSA++P 
Sbjct  80    EGNVSAARNVTTWSGTCYLTPLIGAVLADTCWGRYWTIAAFSSIYFIGMCALTLSASIPA  139

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+       T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  140   LKPAECVGSLCPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS +V+IQ    WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  200   SFFNWFYFSINIGALISSSFLVYIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQRP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS  K  ++VP+D SLL+ET    S I+GSRKL H++EL+  DKAAV
Sbjct  260   GGSPITRMCQVLVASFHKWNLEVPLDSSLLYETQDKHSAIEGSRKLVHSDELKCLDKAAV  319

Query  1209  VESDEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G F +PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  320   LSEAEMKSGDFPNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMLM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYDR++VP+ARKFTG + G + LQRMG+GLFIS
Sbjct  380   DTTIGSFTIPPASLSSFDVISVICWVPIYDRIVVPIARKFTGKERGFSDLQRMGIGLFIS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L+M +AA++E+ RL + K   L  +   VPIS+FWQ+PQY ++G +EVFTFIGQ+EFFY
Sbjct  440   VLSMTAAALVEIKRLQLAKELGLAGEAVAVPISIFWQIPQYMLVGASEVFTFIGQIEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +++PD+MRSLCSALSL T ++GNYLSSF++T+V   TT  GKPGW+ +NLN GHLDYFFW
Sbjct  500   EESPDAMRSLCSALSLLTTSLGNYLSSFILTMVTYFTTTGGKPGWIPDNLNEGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LSV+N+ V+V  A+ Y  K +
Sbjct  560   LLAGLSVLNMLVYVFCARKYKQKAS  584



>ref|XP_011070505.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Sesamum indicum]
Length=587

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/571 (60%), Positives = 429/571 (75%), Gaps = 3/571 (1%)
 Frame = +3

Query  294   IRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIY  473
             + S     D +YT DG++D +  P  K+ TG W+ACPFILG EC ERLAYYG+++NL+ Y
Sbjct  16    VESGNESNDGLYTGDGSVDIKGNPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVSY  75

Query  474   FQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTL  653
                +L++  + A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TL
Sbjct  76    LTKKLHEGNVPAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTL  135

Query  654   SATVPGISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  830
             SATVP   P  C+     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD  
Sbjct  136   SATVPSFKPPECVDSICPSATPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSA  195

Query  831   ERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRL  1010
             ER  K SFFNWFYFSINIGALV+SSLIVWIQ    WG GFG+PA+ M +A+  FFSGT L
Sbjct  196   ERVKKGSFFNWFYFSINIGALVSSSLIVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPL  255

Query  1011  YRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRF  1190
             YR+Q+PGGSP TR+ QV+VAS RK  + VP D SLL+ET    S I+GSRKL HT+EL+ 
Sbjct  256   YRFQRPGGSPVTRMCQVVVASCRKWNLAVPSDSSLLYETPDKHSAIEGSRKLLHTDELKC  315

Query  1191  FDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFV  1367
              DKAA +   E K+G +S PW+LCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV
Sbjct  316   LDKAATIADAEAKRGDYSDPWKLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFV  375

Query  1368  SQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMG  1547
              Q + M+T +G+F IP ASLS FD +SVI WVP+YD+++VP+ARK TG + G + LQRMG
Sbjct  376   EQGMVMDTSIGSFTIPAASLSTFDVISVIFWVPVYDKVLVPIARKLTGKERGFSELQRMG  435

Query  1548  VGLFISILAMVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIG  1724
             +GLFIS+L M +AAV+E  RLA+ K   +  D   VP+S+FWQ+PQYF++G AEVFTFIG
Sbjct  436   IGLFISVLCMSAAAVVETRRLAIAKELGVVDDPVAVPLSIFWQIPQYFLLGAAEVFTFIG  495

Query  1725  QLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGH  1904
             QLEFFYDQ+PD+MRSLCSALSL T ++GNYLSSF++T+V  +TT+ G+ GW+ +NLN GH
Sbjct  496   QLEFFYDQSPDAMRSLCSALSLLTTSLGNYLSSFILTVVTSLTTQGGQIGWIPDNLNEGH  555

Query  1905  LDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LDYFFWLLA LS +N+ ++   AK +  K A
Sbjct  556   LDYFFWLLAGLSFLNMVIYYFCAKRFKSKLA  586



>ref|XP_002459192.1| hypothetical protein SORBIDRAFT_02g000260 [Sorghum bicolor]
 gb|EER95713.1| hypothetical protein SORBIDRAFT_02g000260 [Sorghum bicolor]
Length=585

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/557 (63%), Positives = 435/557 (78%), Gaps = 10/557 (2%)
 Frame = +3

Query  351   YRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTISASKNLSNW  530
             +  +PA ++KTGTW+ACPFILGNEC ERLAYYGMSSNL+ Y   RL+Q   +A+ N+SNW
Sbjct  22    HSGKPAVRSKTGTWRACPFILGNECCERLAYYGMSSNLVNYMIDRLHQGNAAAANNVSNW  81

Query  531   SGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTCIAHEKCTV  710
             SGTCY+MPL+GAFLADAYLGRY TIA F  +Y++G+TL+T+SA VPG+ P         V
Sbjct  82    SGTCYVMPLLGAFLADAYLGRYRTIAAFMALYILGLTLLTMSAAVPGLRPP--PDGAGAV  139

Query  711   TGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINIGA  890
             T   +   F+ALYL+A+GTGGIKPCVSS+GADQFDD D +ER+ KSSFFNWFY SIN+GA
Sbjct  140   TAGQSAAFFVALYLIAVGTGGIKPCVSSFGADQFDDADPRERQSKSSFFNWFYMSINVGA  199

Query  891   LVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPFTRLFQVIVA  1070
             L+ASS++VW+Q  V WGWGFG+PA AMA+AV  F  G++LYR+QKPGGSP TR+ QV+VA
Sbjct  200   LLASSVLVWVQMNVGWGWGFGIPAAAMAVAVASFLMGSKLYRHQKPGGSPLTRMLQVVVA  259

Query  1071  SLRKRKVKVPIDKSLLHE-TSGLESNIQGSRKLSHTNELRFFDKAAVVES-DEYKKGSFS  1244
             + RK K  VP D SLLHE +S   S IQGSRKL HT + R+ D+AAVV S DE  K +  
Sbjct  260   AWRKGKQPVPADASLLHEASSASASAIQGSRKLEHTEQFRWLDRAAVVTSTDEDGKNNPD  319

Query  1245  PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA----IGMNTYVGTFKI  1412
             PWRLCTVTQVEELKS+IRLLP+WA+GI+ S VY QMST FV Q       M +  G FKI
Sbjct  320   PWRLCTVTQVEELKSVIRLLPVWASGIVMSAVYSQMSTMFVLQGNTLDPRMGSGAGAFKI  379

Query  1413  PEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMVSAAV  1592
             P ASLS+FDTLSVI W P YDRL+VP AR++TGH  G T LQRMG+GL +S+L+M++A  
Sbjct  380   PSASLSIFDTLSVIAWAPAYDRLVVPAARRWTGHPRGFTQLQRMGIGLAVSVLSMLAAGA  439

Query  1593  LEMVRLAMVKRHNLYDVTE--VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMR  1766
             LE+ RL +   H + D +   +PIS+FWQVPQYFIIG AEVFTFIGQ+EFFYDQAPD+MR
Sbjct  440   LEVARLRVAASHGMLDDSTNYLPISIFWQVPQYFIIGAAEVFTFIGQIEFFYDQAPDAMR  499

Query  1767  SLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVM  1946
             S+ +ALSLT++A+G+YLS+ LV++V  ITTRNG  GW+ +NLN GHLDYFFWLL+VLSV+
Sbjct  500   SMGTALSLTSSALGSYLSALLVSVVTAITTRNGGLGWIPDNLNRGHLDYFFWLLSVLSVI  559

Query  1947  NLGVFVVVAKMYTYKKA  1997
             N  V++ +AK Y YK+A
Sbjct  560   NFVVYLWIAKWYRYKQA  576



>ref|XP_009419340.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/565 (60%), Positives = 422/565 (75%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E    YT DG++D    P  KN TG W+ACPFILGNEC ERLAYYG+++NL+ Y + +L+
Sbjct  21    ENQGQYTGDGSVDIHGNPVLKNSTGNWRACPFILGNECCERLAYYGIATNLVTYLKNKLH  80

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +   SA++N++ W GTCYI PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  81    EGNASAARNVTTWQGTCYITPLLGAILADAYWGRYWTIAVFSTIYFVGMATLTLSASVPA  140

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P+      C   +     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  141   FKPSPCVESVCPEASAVQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPRERMKKG  200

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS +VW+Q    WG GFG+P + M +A+  FF GT LYR+QKP
Sbjct  201   SFFNWFYFSINIGALISSSFLVWVQDNCGWGLGFGIPTLFMGLAIISFFFGTPLYRFQKP  260

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP  R+ QV+VAS RK KV VP D  LL+E     S I+GSRKL HT+E++F DKAA 
Sbjct  261   GGSPLIRMCQVVVASFRKWKVDVPHDSCLLYEVPEKASAIKGSRKLEHTDEIKFLDKAAT  320

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   + K  SFS PWRLCTVTQVEELK ++R+ P+WAT I+FS VY Q+ST FV Q + M
Sbjct  321   VTDLDTKTESFSNPWRLCTVTQVEELKILVRMFPVWATTIVFSAVYAQISTMFVEQGMVM  380

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVIVWVPIYDR++VP+AR+FTG + G + LQRMG+GLFIS
Sbjct  381   DTSIGSFTIPPASLSTFDVISVIVWVPIYDRILVPVARRFTGKERGFSELQRMGIGLFIS  440

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             ILAM +AAV+E+ RL + K   L  +   +P+S+FWQ PQYF++G AEVFTFIG LEFFY
Sbjct  441   ILAMAAAAVVEIRRLDIAKAEGLVSEKVAIPLSIFWQTPQYFLVGAAEVFTFIGSLEFFY  500

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T A+GNYLSSF++T+V  +TTR G+ GW+ +NLN GHLDY+FW
Sbjct  501   DQSPDAMRSLCSALSLLTTALGNYLSSFILTVVTSVTTRGGRTGWIPDNLNEGHLDYYFW  560

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LL  LS +NL ++V  A  Y  K+A
Sbjct  561   LLTGLSFLNLLIYVACANRYKSKRA  585



>ref|XP_011021701.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Populus euphratica]
Length=584

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/565 (60%), Positives = 430/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT DG++D +  P  K KTG WKACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  20    ESNGLYTGDGSVDIKGNPILKQKTGNWKACPFILGTECCERLAYYGIATNLVTYLTSKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ WSGTCY+ PL+GA LAD   GRYWTIA FS IY IGM  +TLSA++P 
Sbjct  80    EGNVSAARNVTTWSGTCYLTPLIGAVLADTCWGRYWTIAAFSSIYFIGMCALTLSASIPA  139

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+       T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  140   LKPAECVGSLCPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSKERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS +V+IQ    WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  200   SFFNWFYFSINIGALISSSFLVYIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQRP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS  K  ++VP+D SLL+ET    S I+GSRKL H++EL+  DKAAV
Sbjct  260   GGSPITRMCQVLVASFHKWNLEVPLDSSLLYETPDKHSAIEGSRKLEHSDELKCLDKAAV  319

Query  1209  VESDEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G F +PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  320   LSEAEMKSGDFPNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMLM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVPIYDR++VP+ARKFTG   G + LQRMG+GLFIS
Sbjct  380   DTTIGSFTIPPASLSSFDVISVICWVPIYDRIVVPIARKFTGKDRGFSDLQRMGIGLFIS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLY-DVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L+M +AA++E+ RL + K   L  +   VPIS+FWQ+PQY ++G +EVFTFIGQ+EFFY
Sbjct  440   MLSMTAAALVEIKRLQLAKELGLTGEAVAVPISIFWQIPQYMLVGASEVFTFIGQIEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             +++PD+MRSLCSALSL T ++GNYLSSF++T+V   TT  GKPGW+ +NLN GHLDYFFW
Sbjct  500   EESPDAMRSLCSALSLLTTSLGNYLSSFILTMVTYFTTTGGKPGWIPDNLNEGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+ V+V  A+ Y  K +
Sbjct  560   LLAGLSFLNILVYVSCARKYKQKAS  584



>gb|AAO64143.1| putative oligopeptide transporter protein [Arabidopsis thaliana]
Length=512

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/506 (67%), Positives = 411/506 (81%), Gaps = 3/506 (1%)
 Frame = +3

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             ++N   +SASK++SNWSGTCY  PL+GAF+ADAYLGRYWTIA+F +IY+ GMTL+T+SA+
Sbjct  2     QMNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISAS  61

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG++PTC + E C  T   T + FIALYL+ALGTGGIKPCVSS+GADQFDDTDEKE++ 
Sbjct  62    VPGLTPTC-SGETCHATAGQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKES  120

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP VAMA+AV FFF+G+  YR Q
Sbjct  121   KSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMAIAVVFFFAGSNFYRLQ  180

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QVIVAS RK KVK+P D+SLL+E    ES+I GSRKL HT  L FFDKA
Sbjct  181   KPGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSIIGSRKLEHTKILTFFDKA  240

Query  1203  AV-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AV  ESD       S W+LCTVTQVEELK++IRLLPIWATGI+F++VY QM T FV Q  
Sbjct  241   AVEAESDNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGIVFASVYSQMGTVFVLQGN  300

Query  1380  GMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
              ++ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP ARK+TGH+ G T LQR+G+GL
Sbjct  301   TLDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFARKYTGHERGFTQLQRIGIGL  360

