BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24407_g1_i1 len=468 path=[1:0-408 410:409-467]

Length=468
                                                                      Score     E

gb|AAP42505.1|  anionic peroxidase swpa6                                172   7e-49   Ipomoea batatas [batate]
gb|ADB03786.1|  anionic peroxidase                                      124   1e-30   Ipomoea batatas [batate]
gb|AAF00093.1|AF109124_1  anionic peroxidase swpa2                      121   7e-30   Ipomoea batatas [batate]
sp|O04796.1|PERN_IPOBA  RecName: Full=Neutral peroxidase; AltName...    119   4e-29   Ipomoea batatas [batate]
sp|O04795.1|PERA_IPOBA  RecName: Full=Anionic peroxidase; AltName...    117   3e-28   Ipomoea batatas [batate]
gb|AAP42503.1|  anionic peroxidase swpa4                                117   3e-28   Ipomoea batatas [batate]
gb|AAF00094.1|AF109123_1  anionic peroxidase Swpa3                      117   3e-28   Ipomoea batatas [batate]
ref|XP_004232770.1|  PREDICTED: suberization-associated anionic p...  91.3    6e-19   
ref|XP_006347168.1|  PREDICTED: suberization-associated anionic p...  87.0    2e-17   
gb|AAA33837.1|  anionic peroxidase                                    86.7    2e-17   Solanum tuberosum [potatoes]
sp|P12437.2|PERX_SOLTU  RecName: Full=Suberization-associated ani...  87.0    2e-17   Solanum tuberosum [potatoes]
ref|XP_004232771.1|  PREDICTED: suberization-associated anionic p...  86.3    3e-17   
emb|CAI48071.1|  anionic peroxidase                                   84.3    1e-16   Capsicum chinense [bonnet pepper]
ref|XP_009624638.1|  PREDICTED: suberization-associated anionic p...  84.3    2e-16   
ref|XP_009757218.1|  PREDICTED: suberization-associated anionic p...  82.8    7e-16   
ref|XP_006347167.1|  PREDICTED: suberization-associated anionic p...  82.0    1e-15   
gb|AHB59751.1|  Prx01                                                 79.7    9e-15   
ref|XP_009624637.1|  PREDICTED: suberization-associated anionic p...  78.6    2e-14   
ref|XP_009785236.1|  PREDICTED: suberization-associated anionic p...  77.4    6e-14   
ref|XP_009757217.1|  PREDICTED: suberization-associated anionic p...  77.4    6e-14   
ref|XP_009627391.1|  PREDICTED: suberization-associated anionic p...  77.0    6e-14   
ref|XP_009792332.1|  PREDICTED: suberization-associated anionic p...  77.0    7e-14   
ref|XP_009612987.1|  PREDICTED: suberization-associated anionic p...  76.3    1e-13   
dbj|BAD98314.1|  peroxidase                                           76.3    2e-13   Nicotiana tabacum [American tobacco]
ref|XP_006343273.1|  PREDICTED: suberization-associated anionic p...  72.8    2e-12   
ref|XP_004234138.1|  PREDICTED: suberization-associated anionic p...  72.8    2e-12   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                     70.5    1e-11   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                     70.5    1e-11   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                     69.7    2e-11   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                     69.3    3e-11   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010        69.3    4e-11   Sorghum bicolor [broomcorn]
ref|XP_007219390.1|  hypothetical protein PRUPE_ppa020254mg           68.9    5e-11   
ref|XP_008234083.1|  PREDICTED: peroxidase P7-like                    68.6    5e-11   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1          68.9    5e-11   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                     68.9    6e-11   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                     68.6    6e-11   
gb|ACU17608.1|  unknown                                               68.6    6e-11   Glycine max [soybeans]
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g           68.6    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002319968.2|  peroxidase family protein                        68.6    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                67.8    1e-10   Ricinus communis
gb|KHN44724.1|  Peroxidase 4                                          67.8    1e-10   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                  67.8    1e-10   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                     67.8    1e-10   
gb|ACM47317.1|  peroxidase                                            67.8    1e-10   Capsicum annuum
gb|ACU23245.1|  unknown                                               67.8    1e-10   Glycine max [soybeans]
ref|NP_001151940.1|  peroxidase 52 precursor                          67.8    1e-10   Zea mays [maize]
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                     67.8    1e-10   
emb|CAD67479.1|  peroxidase                                           67.8    1e-10   Asparagus officinalis
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                    67.8    1e-10   
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                     67.4    1e-10   
gb|AFV07575.1|  putative peroxidase a2                                66.6    2e-10   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                       67.4    2e-10   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg              67.0    2e-10   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                     67.0    2e-10   
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                    66.6    2e-10   
ref|XP_008369411.1|  PREDICTED: peroxidase P7-like                    67.0    3e-10   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                     66.6    3e-10   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                     67.0    3e-10   
ref|XP_007017044.1|  Peroxidase 68                                    67.8    3e-10   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                     66.6    3e-10   
gb|ACN33662.1|  unknown                                               66.6    3e-10   Zea mays [maize]
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                    66.6    3e-10   
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor   66.6    3e-10   Zea mays [maize]
ref|XP_011076613.1|  PREDICTED: peroxidase P7                         66.6    3e-10   
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010      66.6    3e-10   Sorghum bicolor [broomcorn]
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                     66.6    3e-10   
ref|XP_006838996.1|  hypothetical protein AMTR_s00002p00271820        66.2    3e-10   
gb|ADN96693.1|  peroxidase 6                                          66.2    4e-10   
dbj|BAA82306.1|  peroxidase                                           66.2    4e-10   Nicotiana tabacum [American tobacco]
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor   66.2    4e-10   
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990        66.2    5e-10   Sorghum bicolor [broomcorn]
emb|CDP13933.1|  unnamed protein product                              66.2    5e-10   
gb|AFK41406.1|  unknown                                               66.2    5e-10   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                    66.2    5e-10   
gb|AFK49101.1|  unknown                                               65.9    5e-10   
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                     65.9    5e-10   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                    65.9    5e-10   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  65.9    5e-10   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                          65.9    6e-10   Vitis vinifera
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                    65.9    6e-10   
gb|AFK45898.1|  unknown                                               65.9    6e-10   
gb|EMS53502.1|  Cationic peroxidase 1                                 64.7    6e-10   
emb|CAD67478.1|  peroxidase                                           65.5    6e-10   Asparagus officinalis
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                     65.9    6e-10   
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                    65.9    6e-10   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                         65.5    7e-10   
ref|XP_006842568.1|  hypothetical protein AMTR_s00077p00148760        65.5    7e-10   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg           65.5    7e-10   
ref|XP_007146856.1|  hypothetical protein PHAVU_006G075900g           65.5    7e-10   
ref|XP_004497330.1|  PREDICTED: cationic peroxidase 1-like            65.5    8e-10   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                     65.5    8e-10   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g           65.5    8e-10   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  65.5    8e-10   
ref|XP_002531320.1|  Cationic peroxidase 1 precursor, putative        65.5    8e-10   Ricinus communis
gb|AAC49362.1|  P17                                                   63.5    9e-10   Petunia x hybrida [garden petunia]
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                     65.1    1e-09   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg           65.1    1e-09   
ref|XP_002323054.1|  hypothetical protein POPTR_0016s14030g           65.1    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                     65.1    1e-09   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                          65.1    1e-09   
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                     65.1    1e-09   
ref|XP_010041825.1|  PREDICTED: peroxidase P7-like                    64.7    1e-09   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                     64.7    1e-09   
ref|XP_007142064.1|  hypothetical protein PHAVU_008G249500g           64.7    1e-09   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                     64.7    1e-09   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                    64.7    1e-09   
gb|EMT27941.1|  Cationic peroxidase 1                                 65.1    1e-09   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2          64.7    1e-09   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000        64.7    2e-09   Sorghum bicolor [broomcorn]
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                     64.7    2e-09   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1          64.7    2e-09   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                    64.7    2e-09   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                     64.7    2e-09   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                         64.7    2e-09   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor              64.3    2e-09   
ref|XP_011003590.1|  PREDICTED: peroxidase 2-like                     64.3    2e-09   
ref|XP_011003587.1|  PREDICTED: cationic peroxidase 1-like            64.3    2e-09   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor   64.3    2e-09   Zea mays [maize]
gb|AHL39144.1|  class III peroxidase                                  64.3    2e-09   
ref|XP_003602463.1|  Peroxidase                                       64.3    2e-09   
ref|XP_002308244.1|  peroxidase family protein                        64.3    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004308969.1|  PREDICTED: peroxidase 52-like                    64.3    2e-09   
ref|NP_001065971.1|  Os12g0112000                                     64.3    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011019031.1|  PREDICTED: peroxidase 2-like                     64.3    2e-09   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                     64.3    2e-09   
ref|XP_004490701.1|  PREDICTED: peroxidase 4-like                     64.3    2e-09   
gb|EAY79693.1|  hypothetical protein OsI_34840                        64.3    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002461211.1|  hypothetical protein SORBIDRAFT_02g042870        63.9    2e-09   Sorghum bicolor [broomcorn]
ref|XP_006365360.1|  PREDICTED: peroxidase 70-like                    63.9    2e-09   
ref|XP_007033587.1|  Peroxidase superfamily protein                   63.9    2e-09   
ref|XP_010041911.1|  PREDICTED: peroxidase P7-like                    63.9    2e-09   
ref|XP_007011229.1|  Peroxidase superfamily protein                   63.9    2e-09   
ref|XP_007033582.1|  Peroxidase superfamily protein                   63.9    3e-09   
ref|XP_010264469.1|  PREDICTED: peroxidase 2-like                     63.9    3e-09   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                    63.9    3e-09   
ref|XP_010042156.1|  PREDICTED: peroxidase P7-like                    63.9    3e-09   
gb|AAX44001.2|  putative secretory peroxidase                         63.9    3e-09   Catharanthus roseus [chatas]
gb|KHG09190.1|  Peroxidase 4                                          63.9    3e-09   
ref|XP_010093547.1|  Cationic peroxidase 1                            61.6    3e-09   
ref|XP_006468150.1|  PREDICTED: peroxidase 52-like                    63.5    3e-09   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                     63.9    3e-09   
ref|XP_010260327.1|  PREDICTED: peroxidase P7-like                    63.9    3e-09   
gb|KHG25850.1|  Peroxidase 4                                          63.9    3e-09   
ref|XP_002323056.1|  peroxidase family protein                        63.5    3e-09   Populus trichocarpa [western balsam poplar]
gb|ACU21377.1|  unknown                                               62.8    3e-09   Glycine max [soybeans]
ref|XP_003616748.1|  Peroxidase                                       63.5    3e-09   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                     63.5    3e-09   
gb|KFK27367.1|  hypothetical protein AALP_AA8G373800                  63.5    3e-09   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like            63.5    3e-09   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                     63.5    4e-09   
ref|XP_007033538.1|  Peroxidase superfamily protein                   63.5    4e-09   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like            63.5    4e-09   
dbj|BAJ97638.1|  predicted protein                                    63.5    4e-09   
ref|XP_010067589.1|  PREDICTED: peroxidase P7-like isoform X1         63.5    4e-09   
ref|XP_006833271.1|  hypothetical protein AMTR_s01371p00003540        61.2    4e-09   
ref|XP_010067590.1|  PREDICTED: peroxidase P7-like isoform X2         63.5    4e-09   
gb|ADN96692.1|  peroxidase 5                                          63.5    4e-09   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g           63.5    4e-09   
gb|EPS67864.1|  hypothetical protein M569_06908                       63.2    4e-09   
ref|XP_004958684.1|  PREDICTED: peroxidase 2-like                     63.2    4e-09   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                    63.2    5e-09   
ref|XP_001781580.1|  predicted protein                                63.5    5e-09   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                     63.2    5e-09   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                    63.2    5e-09   
gb|ACU24247.1|  unknown                                               61.2    5e-09   Glycine max [soybeans]
ref|XP_006848016.1|  hypothetical protein AMTR_s00029p00170730        60.5    5e-09   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                          63.2    5e-09   Vitis vinifera
gb|KHN08835.1|  Peroxidase 4                                          63.2    5e-09   
ref|XP_003544922.1|  PREDICTED: peroxidase 4                          63.2    5e-09   
ref|XP_003519284.1|  PREDICTED: peroxidase 4                          63.2    5e-09   
ref|XP_010041993.1|  PREDICTED: peroxidase P7-like                    63.2    5e-09   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like            63.2    6e-09   
emb|CAD67477.1|  peroxidase                                           62.8    6e-09   Asparagus officinalis
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                     63.2    6e-09   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                       63.2    6e-09   
ref|XP_003522118.1|  PREDICTED: cationic peroxidase 1-like            62.8    6e-09   
gb|KHN46282.1|  Peroxidase 4                                          63.2    6e-09   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like            62.8    6e-09   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                     63.2    6e-09   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like            62.8    6e-09   
gb|ABR23054.1|  basic peroxidase swpb4                                62.8    6e-09   Ipomoea batatas [batate]
gb|AAP42508.1|  anionic peroxidase swpb3                              62.8    6e-09   Ipomoea batatas [batate]
ref|NP_001060630.1|  Os07g0677400                                     62.8    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007219210.1|  hypothetical protein PRUPE_ppa017309mg           62.4    6e-09   
ref|XP_006401086.1|  hypothetical protein EUTSA_v10014097mg           62.8    7e-09   
gb|ACU24215.1|  unknown                                               62.8    7e-09   Glycine max [soybeans]
ref|XP_007134678.1|  hypothetical protein PHAVU_010G066800g           62.8    7e-09   
gb|KDP22790.1|  hypothetical protein JCGZ_00377                       62.8    7e-09   
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                     62.8    7e-09   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g           62.4    8e-09   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  62.8    8e-09   
ref|XP_009770760.1|  PREDICTED: cationic peroxidase 1-like            60.5    8e-09   
ref|XP_002268412.1|  PREDICTED: cationic peroxidase 1                 62.4    8e-09   Vitis vinifera
ref|XP_006481156.1|  PREDICTED: cationic peroxidase 1-like            62.4    9e-09   
gb|KDO49649.1|  hypothetical protein CISIN_1g021171mg                 62.4    9e-09   
ref|XP_010256953.1|  PREDICTED: cationic peroxidase 1-like            62.4    9e-09   
gb|ACF08088.1|  class III peroxidase                                  60.5    9e-09   Aegilops ventricosa
ref|XP_002531319.1|  Peroxidase 2 precursor, putative                 62.4    9e-09   Ricinus communis
gb|AFK43418.1|  unknown                                               60.1    1e-08   
gb|AFG53669.1|  hypothetical protein 0_8361_01                        58.9    1e-08   
gb|KHG02293.1|  Peroxidase 15                                         62.4    1e-08   
emb|CDY32701.1|  BnaA02g07630D                                        62.4    1e-08   
emb|CBI18065.3|  unnamed protein product                              62.8    1e-08   
gb|KHG18057.1|  Peroxidase 52 -like protein                           62.0    1e-08   
dbj|BAJ96226.1|  predicted protein                                    62.4    1e-08   
ref|XP_002323055.2|  peroxidase family protein                        62.0    1e-08   Populus trichocarpa [western balsam poplar]
gb|AHL39188.1|  class III peroxidase                                  62.0    1e-08   
ref|XP_008782618.1|  PREDICTED: cationic peroxidase 1-like            62.4    1e-08   
gb|AFK37048.1|  unknown                                               59.3    1e-08   
gb|AAP76387.1|  class III peroxidase                                  62.0    1e-08   Gossypium hirsutum [American cotton]
ref|XP_010087166.1|  Peroxidase 4                                     62.0    1e-08   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor   62.0    1e-08   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1         62.0    1e-08   
emb|CAA46916.1|  peroxidase                                           62.0    1e-08   Oryza sativa [red rice]
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like            62.0    1e-08   
ref|XP_011003588.1|  PREDICTED: peroxidase 2-like                     62.0    1e-08   
ref|NP_001060628.1|  Os07g0677200                                     62.0    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AAC49818.1|  peroxidase                                            62.0    1e-08   Oryza sativa [red rice]
ref|XP_007033588.1|  Peroxidase superfamily protein                   62.0    1e-08   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                    62.0    1e-08   
emb|CDX88673.1|  BnaA03g09760D                                        62.0    1e-08   
ref|XP_007134677.1|  hypothetical protein PHAVU_010G066700g           62.0    1e-08   
ref|XP_010067588.1|  PREDICTED: peroxidase 4-like                     62.0    1e-08   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                    62.0    1e-08   
ref|XP_008384727.1|  PREDICTED: peroxidase 4-like                     59.7    1e-08   
ref|XP_006665136.1|  PREDICTED: peroxidase 70-like                    59.7    1e-08   
emb|CDP04065.1|  unnamed protein product                              61.6    1e-08   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg           61.6    1e-08   
ref|XP_009132056.1|  PREDICTED: peroxidase 68-like                    61.6    2e-08   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like            62.0    2e-08   
ref|XP_006848011.1|  hypothetical protein AMTR_s00029p00169150        59.7    2e-08   
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like            62.0    2e-08   
ref|XP_002304018.2|  hypothetical protein POPTR_0003s21600g           62.0    2e-08   Populus trichocarpa [western balsam poplar]
gb|KDP22792.1|  hypothetical protein JCGZ_00379                       61.6    2e-08   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                     61.6    2e-08   
gb|KDP22791.1|  hypothetical protein JCGZ_00378                       61.6    2e-08   
ref|XP_011025199.1|  PREDICTED: peroxidase A2-like                    62.0    2e-08   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like            61.6    2e-08   
gb|AFW86733.1|  peroxidase 52                                         61.6    2e-08   
gb|EPS59568.1|  hypothetical protein M569_15235                       61.6    2e-08   
ref|XP_009126754.1|  PREDICTED: peroxidase 67                         61.6    2e-08   
ref|NP_001147254.1|  peroxidase 52 precursor                          61.6    2e-08   Zea mays [maize]
