BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24401_g2_i3 len=1280 path=[2051:0-139 2191:140-141 2193:142-166
2218:167-216 2268:217-307 2359:308-333 2385:334-536 @2588@!:537-770
2822:771-804 2856:805-902 7364:903-1057 3109:1058-1279]

Length=1280
                                                                      Score     E

ref|XP_009587078.1|  PREDICTED: putative auxin efflux carrier com...    358   7e-117   
ref|NP_001234192.1|  auxin efflux facilitator SlPIN5                    351   3e-114   
ref|XP_009804213.1|  PREDICTED: putative auxin efflux carrier com...    347   5e-113   
ref|XP_006345358.1|  PREDICTED: putative auxin efflux carrier com...    344   1e-111   
ref|XP_002279191.1|  PREDICTED: putative auxin efflux carrier com...    334   1e-107   Vitis vinifera
ref|XP_002512623.1|  conserved hypothetical protein                     332   7e-107   Ricinus communis
ref|XP_009603485.1|  PREDICTED: putative auxin efflux carrier com...    327   5e-105   
gb|KDP23297.1|  hypothetical protein JCGZ_23130                         323   2e-103   
ref|XP_002325466.1|  putative auxin efflux carrier protein 9            319   6e-102   Populus trichocarpa [western balsam poplar]
emb|CDP04220.1|  unnamed protein product                                318   1e-101   
ref|XP_007029400.1|  Auxin efflux carrier component                     318   2e-101   
ref|XP_010268327.1|  PREDICTED: putative auxin efflux carrier com...    318   2e-101   
ref|XP_009792134.1|  PREDICTED: putative auxin efflux carrier com...    317   6e-101   
ref|XP_006376058.1|  putative auxin efflux carrier protein 9            315   1e-100   
ref|XP_007205413.1|  hypothetical protein PRUPE_ppa007621mg             315   3e-100   
emb|CDP04221.1|  unnamed protein product                                312   3e-99    
emb|CDP11399.1|  unnamed protein product                                311   1e-98    
gb|AIF28449.1|  PIN-like protein                                        311   1e-98    
ref|XP_009338007.1|  PREDICTED: putative auxin efflux carrier com...    308   2e-97    
ref|XP_011014382.1|  PREDICTED: putative auxin efflux carrier com...    307   2e-97    
gb|KFK25870.1|  hypothetical protein AALP_AA8G172900                    307   3e-97    
ref|XP_011009309.1|  PREDICTED: putative auxin efflux carrier com...    307   3e-97    
ref|XP_008218436.1|  PREDICTED: putative auxin efflux carrier com...    306   7e-97    
ref|XP_008370812.1|  PREDICTED: putative auxin efflux carrier com...    306   8e-97    
gb|EYU39430.1|  hypothetical protein MIMGU_mgv1a007953mg                307   9e-97    
ref|XP_008355844.1|  PREDICTED: LOW QUALITY PROTEIN: putative aux...    306   1e-96    
ref|XP_004302153.1|  PREDICTED: putative auxin efflux carrier com...    305   1e-96    
gb|AIF28452.1|  PIN-like protein                                        301   4e-95    
ref|XP_010038273.1|  PREDICTED: putative auxin efflux carrier com...    301   7e-95    
ref|XP_010525085.1|  PREDICTED: putative auxin efflux carrier com...    301   2e-94    
ref|XP_011077194.1|  PREDICTED: putative auxin efflux carrier com...    301   3e-94    
ref|NP_197157.4|  auxin transporter PIN5                                298   8e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400192.1|  hypothetical protein EUTSA_v10013986mg             298   1e-93    
ref|XP_009384295.1|  PREDICTED: putative auxin efflux carrier com...    298   2e-93    
ref|XP_006480409.1|  PREDICTED: putative auxin efflux carrier com...    296   2e-93    
ref|XP_008388803.1|  PREDICTED: putative auxin efflux carrier com...    296   5e-93    
ref|XP_004155098.1|  PREDICTED: putative auxin efflux carrier com...    296   7e-93    
ref|XP_006480407.1|  PREDICTED: putative auxin efflux carrier com...    293   6e-92    
ref|XP_003624144.1|  Auxin Efflux Carrier                               294   6e-92    
gb|AIF28451.1|  PIN-like protein                                        293   9e-92    
ref|XP_006288060.1|  hypothetical protein CARUB_v10001290mg             293   1e-91    
ref|XP_004152830.1|  PREDICTED: putative auxin efflux carrier com...    293   2e-91    
emb|CDY67254.1|  BnaCnng54140D                                          291   3e-91    
gb|EYU39429.1|  hypothetical protein MIMGU_mgv1a009388mg                291   4e-91    
ref|XP_009121478.1|  PREDICTED: putative auxin efflux carrier com...    291   4e-91    
ref|XP_010420348.1|  PREDICTED: putative auxin efflux carrier com...    290   8e-91    
ref|XP_010492564.1|  PREDICTED: putative auxin efflux carrier com...    290   1e-90    
gb|AIF28459.1|  PIN-like protein                                        288   6e-90    
gb|KGN61255.1|  hypothetical protein Csa_2G074170                       288   9e-90    
ref|XP_002871722.1|  hypothetical protein ARALYDRAFT_326097             287   1e-89    
ref|XP_010453817.1|  PREDICTED: putative auxin efflux carrier com...    287   2e-89    
ref|XP_006480408.1|  PREDICTED: putative auxin efflux carrier com...    286   2e-89    
gb|KDO41492.1|  hypothetical protein CISIN_1g019021mg                   285   8e-89    
ref|XP_006480404.1|  PREDICTED: putative auxin efflux carrier com...    283   3e-88    
ref|XP_009383317.1|  PREDICTED: putative auxin efflux carrier com...    284   3e-88    
ref|XP_006645238.1|  PREDICTED: probable auxin efflux carrier com...    284   4e-88    
ref|XP_008802247.1|  PREDICTED: putative auxin efflux carrier com...    283   7e-88    
gb|AIF28460.1|  PIN-like protein                                        282   4e-87    
ref|XP_004492828.1|  PREDICTED: putative auxin efflux carrier com...    281   7e-87    
ref|XP_007139738.1|  hypothetical protein PHAVU_008G055200g             278   2e-85    
emb|CDX70699.1|  BnaC03g07830D                                          276   4e-85    
ref|NP_001234230.1|  auxin efflux facilitator SlPIN10                   275   5e-85    
ref|XP_006848440.1|  hypothetical protein AMTR_s00013p00241000          276   5e-85    
gb|AIF28456.1|  PIN-like protein                                        275   8e-85    
ref|XP_010673920.1|  PREDICTED: putative auxin efflux carrier com...    275   1e-84    
ref|XP_009131547.1|  PREDICTED: putative auxin efflux carrier com...    273   2e-84    
ref|NP_001045214.1|  Os01g0919800                                       272   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006350420.1|  PREDICTED: putative auxin efflux carrier com...    271   2e-83    
gb|AIF28450.1|  PIN-like protein                                        270   3e-83    
ref|XP_010111063.1|  Putative auxin efflux carrier component 8          270   4e-83    
ref|XP_008794580.1|  PREDICTED: putative auxin efflux carrier com...    271   4e-83    
ref|XP_003564940.1|  PREDICTED: probable auxin efflux carrier com...    270   1e-82    
ref|XP_010927704.1|  PREDICTED: putative auxin efflux carrier com...    269   2e-82    
gb|AIF28457.1|  PIN-like protein                                        268   4e-82    
ref|XP_002272306.1|  PREDICTED: putative auxin efflux carrier com...    268   5e-82    Vitis vinifera
ref|XP_009402744.1|  PREDICTED: probable auxin efflux carrier com...    266   5e-81    
ref|XP_003534521.1|  PREDICTED: putative auxin efflux carrier com...    266   6e-81    
dbj|BAJ91285.1|  predicted protein                                      266   8e-81    
ref|XP_010927702.1|  PREDICTED: putative auxin efflux carrier com...    264   1e-80    
gb|AIF28455.1|  PIN-like protein                                        264   2e-80    