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
              ISI +MVSA +LE+ RL  V+ HNLY+   +P+++FWQVPQYF++GCAEVFTFIGQLEF
Sbjct  361   VISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQVPQYFLVGCAEVFTFIGQLEF  420

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRSLCSALSLT  A GNYLS+FLVT+V  +T   G+PGW+A NLN GHLDYF
Sbjct  421   FYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYF  480

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             FWLLA LS +N  V++ +AK YTYKK
Sbjct  481   FWLLAGLSFLNFLVYLWIAKWYTYKK  506



>dbj|BAF00365.1| oligopeptide transporter - like protein [Arabidopsis thaliana]
Length=511

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/506 (67%), Positives = 411/506 (81%), Gaps = 3/506 (1%)
 Frame = +3

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             ++N   +SASK++SNWSGTCY  PL+GAF+ADAYLGRYWTIA+F +IY+ GMTL+T+SA+
Sbjct  1     QMNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISAS  60

Query  663   VPGISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             VPG++PTC + E C  T   T + FIALYL+ALGTGGIKPCVSS+GADQFDDTDEKE++ 
Sbjct  61    VPGLTPTC-SGETCHATAGQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKES  119

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             KSSFFNWFYF IN+GA++ASS++VWIQ  V WGWG GVP VAMA+AV FFF+G+  YR Q
Sbjct  120   KSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMAIAVVFFFAGSNFYRLQ  179

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QVIVAS RK KVK+P D+SLL+E    ES+I GSRKL HT  L FFDKA
Sbjct  180   KPGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSIIGSRKLEHTKILTFFDKA  239

Query  1203  AV-VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AV  ESD       S W+LCTVTQVEELK++IRLLPIWATGI+F++VY QM T FV Q  
Sbjct  240   AVEAESDNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGIVFASVYSQMGTVFVLQGN  299

Query  1380  GMNTYVG-TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
              ++ ++G  FKIP ASLS+FDTLSV+ W P+YD+LIVP ARK+TGH+ G T LQR+G+GL
Sbjct  300   TLDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFARKYTGHERGFTQLQRIGIGL  359

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
              ISI +MVSA +LE+ RL  V+ HNLY+   +P+++FWQVPQYF++GCAEVFTFIGQLEF
Sbjct  360   VISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQVPQYFLVGCAEVFTFIGQLEF  419

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRSLCSALSLT  A GNYLS+FLVT+V  +T   G+PGW+A NLN GHLDYF
Sbjct  420   FYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYF  479

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             FWLLA LS +N  V++ +AK YTYKK
Sbjct  480   FWLLAGLSFLNFLVYLWIAKWYTYKK  505



>ref|XP_002463973.1| hypothetical protein SORBIDRAFT_01g009900 [Sorghum bicolor]
 gb|EER90971.1| hypothetical protein SORBIDRAFT_01g009900 [Sorghum bicolor]
Length=587

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/569 (61%), Positives = 429/569 (75%), Gaps = 5/569 (1%)
 Frame = +3

Query  306   AMEEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             A EE +  VYT DG++D+   P  K  TG WKACPFILGNEC ERLAYYG+S+NL+ Y  
Sbjct  18    APEESNQVVYTGDGSVDFSGNPVVKETTGRWKACPFILGNECCERLAYYGISTNLVTYLT  77

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
              +L+    SA+ N++ W GTCY+ PL+GA LADAY GRYWTIATFS +Y IGM+++TLSA
Sbjct  78    KKLHAGNASAASNVTTWQGTCYLTPLIGAILADAYWGRYWTIATFSTVYFIGMSILTLSA  137

Query  660   TVPGISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             +VP + P       C   +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER
Sbjct  138   SVPMLMPPSCEGSFCPQASPFQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAER  197

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
               K SFFNWFYFSINIGAL++SS +VW+Q  V WG GFG+P V M +A+  FFSGT LYR
Sbjct  198   IQKGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIISFFSGTSLYR  257

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
             +QKPGGSP TR+ QVIVASLRK  V  P D SLL+E     S I+GSR++ HT+ELR  D
Sbjct  258   FQKPGGSPITRVCQVIVASLRKWNVPAPEDSSLLYELPNGVSTIEGSRQIEHTDELRCLD  317

Query  1197  KAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             KAA V   + K   FS PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q
Sbjct  318   KAATVTEVDVKMADFSNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQ  377

Query  1374  AIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              + ++  +G+FKIP ASLS FDTLSVIV VP+YD ++VP+AR+FTG++ G T LQRMG+G
Sbjct  378   GMVLDPSLGSFKIPPASLSTFDTLSVIVCVPMYDYIVVPIARRFTGNERGFTELQRMGIG  437

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             L ISILAM  AA+LE+ RLA+ +  +L D    VP+S+FWQ+PQYF+IG AE+FTFIG L
Sbjct  438   LVISILAMSVAAILEIKRLAVAREAHLVDQNVPVPLSIFWQIPQYFLIGLAEIFTFIGAL  497

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQ+PD+MRSLCSAL+L T A GNYLS+F++T+VA  TTR G PGW+ +NLN GHLD
Sbjct  498   EFFYDQSPDAMRSLCSALNLLTTAGGNYLSTFILTMVAYFTTRGGNPGWIPDNLNEGHLD  557

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             YFFWLLA LS +NL V+V+ A  Y  KKA
Sbjct  558   YFFWLLAGLSFLNLIVYVICAGKYKGKKA  586



>ref|XP_010680056.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Beta vulgaris subsp. 
vulgaris]
Length=583

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/562 (61%), Positives = 427/562 (76%), Gaps = 3/562 (1%)
 Frame = +3

Query  321   DVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  500
             + YT DG++D +     K+KTG W+ACPFILG EC ERLAYYG+++NL+ Y   +L++  
Sbjct  21    EQYTGDGSVDLQGNRVLKSKTGNWRACPFILGTECCERLAYYGIATNLVSYLTGKLHEGN  80

Query  501   ISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP  680
             +SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+VP   P
Sbjct  81    VSAARNVTTWSGTCYLTPLLGAVLADAYWGRYWTIAVFSTIYFIGMCTLTLSASVPAFKP  140

Query  681   -TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
               C+       T     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFF
Sbjct  141   PECVDSFCPAATPPQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPSERVKKGSFF  200

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYFSINIGA V+S+LIVW+Q+   WG GFG+PA+ M +A+  FFSGT LYR+Q+PGGS
Sbjct  201   NWFYFSINIGAFVSSTLIVWMQENAGWGIGFGIPALFMGIAIASFFSGTPLYRFQRPGGS  260

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV++AS RK K+ VP D SLL+ET    S I+GSRKL HT+EL+  DKAAVV  
Sbjct  261   PLTRMGQVVIASFRKCKLDVPQDSSLLYETPDKHSAIEGSRKLEHTDELKCLDKAAVVSD  320

Query  1218  DEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
              + K G FS PWRLCTVTQVEELK +IR+ PIWATGI+F+ VY QMST FV Q   M+  
Sbjct  321   ADMKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFAAVYAQMSTMFVEQGTVMDRR  380

Query  1395  VGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             +G+F IP ASLS FD +SVI WVPIYD  +VP+ARKFTG + G + LQRMG+GLFISIL+
Sbjct  381   IGSFTIPAASLSTFDVISVIFWVPIYDSFLVPIARKFTGQERGFSELQRMGIGLFISILS  440

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQA  1751
             MV+AAV+E+ RL + +   L D    VP+++FWQVPQYF++G AEVFTF+GQLEFFYDQ+
Sbjct  441   MVAAAVVEIKRLQIAQELGLVDENVPVPLNIFWQVPQYFLVGAAEVFTFVGQLEFFYDQS  500

Query  1752  PDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLA  1931
             PD+MRSLCSALSL T ++GNYLSSF++T+V  +TT  G PGW+ +NLN GHLD FFWLLA
Sbjct  501   PDAMRSLCSALSLLTTSLGNYLSSFILTVVTALTTAGGNPGWIPDNLNKGHLDNFFWLLA  560

Query  1932  VLSVMNLGVFVVVAKMYTYKKA  1997
              LS +NL ++V  +  Y  KKA
Sbjct  561   GLSFLNLLLYVFCSLRYKQKKA  582



>ref|XP_002992575.1| hypothetical protein SELMODRAFT_135536, partial [Selaginella 
moellendorffii]
 gb|EFJ06381.1| hypothetical protein SELMODRAFT_135536, partial [Selaginella 
moellendorffii]
Length=574

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/572 (59%), Positives = 438/572 (77%), Gaps = 13/572 (2%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E +E++   TKDGT+D+++ PA++  TG WKACP+ILGNEC ERLAYYG+S NL+++   
Sbjct  4     EDLEKESFITKDGTVDWKHNPADRRTTGGWKACPYILGNECCERLAYYGISMNLVVFLTD  63

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +L+Q   +AS N++NWSGT YI PL+GAFLADAYLGRYWTIA FS +Y +GM L+TLSA+
Sbjct  64    KLHQHNATASTNVTNWSGTAYITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTLSAS  123

Query  663   VPGISPTCIAHEKCTVTGRDTMVCF-IALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  839
             VP + P     + C       +  F +ALYLVALGTGGIKPCVSS+GADQFDD D  E+K
Sbjct  124   VPSLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSSFGADQFDDEDPSEKK  183

Query  840   HKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRY  1019
             +K+ FFNWFYFSIN+GA++AS+ +V+IQQ V+W WGFG+PA AM +A+  FF+G++ YR+
Sbjct  184   YKTVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVSFFTGSKKYRH  243

Query  1020  QKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDK  1199
             QKPGGSP TR+ QVIVA++R  ++++P D+++L+E     S I+GSRK+ HT E  F DK
Sbjct  244   QKPGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDEKASAIEGSRKIQHTAEYSFLDK  303

Query  1200  AAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AAV    E +    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QMST FV Q +
Sbjct  304   AAV----EDRSRPTTTWNLCTVTQVEEVKILLRIVPIWASAIVFSTVYAQMSTLFVVQGL  359

Query  1380  GMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
              M+  +GTFK+P ASLS+FDTLSV++WVPIYDRL+VP  R++TGH  G T LQRMG+GL 
Sbjct  360   KMDYILGTFKVPSASLSMFDTLSVLIWVPIYDRLLVPFVRRYTGHAQGFTQLQRMGIGLV  419

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTE--------VPISVFWQVPQYFIIGCAEVFT  1715
             IS L+MV AAVLE+ RL + +   L D  +          +S+FWQ+PQYFIIG +EVFT
Sbjct  420   ISTLSMVVAAVLEIQRLRVAREKGLVDADDKNFPKLLNAQLSIFWQIPQYFIIGASEVFT  479

Query  1716  FIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLN  1895
             FIGQLEFFY+Q+PD+MRSL SALSL T A+GNYLSS LVTIV  IT R+GKPGW+A+NLN
Sbjct  480   FIGQLEFFYEQSPDAMRSLGSALSLATVALGNYLSSLLVTIVTKITRRDGKPGWIADNLN  539

Query  1896  YGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYK  1991
             +GH+DYFFWLLA LSV+N+  ++  A  + YK
Sbjct  540   HGHIDYFFWLLAALSVVNVLFYLPFAYRFKYK  571



>ref|XP_008798043.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Phoenix dactylifera]
Length=587

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/569 (60%), Positives = 427/569 (75%), Gaps = 3/569 (1%)
 Frame = +3

Query  300   SEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             SE       YT DG++D    P  KN TG W+ACPFILG EC ERLAYYG+++NL+ Y  
Sbjct  18    SEENGNKRPYTGDGSVDINGNPVLKNGTGNWRACPFILGTECCERLAYYGIATNLVTYLT  77

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
              +L++  +SA++N++ W GTCYI PL+GA LADAY GRYWTIA FS IY +GM  +TLSA
Sbjct  78    KKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIAVFSTIYFVGMGTLTLSA  137

Query  660   TVPGISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             +VP   P +C+       +     + F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER
Sbjct  138   SVPAFKPPSCVKSVCPEASLSQYAIFFVGLYLIALGTGGIKPCVSSFGADQFDDTDPAER  197

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
               K SFFNWFYFS+NIGAL++SS +VW+Q    WG GFG+P + MA+A+  FF+GT LYR
Sbjct  198   VKKGSFFNWFYFSVNIGALISSSFLVWVQDNYGWGLGFGIPTLFMALAIISFFAGTTLYR  257

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
             +QKPGGSP TR+ QV VASLRK K+ +P D SLL+E     S I+GSRKL HT+EL+F D
Sbjct  258   FQKPGGSPITRMCQVAVASLRKWKLDIPHDSSLLYELPDKASAIEGSRKLEHTDELKFLD  317

Query  1197  KAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             KAA V   + K  S S PWRLCTVTQVEELK ++R+ PIWAT I+FS VY Q+ST FV Q
Sbjct  318   KAATVSDLDLKTESLSNPWRLCTVTQVEELKILVRMFPIWATTIVFSAVYAQISTMFVEQ  377

Query  1374  AIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              + ++  +G+F IP ASLS FD +SVI+WVPIYDR++VP+ R+FTG + G + LQRMG+G
Sbjct  378   GMVLDATIGSFTIPPASLSTFDVISVIIWVPIYDRILVPIVRRFTGKERGFSELQRMGIG  437

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNL-YDVTEVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             LFISILAM +AA++E+ RL +VK  +L +    VP+S+FWQ+PQYF++G AEVFTFIGQL
Sbjct  438   LFISILAMAAAALVEIKRLDIVKAEHLEHQKVAVPLSIFWQIPQYFLVGAAEVFTFIGQL  497

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQ+PD+MRSLCSALSL T A+GNYLSS ++T+V  ITT  GK GW+ +NLN GHLD
Sbjct  498   EFFYDQSPDAMRSLCSALSLLTTALGNYLSSLILTVVTYITTIGGKTGWIPDNLNEGHLD  557