ref|NP_001060627.1|  Os07g0677100                                     61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010042071.1|  PREDICTED: peroxidase 70-like                    61.6    2e-08   
ref|XP_008463816.1|  PREDICTED: peroxidase P7-like                    61.6    2e-08   
sp|A2YPX3.2|PER2_ORYSI  RecName: Full=Peroxidase 2; Flags: Precursor  61.6    2e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001060629.1|  Os07g0677300                                     61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010066484.1|  PREDICTED: peroxidase 70-like                    61.6    2e-08   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                     61.6    2e-08   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like            61.6    2e-08   
gb|AAL93151.1|AF485265_1  class III peroxidase                        61.6    2e-08   Gossypium hirsutum [American cotton]
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                     61.6    2e-08   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg              61.6    2e-08   
gb|AAC49819.1|  peroxidase                                            61.6    2e-08   Oryza sativa [red rice]
ref|XP_010066504.1|  PREDICTED: peroxidase 70-like                    61.6    2e-08   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                     61.6    2e-08   
gb|ACD70388.1|  class III peroxidase                                  61.6    2e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004249056.1|  PREDICTED: peroxidase 70-like                    61.6    2e-08   
ref|XP_004249054.1|  PREDICTED: peroxidase 70-like                    61.6    2e-08   
ref|XP_003517003.1|  PREDICTED: cationic peroxidase 1                 61.6    2e-08   
gb|AFV07574.1|  peroxidase a1                                         59.7    2e-08   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                     61.6    2e-08   
ref|XP_006658124.1|  PREDICTED: peroxidase 2-like                     61.2    2e-08   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                     61.2    2e-08   
ref|XP_010256952.1|  PREDICTED: peroxidase 4-like                     61.2    2e-08   
ref|XP_003555626.1|  PREDICTED: cationic peroxidase 1                 61.6    2e-08   
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                     61.2    2e-08   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190        61.2    2e-08   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like            61.2    2e-08   
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                     61.2    2e-08   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810        61.2    2e-08   
ref|XP_004958685.1|  PREDICTED: peroxidase 66-like                    61.2    2e-08   
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                     61.2    2e-08   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                     61.2    2e-08   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like            61.2    2e-08   
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1         61.2    2e-08   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like            61.2    3e-08   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                      61.2    3e-08   
ref|XP_006658126.1|  PREDICTED: peroxidase 2-like                     60.8    3e-08   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like            61.2    3e-08   
gb|ABV24960.2|  putative secretory peroxidase                         61.2    3e-08   
tpg|DAA64106.1|  TPA: peroxidase J                                    60.8    3e-08   
gb|KHN33217.1|  Cationic peroxidase 1                                 60.8    3e-08   
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                    60.8    3e-08   
gb|EMS66985.1|  Peroxidase 4                                          60.8    3e-08   
ref|XP_006658123.1|  PREDICTED: peroxidase 2-like                     60.8    3e-08   
gb|AEA86316.1|  plasma membrane-bound peroxidases                     58.2    3e-08   
ref|XP_006576455.1|  PREDICTED: cationic peroxidase 1-like            60.8    3e-08   
ref|XP_003522112.1|  PREDICTED: cationic peroxidase 1-like            60.8    3e-08   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350            60.8    3e-08   
ref|XP_009795618.1|  PREDICTED: peroxidase 2-like                     60.8    3e-08   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like            60.8    3e-08   
ref|XP_002461208.1|  hypothetical protein SORBIDRAFT_02g042850        60.8    3e-08   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like            60.8    3e-08   
ref|XP_008645579.1|  PREDICTED: peroxidase P7-like                    60.8    3e-08   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...  60.5    3e-08   
ref|NP_001046392.2|  Os02g0236600                                     58.9    3e-08   
gb|ACF08087.1|  class III peroxidase                                  60.8    3e-08   
emb|CAA62597.1|  korean-radish isoperoxidase                          60.8    3e-08   
emb|CDY14118.1|  BnaC02g02350D                                        60.8    3e-08   
ref|XP_010066472.1|  PREDICTED: peroxidase 70-like                    60.8    3e-08   
gb|KEH29222.1|  peroxidase family protein                             60.8    3e-08   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                         60.8    3e-08   
emb|CDY04948.1|  BnaAnng01300D                                        60.8    3e-08   
gb|AAR31106.1|  peroxidase precursor                                  60.8    3e-08   
gb|KHN33222.1|  Cationic peroxidase 1                                 60.8    3e-08   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like            60.8    4e-08   
ref|XP_004984445.1|  PREDICTED: peroxidase 52-like                    60.8    4e-08   
gb|KDP22789.1|  hypothetical protein JCGZ_00376                       60.5    4e-08   
emb|CAH10842.1|  peroxidase                                           60.8    4e-08   
ref|XP_004249044.1|  PREDICTED: peroxidase 2-like                     60.8    4e-08   
ref|XP_007142688.1|  hypothetical protein PHAVU_007G008400g           60.8    4e-08   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...  60.5    4e-08   
ref|XP_009625317.1|  PREDICTED: cationic peroxidase 1-like            60.5    4e-08   
ref|XP_009402215.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  60.5    4e-08   
ref|XP_002451847.1|  hypothetical protein SORBIDRAFT_04g008600        60.8    4e-08   
ref|XP_010041728.1|  PREDICTED: peroxidase P7-like                    60.5    4e-08   
emb|CDY02820.1|  BnaC02g10690D                                        60.5    4e-08   
ref|XP_010067587.1|  PREDICTED: peroxidase 4-like                     60.5    4e-08   
ref|XP_003517000.1|  PREDICTED: peroxidase 52-like isoform 1          60.5    4e-08   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444           60.5    4e-08   
ref|XP_006848023.1|  hypothetical protein AMTR_s00029p00176560        58.2    4e-08   
gb|ACJ11762.1|  class III peroxidase                                  60.5    4e-08   
ref|XP_010695716.1|  PREDICTED: peroxidase 4-like                     60.5    4e-08   
ref|XP_003522108.1|  PREDICTED: cationic peroxidase 1-like            60.5    4e-08   
ref|XP_007208188.1|  hypothetical protein PRUPE_ppa020902mg           60.5    4e-08   
emb|CAL25300.1|  properoxidase                                        60.5    4e-08   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1          60.5    4e-08   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like            60.5    4e-08   
gb|AFR44628.1|  class III secretory peroxidase                        60.5    4e-08   
ref|XP_009609571.1|  PREDICTED: peroxidase 70-like                    58.5    4e-08   
ref|XP_010066274.1|  PREDICTED: cationic peroxidase 1-like            60.5    4e-08   
gb|AFG53668.1|  hypothetical protein 0_8361_01                        57.4    4e-08   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like            60.5    4e-08   
emb|CDY02817.1|  BnaC02g10720D                                        60.5    4e-08   
ref|NP_001173411.1|  Os03g0339400                                     60.1    5e-08   
gb|EAZ01280.1|  hypothetical protein OsI_23303                        60.5    5e-08   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...  60.5    5e-08   
ref|NP_001147443.1|  peroxidase 52 precursor                          60.5    5e-08   
ref|XP_003615995.1|  Peroxidase                                       60.5    5e-08   
gb|KHG17773.1|  Peroxidase 52 -like protein                           60.5    5e-08   
ref|XP_004958681.1|  PREDICTED: peroxidase 2-like                     60.1    5e-08   
ref|XP_006665078.1|  PREDICTED: peroxidase 2-like                     60.5    5e-08   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like            60.1    5e-08   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg           60.5    5e-08   
dbj|BAD54117.1|  putative bacterial-induced peroxidase precursor      60.5    5e-08   
gb|AAA20473.1|  peroxidase                                            60.1    5e-08   
ref|XP_009788801.1|  PREDICTED: cationic peroxidase 1-like            60.5    5e-08   
ref|XP_006848009.1|  hypothetical protein AMTR_s00029p00168850        57.4    5e-08   
emb|CAH10840.1|  peroxidase                                           60.5    5e-08   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                 60.1    5e-08   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like            60.1    5e-08   
gb|ACN42168.1|  peroxidase 1                                          60.1    5e-08   
ref|XP_003522104.1|  PREDICTED: peroxidase 2-like                     60.5    5e-08   
ref|XP_003623567.1|  Peroxidase                                       60.1    5e-08   
ref|XP_009410539.1|  PREDICTED: cationic peroxidase 1-like            60.1    5e-08   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like            60.1    5e-08   
gb|AAF65464.2|AF247700_1  peroxidase POC1                             60.1    5e-08   
ref|XP_004965566.1|  PREDICTED: peroxidase 52-like                    60.5    5e-08   
gb|AAR31108.1|  peroxidase precursor                                  60.1    6e-08   
gb|ABO77632.1|  peroxidase                                            60.1    6e-08   
ref|XP_004149367.1|  PREDICTED: peroxidase 4-like                     60.1    6e-08   
ref|XP_003612078.1|  Peroxidase                                       60.1    6e-08   
emb|CAA59484.1|  pox1                                                 60.1    6e-08   
ref|NP_001057821.2|  Os06g0547100                                     60.5    6e-08   
ref|XP_004951343.1|  PREDICTED: peroxidase 4-like                     60.1    6e-08   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g           60.1    6e-08   
ref|XP_003602461.1|  Peroxidase                                       60.1    6e-08   
gb|ACF08086.1|  class III peroxidase                                  60.1    6e-08   
ref|XP_006365357.1|  PREDICTED: cationic peroxidase 1-like            60.1    6e-08   
gb|ACF70703.1|  root peroxidase                                       60.1    6e-08   
ref|XP_002467893.1|  hypothetical protein SORBIDRAFT_01g036000        60.1    6e-08   
ref|XP_006658125.1|  PREDICTED: peroxidase 2-like                     60.1    6e-08   
ref|XP_006365356.1|  PREDICTED: cationic peroxidase 1-like            60.1    6e-08   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like            60.1    6e-08   
gb|AFK43134.1|  unknown                                               60.1    6e-08   
ref|NP_001060631.1|  Os07g0677500                                     60.1    6e-08   
ref|XP_007033589.1|  Peroxidase superfamily protein                   60.1    6e-08   
ref|XP_003571154.1|  PREDICTED: peroxidase P7-like                    60.1    6e-08   
ref|NP_196153.1|  peroxidase 52                                       60.1    6e-08   
ref|XP_003522106.1|  PREDICTED: cationic peroxidase 1-like            60.1    7e-08   
ref|XP_006842421.1|  hypothetical protein AMTR_s00077p00015070        57.8    7e-08   
ref|XP_010689719.1|  PREDICTED: peroxidase 4-like                     60.1    7e-08   
ref|XP_008776455.1|  PREDICTED: peroxidase 70-like                    60.1    7e-08   
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                     60.1    7e-08   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like            60.1    7e-08   
emb|CAH10839.1|  peroxidase                                           59.7    7e-08   
dbj|BAK06463.1|  predicted protein                                    59.7    7e-08   
gb|ABF95842.1|  Peroxidase 2 precursor, putative, expressed           58.5    7e-08   
emb|CAA71493.1|  peroxidase                                           59.7    7e-08   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                  59.7    8e-08   
ref|XP_006842419.1|  hypothetical protein AMTR_s00077p00013260        57.4    8e-08   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like            59.7    8e-08   
gb|ABK25962.1|  unknown                                               59.7    8e-08   
ref|XP_009369546.1|  PREDICTED: peroxidase P7-like                    59.7    8e-08   
ref|XP_006856996.1|  hypothetical protein AMTR_s00711p00000040        57.8    8e-08   
gb|KDO41520.1|  hypothetical protein CISIN_1g020615mg                 59.7    8e-08   
ref|XP_003557955.1|  PREDICTED: peroxidase P7-like                    59.7    8e-08   
gb|KEH29221.1|  peroxidase family protein                             59.7    8e-08   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g           59.7    8e-08   
ref|XP_004294748.1|  PREDICTED: cationic peroxidase 1-like            59.7    8e-08   
gb|ACZ51443.1|  peroxidase protein                                    59.7    8e-08   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg           59.7    8e-08   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                    59.7    8e-08   
ref|XP_006848015.1|  hypothetical protein AMTR_s00029p00170340        59.7    8e-08   
ref|XP_009775854.1|  PREDICTED: peroxidase 2-like                     59.7    9e-08   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440        59.7    9e-08   
dbj|BAJ95101.1|  predicted protein                                    59.7    9e-08   
gb|EMS51084.1|  Peroxidase 2                                          59.3    9e-08   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg           59.7    9e-08   
ref|XP_007149728.1|  hypothetical protein PHAVU_005G094200g           59.7    9e-08   
ref|XP_008384732.1|  PREDICTED: peroxidase P7-like                    59.7    9e-08   
emb|CAH10841.1|  peroxidase                                           59.7    9e-08   
dbj|BAJ86726.1|  predicted protein                                    59.3    9e-08   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                    59.3    9e-08   
ref|XP_004958682.1|  PREDICTED: peroxidase 2-like                     59.3    9e-08   
ref|XP_003579029.2|  PREDICTED: peroxidase 4-like                     59.3    9e-08   
ref|NP_001169452.1|  uncharacterized protein LOC100383323 precursor   59.3    9e-08   
gb|EPS58134.1|  anionic peroxidase swpb3                              59.3    1e-07   
gb|ABK59095.1|  peroxidase 1                                          59.3    1e-07   
gb|AFK42735.1|  unknown                                               58.2    1e-07   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like            59.3    1e-07   
ref|XP_006665079.1|  PREDICTED: peroxidase 52-like                    58.9    1e-07   
ref|XP_006367398.1|  PREDICTED: peroxidase 4-like                     59.3    1e-07   
ref|XP_010087053.1|  Cationic peroxidase 1                            57.8    1e-07   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like            59.3    1e-07   
ref|XP_009610510.1|  PREDICTED: peroxidase 15 {ECO:0000303|PubMed...  59.3    1e-07   
ref|XP_006365355.1|  PREDICTED: peroxidase 4-like                     59.3    1e-07   
dbj|BAK00939.1|  predicted protein                                    59.3    1e-07   
gb|EMT23342.1|  Peroxidase 1                                          59.3    1e-07   
ref|XP_003623564.1|  Peroxidase                                       59.3    1e-07   
gb|ACJ85500.1|  unknown                                               58.2    1e-07   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like            59.3    1e-07   
ref|XP_004493715.1|  PREDICTED: peroxidase 15-like                    56.6    1e-07   
gb|KHN00767.1|  Lignin-forming anionic peroxidase                     59.3    1e-07   
ref|XP_003615976.1|  Peroxidase                                       59.3    1e-07   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                     59.3    1e-07   
ref|XP_004512077.1|  PREDICTED: peroxidase 72-like                    59.3    1e-07   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370        59.3    1e-07   
ref|XP_009597808.1|  PREDICTED: peroxidase 2-like                     59.3    1e-07   
ref|XP_010939956.1|  PREDICTED: peroxidase N                          59.3    1e-07   
ref|XP_003556178.1|  PREDICTED: lignin-forming anionic peroxidase...  59.3    1e-07   
ref|NP_172906.1|  peroxidase 4                                        58.9    1e-07   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg           58.9    1e-07   
ref|XP_006849541.1|  hypothetical protein AMTR_s00024p00166170        59.3    1e-07   
gb|ACF08096.1|  class III peroxidase                                  58.9    1e-07   
gb|EEE59027.1|  hypothetical protein OsJ_10774                        58.5    1e-07   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like            58.9    1e-07   
ref|XP_007208648.1|  hypothetical protein PRUPE_ppa020242mg           57.4    1e-07   
ref|XP_002992293.1|  hypothetical protein SELMODRAFT_3562             58.9    1e-07   
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                     58.9    1e-07   
ref|XP_006305840.1|  hypothetical protein CARUB_v10010887mg           58.9    1e-07   
ref|XP_003522116.1|  PREDICTED: cationic peroxidase 1-like            58.9    1e-07   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like            59.3    1e-07   
ref|XP_004958683.1|  PREDICTED: peroxidase 66-like                    58.9    1e-07   
ref|XP_009610471.1|  PREDICTED: cationic peroxidase 1-like            58.9    1e-07   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                    58.9    1e-07   
ref|XP_008344257.1|  PREDICTED: peroxidase 72-like                    58.9    1e-07   
gb|AAW52718.1|  peroxidase 4                                          58.9    1e-07   
ref|XP_002974373.1|  hypothetical protein SELMODRAFT_101253           58.9    1e-07   
ref|XP_009597807.1|  PREDICTED: peroxidase 2-like                     58.9    1e-07   
ref|XP_002457158.1|  hypothetical protein SORBIDRAFT_03g002370        58.9    1e-07   
ref|XP_002987837.1|  hypothetical protein SELMODRAFT_235372           58.9    1e-07   
gb|KHG00581.1|  hypothetical protein F383_17561                       59.7    1e-07   
gb|ACF70707.1|  root peroxidase                                       58.9    1e-07   
gb|ABR18139.1|  unknown                                               58.9    1e-07   
sp|Q9LEH3.1|PER15_IPOBA  RecName: Full=Peroxidase 15; Short=Prx15...  58.9    1e-07   
ref|XP_004497888.1|  PREDICTED: peroxidase 53-like                    58.9    1e-07   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000        58.9    1e-07   
ref|XP_002438533.1|  hypothetical protein SORBIDRAFT_10g021640        58.9    1e-07   
gb|AFW71138.1|  hypothetical protein ZEAMMB73_199916                  57.0    1e-07   
ref|XP_008337713.1|  PREDICTED: peroxidase 72-like                    58.9    1e-07   
ref|XP_006658128.1|  PREDICTED: cationic peroxidase 1-like            58.9    1e-07   
ref|XP_006589469.1|  PREDICTED: lignin-forming anionic peroxidase...  58.9    1e-07   
ref|XP_008805717.1|  PREDICTED: peroxidase 10                         58.9    2e-07   
ref|XP_010936646.1|  PREDICTED: peroxidase 72-like                    58.9    2e-07   
ref|XP_007134679.1|  hypothetical protein PHAVU_010G066900g           58.9    2e-07   
tpe|CAH69282.1|  TPA: class III peroxidase 40 precursor               58.9    2e-07   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                58.5    2e-07   
ref|XP_010316021.1|  PREDICTED: peroxidase N-like isoform X2          58.9    2e-07   
gb|EMS48893.1|  Peroxidase 52                                         58.9    2e-07   
gb|ACI03401.1|  peroxidase 1                                          58.9    2e-07   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210        58.9    2e-07   
gb|EEC75221.1|  hypothetical protein OsI_11488                        58.9    2e-07   
gb|ABF95843.1|  Peroxidase 52 precursor, putative, expressed          58.9    2e-07   
gb|ACD87898.1|  class III peroxidase                                  58.9    2e-07   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like            58.9    2e-07   
dbj|BAK01551.1|  predicted protein                                    58.9    2e-07   
ref|XP_010264470.1|  PREDICTED: peroxidase P7-like                    58.9    2e-07   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like            58.9    2e-07   
gb|AFW80362.1|  hypothetical protein ZEAMMB73_503947                  57.8    2e-07   
sp|P27337.1|PER1_HORVU  RecName: Full=Peroxidase 1; Flags: Precursor  58.5    2e-07   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like            58.9    2e-07   
gb|AAK95518.1|AF402769_1  peroxidase P7X                              55.8    2e-07   
gb|AAA32972.1|  peroxidase                                            58.5    2e-07   
dbj|BAF33316.1|  peroxidase                                           58.9    2e-07   
ref|XP_008784965.1|  PREDICTED: peroxidase 72-like                    58.9    2e-07   
ref|XP_007206418.1|  hypothetical protein PRUPE_ppa018701mg           58.9    2e-07   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7    58.5    2e-07   
ref|XP_004228694.1|  PREDICTED: peroxidase N-like isoform X1          58.9    2e-07   