dbj|BAJ96544.1|  predicted protein                                      265   2e-80    
ref|XP_009402745.1|  PREDICTED: probable auxin efflux carrier com...    264   2e-80    
ref|XP_009781685.1|  PREDICTED: putative auxin efflux carrier com...    263   4e-80    
ref|XP_010038261.1|  PREDICTED: putative auxin efflux carrier com...    263   4e-80    
ref|XP_004971070.1|  PREDICTED: probable auxin efflux carrier com...    263   5e-80    
gb|KHN29283.1|  Putative auxin efflux carrier component 8               263   9e-80    
gb|AIF28454.1|  PIN-like protein                                        259   2e-79    
ref|XP_010045960.1|  PREDICTED: putative auxin efflux carrier com...    261   4e-79    
ref|NP_001276305.1|  uncharacterized protein LOC100784879               259   1e-78    
ref|XP_010068801.1|  PREDICTED: putative auxin efflux carrier com...    258   4e-78    
ref|NP_001148155.1|  auxin efflux carrier component 6                   257   1e-77    Zea mays [maize]
gb|AFK32343.1|  putative auxin efflux carrier PIN5a                     257   2e-77    
emb|CDX78697.1|  BnaA03g06090D                                          256   4e-77    
gb|KHN40463.1|  Putative auxin efflux carrier component 8               248   4e-74    
ref|XP_006659591.1|  PREDICTED: probable auxin efflux carrier com...    247   6e-74    
ref|XP_010070144.1|  PREDICTED: putative auxin efflux carrier com...    246   9e-74    
gb|AIF28462.1|  PIN-like protein                                        243   5e-73    
ref|NP_001062317.1|  Os08g0529000                                       243   2e-72    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001276122.1|  uncharacterized protein LOC100788225               239   3e-71    
ref|XP_002320435.2|  hypothetical protein POPTR_0014s14390g             239   6e-71    Populus trichocarpa [western balsam poplar]
dbj|BAB09622.1|  unnamed protein product                                238   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|EMS56061.1|  putative auxin efflux carrier component 4               237   6e-70    
gb|KCW65009.1|  hypothetical protein EUGRSUZ_G02548                     234   2e-69    
ref|XP_004957280.1|  PREDICTED: probable auxin efflux carrier com...    235   2e-69    
ref|XP_002462627.1|  hypothetical protein SORBIDRAFT_02g029210          235   3e-69    Sorghum bicolor [broomcorn]
ref|NP_001140977.1|  uncharacterized protein LOC100273056               234   8e-69    Zea mays [maize]
ref|XP_003576710.1|  PREDICTED: probable auxin efflux carrier com...    232   5e-68    
ref|XP_009346849.1|  PREDICTED: putative auxin efflux carrier com...    228   4e-67    
tpd|FAA00684.1|  TPA: auxin efflux carrier                              229   6e-67    
ref|XP_010068800.1|  PREDICTED: uncharacterized protein LOC104455763    234   6e-66    
gb|EAZ07744.1|  hypothetical protein OsI_29999                          225   2e-65    Oryza sativa Indica Group [Indian rice]
gb|KDO47605.1|  hypothetical protein CISIN_1g041301mg                   223   2e-65    
ref|XP_009342872.1|  PREDICTED: putative auxin efflux carrier com...    215   1e-61    
ref|XP_004302355.1|  PREDICTED: probable auxin efflux carrier com...    214   2e-61    
ref|XP_008230728.1|  PREDICTED: putative auxin efflux carrier com...    214   2e-61    
ref|XP_007216395.1|  hypothetical protein PRUPE_ppa021573mg             214   3e-61    
ref|XP_004978371.1|  PREDICTED: probable auxin efflux carrier com...    213   5e-61    
ref|XP_007138460.1|  hypothetical protein PHAVU_009G210900g             214   7e-61    
ref|XP_006853065.1|  hypothetical protein AMTR_s00038p00074050          211   4e-60    
ref|XP_008379330.1|  PREDICTED: putative auxin efflux carrier com...    210   6e-60    
ref|XP_006663186.1|  PREDICTED: probable auxin efflux carrier com...    210   3e-59    
ref|XP_003569680.1|  PREDICTED: probable auxin efflux carrier com...    207   8e-59    
ref|XP_010912889.1|  PREDICTED: probable auxin efflux carrier com...    206   2e-58    
ref|XP_004963479.1|  PREDICTED: probable auxin efflux carrier com...    206   2e-58    
ref|XP_004969744.1|  PREDICTED: auxin efflux carrier component 4-...    205   5e-58    
ref|XP_010087804.1|  Putative auxin efflux carrier component 5          205   6e-58    
gb|EMS67819.1|  Putative auxin efflux carrier component 5               205   8e-58    
gb|KDO39721.1|  hypothetical protein CISIN_1g035534mg                   202   9e-58    
ref|XP_008775592.1|  PREDICTED: probable auxin efflux carrier com...    204   9e-58    
emb|CDM83606.1|  unnamed protein product                                203   3e-57    
ref|XP_004147461.1|  PREDICTED: probable auxin efflux carrier com...    203   3e-57    
ref|XP_002458404.1|  hypothetical protein SORBIDRAFT_03g032850          203   3e-57    Sorghum bicolor [broomcorn]
tpg|DAA57876.1|  TPA: hypothetical protein ZEAMMB73_331388              202   7e-57    
ref|XP_003574813.1|  PREDICTED: probable auxin efflux carrier com...    202   8e-57    
ref|XP_011098572.1|  PREDICTED: auxin efflux carrier component 4 ...    202   1e-56    
gb|KGN59594.1|  hypothetical protein Csa_3G827360                       202   1e-56    
ref|NP_001168208.1|  uncharacterized protein LOC100381964               201   1e-56    Zea mays [maize]
gb|AFK32346.1|  putative auxin efflux carrier PIN8                      201   2e-56    
gb|EMT25709.1|  Putative auxin efflux carrier component 5               202   2e-56    
ref|XP_008673108.1|  PREDICTED: uncharacterized protein LOC100381...    202   2e-56    
ref|XP_011005065.1|  PREDICTED: putative auxin efflux carrier com...    200   4e-56    
emb|CDM85668.1|  unnamed protein product                                199   9e-56    
ref|XP_011077192.1|  PREDICTED: putative auxin efflux carrier com...    201   1e-55    
ref|XP_006373306.1|  hypothetical protein POPTR_0017s11440g             199   1e-55    
ref|XP_010242365.1|  PREDICTED: probable auxin efflux carrier com...    199   1e-55    
ref|XP_007032452.1|  Auxin efflux carrier family protein                199   2e-55    
gb|AIF28458.1|  PIN-like protein                                        194   3e-55    
gb|AGW52147.1|  PIN13                                                   196   1e-54    
ref|XP_010686765.1|  PREDICTED: probable auxin efflux carrier com...    194   5e-54    
gb|EYU34112.1|  hypothetical protein MIMGU_mgv1a024604mg                193   1e-53    
gb|AIF28442.1|  PIN-like protein                                        194   1e-53    
ref|XP_008664247.1|  PREDICTED: LOW QUALITY PROTEIN: probable aux...    193   3e-53    
ref|XP_006482537.1|  PREDICTED: putative auxin efflux carrier com...    192   4e-53    
gb|KDP45475.1|  hypothetical protein JCGZ_09724                         192   6e-53    
ref|XP_002305371.1|  hypothetical protein POPTR_0004s12310g             191   9e-53    Populus trichocarpa [western balsam poplar]
ref|XP_007151202.1|  hypothetical protein PHAVU_004G026500g             189   6e-52    
gb|EMT05834.1|  Putative auxin efflux carrier component 6               188   1e-51    
ref|XP_011098571.1|  PREDICTED: probable auxin efflux carrier com...    189   1e-51    
gb|AIF28463.1|  PIN-like protein                                        182   1e-51    
ref|XP_007139602.1|  hypothetical protein PHAVU_008G043700g             188   1e-51    
gb|KCW58740.1|  hypothetical protein EUGRSUZ_H01382                     185   2e-51    
ref|XP_010686764.1|  PREDICTED: probable auxin efflux carrier com...    189   2e-51    