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             YFFWLLA LS +NL V+V  A  Y  KKA
Sbjct  558   YFFWLLAGLSFLNLLVYVFCAIRYRSKKA  586



>ref|XP_001769410.1| predicted protein [Physcomitrella patens]
 gb|EDQ65779.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/579 (60%), Positives = 441/579 (76%), Gaps = 10/579 (2%)
 Frame = +3

Query  318   DDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  497
             D  Y +DGT+D R  P  K  TG WKACP+ILGNEC ERLAYYG+++NL+ Y    L+Q+
Sbjct  9     DSEYPQDGTVDLRGNPVLKANTGGWKACPYILGNECCERLAYYGIATNLVTYLSHELHQN  68

Query  498   TISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGIS  677
               +A+ N++NWSGTCYI  L+GAFLADAYLGR+WTI  FSIIY +GM L+TLSA +P + 
Sbjct  69    PSTAANNVTNWSGTCYITTLIGAFLADAYLGRFWTIVVFSIIYFLGMVLLTLSAALPSLK  128

Query  678   PTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  857
             P   + E    +     V ++ALYL+ALGTGGIKPCVSS+GADQFD+ D KE+K KSSFF
Sbjct  129   PP--SGEGVVASSTQLAVFYLALYLIALGTGGIKPCVSSFGADQFDENDVKEKKRKSSFF  186

Query  858   NWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGS  1037
             NWFYF+INIGAL+ASS +V+IQ+ V WGWGFG+PAVAM +A+  F  G+ LYR+QKPGGS
Sbjct  187   NWFYFTINIGALIASSALVYIQENVGWGWGFGIPAVAMGIAIVSFLIGSPLYRHQKPGGS  246

Query  1038  PFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVES  1217
             P TR+ QV+VA+ RK  +KV  +   L+E    ES I+GSRKL HT E RF DKAA+   
Sbjct  247   PITRIAQVLVAATRKLSMKVQPNGKHLYEADDKESGIEGSRKLEHTEEFRFLDKAAIPRG  306

Query  1218  DEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTY  1394
             DE  +G+  S WRL +VTQVEE+K ++RLLPIWA+GI+F+TVY QMST FV Q   MN  
Sbjct  307   DEELQGTRPSGWRLTSVTQVEEVKIVMRLLPIWASGIVFATVYSQMSTMFVQQGALMNVS  366

Query  1395  VGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILA  1574
             +G   IP ASLS+FDT+SVIV V IYDR +VP+ RK TGH  G T LQRMG+GLFIS+LA
Sbjct  367   MGKANIPSASLSIFDTISVIVCVVIYDRFLVPVVRKRTGHVRGFTQLQRMGIGLFISVLA  426

Query  1575  MVSAAVLEMVRLAMVKRHNLYDVTE---VPI---SVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             MV AA++E+ RL + +R  +    +   +P+   ++F Q+PQYF+IG AEVFTF+GQLEF
Sbjct  427   MVVAAIVEIERLKLARRDGVAGNPQDEALPVESLTIFVQIPQYFLIGAAEVFTFVGQLEF  486

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQAPD+MRSL SALSLTT A+GNYLSS LVTIV ++TT+ GKPGW+ NNLN GHLDYF
Sbjct  487   FYDQAPDAMRSLMSALSLTTVALGNYLSSVLVTIVTEVTTKGGKPGWIPNNLNRGHLDYF  546

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKAINKVSDLVEEAE  2033
             FW+LA+LS++N+  ++VVAK YTYK+ ++  +D+ E+ +
Sbjct  547   FWMLAILSILNIIFYLVVAKFYTYKR-VHNAADVGEDGK  584



>ref|XP_004981956.1| PREDICTED: peptide transporter PTR2-like [Setaria italica]
Length=588

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/569 (61%), Positives = 427/569 (75%), Gaps = 5/569 (1%)
 Frame = +3

Query  306   AMEEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             A EE +  +YT DG++D++  P  K +TG WKACPFILGNEC ERLAYYG+S+NL+ Y  
Sbjct  19    APEEPNQLIYTGDGSVDFKGNPVVKERTGRWKACPFILGNECCERLAYYGISTNLVTYLT  78

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
              +L+    SA+ N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM ++TLSA
Sbjct  79    KKLHDGNASAASNVTTWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMGILTLSA  138

Query  660   TVPGISPTCIAHEKCT-VTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             +VP + P       C   +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER
Sbjct  139   SVPMLMPPSCEGSICPPASPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAER  198

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
               K SFFNWFYFSINIGAL++SS +VW+Q  V WG GFG+P V M +A+  FFSGT +YR
Sbjct  199   IQKGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIISFFSGTSIYR  258

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
             +QKPGGSP TR+ QV+VASLRK  V VP D SLL+E     S I+GSR+L HT+ELR  D
Sbjct  259   FQKPGGSPITRVCQVVVASLRKWNVHVPEDSSLLYELPDGVSAIEGSRQLEHTDELRCLD  318

Query  1197  KAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQ  1373
             KAA +   + K    + PWR+CTVTQVEELK ++R+ PIWAT I+FS VY QMST FV Q
Sbjct  319   KAATITDVDVKTADLTNPWRICTVTQVEELKILLRMFPIWATTIVFSAVYAQMSTMFVEQ  378

Query  1374  AIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVG  1553
              + ++  +G+FK+P ASLS FDTLSVIV VPIYD ++VP+AR+FTG++ G T LQRMG+G
Sbjct  379   GMVLDPSLGSFKVPPASLSTFDTLSVIVCVPIYDYILVPLARRFTGNERGFTELQRMGIG  438

Query  1554  LFISILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQL  1730
             L ISI+ M  AAVLE+ RLA+ + H L D    VP+S+FWQ+PQYF++G +EVFTFIG L
Sbjct  439   LVISIITMAVAAVLEIKRLAIARDHGLVDQNVPVPLSIFWQIPQYFLVGLSEVFTFIGAL  498

Query  1731  EFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLD  1910
             EFFYDQ+PD+MRSLCSAL L T A GNYLS+F++T+VA  TTR G PGW+ +NLN GHLD
Sbjct  499   EFFYDQSPDAMRSLCSALQLLTTAFGNYLSTFILTMVAYFTTRGGNPGWIPDNLNKGHLD  558

Query  1911  YFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             YFFWLLA LS +NL ++V  A  Y  KKA
Sbjct  559   YFFWLLAGLSFLNLVIYVGCAGKYKSKKA  587



>ref|XP_002972518.1| hypothetical protein SELMODRAFT_97812, partial [Selaginella moellendorffii]
 gb|EFJ26604.1| hypothetical protein SELMODRAFT_97812, partial [Selaginella moellendorffii]
Length=569

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/570 (59%), Positives = 436/570 (76%), Gaps = 13/570 (2%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             +E++   TKDGT+D+++ PA++  TG WKACP+ILGNEC ERLAYYG+S NL+++   +L
Sbjct  1     LEKESFITKDGTVDWKHNPADRRTTGGWKACPYILGNECCERLAYYGISMNLVVFLTDKL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q   +AS N++NWSGT YI PL+GAFLADAYLGRYWTIA FS +Y +GM L+TLSA+VP
Sbjct  61    HQHNATASTNVTNWSGTAYITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTLSASVP  120

Query  669   GISPTCIAHEKCTVTGRDTMVCF-IALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P     + C       +  F +ALYLVALGTGGIKPCVSS+GADQFDD D  E+K+K
Sbjct  121   SLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSSFGADQFDDEDPSEKKYK  180

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             + FFNWFYFSIN+GA++AS+ +V+IQQ V+W WGFG+PA AM +A+  FF+G++ YR+QK
Sbjct  181   TVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVSFFTGSKKYRHQK  240

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QVIVA++R  ++++P D+++L+E     S I+GSRK+ HT E  F DKAA
Sbjct  241   PGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDEKASAIEGSRKIQHTAEYSFLDKAA  300

Query  1206  VVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V    E +    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QMST FV Q + M
Sbjct  301   V----EDRSRPTTTWNLCTVTQVEEVKILLRIVPIWASAIVFSTVYAQMSTLFVVQGLKM  356

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +  +GTFK+P ASLS+FDTLSV++WVPIYDRL+VP  R++TGH  G T LQRMG+GL IS
Sbjct  357   DYILGTFKVPSASLSMFDTLSVLIWVPIYDRLLVPFVRRYTGHPQGFTQLQRMGIGLVIS  416

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTE--------VPISVFWQVPQYFIIGCAEVFTFI  1721
              L+MV AAVLE+ RL + +   L D  +          +S+FWQ+PQYFIIG +EVFTFI
Sbjct  417   TLSMVVAAVLEIQRLRVAREKGLVDADDKNFPKLLNAQLSIFWQIPQYFIIGASEVFTFI  476

Query  1722  GQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYG  1901
             GQLEFFY+Q+PD+MRSL SALSL T A+GNYLSS LVTIV  IT R+GKPGW+A+NLN+G
Sbjct  477   GQLEFFYEQSPDAMRSLGSALSLATVALGNYLSSLLVTIVTKITRRDGKPGWIADNLNHG  536

Query  1902  HLDYFFWLLAVLSVMNLGVFVVVAKMYTYK  1991
             H+DYFFWLLA LSV+N   ++  A  + YK
Sbjct  537   HIDYFFWLLAALSVVNFLFYLPFAYRFKYK  566



>ref|NP_001146682.1| hypothetical protein [Zea mays]
 gb|ACL54513.1| unknown [Zea mays]
 gb|ACL54519.1| unknown [Zea mays]
 tpg|DAA51061.1| TPA: hypothetical protein ZEAMMB73_156096 [Zea mays]
Length=587

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/567 (61%), Positives = 429/567 (76%), Gaps = 5/567 (1%)
 Frame = +3

Query  312   EEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             EE +  VYT DG++D+   P  K +TG WKACPFILGNEC ERLAYYG+S+NL+ Y   +
Sbjct  20    EESNQVVYTGDGSVDFSGNPVVKERTGRWKACPFILGNECCERLAYYGISTNLVTYLTKK  79

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L+    SA+ +++ WSGTCY+ PL+GA LADAY GRYWTIATFS +Y IGMTL+TLSA+V
Sbjct  80    LHAGNASAASSVTTWSGTCYLTPLIGAILADAYWGRYWTIATFSTVYFIGMTLLTLSASV  139

Query  666   PGISPTCIAHEKCTVTGR-DTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             P + P       C         V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  
Sbjct  140   PMLMPPSCEGSFCPAASPFQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERIQ  199

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             K SFFNWFYFSINIGAL++SS +VW+Q  V WG GFG+P V M +A+  FFSGT LYR+Q
Sbjct  200   KGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIISFFSGTSLYRFQ  259

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QVIVASLRK  V VP D SLL+E     S I+GSR++ HT+ELR  DKA
Sbjct  260   KPGGSPITRVCQVIVASLRKWNVPVPEDSSLLYELPNGVSTIEGSRQIEHTDELRCLDKA  319

Query  1203  AVVESDEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             A V   + K   F +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q +
Sbjct  320   ATVTEVDVKTADFNNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGM  379

Query  1380  GMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
              ++  +G+FKIP ASLS FDTLSVI+ VP+YD ++VP+AR+FTG++ G T LQRMG+GL 
Sbjct  380   VLDPSLGSFKIPPASLSTFDTLSVIICVPMYDYIVVPIARRFTGNERGFTELQRMGIGLV  439

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             ISI+AM  AAVLE+ RLA+ +  +L D    VP+S+FWQ+PQYF+IG AE+FTFIG LEF
Sbjct  440   ISIMAMSVAAVLEIKRLAVAREAHLVDQNVPVPLSIFWQIPQYFLIGLAEIFTFIGALEF  499

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQ+PD+MRSLCSAL+L T A GNYLS+F++T+VA  TTR G PGW+ +NLN GHLDYF
Sbjct  500   FYDQSPDAMRSLCSALNLLTTAFGNYLSTFILTMVAYFTTRGGNPGWIPDNLNEGHLDYF  559

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             F L+A +S +NL V+V+ A  Y  KKA
Sbjct  560   FLLIAGISFLNLIVYVLCAGKYKSKKA  586



>gb|EYU30228.1| hypothetical protein MIMGU_mgv1a003438mg [Erythranthe guttata]
Length=585

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/565 (61%), Positives = 425/565 (75%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT DG++D +  P  K+ TG W+ACPFILG EC ERLAYYG+++NL+ Y   +LN
Sbjct  20    ESNGLYTGDGSVDIKGNPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVSYLTKKLN  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q  +SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS +Y IGM  +TLSAT+P 
Sbjct  80    QGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTLYFIGMGTLTLSATIPI  139

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  CI     + T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  140   FKPPECIDSVCPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSAERVKKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+SSLIVWIQ    WG GFG+PA+ M +A+  FFSGT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALVSSSLIVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQKP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  + +P D +LL+ET    S I+GSRKL HT+EL+  D+AA+
Sbjct  260   GGSPLTRMCQVLVASCRKWNLAIPNDSTLLYETQDKSSAIEGSRKLLHTDELQCLDRAAI  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G +S PW+LCTVTQ+EELK +IR+ PIWATGI+FS VY QMST FV Q + M
Sbjct  320   ISDHETKTGDYSNPWKLCTVTQIEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T  G   IP ASLS FD +SVI WVP+YD+++VP ARK TG + G + LQRMG+GLFIS
Sbjct  380   DTSAGPITIPAASLSSFDVISVIFWVPVYDKILVPFARKLTGKERGFSELQRMGIGLFIS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E+ RL + +  +L +    VP+S+FWQVPQYF++G AEVFTFIGQLEFFY
Sbjct  440   VLCMSAAAIVEIQRLRIARELDLVNEGVAVPMSIFWQVPQYFLLGAAEVFTFIGQLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TTR GK GW+ +NLN G LD FFW
Sbjct  500   DQSPDAMRSLCSALSLLTTSLGNYLSSFILTVVTWQTTRGGKTGWIPDNLNEGRLDNFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS  N+ V+V  AKMY  KKA
Sbjct  560   LLAGLSFANMVVYVFCAKMYKSKKA  584