>gb|AAP42505.1| anionic peroxidase swpa6 [Ipomoea batatas]
Length=353

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWLDETLESANILRAlglg  307
            MASFATKLSLALS +AL LAGYSIYQNT+SAINGTELQLIPTWLDETLESANILRALGLG
Sbjct  1    MASFATKLSLALSLLALVLAGYSIYQNTYSAINGTELQLIPTWLDETLESANILRALGLG  60

Query  308  ksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            KSSSGMLSDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCD G+L
Sbjct  61   KSSSGMLSDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDGGIL  113



>gb|ADB03786.1| anionic peroxidase [Ipomoea batatas]
Length=355

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWLDETLESANILRAlglg  307
            MASF T+LSLALSF+ALALAG+SIYQNTH+A+ G +L+L PTWL  TLES+         
Sbjct  1    MASFLTRLSLALSFIALALAGFSIYQNTHTAMKG-QLKLTPTWLVNTLESSVADVLSLRL  59

Query  308  ksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              SSG LSDE C+FSAVKE+V+AAI  ETRMGASLIRLFFHDCFVDGCDAGLL
Sbjct  60   GISSGKLSDEDCIFSAVKEVVDAAIDAETRMGASLIRLFFHDCFVDGCDAGLL  112



>gb|AAF00093.1|AF109124_1 anionic peroxidase swpa2 [Ipomoea batatas]
 gb|AAO13969.1|AF453791_1 anionic peroxidase [Ipomoea batatas]
Length=359

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 92/116 (79%), Gaps = 3/116 (3%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWLD-ETLESANILR--Al  298
            MAS  ++LSLALS +ALALAGYSIYQ+T SA+    ++ +P WL   T +SAN+L     
Sbjct  1    MASIVSRLSLALSLIALALAGYSIYQHTQSAMESQPIKALPAWLQLPTFQSANVLSYYPS  60

Query  299  glgksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            G   S +GMLSDEACVFSAVKE+V+AAI NETRMGASLIRLFFHDCFVDGCDAGLL
Sbjct  61   GRKSSPAGMLSDEACVFSAVKEVVDAAIDNETRMGASLIRLFFHDCFVDGCDAGLL  116



>sp|O04796.1|PERN_IPOBA RecName: Full=Neutral peroxidase; AltName: Full=SwPN1; Flags: 
Precursor [Ipomoea batatas]
 emb|CAB06478.1| neutral peroxidase [Ipomoea batatas]
Length=348

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWLDETLESANILRAlglg  307
            MASF  +L+LALSF+ALALAGYS+ QNT S+   T L LIPTWLD T +SA++L +    
Sbjct  1    MASFVARLTLALSFIALALAGYSLVQNTLSSPTHTRLNLIPTWLDSTFDSADVL-SYLGF  59

Query  308  ksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              SSG LSD  CVFSAVKEIV+AAIT ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  60   GKSSGRLSDSNCVFSAVKEIVDAAITAETRMGASLIRLHFHDCFVDGCDGGIL  112



>sp|O04795.1|PERA_IPOBA RecName: Full=Anionic peroxidase; AltName: Full=SwPA1; Flags: 
Precursor [Ipomoea batatas]
 emb|CAB06477.1| anionic peroxidase [Ipomoea batatas]
Length=364