ref|XP_003552512.1|  PREDICTED: auxin efflux carrier component 3-...    187   2e-51    
ref|XP_011009448.1|  PREDICTED: putative auxin efflux carrier com...    187   3e-51    
ref|NP_001063602.1|  Os09g0505400                                       188   5e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431075.1|  hypothetical protein CICLE_v10012051mg             187   5e-51    
ref|XP_008443437.1|  PREDICTED: putative auxin efflux carrier com...    186   7e-51    
gb|EAZ45288.1|  hypothetical protein OsJ_29930                          186   9e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006338481.1|  PREDICTED: putative auxin efflux carrier com...    186   1e-50    
gb|KDO36786.1|  hypothetical protein CISIN_1g048649mg                   182   2e-50    
ref|XP_008443438.1|  PREDICTED: putative auxin efflux carrier com...    185   2e-50    
ref|NP_001234211.1|  auxin efflux facilitator SlPIN8                    184   6e-50    
ref|XP_002282480.1|  PREDICTED: putative auxin efflux carrier com...    184   6e-50    Vitis vinifera
ref|XP_002458992.1|  hypothetical protein SORBIDRAFT_03g043960          183   7e-50    Sorghum bicolor [broomcorn]
ref|XP_010315851.1|  PREDICTED: auxin efflux facilitator SlPIN8 i...    184   7e-50    
gb|KHN11585.1|  Putative auxin efflux carrier component 5               183   1e-49    
ref|XP_003534463.1|  PREDICTED: probable auxin efflux carrier com...    182   2e-49    
ref|XP_009795990.1|  PREDICTED: putative auxin efflux carrier com...    182   2e-49    
ref|XP_009617494.1|  PREDICTED: putative auxin efflux carrier com...    181   4e-49    
tpg|DAA05219.1|  TPA: auxin efflux carrier protein                      181   8e-49    
ref|XP_004489167.1|  PREDICTED: auxin efflux carrier component 1-...    179   2e-48    
ref|XP_004489373.1|  PREDICTED: putative auxin efflux carrier com...    179   3e-48    
ref|XP_009386292.1|  PREDICTED: auxin efflux carrier component 1        179   3e-48    
ref|XP_008788611.1|  PREDICTED: probable auxin efflux carrier com...    180   5e-48    
emb|CDP02197.1|  unnamed protein product                                178   6e-48    
ref|XP_006853071.1|  hypothetical protein AMTR_s00038p00082540          178   7e-48    
ref|XP_010492334.1|  PREDICTED: putative auxin efflux carrier com...    178   1e-47    
ref|XP_010420162.1|  PREDICTED: putative auxin efflux carrier com...    178   1e-47    
gb|AGJ95049.1|  PIN11                                                   177   2e-47    
ref|XP_003621113.1|  Auxin efflux carrier component                     177   2e-47    
ref|XP_003550957.1|  PREDICTED: putative auxin efflux carrier com...    177   3e-47    
ref|XP_010029286.1|  PREDICTED: putative auxin efflux carrier com...    176   5e-47    
gb|EMT08432.1|  Putative auxin efflux carrier component 4               176   6e-47    
gb|KHN47561.1|  Putative auxin efflux carrier component 5               174   2e-46    
ref|NP_001267507.1|  uncharacterized protein LOC100795531               174   2e-46    
ref|XP_010906421.1|  PREDICTED: probable auxin efflux carrier com...    173   4e-46    
ref|XP_010550069.1|  PREDICTED: putative auxin efflux carrier com...    173   5e-46    
ref|XP_009121614.1|  PREDICTED: putative auxin efflux carrier com...    173   7e-46    
ref|XP_006286843.1|  hypothetical protein CARUB_v10003844mg             171   6e-45    
ref|XP_001765763.1|  PIND AtPIN5-like auxin efflux carrier              170   1e-44    
ref|NP_197014.1|  auxin transporter PIN8                                169   2e-44    Arabidopsis thaliana [mouse-ear cress]
gb|KCW84567.1|  hypothetical protein EUGRSUZ_B01406                     167   3e-44    
ref|XP_009395146.1|  PREDICTED: probable auxin efflux carrier com...    169   4e-44    
ref|NP_001276253.1|  uncharacterized protein LOC100779697               167   1e-43    
ref|XP_006600903.1|  PREDICTED: putative auxin efflux carrier com...    166   2e-43    
emb|CDX85565.1|  BnaA02g02480D                                          166   3e-43    
ref|XP_006661411.1|  PREDICTED: probable auxin efflux carrier com...    162   6e-43    
ref|XP_009126029.1|  PREDICTED: putative auxin efflux carrier com...    165   9e-43    
ref|XP_003564417.1|  PREDICTED: probable auxin efflux carrier com...    165   1e-42    
gb|EMT10264.1|  Putative auxin efflux carrier component 4               160   2e-42    
ref|NP_001267522.1|  uncharacterized protein LOC100781239               166   3e-42    
ref|XP_006400028.1|  hypothetical protein EUTSA_v10016062mg             163   3e-42    
gb|EEE55544.1|  hypothetical protein OsJ_03782                          164   3e-42    Oryza sativa Japonica Group [Japonica rice]
gb|AIF28473.1|  PIN-like protein                                        167   4e-42    
ref|XP_010268329.1|  PREDICTED: auxin efflux carrier component 1-...    166   6e-42    
dbj|BAD93921.1|  auxin transporter splice variant b                     157   7e-42    Arabidopsis thaliana [mouse-ear cress]
gb|EMS56676.1|  putative auxin efflux carrier component 5               164   9e-42    
ref|XP_010268328.1|  PREDICTED: probable auxin efflux carrier com...    166   9e-42    
ref|XP_008441865.1|  PREDICTED: putative auxin efflux carrier com...    154   2e-41    
gb|AIF28472.1|  PIN-like protein                                        165   2e-41    
ref|XP_011006097.1|  PREDICTED: auxin efflux carrier component 3-...    162   6e-41    
gb|AIF28466.1|  PIN-like protein                                        164   7e-41    
gb|AIF28483.1|  PIN-like protein                                        154   9e-41    
gb|AIF28348.1|  PIN-like protein                                        153   1e-40    
ref|XP_006848444.1|  hypothetical protein AMTR_s00013p00242590          160   2e-40    
ref|XP_007161379.1|  hypothetical protein PHAVU_001G0639000g            153   2e-40    
gb|AIF28272.1|  PIN-like protein                                        160   2e-40    
gb|AIF28445.1|  PIN-like protein                                        159   2e-40    
gb|AIF28438.1|  PIN-like protein                                        159   3e-40    
ref|XP_006367982.1|  PREDICTED: putative auxin efflux carrier com...    150   4e-40    
ref|XP_007034342.1|  Auxin efflux carrier family protein isoform 1      159   4e-40    
emb|CDY40380.1|  BnaA02g26940D                                          160   4e-40    
ref|XP_009129244.1|  PREDICTED: auxin efflux carrier component 4        160   6e-40    
ref|XP_006290757.1|  hypothetical protein CARUB_v10016856mg             160   6e-40    
gb|AIF28293.1|  PIN-like protein                                        152   8e-40    
gb|AIF28268.1|  PIN-like protein                                        159   1e-39    
gb|AIF28294.1|  PIN-like protein                                        152   1e-39    
gb|AIF28269.1|  PIN-like protein                                        159   2e-39    
gb|KFK33369.1|  hypothetical protein AALP_AA5G004800                    159   2e-39    
gb|KFK33370.1|  hypothetical protein AALP_AA5G004800                    159   2e-39    
gb|AIF28428.1|  PIN-like protein                                        151   2e-39    
ref|XP_002444705.1|  hypothetical protein SORBIDRAFT_07g026370          156   3e-39    Sorghum bicolor [broomcorn]
gb|AIF28403.1|  PIN-like protein                                        149   4e-39    
ref|XP_010033744.1|  PREDICTED: auxin efflux carrier component 1-...    158   4e-39    
emb|CDY63826.1|  BnaC02g47640D                                          158   5e-39    