>ref|XP_010246838.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nelumbo nucifera]
Length=579

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/560 (62%), Positives = 433/560 (77%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D    PA K+KTG W+ACPFILGNECSERLAYYG+++NL+ Y   +L++   S
Sbjct  19    YTGDGSVDINGDPALKHKTGNWRACPFILGNECSERLAYYGIATNLVTYLTNKLHEGNAS  78

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTC  686
             A++N++ W GTCY+ PL+GA LADAY GRY TIA FS IY IGM  +TLSA++P + P  
Sbjct  79    AARNVTTWQGTCYLAPLIGAVLADAYWGRYRTIAVFSTIYFIGMCTLTLSASIPALKPPS  138

Query  687   IAHEKCTV-TGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
                  C V T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K SFFNW
Sbjct  139   CVGSFCPVATPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDRRERVKKGSFFNW  198

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGAL++SSL+VW+Q  + WG GFG+P V M +A+  F SGT LYR+QKPGGSP 
Sbjct  199   FYFSINIGALISSSLLVWVQDNLGWGLGFGIPTVFMGLAIISFLSGTSLYRFQKPGGSPL  258

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+VASLRK  +++P D SLL+E     S I+GSRKL H++EL+F DKAA+V   E
Sbjct  259   TRICQVVVASLRKWNLELPRDSSLLYELPNKTSAIEGSRKLEHSDELKFLDKAALVTDLE  318

Query  1224  YKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              K   FS PWRLC+VTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M+T +G
Sbjct  319   SKNDGFSDPWRLCSVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVMDTTIG  378

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
             +F IP ASLS FD  SVIVWVPIYDR +VP+ARKFTG +SG + LQRMG+GLFISIL+M+
Sbjct  379   SFTIPPASLSTFDVFSVIVWVPIYDRFLVPVARKFTGIESGFSELQRMGIGLFISILSMI  438

Query  1581  SAAVLEMVRLAMVKRHNLYDVTE-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +AA++E  RL + K   L +  E VPIS+FWQ+PQY ++G +E+FTFIGQLEFFYDQ+PD
Sbjct  439   AAALVETKRLQVAKDLGLVNHGEVVPISIFWQIPQYVLVGASEIFTFIGQLEFFYDQSPD  498

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSAL+L T A+GNYLSSF++TIV  ITT+ GKPGW+ +NLN GHLD+FF L+A L
Sbjct  499   AMRSLCSALALLTTALGNYLSSFILTIVTTITTKGGKPGWIPDNLNEGHLDHFFLLIAGL  558

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S++NL V++  AK Y  KKA
Sbjct  559   SLLNLLVYIFCAKNYKCKKA  578



>ref|XP_009114212.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Brassica rapa]
 emb|CDY04114.1| BnaA09g18920D [Brassica napus]
Length=584

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/565 (61%), Positives = 427/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +   +Y +DG++D    P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L+
Sbjct  19    QAPKLYAEDGSVDLHGNPPLKAKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP 
Sbjct  79    QGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVPA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K+
Sbjct  139   LKPAECIGTYCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKA  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIVSFFFGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  +KVP D +LL+ET    S I GSRK+ HT++ ++ DKAAV
Sbjct  259   GGSPITRISQVVVASFRKSTLKVPEDAALLYETQDKNSAIAGSRKIEHTDDCKYLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   M
Sbjct  319   ISDEESKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRAM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG   G T +QRMG+GLF+S
Sbjct  379   DCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGVDKGFTEIQRMGIGLFVS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E++RL +     L +    VPISV WQ+PQYFI+G AEVF FIGQLEFFY
Sbjct  439   VLCMAAAAIIEIIRLRLADELGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG  GW+++NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGGEGWISDNLNTGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS++N+ V+   A  Y  KKA
Sbjct  559   LLAGLSLVNMAVYFFSAAKYKQKKA  583



>ref|XP_008787880.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Phoenix dactylifera]
Length=585

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/564 (61%), Positives = 431/564 (76%), Gaps = 3/564 (1%)
 Frame = +3

Query  315   EDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  494
             E+  YT DG++D    P  K+ TG W+ACPFILGNEC ERLAYYG+S+NL+ Y    L++
Sbjct  21    ENGPYTGDGSVDIHGNPVLKDCTGNWRACPFILGNECCERLAYYGISANLVSYLTKNLHE  80

Query  495   STISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGI  674
                SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP  
Sbjct  81    GNASAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAVFSTIYFLGMGTLTLSASVPAF  140

Query  675   SP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
              P +C+       +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K+S
Sbjct  141   KPPSCVGPVCPGASAAQYAVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKAS  200

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGAL++SS +VW+Q    WG GFG+P + M +A+  FFSGT LYR+Q+PG
Sbjct  201   FFNWFYFSINIGALISSSFLVWVQDNCGWGLGFGIPTLFMGLAIISFFSGTSLYRFQRPG  260

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VASLRK KV+VP D SLL+E +   S I+GSRKL H+NEL F DKAA V
Sbjct  261   GSPITRMCQVVVASLRKWKVEVPHDSSLLYELTAKASAIEGSRKLEHSNELIFLDKAATV  320

Query  1212  -ESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
              E DE  +  F+PWRLCTVTQVEELK ++R+ PIWAT I+FS VY Q+ST FV Q + ++
Sbjct  321   SEFDEKTESFFNPWRLCTVTQVEELKILVRMFPIWATTIVFSAVYAQISTMFVEQGMVLD  380

Query  1389  TYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
             T +G+F IP ASLS FD +SVI+WVP+YDR+ VP+AR+FTG   G + LQRMG+GL ISI
Sbjct  381   TTIGSFTIPPASLSTFDVISVIIWVPVYDRIFVPIARRFTGKDKGFSELQRMGIGLLISI  440

Query  1569  LAMVSAAVLEMVRLAMVKRHNL-YDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             LAM +AA+LE+ RL++ K  +L +    VP+S+FWQ+PQY ++G AEVFTFIGQLEFFYD
Sbjct  441   LAMAAAALLEIKRLSIAKAEHLEHQKVAVPLSIFWQIPQYSLVGLAEVFTFIGQLEFFYD  500

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             Q+PD+MRSLCSALSL   A+GNYLSSF++TI+  +TTR GK GW+ +NLN GHLDYFFWL
Sbjct  501   QSPDAMRSLCSALSLLITALGNYLSSFILTIITSVTTRGGKTGWIPDNLNEGHLDYFFWL  560

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA LS +NL V+V  AK Y  K+A
Sbjct  561   LAGLSFLNLLVYVYCAKRYKSKRA  584



>gb|ACL52627.1| unknown [Zea mays]
Length=587

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/567 (61%), Positives = 429/567 (76%), Gaps = 5/567 (1%)
 Frame = +3

Query  312   EEDD--VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTR  485
             EE +  VYT DG++D+   P  K +TG WKACPFILGNEC E+LAYYG+S+NL+ Y   +
Sbjct  20    EESNQVVYTGDGSVDFSGNPVVKERTGRWKACPFILGNECCEQLAYYGISTNLVTYLTKK  79

Query  486   LNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATV  665
             L+    SA+ +++ WSGTCY+ PL+GA LADAY GRYWTIATFS +Y IGMTL+TLSA+V
Sbjct  80    LHAGNASAASSVTTWSGTCYLTPLIGAILADAYWGRYWTIATFSTVYFIGMTLLTLSASV  139

Query  666   PGISPTCIAHEKCTVTGR-DTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  842
             P + P       C         V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  
Sbjct  140   PMLMPPSCEGSFCPAASPFQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERIQ  199

Query  843   KSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQ  1022
             K SFFNWFYFSINIGAL++SS +VW+Q  V WG GFG+P V M +A+  FFSGT LYR+Q
Sbjct  200   KGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIISFFSGTSLYRFQ  259

Query  1023  KPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKA  1202
             KPGGSP TR+ QVIVASLRK  V VP D SLL+E     S I+GSR++ HT+ELR  DKA
Sbjct  260   KPGGSPITRVCQVIVASLRKWNVPVPEDSSLLYELPNGVSTIEGSRQIEHTDELRCLDKA  319

Query  1203  AVVESDEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             A V   + K   F +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q +
Sbjct  320   ATVTEVDVKTADFNNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGM  379

Query  1380  GMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
              ++  +G+FKIP ASLS FDTLSVI+ VP+YD ++VP+AR+FTG++ G T LQRMG+GL 
Sbjct  380   VLDPSLGSFKIPPASLSTFDTLSVIICVPMYDYIVVPIARRFTGNERGFTELQRMGIGLV  439

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEF  1736
             ISI+AM  AAVLE+ RLA+ +  +L D    VP+S+FWQ+PQYF+IG AE+FTFIG LEF
Sbjct  440   ISIMAMSVAAVLEIKRLAVAREAHLVDQNVPVPLSIFWQIPQYFLIGLAEIFTFIGALEF  499

Query  1737  FYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYF  1916
             FYDQ+PD+MRSLCSAL+L T A GNYLS+F++T+VA  TTR G PGW+ +NLN GHLDYF
Sbjct  500   FYDQSPDAMRSLCSALNLLTTAFGNYLSTFILTMVAYFTTRGGNPGWIPDNLNEGHLDYF  559

Query  1917  FWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             F L+A +S +NL V+V+ A  Y  KKA
Sbjct  560   FLLIAGISFLNLIVYVLCAGKYKSKKA  586



>ref|XP_006849517.1| hypothetical protein AMTR_s00024p00147790 [Amborella trichopoda]
 gb|ERN11098.1| hypothetical protein AMTR_s00024p00147790 [Amborella trichopoda]
Length=589

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/587 (59%), Positives = 439/587 (75%), Gaps = 7/587 (1%)
 Frame = +3

Query  249   ERDREILGAIVAD*QIRSEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECS  428
             E +R +  +++ D  ++SE++     YT DG++D       ++ TG WKACPFILG EC 
Sbjct  5     EEERLLDESLLEDGTLKSESLGP---YTGDGSVDLHGNRVLRHNTGNWKACPFILGTECC  61

Query  429   ERLAYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIA  608
             ERLAYYG+S+NL+ Y    L++  +SA++N++ W GTCY+ PL+GA LADA  GRY TIA
Sbjct  62    ERLAYYGISTNLVTYLTKILHEGNVSAARNVTTWQGTCYLTPLLGALLADAIWGRYRTIA  121

Query  609   TFSIIYVIGMTLMTLSATVPGISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPC  785
              FS IY IGM  +TLSA+V    P   A   C + +    ++ F  LYL+ALGTGGIKPC
Sbjct  122   VFSTIYFIGMGTLTLSASVSVFKPPSCAGSICPSASPAQYVLFFFGLYLIALGTGGIKPC  181

Query  786   VSSYGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPav  965
             VSS+GADQFDDT   E   K SFFNWFYFSINIGALV+SSLIVWIQ    WG GFG+P +
Sbjct  182   VSSFGADQFDDTSPTESVKKGSFFNWFYFSINIGALVSSSLIVWIQDNAGWGLGFGIPTL  241

Query  966   amamavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESN  1145
              M +A+  FFSGT LYR+QKPGGSP TR+ QVIVAS+RK  VKVP D SLL E S   S 
Sbjct  242   FMGLAIGSFFSGTVLYRFQKPGGSPLTRMCQVIVASIRKLNVKVPDDSSLLFEVSDKNSA  301

Query  1146  IQGSRKLSHTNELRFFDKAAVVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATG  1322
             IQGSRKL HT+E +  DKAA +   + K G+FS PW+LCTVTQVEELK ++R+ PIWATG
Sbjct  302   IQGSRKLEHTDEFKCLDKAATISDLDAKTGNFSNPWKLCTVTQVEELKILVRMFPIWATG  361

Query  1323  IIFSTVYGQMSTQFVSQAIGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARK  1502
             I+FS VY Q+ST FV Q + ++T +G+F IP ASLSVFD +SVIVWVPIYD+++VP+AR+
Sbjct  362   IVFSAVYAQISTMFVEQGMTLDTSLGSFTIPPASLSVFDVISVIVWVPIYDQVLVPIARR  421

Query  1503  FTGHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNL-YDV-TEVPISVFWQV  1676
             FTG   G + LQRMG+GLFISILAM +AAV+E+ RL + + ++L +D  T VP+S+ WQ+
Sbjct  422   FTGKARGFSELQRMGIGLFISILAMAAAAVVEIRRLEIARANDLVFDTSTPVPMSICWQI  481

Query  1677  PQYFIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITT  1856
             PQYF++G AEVFTFIGQLEFFYDQ+PD+MRSLCSALSL T A+GNYLSSF++TIV  +TT
Sbjct  482   PQYFLVGAAEVFTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTVLTT  541

Query  1857  RNGKPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             + G PGW+ +NLN GHLDYFFWLLA LS +NL ++V  A  Y  K+A
Sbjct  542   KGGSPGWIPDNLNEGHLDYFFWLLAGLSFLNLVIYVTCAGRYKCKRA  588



>gb|EMS68423.1| Peptide transporter PTR2 [Triticum urartu]
Length=583

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/565 (60%), Positives = 427/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E    YT DG++D+   P  K KTG WKACPFILGNEC ERLAYYG+S+NL+ Y   +L+
Sbjct  18    ENQLTYTGDGSVDFSGNPVVKEKTGRWKACPFILGNECCERLAYYGISTNLVTYLTKKLH  77