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWLDETLESANILRAlglg  307
            MASF  +LSL LSF+ALALAG ++YQNT +A+   +L++ PTWLD TL+S N+L +LGLG
Sbjct  1    MASFMKQLSLVLSFIALALAGCAVYQNTQTAMK-DQLKVTPTWLDNTLKSTNLL-SLGLG  58

Query  308  ksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            K S G L DEACVFSAVKE+V AAI  E RMGASLIRLFFHDCFVDGCDAGLL
Sbjct  59   KPSGGKLGDEACVFSAVKEVVVAAINAEARMGASLIRLFFHDCFVDGCDAGLL  111



>gb|AAP42503.1| anionic peroxidase swpa4 [Ipomoea batatas]
 gb|ABG73135.1| anionic peroxidase [Ipomoea batatas]
Length=356

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWL-DETLESANILRAlgl  304
            MASF T+LSLALSF+ALALAG+SIYQNTH+A+ G +L+L P WL D TLES+        
Sbjct  1    MASFVTRLSLALSFIALALAGFSIYQNTHTAMKG-QLKLTPKWLLDNTLESSVADVLSLR  59

Query  305  gksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
               SSG LSDE C+FSAVKE+V+AAI  ETRMGASLIRLFFHD FVDGCDAGLL
Sbjct  60   LGISSGKLSDEDCIFSAVKEVVDAAIDAETRMGASLIRLFFHDWFVDGCDAGLL  113



>gb|AAF00094.1|AF109123_1 anionic peroxidase Swpa3 [Ipomoea batatas]
Length=351

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  128  MASFATKlslalsfvalalaGYSIYQNTHSAINGTELQLIPTWLDETLESANILRAlglg  307
            MASF  +LSL LSF+ALALAG ++YQNT +A+   +L++ PTWLD T++S N+L +LGLG
Sbjct  1    MASFMKQLSLVLSFIALALAGCAVYQNTQTAMK-DQLKVTPTWLDRTIKSTNLL-SLGLG  58

Query  308  ksssgmlsDEACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            K S G LSDEAC+FSAVKE+V+AAI  E RMGASLIRLFFHDCFVDGCDAGLL
Sbjct  59   KPSGGKLSDEACIFSAVKEVVDAAIDAEARMGASLIRLFFHDCFVDGCDAGLL  111



>ref|XP_004232770.1| PREDICTED: suberization-associated anionic peroxidase 2 [Solanum 
lycopersicum]
 sp|P15004.1|PER2_SOLLC RecName: Full=Suberization-associated anionic peroxidase 2; AltName: 
Full=TMP2; Flags: Precursor [Solanum lycopersicum]
 emb|CAA33853.1| TAP2 [Solanum lycopersicum]
Length=363

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 10/102 (10%)
 Frame = +2

Query  188  GYSIYQNTHSAI---NGTELQLIPTWLDETLESANIL------RAlglgksssgmlsDEA  340
            G +IY+NT+ A+   NG+ LQ I   +D +LES  +       +     K  S  L+ E+
Sbjct  21   GVAIYRNTYEAMIMNNGSLLQNISPDID-SLESGEVSILILNDKKKNSDKYLSQQLTQES  79

Query  341  CVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            CVFSAVK +V++AI NETRMGASLIRL FHDCFVDGCD G+L
Sbjct  80   CVFSAVKGVVDSAIDNETRMGASLIRLHFHDCFVDGCDGGIL  121



>ref|XP_006347168.1| PREDICTED: suberization-associated anionic peroxidase [Solanum 
tuberosum]
Length=363

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 10/102 (10%)
 Frame = +2

Query  188  GYSIYQNTHSAI---NGTELQLIPTWLDETLES--ANIL----RAlglgksssgmlsDEA  340
            G +IY+NT+ A+   NG+ LQ +    D +LES  A+IL    +     K     L+ EA
Sbjct  21   GVAIYRNTYEAMIMNNGSLLQNVSPNFD-SLESGVASILTLNNKKRNSDKYLRQQLTPEA  79

Query  341  CVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            CVFSAV+ +V++AI  ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  80   CVFSAVRGVVDSAIDAETRMGASLIRLHFHDCFVDGCDGGIL  121



>gb|AAA33837.1| anionic peroxidase, partial [Solanum tuberosum]
 prf||1807325A anionic peroxidase
Length=351

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 66/102 (65%), Gaps = 10/102 (10%)
 Frame = +2

Query  188  GYSIYQNTHSAI---NGTELQLIPTWLDETLES--ANIL----RAlglgksssgmlsDEA  340
            G +IY+NT+ AI   NG+ LQ      D +LES  A+IL    +           L+ EA
Sbjct  9    GVAIYRNTYEAIIMNNGSLLQNASPHFD-SLESGVASILTLNNKKRNSDMYLRQQLTPEA  67

Query  341  CVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            CVFSAV+ +V++AI  ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  68   CVFSAVRGVVDSAIDAETRMGASLIRLHFHDCFVDGCDGGIL  109



>sp|P12437.2|PERX_SOLTU RecName: Full=Suberization-associated anionic peroxidase; AltName: 
Full=POPA; Flags: Precursor [Solanum tuberosum]
Length=363

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 66/102 (65%), Gaps = 10/102 (10%)
 Frame = +2

Query  188  GYSIYQNTHSAI---NGTELQLIPTWLDETLES--ANIL----RAlglgksssgmlsDEA  340
            G +IY+NT+ AI   NG+ LQ      D +LES  A+IL    +           L+ EA
Sbjct  21   GVAIYRNTYEAIIMNNGSLLQNASPHFD-SLESGVASILTLNNKKRNSDMYLRQQLTPEA  79

Query  341  CVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            CVFSAV+ +V++AI  ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  80   CVFSAVRGVVDSAIDAETRMGASLIRLHFHDCFVDGCDGGIL  121



>ref|XP_004232771.1| PREDICTED: suberization-associated anionic peroxidase 1 [Solanum 
lycopersicum]
 sp|P15003.1|PER1_SOLLC RecName: Full=Suberization-associated anionic peroxidase 1; AltName: 
Full=TMP1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA33852.1| peroxidase [Solanum lycopersicum]
Length=364

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = +2

Query  188  GYSIYQNTHSAI---NGTELQLIPTWLDETLES--ANIL-----RAlglgksssgmlsDE  337
            G +IY+NT+ AI   NG+ L+ +    D +LES  A+IL     +     K     L+ E
Sbjct  21   GVAIYRNTYEAIIMKNGSLLKNVSPDFD-SLESGVASILTLNNNKKRNSDKYLRQQLTPE  79

Query  338  ACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ACVFSAV+ +V++AI  ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  80   ACVFSAVRAVVDSAIDAETRMGASLIRLHFHDCFVDGCDGGIL  122



>emb|CAI48071.1| anionic peroxidase [Capsicum chinense]
Length=292

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 10/103 (10%)
 Frame = +2

Query  188  GYSIYQNTHSAI--NGTELQLIPTWLDE--------TLESANILRAlglgksssgmlsDE  337
            G +IY+NT+ A+  NG  LQ +   +          TL + N + A       +  L+ E
Sbjct  21   GVAIYRNTYEAMMNNGGLLQTVSPDIGLLESAASILTLNNKNNIGAERKSAKLNQQLTQE  80

Query  338  ACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +CVFSAV  +V++AI  ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  81   SCVFSAVNGVVDSAIDAETRMGASLIRLHFHDCFVDGCDGGIL  123



>ref|XP_009624638.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=358

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESANIL----RAlglgksssgmlsDEACVFSA  355
            G +IY+NT+ A+N    +L P + D +  S +IL                 S E+CVFSA
Sbjct  21   GVAIYRNTYEAMNMGLQKLSPNF-DLSESSVSILTLNNNVDQQNSHKLSQQSPESCVFSA  79

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ +V++AI  E RMGASLIRL FHDCFVDGCD G+L
Sbjct  80   VRGVVDSAIDTERRMGASLIRLHFHDCFVDGCDGGIL  116



>ref|XP_009757218.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
sylvestris]
Length=358

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 7/98 (7%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESA-NIL----RAlglgksssgmlsDEACVFS  352
            G +IY+NT+ A+N    +L P +  E  ESA +IL                 S E+CVFS
Sbjct  21   GVAIYRNTYEAMNMGLQKLSPNF--ELSESAVSILTLNNNVDQQNSHELSQQSPESCVFS  78

Query  353  AVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            AV+ +V++AI  E RMGASLIRL FHDCFVDGCD G+L
Sbjct  79   AVRGVVDSAIDTERRMGASLIRLHFHDCFVDGCDGGIL  116



>ref|XP_006347167.1| PREDICTED: suberization-associated anionic peroxidase 2-like 
[Solanum tuberosum]
Length=358

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +2

Query  188  GYSIYQNTHSAI---NGT-ELQLIPTWLDETLESANILRAlglgksssgmlsDEACVFSA  355
            G +IY+NT+ AI   NG+ +   + T     L + N  +      + S  L+ E+CVFSA
Sbjct  21   GVAIYRNTYEAIIMNNGSPDFDFLETGAVSIL-TLNNEKINSDKDNLSQQLTQESCVFSA  79

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VK +V++AI NETR+GASLIRL FHDCFVDGCD G+L
Sbjct  80   VKGVVDSAIDNETRVGASLIRLHFHDCFVDGCDGGIL  116



>gb|AHB59751.1| Prx01 [Brunfelsia pauciflora var. calycina]
Length=359

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 13/100 (13%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESANILR-------AlglgksssgmlsDEACV  346
            G SIY+NT+ A++G  +      L+  ++S ++++       +  + + SS  LS E C+
Sbjct  21   GISIYKNTYVAMDGLNM------LNSLIKSTDVMQEIGEEIASSAILEQSSDRLSQEMCI  74

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            FS V  +V  AI  E RMGASLIRLFFHDCFVDGCD G+L
Sbjct  75   FSTVASVVADAIRRERRMGASLIRLFFHDCFVDGCDGGIL  114



>ref|XP_009624637.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=359

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESA------NILRAlglgksssgmlsDEACVF  349
            G +IY+NT+ A++     L P +  + LESA      N           +  LS  AC+F
Sbjct  21   GVAIYRNTYEAMSKGFQTLSPEF--DLLESAASILTLNNNAKKNSDSKLTQPLSPSACIF  78

Query  350  SAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            SAV+ +V +AI  E RMGASLIRL FHDCFVDGCD G+L
Sbjct  79   SAVRGVVNSAIDRERRMGASLIRLHFHDCFVDGCDGGVL  117



>ref|XP_009785236.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
sylvestris]
 dbj|BAD98313.2| peroxidase [Nicotiana tabacum]
Length=360

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 58/99 (59%), Gaps = 7/99 (7%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESANILR------AlglgksssgmlsDEACVF  349
            G +IY+NT+ A++    Q +   LD    +A+IL               +  LS  AC+F
Sbjct  21   GVAIYRNTYEAMS-KGFQTLSPELDLLESAASILTLNNNNAEQNSDSKLTQPLSPSACIF  79

Query  350  SAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            SAV+ +V  AI  E RMGASLIRL FHDCFVDGCD G+L
Sbjct  80   SAVRRVVNRAIDRERRMGASLIRLHFHDCFVDGCDGGVL  118



>ref|XP_009757217.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
sylvestris]
Length=360

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESANILR------AlglgksssgmlsDEACVF  349
            G +IY+NT+ A++    Q +   LD    +A+IL               +  LS  AC+F
Sbjct  21   GVAIYRNTYEAMS-KGFQTLSPELDLLESAASILTLNNNNAEQNSDSKLTQPLSPSACIF  79

Query  350  SAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            SAV+ +V +AI  E RMGASLIRL FHDCFVDGCD G+L
Sbjct  80   SAVRGVVNSAIDRERRMGASLIRLHFHDCFVDGCDGGVL  118



>ref|XP_009627391.1| PREDICTED: suberization-associated anionic peroxidase 1-like 
[Nicotiana tomentosiformis]
Length=346

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 55/93 (59%), Gaps = 12/93 (13%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESANILRAlglgksssgmlsDEACVFSAVKEI  367
            G SIY+NTH A   T ++     +  T   +NIL       S       E C+F+AV  +
Sbjct  21   GISIYKNTHVA---TVMKDFDVKMGST---SNILEQNSDKLSQ------EFCIFAAVGSV  68

Query  368  VEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V  AI+ E RMGASLIRLFFHDCFVDGCD G+L
Sbjct  69   VAEAISRERRMGASLIRLFFHDCFVDGCDGGIL  101



>ref|XP_009792332.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
sylvestris]
Length=346

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLES-ANILRAlglgksssgmlsDEACVFSAVKE  364
            G SIY+NTH A        +    D  +ES +NIL       S       E C+F+AV  
Sbjct  21   GISIYKNTHVAT-------VMEDFDVKMESNSNILEQNSDMLSQ------EFCIFAAVGT  67

Query  365  IVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +V  AI  E RMGASLIRLFFHDCFVDGCD G+L
Sbjct  68   VVAEAIRRERRMGASLIRLFFHDCFVDGCDGGIL  101



>ref|XP_009612987.1| PREDICTED: suberization-associated anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=346

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLES-ANILRAlglgksssgmlsDEACVFSAVKE  364
            G SIY+NTH A        +    D  +ES +NIL       S       + C+F+AV  
Sbjct  21   GISIYKNTHVAT-------VMEDFDTKIESESNILEQNSDMLSQ------DFCIFAAVGS  67

Query  365  IVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +V  AI  E RMGASLIRLFFHDCFVDGCD G+L
Sbjct  68   VVAEAIRRERRMGASLIRLFFHDCFVDGCDGGIL  101