ref|XP_002876748.1|  pin-formed 4                                       158   5e-39    
ref|NP_849923.1|  auxin efflux carrier component 4                      158   5e-39    Arabidopsis thaliana [mouse-ear cress]
emb|CBI15569.3|  unnamed protein product                                152   5e-39    
ref|XP_009105760.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    158   6e-39    
gb|KHN11028.1|  Putative auxin efflux carrier component 6               150   6e-39    
ref|XP_006398529.1|  hypothetical protein EUTSA_v10000822mg             157   6e-39    
emb|CDY68262.1|  BnaC06g43740D                                          157   6e-39    
ref|NP_565261.1|  auxin efflux carrier component 4                      157   6e-39    Arabidopsis thaliana [mouse-ear cress]
emb|CDX96288.1|  BnaA07g28990D                                          157   6e-39    
ref|XP_002976702.1|  hypothetical protein SELMODRAFT_105586             158   7e-39    
ref|XP_008673109.1|  PREDICTED: uncharacterized protein LOC100381...    152   7e-39    
emb|CAC67688.1|  efflux carrier, pin3                                   157   7e-39    Brassica juncea [brown mustard]
emb|CAC67457.1|  efflux carrier, pin2                                   157   7e-39    Brassica juncea [brown mustard]
ref|NP_001066091.1|  Os12g0133800                                       152   8e-39    Oryza sativa Japonica Group [Japonica rice]
gb|AIF28443.1|  PIN-like protein                                        155   8e-39    
ref|XP_010036951.1|  PREDICTED: auxin efflux carrier component 1-...    157   1e-38    
gb|AIF28363.1|  PIN-like protein                                        157   1e-38    
gb|AIF28381.1|  PIN-like protein                                        157   1e-38    
gb|AIF28406.1|  PIN-like protein                                        151   2e-38    
ref|XP_002973335.1|  hypothetical protein SELMODRAFT_98910              157   2e-38    
gb|AIF28385.1|  PIN-like protein                                        156   2e-38    
ref|XP_001755522.1|  PINB AtPIN5/6-like auxin efflux carrier protein    157   2e-38    
ref|XP_009391391.1|  PREDICTED: probable auxin efflux carrier com...    156   2e-38    
gb|AIF28288.1|  PIN-like protein                                        155   3e-38    
gb|ABA95736.2|  Auxin efflux carrier component 3, putative, expre...    153   3e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007154690.1|  hypothetical protein PHAVU_003G139600g             155   3e-38    
gb|KDO61974.1|  hypothetical protein CISIN_1g036474mg                   155   3e-38    
ref|XP_006474301.1|  PREDICTED: auxin efflux carrier component 2-...    155   3e-38    
gb|EMS62769.1|  putative auxin efflux carrier component 1c              152   3e-38    
ref|XP_010451788.1|  PREDICTED: auxin efflux carrier component 2-...    155   3e-38    
emb|CDX68327.1|  BnaA07g23670D                                          154   4e-38    
ref|XP_003535060.1|  PREDICTED: auxin efflux carrier component 2-...    154   4e-38    
emb|CDY23471.1|  BnaC06g24400D                                          154   4e-38    
ref|XP_010483205.1|  PREDICTED: auxin efflux carrier component 2-...    155   4e-38    
ref|XP_010552711.1|  PREDICTED: auxin efflux carrier component 3        155   4e-38    
gb|AIF28476.1|  PIN-like protein                                        147   4e-38    
ref|XP_009104930.1|  PREDICTED: auxin efflux carrier component 3        155   4e-38    
emb|CBI17877.3|  unnamed protein product                                153   4e-38    
ref|XP_010527774.1|  PREDICTED: auxin efflux carrier component 4-...    155   4e-38    
gb|AIF28387.1|  PIN-like protein                                        155   5e-38    
ref|XP_011084207.1|  PREDICTED: probable auxin efflux carrier com...    155   5e-38    
ref|XP_010678065.1|  PREDICTED: probable auxin efflux carrier com...    155   5e-38    
dbj|BAO49653.1|  putative auxin efflux carrier protein                  155   5e-38    
ref|XP_010554422.1|  PREDICTED: auxin efflux carrier component 4-...    155   5e-38    
gb|KHN22650.1|  Auxin efflux carrier component 2                        155   5e-38    
ref|XP_006600116.1|  PREDICTED: auxin efflux carrier protein 4 is...    155   6e-38    
gb|KHN17646.1|  Auxin efflux carrier component 2                        155   6e-38    
gb|AIF28315.1|  PIN-like protein                                        153   6e-38    
ref|XP_006593364.1|  PREDICTED: auxin efflux carrier protein 3 is...    155   6e-38    
gb|KHN15228.1|  Putative auxin efflux carrier component 1b              154   6e-38    
gb|AIF28393.1|  PIN-like protein                                        155   6e-38    
ref|XP_004167314.1|  PREDICTED: auxin efflux carrier component 2-...    155   6e-38    
gb|AIF28485.1|  PIN-like protein                                        148   6e-38    
ref|XP_006280155.1|  hypothetical protein CARUB_v10026053mg             155   7e-38    
ref|XP_001753612.1|  PINA AtPIN5/PIN6-like auxin efflux carrier p...    155   7e-38    
ref|XP_010443377.1|  PREDICTED: auxin efflux carrier component 2 ...    155   7e-38    
ref|XP_010451791.1|  PREDICTED: auxin efflux carrier component 2-...    155   7e-38    
ref|XP_010097558.1|  Auxin efflux carrier component 1                   154   7e-38    
gb|AIF28535.1|  PIN-like protein                                        154   7e-38    
ref|XP_010483204.1|  PREDICTED: auxin efflux carrier component 2-...    155   7e-38    
ref|XP_008453545.1|  PREDICTED: auxin efflux carrier component 2        154   8e-38    
ref|XP_009601532.1|  PREDICTED: auxin efflux carrier component 3-...    154   8e-38    
emb|CAC24691.1|  efflux carrier of polar auxin transport                154   8e-38    
ref|XP_009601533.1|  PREDICTED: auxin efflux carrier component 3-...    154   8e-38    
ref|XP_002864498.1|  hypothetical protein ARALYDRAFT_918870             154   8e-38    
ref|NP_001234177.1|  auxin efflux facilitator SlPIN3                    154   8e-38    
gb|AGG79240.1|  auxin efflux facilitator PIN3                           154   9e-38    
ref|XP_009761336.1|  PREDICTED: auxin efflux carrier component 3-...    154   9e-38    
gb|AIF28270.1|  PIN-like protein                                        153   9e-38    
ref|XP_009763716.1|  PREDICTED: auxin efflux carrier component 2        154   9e-38    
ref|XP_010319114.1|  PREDICTED: auxin efflux facilitator SlPIN3 i...    154   1e-37    
gb|AIF28440.1|  PIN-like protein                                        152   1e-37    
gb|AGG79243.1|  auxin efflux facilitator PIN3b                          154   1e-37    
ref|XP_009761335.1|  PREDICTED: auxin efflux carrier component 3-...    154   1e-37    
ref|XP_006430537.1|  hypothetical protein CICLE_v10012938mg             145   1e-37    
ref|XP_006360412.1|  PREDICTED: auxin efflux carrier component 3-...    154   1e-37    
gb|AIF28416.1|  PIN-like protein                                        154   1e-37    
ref|XP_010274725.1|  PREDICTED: probable auxin efflux carrier com...    154   1e-37    
gb|AIF28373.1|  PIN-like protein                                        154   1e-37    
ref|XP_004965062.1|  PREDICTED: probable auxin efflux carrier com...    154   1e-37    
ref|XP_006390822.1|  hypothetical protein EUTSA_v10018257mg             154   1e-37    
ref|XP_007138429.1|  hypothetical protein PHAVU_009G208200g             152   1e-37    
gb|AIF28258.1|  PIN-like protein                                        154   1e-37    