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
                 SA++N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM+++TLSA+VP 
Sbjct  78    DGNSSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMSVLTLSASVPM  137

Query  672   ISPTCIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P       C   +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  138   LMPPSCEGAICPEASPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERIQKG  197

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS +VW+Q  + WG GFG+P V M +A+  FF+GT LYR+QKP
Sbjct  198   SFFNWFYFSINIGALISSSFLVWVQDNLGWGLGFGIPTVFMGLAIISFFAGTSLYRFQKP  257

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+ A+LRK    VP D SLL+E +   S I+GSR+L HT+ELR  DKAA 
Sbjct  258   GGSPITRVCQVVAATLRKWNAPVPEDSSLLYELADGVSAIEGSRQLEHTDELRCLDKAAT  317

Query  1209  VESDEYKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   + K+ SF +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q + +
Sbjct  318   ITDLDVKEDSFNNPWRVCTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGMVL  377

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +  +G+FKIP ASLS FD +SVI+WVPIYD ++VP+AR+FTG + G + LQRMG+GL IS
Sbjct  378   DPTIGSFKIPPASLSTFDVVSVIIWVPIYDSILVPIARRFTGKERGFSELQRMGIGLVIS  437

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             ILAM +AAVLE+ RLA+ +  +L D    VP+S+ WQ+PQYF++G +EVFTFIG LEFFY
Sbjct  438   ILAMSAAAVLEIKRLAIAREAHLVDQNVPVPLSILWQIPQYFLVGASEVFTFIGALEFFY  497

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSAL L T A+GNYLS+F++T+VA  TTR G+PGW+ +NLN G LDYFFW
Sbjct  498   DQSPDAMRSLCSALQLITTALGNYLSAFILTMVAYFTTRGGRPGWIPDNLNEGRLDYFFW  557

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N  V+V+ A  +  KKA
Sbjct  558   LLAGLSFLNFLVYVLCANRFKSKKA  582



>emb|CDY17446.1| BnaC09g20910D [Brassica napus]
Length=584

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/565 (60%), Positives = 427/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +   +Y +DG++D    P  K KTG WKACPFILGNEC ERLAYYG++ NL+ Y  T+L+
Sbjct  19    QAPKLYAEDGSVDLHGNPPLKAKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKLH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP 
Sbjct  79    QGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVPA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C+     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K+
Sbjct  139   LKPAECLGTFCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKA  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIVSFFFGTPLYRFQKP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  +KVP D +LL+ET    S I GSRK+ HT++ ++ DKAAV
Sbjct  259   GGSPITRISQVVVASFRKSTLKVPEDAALLYETQDKNSAIAGSRKIEHTDDCKYLDKAAV  318

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +  +E K G FS  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   M
Sbjct  319   ISDEESKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRAM  378

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG   G T +QRMG+GLF+S
Sbjct  379   DCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARRFTGVDKGFTEIQRMGIGLFVS  438

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E++RL +     L +    VPISV WQ+PQYFI+G AEVF FIGQLEFFY
Sbjct  439   VLCMAAAAIIEIIRLRLADELGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFY  498

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TTRNG  GW+++NLN GHLDYFFW
Sbjct  499   DQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGGEGWISDNLNTGHLDYFFW  558

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS++N+ V+   A  Y  KKA
Sbjct  559   LLAGLSLVNMAVYFFSAAKYKQKKA  583



>gb|ADQ43190.1| peptide transporter [Eutrema parvulum]
Length=581

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/566 (60%), Positives = 426/566 (75%), Gaps = 5/566 (1%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             ++E  +Y +DG++D    P  K KTG WKACPFIL NEC ERLAYYG++ NL+ Y  T+L
Sbjct  17    LQEAKLYAEDGSVDLHGNPPLKEKTGNWKACPFIL-NECCERLAYYGIAGNLITYLTTKL  75

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             +Q  +SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM+ +TLSA+VP
Sbjct  76    HQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVP  135

Query  669   GISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  845
              + P  CI     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  136   ALKPAECIGEFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRK  195

Query  846   SSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQK  1025
             +SFFNWFYFSINIGALV+SSL+VWIQ+   WG GFG+P V M +A+  FF GT LYR+QK
Sbjct  196   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  255

Query  1026  PGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAA  1205
             PGGSP TR+ QV+VAS RK  +KVP D +LL+ET    S I GSRK+ HT++  + DKAA
Sbjct  256   PGGSPITRISQVLVASFRKSTLKVPEDVTLLYETQDKNSAIAGSRKIKHTDDC-YLDKAA  314

Query  1206  VVESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIG  1382
             VV  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QMST FV Q   
Sbjct  315   VVSEEESKSGDLSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRA  374

Query  1383  MNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFI  1562
             MN  +G+F++P A+L  FDT SVI+WVP+YDR IVP+AR+FTG   G T +QRMG+GLF+
Sbjct  375   MNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPVARRFTGVDKGFTEIQRMGIGLFV  434

Query  1563  SILAMVSAAVLEMVRLAMVKRHNLYDV-TEVPISVFWQVPQYFIIGCAEVFTFIGQLEFF  1739
             S+L M +AA++E++RL +     L +    VPISV WQ+PQYFI+G AEVF FIGQLEFF
Sbjct  435   SVLCMAAAAIVEIIRLHLANELGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFF  494

Query  1740  YDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFF  1919
             YDQ+PD+MRSLCSAL+L TNA+GNYLSS ++T+V   TT NG+ GW+++NLN GHLDYFF
Sbjct  495   YDQSPDAMRSLCSALALLTNALGNYLSSLILTLVYYFTTMNGQQGWISDNLNSGHLDYFF  554

Query  1920  WLLAVLSVMNLGVFVVVAKMYTYKKA  1997
             WLLA LS++N+ ++   A  Y  KKA
Sbjct  555   WLLAGLSLVNMAIYFFSAAKYKQKKA  580



>ref|XP_010276263.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nelumbo nucifera]
 ref|XP_010276264.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nelumbo nucifera]
Length=585

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/560 (62%), Positives = 425/560 (76%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D    P  K+ TG W+ACPFILG EC ERLAYYG+++NL+ Y   +L++   S
Sbjct  25    YTGDGSVDINGNPVLKHNTGNWRACPFILGTECCERLAYYGIATNLVTYLTNKLHEGNAS  84

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISP-T  683
             A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+VP   P  
Sbjct  85    AARNVTTWQGTCYLAPLIGAVLADAYWGRYWTIAVFSTIYFIGMGTLTLSASVPVFKPPA  144

Query  684   CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
             C+       T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K SFFNW
Sbjct  145   CVGSICPAATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDTRERVKKGSFFNW  204

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGALV+SS +VWIQ    WG GFG+P + M +A+  FFSGT LYR+QKPGGSP 
Sbjct  205   FYFSINIGALVSSSFLVWIQDNAGWGLGFGIPTLFMGLAIISFFSGTPLYRFQKPGGSPI  264

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+VASLRK  VKVP D SLL+E     S I GSRKL H+NEL+  DKA+VV   E
Sbjct  265   TRMCQVVVASLRKWNVKVPHDSSLLYELPDKTSAIAGSRKLEHSNELKCLDKASVVTDHE  324

Query  1224  YKKGSFSP-WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              +   FS  W+LCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M+T +G
Sbjct  325   SESDDFSNRWKLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVMDTSIG  384

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
             +F IP ASLS FD +SVIVWVPIYD+++VP+ARKFTG + G + LQRMG+GLFISIL+M+
Sbjct  385   SFTIPPASLSTFDVISVIVWVPIYDKILVPIARKFTGKERGFSELQRMGIGLFISILSMI  444

Query  1581  SAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
              AA++EM RL + K  +L D    VPIS+FWQ+PQY ++G +E+FTFIGQLEFFYDQ+PD
Sbjct  445   VAALVEMKRLQLAKELDLVDQNVAVPISIFWQIPQYVLVGASEIFTFIGQLEFFYDQSPD  504

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSALSL T A+GNYLSSF++T+V  +TT++G PGW+ +NLN GHLDYFF L+A L
Sbjct  505   AMRSLCSALSLLTTALGNYLSSFILTVVTTVTTKDGNPGWIPDNLNEGHLDYFFLLIAGL  564

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +NL V+V+ A  Y  KKA
Sbjct  565   SFLNLLVYVLCAAKYKCKKA  584



>ref|XP_010105518.1| Peptide transporter [Morus notabilis]
 gb|EXC05013.1| Peptide transporter [Morus notabilis]
Length=1129

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 428/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT DG++D   +P  K  TG WKACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  564   EGNGLYTGDGSVDIHGKPVLKRNTGNWKACPFILGTECCERLAYYGIATNLVTYLTKKLH  623

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY IGM  +TLSA+VP 
Sbjct  624   EGNVSAARNVTTWSGTCYLTPLIGAILADAYWGRYWTIAVFSTIYFIGMCTLTLSASVPA  683

Query  672   ISP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             + P  C   E  + T     V F  LY++ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  684   LKPPECFGSECPSATPAQYAVFFFGLYMIALGTGGIKPCVSSFGADQFDDTDPGERVKKG  743

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SS +VWIQ+   WG GFG+PA+ M +A+  FF+GT LYR+QKP
Sbjct  744   SFFNWFYFSINIGALISSSFLVWIQENAGWGIGFGIPALFMGLAIASFFAGTSLYRFQKP  803

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK   +VP D +LL ET    S I+GSRKL H++EL   DKAAV
Sbjct  804   GGSPVTRMSQVLVASCRKWNQEVPKDSTLLFETQDKSSAIEGSRKLEHSDELECLDKAAV  863

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E   G FS PWRLCTVTQVEELK +IR+ PIWATGI+F+ VY QMST FV Q   M
Sbjct  864   ITDSETNSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFAAVYAQMSTMFVEQGTMM  923

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVP+YD +IVP+ARKFTG + G + LQRMG+GLF+S
Sbjct  924   DTSIGSFTIPPASLSTFDVISVIFWVPVYDTVIVPIARKFTGKERGFSELQRMGIGLFLS  983

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AAV+E+ RL + K  +L D    VPIS+FWQVPQYF++G AE+FTFIGQLEFFY
Sbjct  984   VLCMSAAAVVEINRLQLAKELDLVDKPVAVPISIFWQVPQYFLLGAAEIFTFIGQLEFFY  1043

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSALSL T ++GNYLSSF++T+V   TT+ GKPGW+ +NLN GHLDYFFW
Sbjct  1044  DQSPDAMRSLCSALSLLTTSLGNYLSSFILTVVTYFTTQGGKPGWIPDNLNEGHLDYFFW  1103

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+  +VV AK Y  K A
Sbjct  1104  LLAGLSFLNMLAYVVCAKKYKQKLA  1128


 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/550 (57%), Positives = 399/550 (73%), Gaps = 3/550 (1%)
 Frame = +3

Query  324   VYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTI  503
             +YT DG++D   +P  K  TG WKAC FILG EC ERLA+YG+S+NL+ Y   +L++  +
Sbjct  13    LYTGDGSVDINGKPVLKQNTGNWKACYFILGTECCERLAFYGISTNLVTYLTNKLHEGNV  72

Query  504   SASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPT  683
             SA+K+ + W GTCY+ PL+GA LADAYLGRYWTIA FS+IY +GM  + LSA+VP + P 
Sbjct  73    SAAKHATIWQGTCYLTPLLGATLADAYLGRYWTIAAFSMIYFLGMCALILSASVPALRPA  132

Query  684   CIAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  860
                   C + T     V    LYLVALGTGGIKPCVS +GADQFDDTD  ER  K SFFN
Sbjct  133   ECTGSVCPSATLAQQAVFLFGLYLVALGTGGIKPCVSPFGADQFDDTDSMERMKKGSFFN  192

Query  861   WFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSP  1040
             WFYFSI IG L++S+LIVWI+  V WG GFGV A+ + +A+  F SGT  YR+Q PG SP
Sbjct  193   WFYFSIYIGILMSSTLIVWIEDNVGWGPGFGVLALFVGIAIAGFISGTPRYRFQTPGESP  252

Query  1041  FTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESD  1220
              TR+ QV+VAS RK  +KVP D S+L ET    S I+GS +++HT  L+F DKAAV+   
Sbjct  253   ITRMCQVLVASCRKWNLKVPSDGSVLFETREKSSVIEGSYEVNHTATLKFLDKAAVISDA  312

Query  1221  EYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYV  1397
             E   G FS PWRLCTVTQVEELK++I LLPIWA+GI  STVY Q+ST FV Q + M+   
Sbjct  313   EISSGDFSNPWRLCTVTQVEELKTLIHLLPIWASGIFISTVYIQVSTMFVEQGMMMDRTF  372

Query  1398  GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAM  1577
             G   IP ASL  FD +SV+  +PIYD L VPMARKFTG + G+T LQRMG+GLFIS+L M
Sbjct  373   GFLTIPSASLLTFDVISVLFLLPIYDSLFVPMARKFTGEEKGITVLQRMGIGLFISVLCM  432

Query  1578  VSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAP  1754
              +AAV+E+ RL + K  +L D    VP+S+ WQ+PQY ++G AE+FT++GQLEFFY+Q+P
Sbjct  433   AAAAVIEITRLRLAKELDLVDKKVAVPLSILWQIPQYILMGTAEIFTYVGQLEFFYEQSP  492

Query  1755  DSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAV  1934
             D ++SLC++L L T ++G YL+SF++TIV   TT  G  GW+ +NLN GHLDYFFWLLA 
Sbjct  493   DGLQSLCTSLCLCTISLGYYLNSFILTIVTYFTTEGGNVGWIPDNLNEGHLDYFFWLLAG  552

Query  1935  LSVMNLGVFV  1964
             LSV+N+ V++
Sbjct  553   LSVLNMLVYM  562