>dbj|BAD98314.1| peroxidase [Nicotiana tabacum]
Length=360

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  188  GYSIYQNTHSAINGTELQLIPTWLDETLESANILR------AlglgksssgmlsDEACVF  349
            G +IY+NT+ A++    Q +   LD    +A+IL               +  LS  AC+F
Sbjct  21   GVAIYRNTYEAMS-KGFQTLSPELDLLESAASILTLDNNNAEQNSDSKLTQPLSPSACIF  79

Query  350  SAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +AV+ +V +AI  E RMGASLIRL FHDCFVDGCD G+L
Sbjct  80   TAVRGVVNSAIDRERRMGASLIRLHFHDCFVDGCDGGVL  118



>ref|XP_006343273.1| PREDICTED: suberization-associated anionic peroxidase 2-like 
[Solanum tuberosum]
Length=334

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  341  CVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            C+F+AV  +V  AI  E RMGASLIRLFFHDCFVDGCDAG+L
Sbjct  48   CIFAAVGSVVAEAIARERRMGASLIRLFFHDCFVDGCDAGIL  89



>ref|XP_004234138.1| PREDICTED: suberization-associated anionic peroxidase 2-like 
[Solanum lycopersicum]
Length=334

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  341  CVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            C+F+AV  +V  AI  E RMGASLIRLFFHDCFVDGCDAG+L
Sbjct  48   CIFAAVGSVVTEAIARERRMGASLIRLFFHDCFVDGCDAGIL  89



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VFSAVK +V+AAI  E RMGASL+RLFFHDCFV GCD  +L
Sbjct  38   VFSAVKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSIL  78



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FSAVK ++E+AI++E RMGAS++RLFFHDCFV+GCD  LL
Sbjct  38   LFSAVKPVIESAISSEKRMGASILRLFFHDCFVNGCDGSLL  78



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VFSAVK +V++AI  E RMGASL+RLFFHDCFV GCD  +L
Sbjct  37   VFSAVKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSIL  77



>ref|XP_010067586.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK+IV AAI NETRMGASL+RLFFHDCFV+GCD   L
Sbjct  40   LFPTVKKIVRAAIANETRMGASLLRLFFHDCFVNGCDGSNL  80



>ref|XP_002450133.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
 gb|EES09121.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
Length=328

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AVK ++++AI NE RMGAS++RLFFHDCFV GCDA LL
Sbjct  46   VYGAVKSVMKSAIANEKRMGASIVRLFFHDCFVQGCDASLL  86



>ref|XP_007219390.1| hypothetical protein PRUPE_ppa020254mg [Prunus persica]
 gb|EMJ20589.1| hypothetical protein PRUPE_ppa020254mg [Prunus persica]
Length=326

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK IVE+AI  E RMGASL+RLF+HDCFV+GCDA LL
Sbjct  41   LFPTVKPIVESAIKKEARMGASLLRLFYHDCFVNGCDASLL  81



>ref|XP_008234083.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=306

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK IVE+AI  E RMGASL+RLF+HDCFV+GCDA LL
Sbjct  21   LFPTVKPIVESAIKKEARMGASLLRLFYHDCFVNGCDASLL  61



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS+VK  V++AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSIL  78



>ref|XP_004978553.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=355

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+SAVK +V++AI  E RMGAS++RLFFHDCFV GCD  LL
Sbjct  73   VYSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDGSLL  113



>ref|XP_004978554.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=331

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AVK +V+AAI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  49   VYDAVKSVVQAAIAREQRMGASILRLFFHDCFVQGCDASLL  89



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS+VK  V++AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSIL  78



>ref|XP_002319967.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|EEE95890.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|AHL39177.1| class III peroxidase [Populus trichocarpa]
Length=326

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D++C  +F  VK +V++AI  E RMGASL+RLFFHDCFV GCDA +L
Sbjct  40   DKSCPQLFGTVKSVVQSAIAKERRMGASLVRLFFHDCFVKGCDASIL  86



>ref|XP_002319968.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE95891.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39178.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK +V++A++ E RMGASL+RLFFHDCFV GCD  +L
Sbjct  42   VFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSIL  82



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK +V++AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSIL  78



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  VE+AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  36   LFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSIL  76



>gb|AFW64595.1| hypothetical protein ZEAMMB73_885092 [Zea mays]
Length=333

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AVK +V++A+ +E RMGAS++RLFFHDCFV GCDA LL
Sbjct  50   VYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLL  90



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  VE+AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  44   LFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSIL  84



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  V++AI  ETRMGASL+RLFFHDCFV+GCD  LL
Sbjct  41   LFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLL  81



>gb|ACU23245.1| unknown [Glycine max]
Length=326

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  VE+AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  44   LFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSIL  84



>ref|NP_001151940.1| peroxidase 52 precursor [Zea mays]
 gb|ACG45093.1| peroxidase 52 precursor [Zea mays]
Length=334

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AVK +V++A+ +E RMGAS++RLFFHDCFV GCDA LL
Sbjct  50   VYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLL  90



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  VE+AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  42   LFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSIL  82



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  +K +V++AI++E RMGASL+RLFFHDCFV+GCD  LL
Sbjct  38   LFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLL  78



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + S VK +V++A+ NE RMGASL+RLFFHDCFV+GCD  +L
Sbjct  41   LLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVL  81



>ref|XP_004977588.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=321

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V SAVK +V++AI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  39   VSSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDASLL  79



>gb|AFV07575.1| putative peroxidase a2 [Solanum tuberosum]
Length=257

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK  V++AI  ETRMGASL+RLFFHDCFV+GCD  LL
Sbjct  39   LYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLL  79



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS +K +V++AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  43   LFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVL  83



>gb|EYU20115.1| hypothetical protein MIMGU_mgv1a025851mg [Erythranthe guttata]
Length=318

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F+ VK +V +AI NE RMGASL+RLFFHDCFV+GCD  +L
Sbjct  34   LFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSIL  74



>ref|XP_011021038.1| PREDICTED: peroxidase 4-like [Populus euphratica]
Length=325

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  VK +V++A++ E RMGASL+RLFFHDCFV GCD  +L
Sbjct  42   VFGVVKSVVQSAVSKERRMGASLVRLFFHDCFVKGCDGSIL  82



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VFSAV+  V++AI NE R+GASL+RL FHDCFV+GCD  LL
Sbjct  37   VFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLL  77



>ref|XP_008369411.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=325

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK IVE+AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  40   LFPTVKSIVESAIKKEARMGASLLRLFFHDCFVNGCDGSVL  80



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK  V +AI+ E+RMGASL+RLFFHDCFV+GCD  +L
Sbjct  39   VFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSIL  79



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK  V+AAI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  49   VFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSIL  89



>ref|XP_007017044.1| Peroxidase 68 [Theobroma cacao]
 gb|EOY34663.1| Peroxidase 68 [Theobroma cacao]
Length=592

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +2

Query  284  ILRAlglgksssgmlsDEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDA  457
            I+R+       S     ++C  VFS VK  V++A++ E RMGASL+RLFFHDCFV+GCD 
Sbjct  21   IMRSSSTSAQLSTNFYSKSCPKVFSTVKSAVQSAVSKERRMGASLVRLFFHDCFVNGCDG  80

Query  458  GLL  466
             +L
Sbjct  81   SIL  83


 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  368  VEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V++A++ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  316  VKSAVSKEPRMGASLVRLFFHDCFVNGCDGSIL  348



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS V+ ++++AI++E RMGAS++RLFFHDCFV+GCD  LL
Sbjct  38   LFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLL  78



>gb|ACN33662.1| unknown [Zea mays]
Length=320

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AVK ++++AI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  36   VYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLL  76



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK  V++AI  ETRMGASL+RLFFHDCFV+GCD  LL
Sbjct  39   LYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLL  79



>ref|NP_001131000.1| uncharacterized protein LOC100192105 precursor [Zea mays]
 gb|ACF79421.1| unknown [Zea mays]
 gb|ACL53914.1| unknown [Zea mays]
Length=320

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AVK ++++AI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  36   VYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLL  76



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F+ VK +V +A+ NE RMGASL+RLFFHDCFV+GCD  +L
Sbjct  39   LFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSIL  79



>ref|XP_002489046.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
 gb|EES20431.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
Length=320

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++SAVK +V++AI +E R+GAS++RLFFHDCFV GCDA LL
Sbjct  38   LYSAVKPVVQSAIDSEKRVGASIVRLFFHDCFVQGCDASLL  78



>ref|XP_008354764.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=327

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK +V++A++ E RMGASL+RL FHDCFV+GCD  LL
Sbjct  44   VFDAVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLL  84



>ref|XP_006838996.1| hypothetical protein AMTR_s00002p00271820 [Amborella trichopoda]
 gb|ERN01565.1| hypothetical protein AMTR_s00002p00271820 [Amborella trichopoda]
Length=318

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  VK +V +AI  E R+GAS++RLFFHDCFV+GCD GLL
Sbjct  37   VFDMVKSVVRSAINREKRVGASIVRLFFHDCFVNGCDGGLL  77



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++S VK  V++AI  ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LYSTVKSTVQSAIAKETRMGASLLRLFFHDCFVNGCDGSIL  78



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK  V++AI  ETRMGASL+RLFFHDCFV+GCD  LL
Sbjct  38   LYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLL  78



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V++AI+ ETRMGASL+R FFHDCFV+GCD  +L
Sbjct  38   LFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSIL  78



>ref|XP_002441703.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
 gb|EES15541.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
Length=328

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ AV+ +++AAI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  46   VYDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLL  86



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V++AI+ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVL  78



>gb|AFK41406.1| unknown [Lotus japonicus]
Length=322

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V++AI+ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  39   LFSTVKSSVQSAISKEARMGASLLRLFFHDCFVNGCDGSVL  79



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  +K  V++AI  ETRMGASL+RLFFHDCFV+GCD  LL
Sbjct  39   LYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLL  79



>gb|AFK49101.1| unknown [Lotus japonicus]
Length=305

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+AVK +V +A+  E RMG SL+RLFFHDCFV+GCD  +L
Sbjct  45   VFNAVKSVVHSAVAKEARMGGSLLRLFFHDCFVNGCDGSVL  85



>ref|XP_010931330.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=319

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK +V+AAI  E RMGASL+RL FHDCFV GCDA +L
Sbjct  37   LFSTVKPVVQAAIAKEKRMGASLLRLVFHDCFVQGCDASIL  77



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK  V++AI  ETRMGASL+RLFFHDCFV+GCD  LL
Sbjct  38   LYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLL  78



>ref|XP_009403860.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VK +V +AI++E RMGASL+RLFFHDCFV+GCDA LL
Sbjct  38   VKPVVHSAISSEQRMGASLLRLFFHDCFVNGCDASLL  74



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  VK  V++A++ E RMGASL+RLFFHDCFV+GCDA +L
Sbjct  39   VFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVL  79



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V +AI  ETRMGASL+RL FHDCFV+GCD  LL
Sbjct  37   LFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLL  77



>gb|AFK45898.1| unknown [Lotus japonicus]
Length=330

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+AVK +V +A+  E RMG SL+RLFFHDCFV+GCD  +L
Sbjct  45   VFNAVKSVVHSAVAKEARMGGSLLRLFFHDCFVNGCDGSVL  85



>gb|EMS53502.1| Cationic peroxidase 1 [Triticum urartu]
Length=232

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DEAC    SA+K +V AAI  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  30   DEACPQALSAIKLVVGAAIVKEPRMGASLVRLHFHDCFVNGCDGSIL  76



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VFS +K ++++AI  E RMGAS++RLFFHDCFV+GCD  +L
Sbjct  19   VFSTIKPVLQSAIAKEKRMGASILRLFFHDCFVNGCDGSIL  59



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S VK +V +A++ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  40   VLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSIL  80



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V +AI  ETRMGASL+RL FHDCFV+GCD  LL
Sbjct  37   LFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLL  77



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK +V++AI  E R+GAS++RLFFHDCFV+GCD  LL
Sbjct  40   LFSTVKPVVQSAINKEARIGASILRLFFHDCFVNGCDGSLL  80



>ref|XP_006842568.1| hypothetical protein AMTR_s00077p00148760 [Amborella trichopoda]
 gb|ERN04243.1| hypothetical protein AMTR_s00077p00148760 [Amborella trichopoda]
Length=302

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  V+  V++A+  E RMGAS+IRLFFHDCFV+GCD G+L
Sbjct  21   VFDTVRSGVQSAVNREPRMGASIIRLFFHDCFVNGCDGGIL  61



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK +V++A+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  41   VFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSIL  81



>ref|XP_007146856.1| hypothetical protein PHAVU_006G075900g [Phaseolus vulgaris]
 gb|ESW18850.1| hypothetical protein PHAVU_006G075900g [Phaseolus vulgaris]
Length=331

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK +V++A+  E R+GAS++RLFFHDCFVDGCD  LL
Sbjct  48   VFNTVKAVVKSAVAKEPRIGASILRLFFHDCFVDGCDGSLL  88



>ref|XP_004497330.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=328

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D++C  V   +++IVE A++NE+RMGASL+RL FHDCFV GCDA +L
Sbjct  31   DKSCPKVLRTIRKIVEKAVSNESRMGASLLRLHFHDCFVQGCDASVL  77



>ref|XP_011080739.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=328

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D++C  VFS VK +V++A+  E RMGASL+RL FHDCFV GCDA +L
Sbjct  39   DKSCPTVFSIVKSVVKSAVMEEKRMGASLLRLHFHDCFVQGCDASIL  85



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + S VK +V++AI  E RMGAS++RLFFHDCFV+GCD  LL
Sbjct  40   LLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLL  80