ref|XP_002873708.1|  pin-formed 8                                       150   1e-37    
ref|NP_001234170.1|  auxin efflux facilitator SlPIN2                    154   1e-37    
gb|AIF28444.1|  PIN-like protein                                        149   1e-37    
ref|NP_001057227.1|  Os06g0232300                                       153   2e-37    
ref|XP_010263760.1|  PREDICTED: probable auxin efflux carrier com...    153   2e-37    
gb|AIF28326.1|  PIN-like protein                                        153   2e-37    
ref|XP_006655945.1|  PREDICTED: probable auxin efflux carrier com...    153   2e-37    
ref|XP_002266059.1|  PREDICTED: auxin efflux carrier component 2        153   2e-37    
ref|XP_008659083.1|  PREDICTED: probable auxin efflux carrier com...    153   2e-37    
ref|XP_011072996.1|  PREDICTED: auxin efflux carrier component 1-...    153   2e-37    
ref|XP_002436761.1|  hypothetical protein SORBIDRAFT_10g008290          153   2e-37    
gb|AIF28256.1|  PIN-like protein                                        153   2e-37    
ref|XP_004137343.1|  PREDICTED: auxin efflux carrier component 1-...    153   2e-37    
emb|CDY38263.1|  BnaA10g11110D                                          153   2e-37    
ref|XP_008453480.1|  PREDICTED: probable auxin efflux carrier com...    153   2e-37    
ref|XP_006366195.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    153   2e-37    
gb|AIF28423.1|  PIN-like protein                                        154   2e-37    
ref|XP_009126903.1|  PREDICTED: auxin efflux carrier component 2        153   2e-37    
ref|XP_004160415.1|  PREDICTED: auxin efflux carrier component 1-...    153   2e-37    
gb|EAZ36376.1|  hypothetical protein OsJ_20704                          153   2e-37    
ref|XP_007226940.1|  hypothetical protein PRUPE_ppa025174mg             153   2e-37    
gb|KDP46642.1|  hypothetical protein JCGZ_13598                         153   2e-37    
gb|AIF28286.1|  PIN-like protein                                        152   2e-37    
ref|XP_009120227.1|  PREDICTED: auxin efflux carrier component 2-...    153   2e-37    
ref|XP_010424909.1|  PREDICTED: auxin efflux carrier component 4        153   3e-37    
gb|AIF28311.1|  PIN-like protein                                        148   3e-37    
emb|CDY20694.1|  BnaA02g08340D                                          153   3e-37    
ref|NP_001065693.1|  Os11g0137000                                       152   3e-37    
dbj|BAJ97950.1|  predicted protein                                      152   3e-37    
ref|NP_001234184.1|  auxin efflux facilitator SlPIN4                    153   3e-37    
ref|XP_006344239.1|  PREDICTED: auxin efflux carrier component 3-...    153   3e-37    
ref|XP_010513862.1|  PREDICTED: auxin efflux carrier component 4-...    152   3e-37    
gb|ACH91613.2|  PIN-like auxin efflux carrier                           153   3e-37    
ref|XP_010419235.1|  PREDICTED: probable auxin efflux carrier com...    152   3e-37    
ref|XP_008223846.1|  PREDICTED: auxin efflux carrier component 2-...    153   3e-37    
tpd|FAA00679.1|  TPA: auxin efflux carrier                              152   3e-37    
gb|EEC67626.1|  hypothetical protein OsI_35015                          152   3e-37    
gb|AIF28400.1|  PIN-like protein                                        152   3e-37    
dbj|BAH23795.1|  putative auxin transport facilitator protein           152   3e-37    
ref|XP_009601548.1|  PREDICTED: auxin efflux carrier component 7-...    153   3e-37    
ref|XP_007227619.1|  hypothetical protein PRUPE_ppa024134mg             153   3e-37    
ref|XP_010320545.1|  PREDICTED: auxin efflux facilitator SlPIN4 i...    153   3e-37    
ref|XP_011069941.1|  PREDICTED: auxin efflux carrier component 2        152   3e-37    
ref|XP_002990501.1|  hypothetical protein SELMODRAFT_131936             152   4e-37    
ref|XP_002983754.1|  hypothetical protein SELMODRAFT_234325             152   4e-37    
gb|AIF28289.1|  PIN-like protein                                        152   4e-37    
ref|XP_004299530.1|  PREDICTED: auxin efflux carrier component 1-...    152   4e-37    
gb|EMT33514.1|  Putative auxin efflux carrier component 1c              153   4e-37    
gb|AIF28362.1|  PIN-like protein                                        153   4e-37    
ref|XP_002282220.1|  PREDICTED: probable auxin efflux carrier com...    152   4e-37    
emb|CBI26909.3|  unnamed protein product                                147   4e-37    
gb|AIF28249.1|  PIN-like protein                                        152   4e-37    
gb|AGY29598.1|  auxin efflux carrier                                    152   4e-37    
ref|XP_010246122.1|  PREDICTED: auxin efflux carrier component 2-...    152   4e-37    
gb|AIF28357.1|  PIN-like protein                                        147   5e-37    
gb|AGY29597.1|  auxin efflux carrier                                    152   5e-37    
gb|KDP23925.1|  hypothetical protein JCGZ_27085                         152   5e-37    
ref|XP_009132150.1|  PREDICTED: auxin efflux carrier component 2-...    152   5e-37    
gb|AAQ14257.1|AF247004_1  auxin efflux carrier                          152   5e-37    
gb|AIN44211.1|  PIN1                                                    152   5e-37    
ref|XP_004953880.1|  PREDICTED: auxin efflux carrier component 1-...    152   5e-37    
ref|XP_003564038.1|  PREDICTED: probable auxin efflux carrier com...    152   5e-37    
gb|AIF28338.1|  PIN-like protein                                        152   5e-37    
ref|XP_007160541.1|  hypothetical protein PHAVU_002G330300g             152   5e-37    
ref|XP_009610818.1|  PREDICTED: auxin efflux carrier component 2        152   5e-37    
emb|CDX88606.1|  BnaA03g10430D                                          152   5e-37    
gb|AIF28300.1|  PIN-like protein                                        147   5e-37    
gb|AIF28253.1|  PIN-like protein                                        152   6e-37    
gb|EYU18610.1|  hypothetical protein MIMGU_mgv1a003446mg                152   6e-37    
emb|CDY11886.1|  BnaC03g13120D                                          152   6e-37    
ref|XP_002527704.1|  Auxin efflux carrier component, putative           152   6e-37    
gb|AHN96182.1|  PIN-formed protein 1                                    152   6e-37    
dbj|BAJ10463.1|  auxin efflux facilitator                               152   6e-37    
gb|EYU37304.1|  hypothetical protein MIMGU_mgv1a002534mg                152   6e-37    
ref|XP_009414067.1|  PREDICTED: probable auxin efflux carrier com...    152   6e-37    
gb|AAQ14256.1|AF246995_1  AEC1                                          152   6e-37    
dbj|BAJ09455.1|  auxin efflux carrier                                   152   6e-37    
ref|XP_008812806.1|  PREDICTED: probable auxin efflux carrier com...    152   6e-37    
gb|AIF28413.1|  PIN-like protein                                        152   6e-37    
gb|ABQ95664.1|  auxin efflux carrier                                    150   7e-37    
ref|XP_007210282.1|  hypothetical protein PRUPE_ppa002944mg             152   7e-37    
ref|XP_004507913.1|  PREDICTED: auxin efflux carrier component 2-...    152   7e-37    
gb|AIF28296.1|  PIN-like protein                                        149   7e-37    
ref|XP_009802789.1|  PREDICTED: auxin efflux carrier component 7-...    152   7e-37    
gb|ABQ95663.1|  auxin efflux carrier                                    150   7e-37    
emb|CDO98348.1|  unnamed protein product                                151   8e-37    