>emb|CDP05420.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/565 (60%), Positives = 430/565 (76%), Gaps = 3/565 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E + +YT+DG++D   +P  K+ TG W+ACPFILG EC ERLAYYG+++NL+ Y   +++
Sbjct  66    ESNGLYTRDGSVDINGKPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTKKMH  125

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W GTCY+ PL+GA +ADAY GRYWTIATFS IY IGM  ++LSA+VP 
Sbjct  126   EGNVSAARNVTTWQGTCYLTPLIGAVVADAYWGRYWTIATFSTIYFIGMCTLSLSASVPA  185

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     + T     + FI LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  186   FRPVECVDSVCPSATSAQYAILFIGLYLIALGTGGIKPCVSSFGADQFDDTDPKERAKKG  245

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFS+NIGA V+SSLIVWIQ    WG GFG+PAV MA+A+  FFSGT LYR+QKP
Sbjct  246   SFFNWFYFSVNIGAFVSSSLIVWIQDNAGWGLGFGIPAVFMAIAIVSFFSGTPLYRFQKP  305

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  + VP D +LL+ET    S I+GSRKL HT+EL+  DKAAV
Sbjct  306   GGSPITRMCQVLVASCRKWGLPVPEDSNLLYETQDEFSAIEGSRKLFHTDELKCLDKAAV  365

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             +   E K G  S PW++CTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q   M
Sbjct  366   ISEAEIKTGDLSNPWKICTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGTMM  425

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F IP ASLS FD +SVI WVP+YDR++VP+ARKFTG + G T LQRMG+GLF+S
Sbjct  426   DTSIGSFTIPAASLSTFDVISVIFWVPVYDRILVPIARKFTGKERGFTELQRMGIGLFVS  485

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +  M +AAV+E+ RL + +   L D    VP+++FWQVPQYF++G AEVF FIGQLEFFY
Sbjct  486   VFCMAAAAVVEIKRLQLARDLGLVDEAVAVPLNIFWQVPQYFLLGAAEVFFFIGQLEFFY  545

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLC+ALSL T  +GNYLS+ ++T+V  ITTR GK GW+ +NLN GHLDYFFW
Sbjct  546   DQSPDAMRSLCAALSLLTTCLGNYLSALILTVVTTITTRGGKFGWIPDNLNEGHLDYFFW  605

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKKA  1997
             LLA LS +N+ +++  AK Y  KKA
Sbjct  606   LLAGLSFLNMVIYIFCAKAYKSKKA  630



>ref|XP_002992551.1| hypothetical protein SELMODRAFT_448814 [Selaginella moellendorffii]
 gb|EFJ06357.1| hypothetical protein SELMODRAFT_448814 [Selaginella moellendorffii]
Length=589

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/572 (58%), Positives = 433/572 (76%), Gaps = 13/572 (2%)
 Frame = +3

Query  303   EAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQT  482
             E +E++   TKDGT+D++N PA++  TG WKACP+ILGNEC ERLAYYGMS NL+++   
Sbjct  19    EDLEKESFITKDGTVDWKNNPADRRTTGGWKACPYILGNECCERLAYYGMSINLVVFLTD  78

Query  483   RLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSAT  662
             +L+Q   +AS N++NWSGTC I PL+GAFLADAYLGRYWTIA FS +Y +GM L+TLSA+
Sbjct  79    KLHQHNATASTNVTNWSGTCDITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTLSAS  138

Query  663   VPGISPTCIAHEKCTVTGRDTMVCF-IALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  839
             VP + P     + C       +  F +ALYLVALGTGGIKPCVS++GADQFDD D  E+K
Sbjct  139   VPSLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSTFGADQFDDEDPSEKK  198

Query  840   HKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRY  1019
             + + FFNWFYFSIN+GA++AS+ +V+IQQ V+W WGFG+PA AM +A+  FF G++ YR+
Sbjct  199   YMTVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVSFFIGSKQYRH  258

Query  1020  QKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDK  1199
             QKPGGSP TR+ QVIVA++R  ++++P D+++L+E  G  S I+GSRK+ HT E  F DK
Sbjct  259   QKPGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDGKASAIEGSRKIQHTAEYSFLDK  318

Query  1200  AAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAI  1379
             AA+    E K    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QMST FV Q +
Sbjct  319   AAI----EDKSRPTTKWNLCTVTQVEEVKILLRIVPIWASVIVFSTVYAQMSTLFVVQGL  374

Query  1380  GMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLF  1559
              M+  +GTFK+P ASLS+FD LSV++ VPIYDRL+VP  RK+TGH  G T LQRMG+GL 
Sbjct  375   KMDYILGTFKVPSASLSMFDPLSVLILVPIYDRLLVPFVRKYTGHPQGFTQLQRMGIGLV  434

Query  1560  ISILAMVSAAVLEMVRLAMVKRHNLYDVTE--------VPISVFWQVPQYFIIGCAEVFT  1715
             IS ++MV AAVLE+ RL + +   L D  +          +S+FWQ+PQYFIIG +EVFT
Sbjct  435   ISTISMVVAAVLEIQRLRVAREKGLVDADDKNFPKLLNAQLSIFWQIPQYFIIGASEVFT  494

Query  1716  FIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLN  1895
             FIGQLEFFY+Q+PD+MRSL SALSL T A+GNYLSS LVTIV  IT R+GKPGW+A+NLN
Sbjct  495   FIGQLEFFYEQSPDAMRSLGSALSLATVALGNYLSSLLVTIVTKITRRDGKPGWIADNLN  554

Query  1896  YGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYK  1991
             +GH+DYFFWLL  LSV+N   ++  A  + YK
Sbjct  555   HGHIDYFFWLLVALSVVNFLFYLPFAYRFKYK  586



>dbj|BAJ95092.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/560 (60%), Positives = 424/560 (76%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D+   P  K KTG WKACPFILGNEC ERLAYYG+S+NL+ Y   +L+    S
Sbjct  25    YTGDGSVDFSGNPVVKEKTGRWKACPFILGNECCERLAYYGISTNLVTYLTKKLHDGNSS  84

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTC  686
             A++N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM+++TLSA+VP + P  
Sbjct  85    AARNVTTWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMSVLTLSASVPMLMPPS  144

Query  687   IAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
                  C   +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFFNW
Sbjct  145   CEGAICPEASPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERIQKGSFFNW  204

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGAL++SS +VW+Q  + WG GFG+P V M +A+  FF+GT LYR+QKPGGSP 
Sbjct  205   FYFSINIGALISSSFLVWVQDNLGWGLGFGIPTVFMGLAIISFFAGTSLYRFQKPGGSPI  264

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+ A+LRK    VP D +LL+E     S I+GSR+L HT+ELR  DKAA +   +
Sbjct  265   TRVCQVVAATLRKWNAHVPEDSALLYELPDGVSAIEGSRQLEHTDELRCLDKAATITDLD  324

Query  1224  YKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              K+ SF +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q + ++  +G
Sbjct  325   VKEDSFNNPWRVCTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGMVLDPTIG  384

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
             +FKIP ASLS FD +SVI+WVPIYD ++VP+AR+FTG + G + LQRMG+GL ISILAM 
Sbjct  385   SFKIPPASLSTFDVVSVIIWVPIYDSILVPIARRFTGKERGFSELQRMGIGLIISILAMS  444

Query  1581  SAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +AAVLE+ RLA+ +  +L D    VP+S+ WQ+PQYF++G +EVFTFIG LEFFYDQ+PD
Sbjct  445   AAAVLEIKRLAIAREAHLVDQNVPVPLSILWQIPQYFLVGASEVFTFIGALEFFYDQSPD  504

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSAL L T A+GNYLS+F++T+VA  TTR G+PGW+ +NLN G LD FFWLLA L
Sbjct  505   AMRSLCSALQLITTALGNYLSAFILTMVAYFTTRGGRPGWIPDNLNEGRLDNFFWLLAGL  564

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +N  V+VV A  +  KKA
Sbjct  565   SFLNFLVYVVCANRFKSKKA  584



>gb|ACN26865.1| unknown [Zea mays]
 gb|AFW80032.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
Length=549

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/534 (64%), Positives = 419/534 (78%), Gaps = 5/534 (1%)
 Frame = +3

Query  414   GNECSERLAYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGR  593
              NEC ERLAYYGMS+NL+ Y +TRL Q    AS N++NW GTCYI PL+GAF ADAY+GR
Sbjct  6     ANECCERLAYYGMSTNLVNYMKTRLGQVNSVASNNVTNWQGTCYITPLIGAFFADAYMGR  65

Query  594   YWTIATFSIIYVIGMTLMTLSATVPGISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTG  770
             +WTIA F IIY+ G+ L+T++++V G+ PT C   + C  T     V F+ALYL+ALGTG
Sbjct  66    FWTIAIFMIIYIFGLALLTMASSVKGLVPTSCGDKDVCHPTDAQAAVVFVALYLIALGTG  125

Query  771   GIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGF  950
             GIKPCVSS+GADQFD+ DE+E+K KSSFFNWFYFSINIGALVAS+++V++Q  V WGWGF
Sbjct  126   GIKPCVSSFGADQFDENDEREKKSKSSFFNWFYFSINIGALVASTVLVYVQTHVGWGWGF  185

Query  951   GVPavamamavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETS  1130
             G+PAV MA+AV  FF GT LYR+QKPGGSP TR+ QV+VA  RK  V VP DKS LHET 
Sbjct  186   GIPAVVMAIAVGSFFVGTPLYRHQKPGGSPLTRIAQVLVACARKWNVAVPADKSRLHETV  245

Query  1131  GLESNIQGSRKLSHTNELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPI  1310
               ES I+GSRKL H+ +L   D+AAVV +++  +   SPWRLC+VTQVEELKS+IRLLPI
Sbjct  246   DGESVIEGSRKLEHSEQLACLDRAAVVTAEDGAEA--SPWRLCSVTQVEELKSVIRLLPI  303

Query  1311  WATGIIFSTVYGQMSTQFVSQAIGMNTYVGT-FKIPEASLSVFDTLSVIVWVPIYDRLIV  1487
             WA+GI+F+ VY QMST FV Q   ++  +G  FKIP A+LS+ DT+SVIVWVP+YDR IV
Sbjct  304   WASGIVFAAVYSQMSTMFVLQGNTLDQSMGPRFKIPSATLSMVDTISVIVWVPVYDRAIV  363

Query  1488  PMARKFTGHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVTE-VPISV  1664
             P+ R +TG   G T LQRMG+GL +SI +MV+A VL++VRL  + RH LY   + VPIS+
Sbjct  364   PLVRSYTGRPRGFTQLQRMGIGLVVSIFSMVAAGVLDIVRLRAIARHGLYGEDDIVPISI  423

Query  1665  FWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVA  1844
             FWQ+PQYFIIGCAEVFTF+GQLEFFYDQAPD+MRS+CSALSLTT A+GNYLS+ LVTIV 
Sbjct  424   FWQIPQYFIIGCAEVFTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTVLVTIVT  483

Query  1845  DITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAINK  2006
              ITTR+G+ GW+  NLN GHLDYFFWLLAVLS++N   ++V+A  Y YKK  + 
Sbjct  484   HITTRHGRIGWIPENLNRGHLDYFFWLLAVLSLLNFLAYLVIASWYKYKKTADD  537



>ref|XP_010939960.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Elaeis guineensis]
Length=585

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/564 (61%), Positives = 429/564 (76%), Gaps = 3/564 (1%)
 Frame = +3

Query  315   EDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  494
             E + YT DG++D    P  K+ TG W+ACPFILGNEC ERLAYYG+S+NL+ Y   +L++
Sbjct  21    EKEPYTGDGSIDIHGNPVLKDCTGNWRACPFILGNECCERLAYYGISTNLVSYLTKKLHE  80

Query  495   STISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGI  674
                SA++N++ W GTCY+ PLVGA LADAY GRYWTIA FS IY +GM  +TLSA+VP  
Sbjct  81    GNASAARNVTTWQGTCYLTPLVGAILADAYWGRYWTIAVFSTIYFLGMGTLTLSASVPAF  140

Query  675   SP-TCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  851
              P +C+       +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KE+  K+S
Sbjct  141   KPPSCVGPVCPEASAAQYAVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKEKVKKAS  200

Query  852   FFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPG  1031
             FFNWFYFSINIGAL++SS +VW+Q    WG GFG+P + M +A+  FF GT LYR+Q+PG
Sbjct  201   FFNWFYFSINIGALISSSFLVWVQDNCGWGLGFGIPTLFMGLAIISFFLGTSLYRFQRPG  260

Query  1032  GSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVV  1211
             GSP TR+ QV+VASLRK KV+VP D SLL+E +   S I+GSRKL H++EL F DKAA V
Sbjct  261   GSPITRVCQVVVASLRKWKVEVPHDSSLLYELTDKTSAIEGSRKLEHSDELIFLDKAATV  320

Query  1212  ESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                + K  SFS PWRLCTVTQVEELK ++R+ PIWAT I+FS VY Q+ST FV Q + ++
Sbjct  321   SELDEKTESFSNPWRLCTVTQVEELKILVRMFPIWATTIVFSAVYAQISTMFVEQGMVLD  380

Query  1389  TYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
             T +G+F IP ASLS FD +SVIVWVP+YDR+ VP+AR+FTG   G + LQRMG+GL ISI
Sbjct  381   TTIGSFTIPPASLSTFDVISVIVWVPVYDRIFVPIARRFTGKDKGFSELQRMGIGLLISI  440

Query  1569  LAMVSAAVLEMVRLAMVKRHNL-YDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             LAM +AA+LE+ RL++ K  +L +    VP+S+FWQ+PQY ++G AEVFTFIGQLEFFYD
Sbjct  441   LAMAAAALLEIKRLSIAKAEHLEHQKVAVPLSIFWQIPQYSLVGLAEVFTFIGQLEFFYD  500