>ref|XP_009410536.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=321

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS V  +V++AI+ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  39   LFSTVSGVVQSAISKEKRMGASLLRLFFHDCFVNGCDGSIL  79



>ref|XP_002531320.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
 gb|EEF31070.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
Length=319

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C    + +K +VEAA++ E RMGASL+RL FHDCFV+GCDA LL
Sbjct  32   DQVCPNALTTIKRVVEAAVSRERRMGASLLRLHFHDCFVNGCDASLL  78



>gb|AAC49362.1| P17, partial [Petunia x hybrida]
Length=205

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  365  IVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +VE AI  ETRMGASLIRL FHDCFVDGCD G+L
Sbjct  2    VVENAINTETRMGASLIRLHFHDCFVDGCDGGIL  35



>ref|XP_009354386.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK +V++A++ + RMGASL+RL FHDCFV+GCD  LL
Sbjct  44   VFDAVKSVVKSAVSKDKRMGASLLRLHFHDCFVNGCDGSLL  84



>ref|XP_007205544.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
 gb|EMJ06743.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
Length=326

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+AVK +V++A+  E RMGASL+RL FHDCFV GCD  LL
Sbjct  41   VFNAVKSVVQSAVHKEKRMGASLLRLHFHDCFVHGCDGSLL  81



>ref|XP_002323054.1| hypothetical protein POPTR_0016s14030g [Populus trichocarpa]
 gb|EEF04815.1| hypothetical protein POPTR_0016s14030g [Populus trichocarpa]
 gb|AHL39187.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V++A++NE RMGASL+RL FHDCFV+GCDA +L
Sbjct  44   VLSVIKSAVDSAVSNEARMGASLLRLHFHDCFVNGCDASVL  84



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK  V +AI+ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   VFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSIL  78



>ref|XP_008244108.1| PREDICTED: peroxidase 4 [Prunus mume]
Length=325

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK +V++A+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  41   VFHAVKSVVQSAVNREKRMGASLLRLHFHDCFVNGCDGSIL  81



>ref|XP_010685964.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK +V +A+  E+RMGASL+RLFFHDCFV+GCD  +L
Sbjct  36   LFGTVKSVVRSAVAKESRMGASLLRLFFHDCFVNGCDGSIL  76



>ref|XP_010041825.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D AC     AV+ IVEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  37   DYACPQALPAVQRIVEAAVQQERRMGASLLRLHFHDCFVNGCDASIL  83



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S  K +V++A++ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  40   VLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSIL  80



>ref|XP_007142064.1| hypothetical protein PHAVU_008G249500g [Phaseolus vulgaris]
 gb|AAD37428.1|AF149278_1 peroxidase 3 precursor [Phaseolus vulgaris]
 gb|ESW14058.1| hypothetical protein PHAVU_008G249500g [Phaseolus vulgaris]
Length=324

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V  AVK +V++A+  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  42   VLYAVKSVVQSAVAKEPRMGASLLRLFFHDCFVNGCDGSVL  82



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  VK +V++A++ E RMGASL+RL FHDCFV+GCD  LL
Sbjct  44   VFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLL  84



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK +V +AI  ETRMGASL+RLFFHDCFV+GCD  L 
Sbjct  36   LYQTVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLF  76



>gb|EMT27941.1| Cationic peroxidase 1 [Aegilops tauschii]
Length=349

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DEAC    SA+K +V AAI  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  30   DEACPQALSAIKLVVGAAIVKEPRMGASLVRLHFHDCFVNGCDGSIL  76



>ref|XP_008384730.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=323

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  VK +V++A++ E RMGASL+RL FHDCFV+GCD  LL
Sbjct  40   VFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLL  80



>ref|XP_002450132.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
 gb|EES09120.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
Length=331

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+ +VK  +++AI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  49   VYDSVKSAIQSAIATEQRMGASIVRLFFHDCFVQGCDASLL  89



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S VK +V++A++ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  41   LSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSIL  80



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  VK +V++A++ E RMGASL+RL FHDCFV+GCD  LL
Sbjct  44   VFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLL  84



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V++AI  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  37   LFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLL  77



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK +V +AI  ETRMGASL+RLFFHDCFV+GCD  L 
Sbjct  36   LYETVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLF  76



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK +V +AI  ETRMGASL+RLFFHDCFV+GCD  L 
Sbjct  36   LYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSLF  76



>tpe|CAH69372.1| TPA: class III peroxidase 130 precursor [Oryza sativa Japonica 
Group]
 gb|ABA91159.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ00524.1| hypothetical protein OsI_22542 [Oryza sativa Indica Group]
 gb|EAZ17186.1| hypothetical protein OsJ_32693 [Oryza sativa Japonica Group]
 dbj|BAH01350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK  +++AI NE R+GAS++RLFFHDCFV GCDA LL
Sbjct  42   VFDAVKCGMQSAIANEKRIGASIVRLFFHDCFVQGCDASLL  82



>ref|XP_011003590.1| PREDICTED: peroxidase 2-like [Populus euphratica]
Length=321

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C     A+K +VEAAI  E RMGASL+RL FHDCFV GCDA +L
Sbjct  35   DHVCPKALPAIKRVVEAAINKERRMGASLLRLHFHDCFVHGCDASIL  81



>ref|XP_011003587.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=317

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V +A++NE RMGASL+RL FHDCFV+GCDA +L
Sbjct  44   VLSVIKSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVL  84



>ref|NP_001169614.1| uncharacterized protein LOC100383495 precursor [Zea mays]
 gb|ACN34270.1| unknown [Zea mays]
Length=332

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V  AV+ +++AAI  E RMGAS++RLFFHDCFV GCDA LL
Sbjct  47   VHDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLL  87



>gb|AHL39144.1| class III peroxidase [Populus trichocarpa]
Length=321

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +K +VEAA+ NE RMGASL+RL FHDCFV+GCDA +L
Sbjct  45   IKRVVEAAVYNERRMGASLLRLHFHDCFVNGCDASIL  81



>ref|XP_003602463.1| Peroxidase [Medicago truncatula]
 gb|AES72714.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  350  SAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            S V+  V++AI+NE RMGAS++RLFFHDCFV+GCD  +L
Sbjct  42   STVQSTVQSAISNEARMGASILRLFFHDCFVNGCDGSIL  80



>ref|XP_002308244.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE91767.1| peroxidase family protein [Populus trichocarpa]
Length=321

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +K +VEAA+ NE RMGASL+RL FHDCFV+GCDA +L
Sbjct  45   IKRVVEAAVYNERRMGASLLRLHFHDCFVNGCDASIL  81



>ref|XP_004308969.1| PREDICTED: peroxidase 52-like [Fragaria vesca subsp. vesca]
Length=324

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS V+ IV++AI    RMGA L+RLFFHDCFV+GCDA LL
Sbjct  40   LFSTVRPIVQSAIDKNPRMGACLLRLFFHDCFVNGCDASLL  80



>ref|NP_001065971.1| Os12g0112000 [Oryza sativa Japonica Group]
 tpe|CAH69377.1| TPA: class III peroxidase 135 precursor [Oryza sativa Japonica 
Group]
 gb|ABA96259.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28990.1| Os12g0112000 [Oryza sativa Japonica Group]
 gb|EAZ19424.1| hypothetical protein OsJ_34981 [Oryza sativa Japonica Group]
 dbj|BAG91443.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK99332.1| peroxidase [Oryza sativa Japonica Group]
Length=327

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+AVK  +++AI  E R+GAS++RLFFHDCFV GCDA LL
Sbjct  45   VFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLL  85



>ref|XP_011019031.1| PREDICTED: peroxidase 2-like [Populus euphratica]
Length=321

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +K +VEAA+ NE RMGASL+RL FHDCFV+GCDA +L
Sbjct  45   IKRVVEAAVYNERRMGASLLRLHFHDCFVNGCDASIL  81



>ref|XP_004294746.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=327

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F+ VK +V++AI+NE R+GASL+RL FHDCFV+GCD  +L
Sbjct  44   LFTTVKSVVQSAISNENRIGASLLRLHFHDCFVNGCDGSVL  84



>ref|XP_004490701.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=335

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+A+  +V +A+  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  51   VFNAINSVVHSAVAKEPRMGASLLRLFFHDCFVNGCDGSVL  91



>gb|EAY79693.1| hypothetical protein OsI_34840 [Oryza sativa Indica Group]
Length=329

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+AVK  +++AI  E R+GAS++RLFFHDCFV GCDA LL
Sbjct  47   VFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLL  87



>ref|XP_002461211.1| hypothetical protein SORBIDRAFT_02g042870 [Sorghum bicolor]
 gb|EER97732.1| hypothetical protein SORBIDRAFT_02g042870 [Sorghum bicolor]
Length=321

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    + +K  V AA+ NE RMGASL+RL FHDCFVDGCDA +L
Sbjct  31   DTSCPKALATIKSAVTAAVNNEARMGASLLRLHFHDCFVDGCDASVL  77



>ref|XP_006365360.1| PREDICTED: peroxidase 70-like [Solanum tuberosum]
Length=320

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              A+K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  40   LPAIKRVVEAAVRKERRMGASLLRLHFHDCFVNGCDASIL  79



>ref|XP_007033587.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04513.1| Peroxidase superfamily protein [Theobroma cacao]
Length=316

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C     A+K+IV+AA+  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  30   DKVCPQALPAIKKIVQAAVHRERRMGASLLRLHFHDCFVNGCDGSLL  76



>ref|XP_010041911.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              A+K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  44   LPAIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASIL  83



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  V +AI  E RMGASL+RLFFHDCFV+GCD  LL
Sbjct  39   LFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLL  79



>ref|XP_007033582.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04508.1| Peroxidase superfamily protein [Theobroma cacao]
Length=323

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C     A+K+IV+AA+  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  30   DKVCPQALPAIKKIVQAAVHRERRMGASLLRLHFHDCFVNGCDGSLL  76



>ref|XP_010264469.1| PREDICTED: peroxidase 2-like [Nelumbo nucifera]
Length=320

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +K+IVE A+  ETRMGASL+RL FHDCFV+GCDA +L
Sbjct  42   IKKIVEEAVKKETRMGASLLRLHFHDCFVNGCDASIL  78



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++  VK +V +A+  ETRMGASL+RLFFHDCFV+GCD  L 
Sbjct  36   LYETVKSVVHSAVQKETRMGASLLRLFFHDCFVNGCDGSLF  76



>ref|XP_010042156.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
               A+K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  43   ALPAIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASIL  83



>gb|AAX44001.2| putative secretory peroxidase [Catharanthus roseus]
Length=318

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK  V +AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  35   VFNTVKSQVHSAILKEARMGASLLRLFFHDCFVNGCDGSIL  75



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S V+ +V++A++ E RMGASL+RLFFHDCFV GCD  +L
Sbjct  39   VLSTVESVVKSAVSKEKRMGASLVRLFFHDCFVKGCDGSIL  79



>ref|XP_010093547.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54254.1| Cationic peroxidase 1 [Morus notabilis]
Length=138

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  338  ACVFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            A   S +K IVEAA+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  9    AAALSTIKSIVEAAVEKEGRMGASLLRLQFHDCFVNGCDGSIL  51



>ref|XP_006468150.1| PREDICTED: peroxidase 52-like [Citrus sinensis]
 ref|XP_006468154.1| PREDICTED: peroxidase 52-like [Citrus sinensis]
Length=287

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++ +V  AITNETRMGASL+RL FHDCFV+GCD  LL
Sbjct  9    IRTVVRNAITNETRMGASLLRLHFHDCFVNGCDGSLL  45



>ref|XP_004500341.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=326

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF  V+ +V++A++ E R+GASL+RLFFHDCFVDGCD  +L
Sbjct  43   VFDTVETVVKSAVSKEQRIGASLLRLFFHDCFVDGCDGSIL  83



>ref|XP_010260327.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=324

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+AC      +K+IVE AI  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  36   DKACPQALPTIKKIVEQAIEREPRMGASLLRLHFHDCFVNGCDGSLL  82



>gb|KHG25850.1| Peroxidase 4 [Gossypium arboreum]
Length=323

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V +AI  E RMGASL+RLFFHDCFV+GCD  LL
Sbjct  41   LFSTVKFTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLL  81



>ref|XP_002323056.1| peroxidase family protein [Populus trichocarpa]
 gb|EEF04817.1| peroxidase family protein [Populus trichocarpa]
 gb|AHL39189.1| class III peroxidase [Populus trichocarpa]
Length=321

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C     A+K +VEAA+  E RMGASL+RL FHDCFV GCDA +L
Sbjct  35   DHVCPKALPAIKRVVEAAVNKERRMGASLLRLHFHDCFVHGCDASIL  81



>gb|ACU21377.1| unknown [Glycine max]
Length=261

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C  VF AVK ++++A+  E R GAS++RLFFHDCFV+GCD  +L
Sbjct  36   DSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  V++AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  43   LFETVKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSIL  83



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +   VK +V++AI+ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVL  78



>gb|KFK27367.1| hypothetical protein AALP_AA8G373800 [Arabis alpina]
Length=325

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E+C  +F AV+ +V+ A+  E RM ASL+RLFFHDCFV+GCD  +L
Sbjct  37   ESCPSLFPAVRRVVQRAVARERRMAASLLRLFFHDCFVNGCDGSIL  82



>ref|XP_003552299.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=322

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S +K +V++A++NE RMGASL+RL FHDCFV GCDA +L
Sbjct  44   LSTIKSVVDSAVSNEARMGASLLRLHFHDCFVQGCDASVL  83



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V+ AI NE RMGAS++RL FHDCFV+GCD  +L
Sbjct  39   LFSIVKSTVQPAIRNEPRMGASILRLHFHDCFVNGCDGSVL  79