dbj|BAJ10462.1|  auxin efflux facilitator                               151   8e-37    
dbj|BAO49657.1|  putative auxin efflux carrier protein                  151   8e-37    
ref|XP_008362771.1|  PREDICTED: probable auxin efflux carrier com...    151   8e-37    
ref|XP_010650417.1|  PREDICTED: auxin efflux carrier component 3        150   8e-37    
ref|XP_004973987.1|  PREDICTED: probable auxin efflux carrier com...    148   8e-37    
ref|XP_006401246.1|  hypothetical protein EUTSA_v10012929mg             152   8e-37    
ref|XP_010932634.1|  PREDICTED: probable auxin efflux carrier com...    152   8e-37    
ref|XP_004140432.1|  PREDICTED: auxin efflux carrier component 7-...    151   8e-37    
ref|XP_010932635.1|  PREDICTED: probable auxin efflux carrier com...    152   8e-37    
gb|EYU33972.1|  hypothetical protein MIMGU_mgv1a003655mg                151   8e-37    
ref|XP_009416747.1|  PREDICTED: probable auxin efflux carrier com...    151   8e-37    
ref|XP_009360078.1|  PREDICTED: probable auxin efflux carrier com...    151   9e-37    
ref|XP_009350116.1|  PREDICTED: auxin efflux carrier component 2-...    151   9e-37    
ref|XP_006663800.1|  PREDICTED: probable auxin efflux carrier com...    151   9e-37    
ref|XP_008454788.1|  PREDICTED: auxin efflux carrier component 7-...    151   9e-37    
ref|XP_009359964.1|  PREDICTED: auxin efflux carrier component 2-...    151   9e-37    
ref|XP_009416741.1|  PREDICTED: probable auxin efflux carrier com...    151   9e-37    
ref|XP_008363929.1|  PREDICTED: auxin efflux carrier component 2        152   9e-37    
gb|AIU94749.1|  auxin efflux carrier                                    151   9e-37    
gb|KCW78612.1|  hypothetical protein EUGRSUZ_C00078                     151   9e-37    
gb|KFK27268.1|  hypothetical protein AALP_AA8G359900                    151   9e-37    
gb|AIF28520.1|  PIN-like protein                                        152   1e-36    
gb|AIF28490.1|  PIN-like protein                                        152   1e-36    
ref|NP_568848.1|  auxin efflux carrier component 2                      151   1e-36    
ref|XP_010046903.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    151   1e-36    
ref|XP_010673043.1|  PREDICTED: probable auxin efflux carrier com...    151   1e-36    
emb|CAL51275.1|  auxin efflux carrier                                   150   1e-36    
ref|XP_009407784.1|  PREDICTED: probable auxin efflux carrier com...    151   1e-36    
gb|KDO63827.1|  hypothetical protein CISIN_1g007420mg                   150   1e-36    
ref|XP_011075450.1|  PREDICTED: probable auxin efflux carrier com...    151   1e-36    
gb|ABQ95658.1|  auxin efflux carrier                                    150   1e-36    
ref|XP_008374845.1|  PREDICTED: probable auxin efflux carrier com...    151   1e-36    
emb|CDP03009.1|  unnamed protein product                                151   1e-36    
gb|EYU24143.1|  hypothetical protein MIMGU_mgv1a003175mg                151   1e-36    
ref|XP_003595119.1|  Auxin efflux carrier component                     142   1e-36    
gb|AIF28267.1|  PIN-like protein                                        149   1e-36    
ref|XP_011075451.1|  PREDICTED: probable auxin efflux carrier com...    150   1e-36    
ref|XP_009357915.1|  PREDICTED: auxin efflux carrier component 3 ...    151   1e-36    
gb|AIF28282.1|  PIN-like protein                                        151   1e-36    
ref|XP_010428778.1|  PREDICTED: probable auxin efflux carrier com...    150   1e-36    
ref|XP_009356039.1|  PREDICTED: probable auxin efflux carrier com...    150   1e-36    
ref|XP_008646250.1|  PREDICTED: auxin efflux carrier component 1        150   1e-36    
ref|XP_009357924.1|  PREDICTED: auxin efflux carrier component 3 ...    151   1e-36    
gb|EEE51615.1|  hypothetical protein OsJ_32887                          154   1e-36    
ref|XP_011000408.1|  PREDICTED: probable auxin efflux carrier com...    150   1e-36    
ref|XP_010913714.1|  PREDICTED: probable auxin efflux carrier com...    150   2e-36    
ref|XP_007028296.1|  Auxin efflux carrier family protein isoform 2      150   2e-36    
gb|AAM54034.1|AF515435_1  PIN1-like auxin transport protein             150   2e-36    
ref|XP_008464398.1|  PREDICTED: probable auxin efflux carrier com...    150   2e-36    
gb|AIF28386.1|  PIN-like protein                                        151   2e-36    
gb|AIF28266.1|  PIN-like protein                                        147   2e-36    
gb|KDO64676.1|  hypothetical protein CISIN_1g006199mg                   150   2e-36    
ref|XP_004503270.1|  PREDICTED: probable auxin efflux carrier com...    150   2e-36    
ref|NP_001275530.1|  auxin efflux carrier component 1-like              150   2e-36    
gb|ABQ95659.1|  auxin efflux carrier                                    149   2e-36    
ref|XP_010909244.1|  PREDICTED: probable auxin efflux carrier com...    150   2e-36    
ref|XP_006469168.1|  PREDICTED: auxin efflux carrier component 3-...    150   2e-36    
ref|XP_007019383.1|  Auxin efflux carrier component isoform 1           150   2e-36    
dbj|BAH47609.1|  auxin:hydrogen symporter/transporter                   150   2e-36    
gb|AIF28352.1|  PIN-like protein                                        150   2e-36    
emb|CDP12011.1|  unnamed protein product                                150   2e-36    
gb|KDP38049.1|  hypothetical protein JCGZ_04692                         150   2e-36    
ref|XP_002322614.1|  putative auxin efflux carrier protein 10           150   2e-36    
ref|XP_008393426.1|  PREDICTED: probable auxin efflux carrier com...    150   2e-36    
dbj|BAH47611.1|  auxin:hydrogen symporter/transporter                   150   2e-36    
ref|XP_006490772.1|  PREDICTED: probable auxin efflux carrier com...    150   2e-36    
ref|NP_001169667.1|  uncharacterized protein LOC100383548               150   2e-36    
gb|AIF28295.1|  PIN-like protein                                        150   2e-36    
gb|AIF28277.1|  PIN-like protein                                        150   2e-36    
gb|AIF28390.1|  PIN-like protein                                        150   2e-36    
ref|XP_004299793.1|  PREDICTED: auxin efflux carrier component 2-...    150   2e-36    
gb|AAS19858.1|  auxin transporter PIN1                                  150   2e-36    
ref|XP_010044176.1|  PREDICTED: auxin efflux carrier component 4-...    150   3e-36    
gb|AIF28285.1|  PIN-like protein                                        150   3e-36    
ref|XP_008339560.1|  PREDICTED: auxin efflux carrier component 3 ...    150   3e-36    
gb|KDP28042.1|  hypothetical protein JCGZ_19719                         150   3e-36    
gb|AIF28398.1|  PIN-like protein                                        150   3e-36    
ref|NP_001267510.1|  uncharacterized protein LOC100800139               149   3e-36    
gb|EYU40829.1|  hypothetical protein MIMGU_mgv1a025638mg                150   3e-36    
gb|AHN96183.1|  PIN-formed protein 1                                    150   3e-36    
ref|XP_003631123.1|  Auxin efflux carrier component                     149   3e-36    
gb|AIF28396.1|  PIN-like protein                                        150   3e-36    
ref|XP_010246119.1|  PREDICTED: auxin efflux carrier component 2-...    150   3e-36    
gb|AHN96184.1|  PIN-formed protein 1                                    150   3e-36    
ref|XP_006390124.1|  hypothetical protein EUTSA_v10018345mg             149   3e-36    
ref|XP_004505266.1|  PREDICTED: auxin efflux carrier component 3-...    150   3e-36    