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             Q+PD+MRSLCSALSL T A+GNYLSSF++T+V  I TR GK GW+ +NLN GHLDYFFWL
Sbjct  501   QSPDAMRSLCSALSLLTTALGNYLSSFILTVVTSIMTRGGKAGWIPDNLNEGHLDYFFWL  560

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA LS +NL V+V  A  Y  K+A
Sbjct  561   LAGLSFLNLLVYVYCAMRYKSKRA  584



>ref|XP_007205100.1| hypothetical protein PRUPE_ppa014631mg [Prunus persica]
 gb|EMJ06299.1| hypothetical protein PRUPE_ppa014631mg [Prunus persica]
Length=530

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/565 (62%), Positives = 425/565 (75%), Gaps = 40/565 (7%)
 Frame = +3

Query  309   MEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  488
             MEE+D++TKDGT+DY+NRPA K  TGTWKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEEEDIHTKDGTIDYQNRPAIKKNTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  489   NQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVP  668
             NQ  + A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA++ 
Sbjct  61    NQRNVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTLLTLSASLQ  120

Query  669   GISPTCIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
             G+ P C  +  C  TG    V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K+K 
Sbjct  121   GLKPPCDTNNVCHPTGLQAGVFFMGLYLIALGTGGIKPCVSSFGADQFDDSDEAEKKNKG  180

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGALVASS++VWIQ  V W WGFG+PAVAMA+AV  FF GTRLYR Q+P
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQTNVGWSWGFGIPAVAMALAVVSFFLGTRLYRNQRP  240

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV VAS  K +VKVP DKSLL+ET+  E  ++GSRKL HT EL F DKAAV
Sbjct  241   GGSPLTRICQVFVASFGKFRVKVPGDKSLLYETADEEPVVKGSRKLDHTEELSFLDKAAV  300

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
                 +  K S   WRLCTVTQVEELKS+++LLPIWATGIIFS VY QM T FV Q   M+
Sbjct  301   ETPSDKIKDSVMAWRLCTVTQVEELKSLVKLLPIWATGIIFSAVYSQMGTLFVLQGNTMD  360

Query  1389  TYV-GTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
              +V  +F+IP ASLS+FDT+SVI WVP+YDRLIVP  RKFT   +G T LQR+ +GL IS
Sbjct  361   LHVTKSFEIPSASLSLFDTISVIFWVPVYDRLIVPFVRKFTKRNNGFTQLQRIAIGLVIS  420

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             I AM++A  LE+VRL                                        EFFY+
Sbjct  421   IFAMLAAGTLELVRLN---------------------------------------EFFYE  441

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             QAPD+MRSLCSALSLTT A+G+YLS+ LV IV D++TR+GK GW+ +NLNYGHL YFFWL
Sbjct  442   QAPDAMRSLCSALSLTTAALGSYLSTMLVNIVTDVSTRDGKAGWIPDNLNYGHLHYFFWL  501

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKAI  2000
             LA LSVMNLG +++VA+ +TYK+A+
Sbjct  502   LACLSVMNLGFYLLVARWHTYKRAV  526



>ref|XP_010066525.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Eucalyptus grandis]
 gb|KCW64432.1| hypothetical protein EUGRSUZ_G02047 [Eucalyptus grandis]
Length=581

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/564 (60%), Positives = 427/564 (76%), Gaps = 4/564 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             +++ +YT DG++D    P  K+ TG W+ACPFILG EC ERLAYYG+++NL+ Y    ++
Sbjct  19    KQNGLYTGDGSVDVNGNPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVSYLTNNMH  78

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  +SA++N++ W+GTCY+ PL+GA +ADAY GRYWTIA FS IY  GM  +TLSATVP 
Sbjct  79    EGNVSAARNVTTWAGTCYLAPLIGAVVADAYWGRYWTIAAFSTIYFFGMCTLTLSATVPA  138

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     T T     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   FKPVECVGSLCPTTTPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPRERMKKG  198

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIGAL++SSL+VWIQ+   WGWGFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQENAGWGWGFGIPALFMGIAIASFFSGTPLYRFQRP  258

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VAS RK  +KVP D SLL+E     S I+GSRKL HT+EL+  DKAAV
Sbjct  259   GGSPITRMCQVLVASFRKWNIKVPEDGSLLYEMQ--NSAIEGSRKLEHTDELKCLDKAAV  316

Query  1209  VESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMN  1388
             +   E K G ++ W LCTVTQVEELK +IR+ PIWATGI+FS VY QMST FV Q + M+
Sbjct  317   LSDAEAKSGEYNSWNLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMMMD  376

Query  1389  TYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISI  1568
             T VG+F IP ASLS FD +SVI WVP+YD +IVP+ARKFTG + G + LQRMG+GLFIS+
Sbjct  377   TTVGSFAIPPASLSTFDVISVIFWVPVYDSIIVPIARKFTGKERGFSELQRMGIGLFISV  436

Query  1569  LAMVSAAVLEMVRLAMVKRHNL-YDVTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYD  1745
             LAM +AAV+E+ RL + +   L +    VP+S+ WQ+PQYF++G AEV TFIGQLEFFY+
Sbjct  437   LAMAAAAVVEIRRLQLARELGLAHQDVAVPLSILWQIPQYFLVGAAEVCTFIGQLEFFYE  496

Query  1746  QAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWL  1925
             Q+PD+MRSLCSAL+L T A+GNYLSS ++TIV   TT  GK GW+ NNLN GHLDY+FWL
Sbjct  497   QSPDAMRSLCSALALLTTALGNYLSSLILTIVTYFTTSGGKAGWIPNNLNEGHLDYYFWL  556

Query  1926  LAVLSVMNLGVFVVVAKMYTYKKA  1997
             LA LS  N+ V+VV AK Y  K+A
Sbjct  557   LAGLSFSNMLVYVVCAKRYKQKRA  580



>ref|XP_002972318.1| hypothetical protein SELMODRAFT_441824 [Selaginella moellendorffii]
 gb|EFJ26404.1| hypothetical protein SELMODRAFT_441824 [Selaginella moellendorffii]
Length=591

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/574 (58%), Positives = 435/574 (76%), Gaps = 13/574 (2%)
 Frame = +3

Query  300   SEAMEEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQ  479
             S  +E++   TKDGT+D++N PA++  TG WKACP+ILGNEC ERLAYYGMS NL+++  
Sbjct  20    SGDLEKESFITKDGTVDWKNNPADRRTTGGWKACPYILGNECCERLAYYGMSINLVVFLT  79

Query  480   TRLNQSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSA  659
              +L+Q   +AS N++NWSGTC I PL+GAFLADAYLGRYWTIA FS +Y +GM L+TLSA
Sbjct  80    DKLHQHNATASTNVTNWSGTCDITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTLSA  139

Query  660   TVPGISPTCIAHEKCTVTGRDTMVCF-IALYLVALGTGGIKPCVSSYGADQFDDTDEKER  836
             +VP + P     + C       +  F +ALYLVALGTGGIKPCVSS+GADQFDD D  E+
Sbjct  140   SVPSLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSSFGADQFDDEDLSEK  199

Query  837   KHKSSFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYR  1016
             K+ + FFNWFYFSIN+GA++AS+ +V+IQQ V+W WGFG+PA AM +A+  FF G++ YR
Sbjct  200   KYMTVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVGFFIGSKQYR  259

Query  1017  YQKPGGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFD  1196
             +QKPGGSP TR+ QVIVA++R  ++++P D+++L+E  G  S I+GSRK+ HT E  F D
Sbjct  260   HQKPGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDGKASAIEGSRKIQHTAEYSFLD  319

Query  1197  KAAVVESDEYKKGSFSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQA  1376
             KAA+    E +    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QMST FV Q 
Sbjct  320   KAAI----ENQSRPTTKWNLCTVTQVEEVKILLRIVPIWASVIVFSTVYAQMSTLFVVQG  375

Query  1377  IGMNTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGL  1556
             + M+  +GTFK+P ASLS+FD LSV++ VPIYDRL+VP  RK+TGH  G T LQRMG+GL
Sbjct  376   LKMDYILGTFKVPSASLSMFDPLSVLILVPIYDRLLVPFVRKYTGHPQGFTQLQRMGIGL  435

Query  1557  FISILAMVSAAVLEMVRLAMVKRHNLYDVTE--------VPISVFWQVPQYFIIGCAEVF  1712
              IS ++MV AAVLE+ RL + +   L D  +          +S+FWQ+PQYFIIG +EVF
Sbjct  436   VISTISMVVAAVLEIQRLRVAREKGLVDADDKNFPKLLNAQLSIFWQIPQYFIIGASEVF  495

Query  1713  TFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNL  1892
             TFIGQLEFFY+Q+PD+MRSL SALSL T A+GNYLSS LVTIV  IT R+GKPGW+A+NL
Sbjct  496   TFIGQLEFFYEQSPDAMRSLGSALSLATVALGNYLSSLLVTIVTKITRRDGKPGWIADNL  555

Query  1893  NYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKK  1994
             N+GH++YFFWLLA LSV+N   ++  A  + YK+
Sbjct  556   NHGHINYFFWLLAALSVVNFLFYLSFAYRFKYKE  589



>ref|NP_001051098.1| Os03g0719900 [Oryza sativa Japonica Group]
 dbj|BAB62326.1| peptide transporter [Oryza sativa Japonica Group]
 dbj|BAB62327.1| peptide transporter [Oryza sativa Japonica Group]
 gb|AAT77837.1| putative peptide transporter 1 [Oryza sativa Japonica Group]
 gb|ABF98582.1| Peptide transporter PTR2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13012.1| Os03g0719900 [Oryza sativa Japonica Group]
 dbj|BAG93866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76085.1| hypothetical protein OsI_13317 [Oryza sativa Indica Group]
Length=593

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/560 (59%), Positives = 418/560 (75%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D+   P  K +TG W+ACPFILGNEC ERLAYYG+S+NL+ Y   +L+    S
Sbjct  33    YTGDGSVDFSGNPVVKERTGRWRACPFILGNECCERLAYYGISTNLVTYLTKKLHDGNAS  92

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTC  686
             A+ N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM ++TLSA+VP   P  
Sbjct  93    AASNVTAWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMAVLTLSASVPTFMPPP  152

Query  687   IAHEKCTVTGR-DTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
                  C         V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFFNW
Sbjct  153   CEGSFCPPANPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPVERIQKGSFFNW  212

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGAL++SS +VW+Q  + WG GFG+P + M +A+  FFSGT LYR+QKPGGSP 
Sbjct  213   FYFSINIGALISSSFLVWVQDNIGWGIGFGIPTIFMGLAIISFFSGTSLYRFQKPGGSPI  272

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+VAS RK  V VP D S L+E     S I+GSR+L HT+ELR  DKAA +   +
Sbjct  273   TRVCQVVVASFRKWNVHVPEDSSRLYELPDGASAIEGSRQLEHTDELRCLDKAATITDLD  332

Query  1224  YKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              K  SF+ PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q + ++T VG
Sbjct  333   VKADSFTNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGMMLDTSVG  392

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
              FKIP ASLS FD +SVI+WVP+YD ++VP+AR+FTG+  G T LQRMG+GL ISI +M 
Sbjct  393   PFKIPPASLSTFDVVSVIIWVPLYDSILVPIARRFTGNPRGFTELQRMGIGLVISIFSMA  452

Query  1581  SAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +AAVLE+ RL + +  +L D    VP+++ WQ+PQYF++G +EVFTF+G LEFFYDQ+PD
Sbjct  453   AAAVLEIKRLDIARAEHLVDQNVPVPLNICWQIPQYFLVGASEVFTFVGSLEFFYDQSPD  512

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSAL L T A+GNYLS+F++T+VA  TTR G PGW+ +NLN GHLDYFFWLLA L
Sbjct  513   AMRSLCSALQLVTTALGNYLSAFILTLVAYFTTRGGNPGWIPDNLNQGHLDYFFWLLAGL  572

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +N  ++V+ A  Y  KKA
Sbjct  573   SFLNFVIYVICANKYKSKKA  592



>dbj|BAJ97409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/560 (60%), Positives = 423/560 (76%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D+   P  K KTG WKACPFILGNEC ERLAYYG+S+NL+ Y   +L+    S
Sbjct  25    YTGDGSVDFSGNPVVKEKTGRWKACPFILGNECCERLAYYGISTNLVTYLTKKLHDGNSS  84

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTC  686
             A++N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM+++TLSA+VP + P  
Sbjct  85    AARNVTTWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMSVLTLSASVPMLMPPS  144

Query  687   IAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
                  C   +     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFFNW
Sbjct  145   CEGAICPEASPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERIQKGSFFNW  204

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGAL++SS +VW+Q  + WG GFG+P V M +A+  FF+GT LYR+QKPGGSP 
Sbjct  205   FYFSINIGALISSSFLVWVQDNLGWGLGFGIPTVFMGLAIISFFAGTSLYRFQKPGGSPI  264

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+ A+LRK    VP D +LL+E     S I+GSR+L HT+ELR  DKAA +   +
Sbjct  265   TRVCQVVAATLRKWNAHVPEDSALLYELPDGVSAIEGSRQLEHTDELRCLDKAATITDLD  324

Query  1224  YKKGSF-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              K+ SF +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q + ++  +G
Sbjct  325   VKEDSFNNPWRVCTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGMVLDPTIG  384

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
             +FKIP ASLS FD +SVI+WVPIYD ++VP+AR+FTG + G + LQRMG+GL ISILAM 
Sbjct  385   SFKIPPASLSTFDVVSVIIWVPIYDSILVPIARRFTGKERGFSELQRMGIGLIISILAMS  444