>ref|XP_007033538.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04464.1| Peroxidase superfamily protein [Theobroma cacao]
Length=316

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C     A+K++V+AA+  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  30   DKVCPQALPAIKKVVQAAVHRERRMGASLLRLHFHDCFVNGCDGSLL  76



>ref|XP_009803848.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V++A+T E RMGASL+RL FHDCFV+GCDA +L
Sbjct  35   VLSVIKTAVDSAVTKEARMGASLLRLHFHDCFVNGCDASVL  75



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              AV  +V++A+ NE RMGAS++RLFFHDCFV GCD  LL
Sbjct  39   LGAVASVVQSAVANEPRMGASILRLFFHDCFVQGCDGSLL  78



>ref|XP_010067589.1| PREDICTED: peroxidase P7-like isoform X1 [Eucalyptus grandis]
Length=326

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  V+ IV AAI  E RMGASL+RLFFHDCFV+GCD  LL
Sbjct  44   LFPTVRLIVGAAIAREARMGASLLRLFFHDCFVNGCDGSLL  84



>ref|XP_006833271.1| hypothetical protein AMTR_s01371p00003540, partial [Amborella 
trichopoda]
 gb|ERM98549.1| hypothetical protein AMTR_s01371p00003540, partial [Amborella 
trichopoda]
Length=138

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S ++  + AAI+ E RMGASLIRL FHDCFV+GCDA LL
Sbjct  35   DSSCPNALSTIRTAIHAAISAERRMGASLIRLHFHDCFVNGCDASLL  81



>ref|XP_010067590.1| PREDICTED: peroxidase P7-like isoform X2 [Eucalyptus grandis]
Length=325

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  V+ IV AAI  E RMGASL+RLFFHDCFV+GCD  LL
Sbjct  44   LFPTVRLIVGAAIAREARMGASLLRLFFHDCFVNGCDGSLL  84



>gb|ADN96692.1| peroxidase 5 [Rubia cordifolia]
Length=318

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V+  + AA++ E RMGAS++RLFFHDCFV+GCDAGLL
Sbjct  43   VRNAMTAAVSKERRMGASILRLFFHDCFVNGCDAGLL  79



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VK  VE+AI+ ETRMGASL+RLFFHDCFV+GCD  +L
Sbjct  42   VKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSIL  78



>gb|EPS67864.1| hypothetical protein M569_06908, partial [Genlisea aurea]
Length=312

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            ++S V+ +V++AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  28   LYSTVRSVVDSAIQAEARMGASLLRLFFHDCFVNGCDGSIL  68



>ref|XP_004958684.1| PREDICTED: peroxidase 2-like [Setaria italica]
Length=318

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K  V +A+ NE RMGASL+R+ FHDCFVDGCDA +L
Sbjct  29   DTSCPNALSTIKSAVTSAVNNEPRMGASLLRMHFHDCFVDGCDASVL  75



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + + V  +V++AI  E+RMGASL+RLFFHDCFV+GCD  +L
Sbjct  40   LLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSIL  80



>ref|XP_001781580.1| predicted protein [Physcomitrella patens]
 gb|EDQ53631.1| predicted protein [Physcomitrella patens]
Length=336

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DE+C  ++S VKE V+ A+  E RM ASLIRL FHDCFV+GCD  LL
Sbjct  34   DESCPEIYSIVKEEVQKAVEAEKRMAASLIRLHFHDCFVNGCDGSLL  80



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +   VK +V++A++ E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  37   LLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVL  77



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK  V +AI  ETR GASL+RL FHDCFV+GCD  LL
Sbjct  37   LFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSLL  77



>gb|ACU24247.1| unknown [Glycine max]
Length=143

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K +VEAA+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  33   DYSCPNALSTIKSVVEAAVQKEHRMGASLLRLHFHDCFVNGCDGSVL  79



>ref|XP_006848016.1| hypothetical protein AMTR_s00029p00170730 [Amborella trichopoda]
 gb|ERN09597.1| hypothetical protein AMTR_s00029p00170730 [Amborella trichopoda]
Length=112

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C   FS ++  + AAI+ E  MGASLIRL FHDCFV+GCDA LL
Sbjct  35   DSSCPNAFSTIRTAIHAAISAERPMGASLIRLHFHDCFVNGCDASLL  81



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK  V++A+  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  39   LFPTVKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSVL  79



>gb|KHN08835.1| Peroxidase 4 [Glycine soja]
Length=324

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C  VF AVK ++++A+  E R GAS++RLFFHDCFV+GCD  +L
Sbjct  36   DSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82



>ref|XP_003544922.1| PREDICTED: peroxidase 4 [Glycine max]
Length=324

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C  VF AVK ++++A+  E R GAS++RLFFHDCFV+GCD  +L
Sbjct  36   DSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82



>ref|XP_003519284.1| PREDICTED: peroxidase 4 [Glycine max]
 gb|KHN46096.1| Peroxidase 4 [Glycine soja]
Length=324

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C  VF AVK ++++A+  E R GAS++RLFFHDCFV+GCD  +L
Sbjct  36   DSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82



>ref|XP_010041993.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=323

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
               A+K +VEAA+  E RMGASL RL FHDCFV+GCDA +L
Sbjct  43   ALPAIKRVVEAAVQQERRMGASLFRLHFHDCFVNGCDASIL  83



>ref|XP_006345521.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K +V +AI  E+RMGASL+RL FHDCFV+GCDA +L
Sbjct  37   VLSIIKTVVNSAIATESRMGASLLRLHFHDCFVNGCDASVL  77



>emb|CAD67477.1| peroxidase [Asparagus officinalis]
Length=315

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ +K +++ AI  E RMGAS++RLFFHDCFV+GCD  +L
Sbjct  33   VFTTIKPVLQHAIEKEKRMGASILRLFFHDCFVNGCDGSIL  73



>ref|XP_006662662.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=324

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK  +++AI  E R+GAS++RLFFHDCFV GCDA LL
Sbjct  42   VFDAVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLL  82



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  VK +V  AI+ E RMGASL+RLFFHDCFV GCD  +L
Sbjct  45   LFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSIL  85



>ref|XP_003522118.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=321

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D AC    S +K +VEAA+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  33   DYACPNALSTIKSVVEAAVQKEYRMGASLLRLHFHDCFVNGCDGSIL  79



>gb|KHN46282.1| Peroxidase 4 [Glycine soja]
Length=330

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK +V++A+  E R+GAS++RLFFHDCFV GCD  +L
Sbjct  47   VFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSIL  87



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V +AI+ E+RMGASL+RL FHDCFV+GCDA +L
Sbjct  35   VLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVL  75



>ref|XP_003538328.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=329

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK +V++A+  E R+GAS++RLFFHDCFV GCD  +L
Sbjct  46   VFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSIL  86



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V +AI+ E+RMGASL+RL FHDCFV+GCDA +L
Sbjct  35   VLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVL  75



>gb|ABR23054.1| basic peroxidase swpb4 [Ipomoea batatas]
Length=320

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  V  +V +AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSIL  78



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F  V  +V +AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  38   LFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSIL  78



>ref|NP_001060630.1| Os07g0677400 [Oryza sativa Japonica Group]
 gb|AAC49820.1| peroxidase [Oryza sativa Indica Group]
 dbj|BAC79530.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAD30310.1| peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69355.1| TPA: class III peroxidase 113 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF22544.1| Os07g0677400 [Oryza sativa Japonica Group]
Length=314

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K  V AA+ NE RMGASL+RL FHDCFV GCDA +L
Sbjct  30   DTSCPRAMSIIKSTVTAAVNNEPRMGASLLRLHFHDCFVQGCDASIL  76



>ref|XP_007219210.1| hypothetical protein PRUPE_ppa017309mg, partial [Prunus persica]
 gb|EMJ20409.1| hypothetical protein PRUPE_ppa017309mg, partial [Prunus persica]
Length=291

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VFS V+  V++AI  E R+GASL+RL FHDCFV+GCD  LL
Sbjct  37   VFSTVRSTVQSAIRKEARIGASLLRLHFHDCFVNGCDGSLL  77



>ref|XP_006401086.1| hypothetical protein EUTSA_v10014097mg [Eutrema salsugineum]
 gb|ESQ42539.1| hypothetical protein EUTSA_v10014097mg [Eutrema salsugineum]
Length=326

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E+C  +F AV+ +V+ A+  E RM ASL+RLFFHDCFV+GCD  +L
Sbjct  38   ESCPSLFPAVRRVVQHAVAKERRMAASLLRLFFHDCFVNGCDGSIL  83



>gb|ACU24215.1| unknown [Glycine max]
Length=329

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK +V++A+  E R+GAS++RLFFHDCFV GCD  +L
Sbjct  46   VFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSIL  86



>ref|XP_007134678.1| hypothetical protein PHAVU_010G066800g [Phaseolus vulgaris]
 gb|ESW06672.1| hypothetical protein PHAVU_010G066800g [Phaseolus vulgaris]
Length=320

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K +VEAA+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  33   DYSCPNALSTIKSVVEAAVQKENRMGASLLRLHFHDCFVNGCDGSIL  79



>gb|KDP22790.1| hypothetical protein JCGZ_00377 [Jatropha curcas]
Length=326

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  30   DKLCPEALPTIKRVVEAAVRKEKRMGASLLRLHFHDCFVNGCDASVL  76



>ref|XP_003577141.1| PREDICTED: peroxidase 4-like [Brachypodium distachyon]
Length=329

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  353  AVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            AVK ++EAAI  E R+GAS++RLFFHDCFV GCD  LL
Sbjct  50   AVKSVMEAAIAGEPRIGASILRLFFHDCFVQGCDGSLL  87



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + S VK  +++AI+ ETR+GASL+RLFFHDCFV+GCD  +L
Sbjct  38   LLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSIL  78



>ref|XP_009384773.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578} [Musa 
acuminata subsp. malaccensis]
Length=356

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +FS VK +V++AI+ E R+GAS++RLFFHDCFV GCD  +L
Sbjct  73   LFSTVKPVVQSAISKEKRLGASVLRLFFHDCFVLGCDGSVL  113



>ref|XP_009770760.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=157

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K +VE A+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  31   DDVCPEALPTIKRVVEDAVRQERRMGASLLRLHFHDCFVNGCDASIL  77



>ref|XP_002268412.1| PREDICTED: cationic peroxidase 1 [Vitis vinifera]
Length=318

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  42   IKRVVEAAVQKEKRMGASLLRLHFHDCFVNGCDASIL  78



>ref|XP_006481156.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=316

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K IVEAA+  E RMGASL+RL FHDCFV GCDA +L
Sbjct  29   DKVCPEALPTIKRIVEAAVEKEGRMGASLLRLHFHDCFVQGCDASIL  75



>gb|KDO49649.1| hypothetical protein CISIN_1g021171mg [Citrus sinensis]
Length=316

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K IVEAA+  E RMGASL+RL FHDCFV GCDA +L
Sbjct  29   DKVCPEALPTIKRIVEAAVEKEGRMGASLLRLHFHDCFVQGCDASIL  75



>ref|XP_010256953.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=324

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K+ VEAA+  E+RMGASL+RL FHDCFV GCDA +L
Sbjct  35   DKVCPQALPTIKKTVEAAVKKESRMGASLLRLHFHDCFVHGCDASIL  81



>gb|ACF08088.1| class III peroxidase, partial [Aegilops ventricosa]
Length=181

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    + +K  V AA+  ETRMGASL+RL FHDCFVDGCD  +L
Sbjct  29   DTSCPNALATIKAGVTAALNTETRMGASLVRLHFHDCFVDGCDGSVL  75



>ref|XP_002531319.1| Peroxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31069.1| Peroxidase 2 precursor, putative [Ricinus communis]
Length=323

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K I+EAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  33   DKVCPEALPTIKRIIEAAVYEEPRMGASLLRLHFHDCFVNGCDASVL  79



>gb|AFK43418.1| unknown [Medicago truncatula]
Length=143

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S +K +V+AA+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  40   LSTIKSVVKAAVQRENRMGASLLRLHFHDCFVNGCDGSIL  79



>gb|AFG53669.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
 gb|AFG53670.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
 gb|AFG53671.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
 gb|AFG53672.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
 gb|AFG53673.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
 gb|AFG53674.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
 gb|AFG53675.1| hypothetical protein 0_8361_01, partial [Pinus taeda]
Length=82

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S VK  V+ A+  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  24   DTSCPKALSTVKAAVKQAVAKEKRMGASLLRLHFHDCFVNGCDGSLL  70



>gb|KHG02293.1| Peroxidase 15 [Gossypium arboreum]
Length=345

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DE C  VFS ++ I+E A+ ++ R+GASL+RL FHDCFV+GCDA +L
Sbjct  37   DETCPAVFSIIRGIIEQALLSDPRIGASLLRLHFHDCFVNGCDASIL  83



>emb|CDY32701.1| BnaA02g07630D [Brassica napus]
Length=326

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E+C  +F AV+ +++ A+  E RM ASL+RLFFHDCFV+GCD  +L
Sbjct  38   ESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFVNGCDGSIL  83



>emb|CBI18065.3| unnamed protein product [Vitis vinifera]
Length=413

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  356  VKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  281  IKRVVEAAVQKEKRMGASLLRLHFHDCFVNGCDASIL  317



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + S VK  V +AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  40   LLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVL  80



>dbj|BAJ96226.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89314.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V  AV++++  A+ N+TR GA+++RLFFHDCFV+GCDA LL
Sbjct  47   VHGAVRQVMSQAVMNDTRTGAAILRLFFHDCFVNGCDASLL  87



>ref|XP_002323055.2| peroxidase family protein [Populus trichocarpa]
 gb|EEF04816.2| peroxidase family protein [Populus trichocarpa]
Length=320