>ref|XP_009587078.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
tomentosiformis]
Length=367

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 224/368 (61%), Positives = 289/368 (79%), Gaps = 12/368 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVV AM PLYVA+ILGYGS++WWHMFK + CDAINRFNCFFILPFF F FIA  
Sbjct  3     GWEDIYKVVTAMVPLYVALILGYGSVKWWHMFKSEQCDAINRFNCFFILPFFNFEFIANF  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY +N LF+  DV++K +++V LV+WANF K G   WSITTFSLSTLNNTLVVGVPLM+
Sbjct  63    DPYNVNGLFLTGDVISKVLLIVILVLWANFYKKGNFSWSITTFSLSTLNNTLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL------GQISAAADNARPEMGT-  697
             AMYG+LG D+V+QAA +QALLWLT LLF LEF +T++      G I+ A++    E+G+ 
Sbjct  123   AMYGKLGVDIVIQAAVIQALLWLTSLLFALEFWKTKMNNSDSNGVINGASNGNSVELGSI  182

Query  696   -DLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGW  520
              DLEGN               N G ++  ++K V ++LAKNPN+YACFLGLIWA++   W
Sbjct  183   SDLEGNNTSVTPVRNNT----NNGLAFRPLIKVVSIKLAKNPNSYACFLGLIWALLANRW  238