Query  1581  SAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +AAVLE+ RLA+ +  +L D    VP+S+ WQ+PQYF++G +EVFTFIG LEFFYDQ+PD
Sbjct  445   AAAVLEIKRLAIAREAHLVDQNVPVPLSILWQIPQYFLVGASEVFTFIGALEFFYDQSPD  504

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSAL   T A+GNYLS+F++T+VA  TTR G+PGW+ +NLN G LD FFWLLA L
Sbjct  505   AMRSLCSALQPITTALGNYLSAFILTMVAYFTTRGGRPGWIPDNLNEGRLDNFFWLLAGL  564

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +N  V+VV A  +  KKA
Sbjct  565   SFLNFLVYVVCANRFKSKKA  584



>gb|EEE59822.1| hypothetical protein OsJ_12376 [Oryza sativa Japonica Group]
Length=593

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/560 (59%), Positives = 418/560 (75%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D+   P  K +TG W+ACPFILGNEC ERLAYYG+S+NL+ Y   +L+    S
Sbjct  33    YTGDGSVDFSGNPVVKERTGRWRACPFILGNECCERLAYYGISTNLVTYLTKKLHDGNAS  92

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTC  686
             A+ N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM ++TLSA+VP   P  
Sbjct  93    AASNVTAWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMAVLTLSASVPTFMPPP  152

Query  687   IAHEKCTVTGR-DTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
                  C         V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFFNW
Sbjct  153   CEGSFCPPANPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPVERIQKGSFFNW  212

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGAL++SS +VW+Q  + WG GFG+P + M +A+  FFSGT LYR+QKPGGSP 
Sbjct  213   FYFSINIGALISSSFLVWVQDNIGWGIGFGIPTIFMGLAIISFFSGTSLYRFQKPGGSPI  272

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+VAS RK  V VP D S L+E     S I+GSR+L HT+ELR  DKAA +   +
Sbjct  273   TRVCQVVVASFRKWNVHVPEDSSRLYELPDGASAIEGSRQLEHTDELRCLDKAATITDLD  332

Query  1224  YKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              K  SF+ PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q + ++T VG
Sbjct  333   VKADSFTNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGMMLDTSVG  392

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
              FKIP ASLS FD +SVI+WVP+YD ++VP+AR+FTG+  G T LQRMG+GL ISI +M 
Sbjct  393   PFKIPPASLSTFDVVSVIIWVPLYDSILVPIARRFTGNPRGFTELQRMGIGLVISIFSMA  452

Query  1581  SAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +AAVLE+ RL + +  +L D    VP+++ WQ+PQYF++G +EVFTF+G LEFFYDQ+PD
Sbjct  453   AAAVLEIKRLDIARAEHLVDQNVPVPLNICWQIPQYFLVGASEVFTFVGSLEFFYDQSPD  512

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSAL L T A+GNYLS+F++T+VA  TTR G PGW+ +NLN GHLDYFFWLLA L
Sbjct  513   AMRSLCSALQLVTTALGNYLSAFILTLVAYFTTRGGNPGWIPDNLNQGHLDYFFWLLAGL  572

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +N  ++V+ A  Y  KKA
Sbjct  573   SFLNFVIYVICANKYKSKKA  592



>ref|XP_006650508.1| PREDICTED: peptide transporter PTR2-like [Oryza brachyantha]
Length=595

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/560 (59%), Positives = 419/560 (75%), Gaps = 3/560 (1%)
 Frame = +3

Query  327   YTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTIS  506
             YT DG++D+   P  K +TG W+ACPFILGNEC ERLAYYG+S+NL+ Y   +L+    S
Sbjct  35    YTGDGSVDFSGNPVVKERTGRWRACPFILGNECCERLAYYGISTNLVTYLTKKLHDGNSS  94

Query  507   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTC  686
             A+ N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY IGM ++T+SA+VP   P  
Sbjct  95    AASNVTAWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMAILTMSASVPTFMPPP  154

Query  687   IAHEKC-TVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  863
                  C         V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFFNW
Sbjct  155   CEGSFCPEANPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPVERIQKGSFFNW  214

Query  864   FYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPF  1043
             FYFSINIGAL++SS +VW+Q  + WG GF +P + M +A+  FF+GT LYR+QKPGGSP 
Sbjct  215   FYFSINIGALISSSFLVWVQDNIGWGIGFAIPTIFMGLAIISFFAGTSLYRFQKPGGSPI  274

Query  1044  TRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDE  1223
             TR+ QV+VASLRK  + VP D SLL+E     S I+GSR+L HT+ELR  DKAA +   +
Sbjct  275   TRVCQVVVASLRKWNIHVPEDSSLLYELPDGVSAIEGSRQLEHTDELRCLDKAATITDLD  334

Query  1224  YKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG  1400
              K  SF+ PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QMST FV Q + ++T VG
Sbjct  335   VKADSFTNPWRVCTVTQVEELKILVRMFPVWATTIVFSAVYAQMSTMFVEQGMMLDTSVG  394

Query  1401  TFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMV  1580
              FKIP ASLS FD +SVI+WVP+YD ++VPMAR+FTG+  G T LQRMG+GL ISIL+M 
Sbjct  395   PFKIPPASLSTFDVVSVIIWVPLYDSILVPMARRFTGNPRGFTELQRMGIGLVISILSMA  454

Query  1581  SAAVLEMVRLAMVKRHNLYDVT-EVPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPD  1757
             +AAVLE+ RL + +  +L D    VP+++ WQ+PQYF++G +EVFTF+G LEFFYDQ+PD
Sbjct  455   AAAVLEIKRLEIARAEHLVDQNVPVPLNICWQIPQYFLVGASEVFTFVGSLEFFYDQSPD  514

Query  1758  SMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVL  1937
             +MRSLCSAL L T A+GNYLS+F++T+VA  TTR G PGW+ +NLN GHLDYFFWLLA L
Sbjct  515   AMRSLCSALQLLTTALGNYLSAFILTLVAYFTTRGGNPGWIPDNLNEGHLDYFFWLLAGL  574

Query  1938  SVMNLGVFVVVAKMYTYKKA  1997
             S +N  +++  A  Y  KKA
Sbjct  575   SFLNFVIYIFCANKYKSKKA  594



>dbj|BAK03852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/551 (62%), Positives = 424/551 (77%), Gaps = 4/551 (1%)
 Frame = +3

Query  390   WKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTISASKNLSNWSGTCYIMPLVGAF  569
             W+    +  NEC ERLAYYGMS+NL+ + + R+  +  +A+ N++NW GTCYI PL+GAF
Sbjct  80    WRRHDRVAANECCERLAYYGMSTNLVNFMKDRMGMANAAAANNVTNWGGTCYITPLIGAF  139

Query  570   LADAYLGRYWTIATFSIIYVIGMTLMTLSATVPGISPTCIAHEKCTVTGRDTMVCFIALY  749
             LADAYLGR+WTIA+F IIY+ G+ L+T++ +V G+ P C +   C  T   +   FIALY
Sbjct  140   LADAYLGRFWTIASFMIIYIFGLGLLTMATSVHGLVPACASKGVCDPTPGQSAAVFIALY  199

Query  750   LVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINIGALVASSLIVWIQQE  929
             L+ALGTGGIKPCVSS+GADQFD+ D+ ERK KSSFFNWFYFSINIGALVASS++V++Q  
Sbjct  200   LIALGTGGIKPCVSSFGADQFDEHDDVERKSKSSFFNWFYFSINIGALVASSVLVYVQTH  259

Query  930   VSWGWGFGVPavamamavTFFFSGTRLYRYQKPGGSPFTRLFQVIVASLRKRKVKVPIDK  1109
             V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP TR+ QV+VA+   RK+ V +D 
Sbjct  260   VGWSWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSPLTRIAQVLVAA--TRKLGVAVDG  317

Query  1110  SLLHETSGLESNIQGSRKLSHTNELRFFDKAAVVESDEYKKGSFSPWRLCTVTQVEELKS  1289
             S L+ET+  ES I+GSRKL HT + RF DKAAV    +    + SPWRLCTVTQVEELKS
Sbjct  318   SALYETADKESGIEGSRKLEHTRQFRFLDKAAVETQADRTAAAPSPWRLCTVTQVEELKS  377

Query  1290  IIRLLPIWATGIIFSTVYGQMSTQFVSQAIGMNTYVG-TFKIPEASLSVFDTLSVIVWVP  1466
             ++RLLPIWA+GI+F+TVYGQMST FV Q   ++  +G  FKIP ASLS+FDTLSVI WVP
Sbjct  378   VVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDASMGPKFKIPSASLSIFDTLSVIAWVP  437

Query  1467  IYDRLIVPMARKFTGHKSGLTHLQRMGVGLFISILAMVSAAVLEMVRLAMVKRHNLYDVT  1646
             +YDR++VP  R  TG   G T LQRMG+GL +S+ AM++A VLE+VRL  + +H LY   
Sbjct  438   VYDRILVPAVRSVTGRPRGFTQLQRMGIGLVVSMFAMLAAGVLELVRLRTIAQHGLYGEK  497

Query  1647  E-VPISVFWQVPQYFIIGCAEVFTFIGQLEFFYDQAPDSMRSLCSALSLTTNAIGNYLSS  1823
             + VPIS+FWQVPQYFIIGCAEVFTF+GQLEFFYDQAPD+MRS+CSALSLTT A+GNYLS+
Sbjct  498   DVVPISIFWQVPQYFIIGCAEVFTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLST  557

Query  1824  FLVTIVADITTRNGKPGWLANNLNYGHLDYFFWLLAVLSVMNLGVFVVVAKMYTYKKAIN  2003
              LVT+VA +TTR GK GW+ +NLN GHLDYFFWLLA LS++N  V++++A  YTYKK   
Sbjct  558   LLVTVVAKVTTRGGKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKKTAE  617

Query  2004  KVSDLVEEAEN  2036
                D    A +
Sbjct  618   DSPDAKGGAHD  628



>ref|XP_006346629.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum]
Length=585

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/564 (59%), Positives = 424/564 (75%), Gaps = 3/564 (1%)
 Frame = +3

Query  312   EEDDVYTKDGTLDYRNRPANKNKTGTWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  491
             E   +YT+DG++D    PA + +TG W+ACPFILGNEC ERLA++G++ NL+ Y   +L+
Sbjct  20    ENSGLYTRDGSVDINGNPALRGETGNWRACPFILGNECCERLAFFGIAGNLVTYLTKKLH  79

Query  492   QSTISASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVIGMTLMTLSATVPG  671
             +  + A++N++ W GTC + PL+GA +ADAY GRY TIATFSIIY +GM  +TLSA+VP 
Sbjct  80    EGNVPAARNVTTWLGTCSLTPLIGAVMADAYWGRYRTIATFSIIYFMGMCTLTLSASVPA  139

Query  672   ISPT-CIAHEKCTVTGRDTMVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  848
               P  C+     + T     + F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  140   FKPPDCVDSVCPSATPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVTKG  199

Query  849   SFFNWFYFSINIGALVASSLIVWIQQEVSWGWGFGVPavamamavTFFFSGTRLYRYQKP  1028
             SFFNWFYFSINIG L++S+LIVWIQQ   WG+GFG+PAV M +A+  FF GT LYR+Q+P
Sbjct  200   SFFNWFYFSINIGGLISSTLIVWIQQNYGWGFGFGIPAVFMGIAIASFFFGTPLYRFQRP  259

Query  1029  GGSPFTRLFQVIVASLRKRKVKVPIDKSLLHETSGLESNIQGSRKLSHTNELRFFDKAAV  1208
             GGSP TR+ QV+VA+  K  + VP D +LL+ET+   S I GSRKL HT+ELR  DKAAV
Sbjct  260   GGSPLTRICQVLVAAFHKWTLPVPDDSTLLYETTDKSSVIDGSRKLLHTDELRCLDKAAV  319

Query  1209  VESDEYKKGSFS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTQFVSQAIGM  1385
             V   E+K G +S  W+LCTVTQVEELK +IR+ PIWATGI+F  VY QM T FV Q   M
Sbjct  320   VSDTEWKTGDYSNAWKLCTVTQVEELKILIRMFPIWATGIVFYAVYAQMVTMFVEQGTAM  379

Query  1386  NTYVGTFKIPEASLSVFDTLSVIVWVPIYDRLIVPMARKFTGHKSGLTHLQRMGVGLFIS  1565
             +T +G+F+IP AS+ +FD +SVI+WVPIYDR++VP AR+ TG + G + LQR+G+GLF+S
Sbjct  380   DTAIGSFRIPPASILIFDAISVIIWVPIYDRILVPFARRLTGKERGFSKLQRIGIGLFLS  439

Query  1566  ILAMVSAAVLEMVRLAMVKRHNLYD-VTEVPISVFWQVPQYFIIGCAEVFTFIGQLEFFY  1742
             +L M +AA++E  RL + +   L D    VP+S+FWQ+PQYFI+G AE+FT IG LEFFY
Sbjct  440   VLCMSAAAIVEFKRLQIARHLGLVDEPVAVPLSIFWQIPQYFILGAAEIFTSIGHLEFFY  499

Query  1743  DQAPDSMRSLCSALSLTTNAIGNYLSSFLVTIVADITTRNGKPGWLANNLNYGHLDYFFW  1922
             DQ+PD+MRSLCSAL L TNA+G+YLSSF++T+V  ITT+ GKPGW+ NNLN GHLDYFFW
Sbjct  500   DQSPDAMRSLCSALPLMTNALGHYLSSFILTLVTSITTQGGKPGWIPNNLNSGHLDYFFW  559

Query  1923  LLAVLSVMNLGVFVVVAKMYTYKK  1994
             LLA LS  N  ++ + AKMY  KK
Sbjct  560   LLAALSFCNFVIYALCAKMYKSKK  583



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7014951869940