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             + +K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  41   LATIKRVVEAAVYKERRMGASLLRLHFHDCFVNGCDASIL  80



>gb|AHL39188.1| class III peroxidase [Populus trichocarpa]
Length=320

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             + +K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  41   LATIKRVVEAAVYKERRMGASLLRLHFHDCFVNGCDASIL  80



>ref|XP_008782618.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=350

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DE C      +K +VE AI +E RMGASL+RL FHDCFV+GCD  +L
Sbjct  59   DEVCSQALPTIKSVVEQAIASEPRMGASLVRLHFHDCFVNGCDGSIL  105



>gb|AFK37048.1| unknown [Medicago truncatula]
Length=95

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  +++A+ NE RMGAS++RL FHDCFV GCDA +L
Sbjct  32   VLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVL  72



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + S VK  V +AI  E RMGASL+RLFFHDCFV+GCD  +L
Sbjct  48   LLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVL  88



>ref|XP_010087166.1| Peroxidase 4 [Morus notabilis]
 gb|EXB28405.1| Peroxidase 4 [Morus notabilis]
Length=326

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF+ VK +V+ AI+ E R+GASL+RL FHDCFV+GCD  +L
Sbjct  43   VFATVKSVVKTAISKENRIGASLLRLHFHDCFVNGCDGSIL  83



>ref|NP_001242089.1| uncharacterized protein LOC100815671 precursor [Glycine max]
 gb|ACU22965.1| unknown [Glycine max]
Length=322

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S +K  V++A++NE RMGASL+RL FHDCFV GCDA +L
Sbjct  44   LSTIKSAVDSAVSNEARMGASLLRLHFHDCFVQGCDASVL  83



>ref|XP_007011215.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20025.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=317

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S VKE V  AI  E RMGASL+RL FHDCFV+GCD  LL
Sbjct  37   VLSIVKERVRVAIKKEARMGASLLRLHFHDCFVNGCDGSLL  77



>emb|CAA46916.1| peroxidase [Oryza sativa Japonica Group]
 prf||1909367A peroxidase
Length=317

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K ++ AA+ +E RMGASL+RL FHDCFV GCDA +L
Sbjct  33   DTSCPNALSTIKSVITAAVNSEARMGASLLRLHFHDCFVQGCDASVL  79



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V +A+++E RMGASL+RL FHDCFV+GCDA +L
Sbjct  36   VLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVL  76



>ref|XP_011003588.1| PREDICTED: peroxidase 2-like [Populus euphratica]
Length=320

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
               +K +VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  41   LPTIKRVVEAAVYKERRMGASLLRLHFHDCFVNGCDASIL  80



>ref|NP_001060628.1| Os07g0677200 [Oryza sativa Japonica Group]
 dbj|BAC83103.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAF22542.1| Os07g0677200 [Oryza sativa Japonica Group]
 dbj|BAG93342.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96895.1| unnamed protein product [Oryza sativa Japonica Group]
Length=317

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K ++ AA+ +E RMGASL+RL FHDCFV GCDA +L
Sbjct  33   DTSCPNALSTIKSVITAAVNSEARMGASLLRLHFHDCFVQGCDASVL  79



>gb|AAC49818.1| peroxidase [Oryza sativa Indica Group]
Length=317

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K ++ AA+ +E RMGASL+RL FHDCFV GCDA +L
Sbjct  33   DTSCPNALSTIKSVITAAVNSEARMGASLLRLHFHDCFVQGCDASVL  79



>ref|XP_007033588.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04514.1| Peroxidase superfamily protein [Theobroma cacao]
Length=339

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
               +K++VEAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  59   LPTIKKLVEAAVYKERRMGASLLRLHFHDCFVNGCDASIL  98



>ref|XP_004253400.1| PREDICTED: peroxidase 70-like [Solanum lycopersicum]
Length=319

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              A+K +VE A+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  39   LPAIKRVVEDAVRKERRMGASLLRLHFHDCFVNGCDASIL  78



>emb|CDX88673.1| BnaA03g09760D [Brassica napus]
Length=366

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E+C  +F AV+  V+ A+T E RM ASL+RLFFHDCFV+GCD  +L
Sbjct  35   ESCPSLFYAVRREVQRAVTRERRMAASLLRLFFHDCFVNGCDGSIL  80



>ref|XP_007134677.1| hypothetical protein PHAVU_010G066700g [Phaseolus vulgaris]
 gb|ESW06671.1| hypothetical protein PHAVU_010G066700g [Phaseolus vulgaris]
Length=319

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S+++ +VEAA+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  33   DYSCPNALSSIRSVVEAAVQKEQRMGASLLRLHFHDCFVNGCDGSIL  79



>ref|XP_010067588.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E C  +F  V+ IV+ AI  E RMGASL+RLFFHDCFV+GCD   L
Sbjct  35   ETCPDLFPTVQSIVQEAIAKEARMGASLLRLFFHDCFVNGCDGSNL  80



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            + S VK  V +A+++E RMGAS++RLFFHDCFV+GCD  +L
Sbjct  40   LLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSIL  80



>ref|XP_008384727.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=146

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              A+++ VE AI  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  41   LPAIRKAVERAIKREPRMGASLVRLHFHDCFVNGCDGSIL  80



>ref|XP_006665136.1| PREDICTED: peroxidase 70-like [Oryza brachyantha]
Length=141

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C      +K +VE A++ E RMGASL+RL FHDCFV+GCD  +L
Sbjct  30   DSVCPAALPTIKRVVEEAVSAEPRMGASLLRLHFHDCFVNGCDGSIL  76



>emb|CDP04065.1| unnamed protein product [Coffea canephora]
Length=316

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V   ++  V++A++ E RMGASL+RLFFHDCFV GCDA +L
Sbjct  33   VLGTIRSEVQSAVSKERRMGASLVRLFFHDCFVQGCDASIL  73



>ref|XP_007218699.1| hypothetical protein PRUPE_ppa008820mg [Prunus persica]
 gb|EMJ19898.1| hypothetical protein PRUPE_ppa008820mg [Prunus persica]
Length=318

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S V+E V AAI NETR+GASL+RL FHDCFV+GCDA +L
Sbjct  38   LSIVQEEVVAAIKNETRIGASLLRLHFHDCFVNGCDASVL  77



>ref|XP_009132056.1| PREDICTED: peroxidase 68-like [Brassica rapa]
Length=324

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E+C  +F AV+  V+ A+T E RM ASL+RLFFHDCFV+GCD  +L
Sbjct  35   ESCPSLFYAVRREVQRAVTRERRMAASLLRLFFHDCFVNGCDGSIL  80



>ref|XP_010683551.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=343

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S ++  V++A+ NE+RMGASL+RL FHDCFV+GCD  LL
Sbjct  41   LSTIQSAVQSAVNNESRMGASLLRLHFHDCFVNGCDGSLL  80



>ref|XP_006848011.1| hypothetical protein AMTR_s00029p00169150 [Amborella trichopoda]
 gb|ERN09592.1| hypothetical protein AMTR_s00029p00169150 [Amborella trichopoda]
Length=156

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D  C    S ++  +  AI+ E RMGASLIRL FHDCFV+GCDA LL
Sbjct  38   DSTCPNALSTIRTAIRTAISAERRMGASLIRLHFHDCFVNGCDASLL  84



>ref|XP_010683553.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=329

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S ++  V+AA+ NE+RMGASL+RL FHDCFV+GCD  +L
Sbjct  48   LSTIQSAVQAAVKNESRMGASLLRLHFHDCFVNGCDGSIL  87



>ref|XP_002304018.2| hypothetical protein POPTR_0003s21600g [Populus trichocarpa]
 gb|EEE78997.2| hypothetical protein POPTR_0003s21600g [Populus trichocarpa]
 gb|AHL39124.1| class III peroxidase [Populus trichocarpa]
Length=348

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DE C  V S ++EI+E  + ++ R+GASLIRL FHDCFVDGCDA +L
Sbjct  33   DETCPNVTSIIREIIEDTLLSDARIGASLIRLHFHDCFVDGCDASIL  79



>gb|KDP22792.1| hypothetical protein JCGZ_00379 [Jatropha curcas]
Length=321

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K ++EAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  34   DKVCPEALPTIKRLIEAAVYKERRMGASLLRLHFHDCFVNGCDASVL  80



>ref|XP_008244444.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            VF AVK +V +A+  E R+GASL+RL FHDCFV GCD  +L
Sbjct  41   VFHAVKSVVRSAVKKEKRIGASLLRLHFHDCFVKGCDGSVL  81



>gb|KDP22791.1| hypothetical protein JCGZ_00378 [Jatropha curcas]
Length=321

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D+ C      +K ++EAA+  E RMGASL+RL FHDCFV+GCDA +L
Sbjct  34   DKVCPEALPTIKRLIEAAVYKERRMGASLLRLHFHDCFVNGCDASVL  80



>ref|XP_011025199.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=351

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            DE C  V S ++EI+E  + ++ R+GASLIRL FHDCFVDGCDA +L
Sbjct  36   DETCPNVTSIIREIIEDTLLSDARIGASLIRLHFHDCFVDGCDASIL  82



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V S +K  V +AI  E+RMGASL+RL FHDCFV+GCDA +L
Sbjct  37   VLSIIKTAVNSAIAKESRMGASLLRLHFHDCFVNGCDASVL  77



>gb|AFW86733.1| peroxidase 52 [Zea mays]
Length=320

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V + V+ ++E A+  E RMGAS+IRLFFHDCFV+GCDA +L
Sbjct  40   VAAIVRSVMEQAVAKEPRMGASIIRLFFHDCFVNGCDASIL  80



>gb|EPS59568.1| hypothetical protein M569_15235, partial [Genlisea aurea]
Length=314

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            +F+ V+ +VE+A+  E R+GASL+RLFFHDCFV+GCD  +L
Sbjct  32   LFATVRSVVESAVQAEARIGASLLRLFFHDCFVNGCDGSVL  72



>ref|XP_009126754.1| PREDICTED: peroxidase 67 [Brassica rapa]
Length=326

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  EAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            E+C  +F AV+ +++ A+  E RM ASL+RLFFHDCF++GCD  +L
Sbjct  38   ESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFINGCDGSIL  83



>ref|NP_001147254.1| peroxidase 52 precursor [Zea mays]
 gb|ACG26392.1| peroxidase 52 precursor [Zea mays]
Length=318

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            V + V+ ++E A+  E RMGAS+IRLFFHDCFV+GCDA +L
Sbjct  38   VAAIVRSVMEQAVAKEPRMGASIIRLFFHDCFVNGCDASIL  78



>ref|NP_001060627.1| Os07g0677100 [Oryza sativa Japonica Group]
 dbj|BAC83102.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAF22541.1| Os07g0677100 [Oryza sativa Japonica Group]
 dbj|BAG95220.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    + +K  V AA+ NE RMGASL+RL FHDCFV GCDA +L
Sbjct  27   DTSCPRALATIKSAVTAAVNNEPRMGASLLRLHFHDCFVQGCDASVL  73



>ref|XP_010042071.1| PREDICTED: peroxidase 70-like [Eucalyptus grandis]
 gb|KCW88295.1| hypothetical protein EUGRSUZ_A00682 [Eucalyptus grandis]
Length=321

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              A+K +VE A+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  42   LPAIKRVVEGAVQQERRMGASLLRLHFHDCFVNGCDGSIL  81



>ref|XP_008463816.1| PREDICTED: peroxidase P7-like [Cucumis melo]
Length=322

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S +K +V  AI NE RMGASL+RL FHDCFV+GCD  +L
Sbjct  41   LSTIKSVVSKAIKNEPRMGASLLRLHFHDCFVNGCDGSVL  80



>sp|A2YPX3.2|PER2_ORYSI RecName: Full=Peroxidase 2; Flags: Precursor [Oryza sativa Indica 
Group]
 gb|AAC49821.1| peroxidase [Oryza sativa Indica Group]
 gb|EEC82682.1| hypothetical protein OsI_27327 [Oryza sativa Indica Group]
Length=314

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K  V AA+ +E RMGASL+RL FHDCFV GCDA +L
Sbjct  31   DTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVL  77



>ref|NP_001060629.1| Os07g0677300 [Oryza sativa Japonica Group]
 sp|Q0D3N0.1|PER2_ORYSJ RecName: Full=Peroxidase 2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA03911.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAC79528.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAC83104.1| peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69354.1| TPA: class III peroxidase 112 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF22543.1| Os07g0677300 [Oryza sativa Japonica Group]
 dbj|BAG93552.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67816.1| hypothetical protein OsJ_25570 [Oryza sativa Japonica Group]
Length=314

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  332  DEAC--VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
            D +C    S +K  V AA+ +E RMGASL+RL FHDCFV GCDA +L
Sbjct  31   DTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVL  77



>ref|XP_010066484.1| PREDICTED: peroxidase 70-like [Eucalyptus grandis]
Length=321

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              A+K +VE A+  E RMGASL+RL FHDCFV+GCD  +L
Sbjct  42   LPAIKRVVEGAVQQERRMGASLLRLHFHDCFVNGCDGSIL  81



>ref|XP_008233849.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=340

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  347  FSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
             S V+E V AAI NETR+GASL+RL FHDCFV+GCDA +L
Sbjct  60   LSIVQEEVVAAIKNETRIGASLLRLHFHDCFVNGCDASVL  99



>ref|XP_010066359.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  344  VFSAVKEIVEAAITNETRMGASLIRLFFHDCFVDGCDAGLL  466
              S +K  V +A+ NE RMGASL+RL FHDCFV+GCDA +L
Sbjct  39   ALSTIKSSVSSAVKNEARMGASLLRLHFHDCFVNGCDASIL  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758