Query  519   HFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATS  340
             +F MPSII+  I+IM+K GSG+AMFS GLFMALQ +II+CG  LT+Y ++LRF++GPAT 
Sbjct  239   NFEMPSIIEGPILIMSKAGSGVAMFSMGLFMALQGKIIACGTALTIYAMILRFVVGPATM  298

Query  339   AIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIG  160
             A G ++L LHG+VL++ I+QSALPQAVT+F++A+EYGLHADVLSTA+I+GTI+SLP++I 
Sbjct  299   AFGCVVLGLHGNVLRVAIIQSALPQAVTSFVYAQEYGLHADVLSTAVIVGTIISLPLLIA  358

Query  159   YYVILELL  136
             YY +L+++
Sbjct  359   YYAVLDIM  366



>ref|NP_001234192.1| auxin efflux facilitator SlPIN5 [Solanum lycopersicum]
 gb|ADR30412.1| auxin efflux facilitator SlPIN5 [Solanum lycopersicum]
Length=358

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 221/364 (61%), Positives = 286/364 (79%), Gaps = 11/364 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVV M PLYVA+ILGYGS++WWHMFKP+ CD INRFNCFFILPFF F FIA++
Sbjct  3     GWDDIYKVVVGMMPLYVALILGYGSVKWWHMFKPEQCDTINRFNCFFILPFFNFQFIAKI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY +NYLF++ DV+AKA+V++ LV+WANF K G   W ITTFSLSTLNNTLVVGVPLM+
Sbjct  63    NPYNLNYLFLSGDVIAKALVILILVLWANFYKKGSFCWGITTFSLSTLNNTLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD---NARPEMGTDLEG  685
             AMYG LG DLV+QAA +QALLWLT LLF LEF +T++   S   D   N   E+G     
Sbjct  123   AMYGDLGVDLVVQAAVIQALLWLTSLLFALEFWKTKMTNNSNLIDDNNNNSLELGNISST  182

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
             N +             NI  ++  +MK+V  +LAKNPN+YACFLGL WA++   WHF MP
Sbjct  183   NTQMRNIN--------NIELAFWPLMKAVSTKLAKNPNSYACFLGLFWALVASRWHFEMP  234

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
             SII+ SI+IM+K GSG++MFS GLFMAL+ +II+CG  LT+Y ++LRF++GPAT A+G +
Sbjct  235   SIIEGSILIMSKAGSGVSMFSMGLFMALRGKIIACGAALTIYSMILRFIVGPATMALGCV  294

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             +L L G+VL++ I+Q+ALPQAVT+F++A+EYGLHADVLSTA+I+GTI+SLP++I YY +L
Sbjct  295   VLGLRGNVLRVAIIQAALPQAVTSFVYAQEYGLHADVLSTAVIVGTIISLPLLIAYYAVL  354

Query  144   ELLP  133
             +++P
Sbjct  355   DIIP  358



>ref|XP_009804213.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
sylvestris]
Length=345

 Score =   347 bits (891),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 281/359 (78%), Gaps = 18/359 (5%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W DIYKVV AM PLYVA+ILGYGS++WWHMFK + CDAINRFNCFFI+PFF F FIA  D
Sbjct  4     WEDIYKVVAAMTPLYVALILGYGSVKWWHMFKSEQCDAINRFNCFFIIPFFNFEFIANFD  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY +N LF+  DV++KA+++V LV+WANF K G   WSITTFSLSTLNNTLVVGVPLM+A
Sbjct  64    PYNVNGLFLTGDVISKALLIVILVLWANFYKKGNFSWSITTFSLSTLNNTLVVGVPLMKA  123

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKe  673
             MYG+LG DLV+QAA +QALLWLT LLF LEF +T++        N      +DLEGN   
Sbjct  124   MYGKLGVDLVIQAAVIQALLWLTSLLFALEFWKTKMN------SNGNSVELSDLEGNNTP  177

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                           GP    ++K+V ++LAKNPN+YACFLGL+WA++   W+F MPSII+
Sbjct  178   VRNMA--------FGP----LIKAVSIKLAKNPNSYACFLGLVWALLANRWNFEMPSIIE  225

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
              S +IM+K GSG+AMFS GLFMALQ +II+CG  LT+Y ++LRF++GPAT A+G ++L L
Sbjct  226   GSFLIMSKAGSGVAMFSMGLFMALQGKIIACGTALTIYAMILRFVVGPATMALGCVVLGL  285

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             HG+VL++ I+QSALPQA+T+F++A+EYGLHADVLSTA+I+GT++SLP++I YY +L+++
Sbjct  286   HGNVLRVAIIQSALPQAITSFVYAQEYGLHADVLSTAVIVGTVISLPLLIAYYAVLDIM  344



>ref|XP_006345358.1| PREDICTED: putative auxin efflux carrier component 8-like [Solanum 
tuberosum]
Length=355

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 220/362 (61%), Positives = 279/362 (77%), Gaps = 10/362 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVV M PLYVA+ILGYGS++WWHMFKP+ CD INRFNCFFILPFF F FIA +
Sbjct  3     GWDDIYKVVVGMMPLYVALILGYGSVKWWHMFKPEQCDTINRFNCFFILPFFNFQFIANI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY +NYLF+  DV+AKA+V++ LV+WANF + G   W ITTFSLSTLNNTLVVGVPLM+
Sbjct  63    NPYNLNYLFLTGDVIAKALVILILVLWANFYRKGSFSWGITTFSLSTLNNTLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARP-EMGTDLEGNP  679
             AMYG LG DLV+QAA +QALLWLT LLF LEF +T++        N    E+G       
Sbjct  123   AMYGDLGVDLVVQAAVIQALLWLTSLLFALEFWKTKMNNNINGIANNNSVELGN------  176

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
                           N   ++  +MK+V  +LAKNPN+YACFLGL WA++   WHF MPSI
Sbjct  177   ---INTTTQMRNINNAELAFWPLMKAVSTKLAKNPNSYACFLGLFWALVASRWHFRMPSI  233

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             I+ SI+IM+K GSG+AMFS GLFMALQ +II+CG  LT+Y ++LRF++GPAT A+G ++L
Sbjct  234   IEGSILIMSKAGSGVAMFSMGLFMALQGKIIACGAALTIYAMILRFVVGPATMALGCVVL  293

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L G+VL+I I+Q+ALPQAVT+F++A+EYGLHADVLSTA+I+GTI+SLP++I YY IL++
Sbjct  294   GLRGNVLRIAIIQAALPQAVTSFVYAQEYGLHADVLSTAVIVGTIISLPLLIAYYAILDI  353

Query  138   LP  133
             +P
Sbjct  354   MP  355



>ref|XP_002279191.1| PREDICTED: putative auxin efflux carrier component 8 [Vitis vinifera]
 emb|CBI17652.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 207/364 (57%), Positives = 274/364 (75%), Gaps = 15/364 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLYVA++LGYGS++WW +F PD CDAINR  C+F LP FTF F A V
Sbjct  3     GWEDVYKVVVAMLPLYVALVLGYGSVKWWRIFTPDQCDAINRLVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+ +D V+K ++V+ L +WA     G   WSIT+FSL+TL N+LVVGVPL++
Sbjct  63    DPFKMNYLFIGADAVSKLIIVLVLALWAKCSSKGSYCWSITSFSLATLTNSLVVGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA--DNA--RPEMGTDLE  688
             AMYG LG DLV+Q++ +QA++WLT+LLF LEFRRT  G  S     D+     E G DLE
Sbjct  123   AMYGPLGVDLVVQSSVVQAIIWLTLLLFVLEFRRTGTGISSNTTMGDSGVIEVEPGKDLE  182

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
              N    +              S+ ++M+ V L+LA+NPN+YAC +G++WA I   WHF M
Sbjct  183   TNEMVVSTRL-----------SFWSLMRKVWLKLAQNPNSYACIIGIVWAFIANRWHFEM  231

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             PSI++ SI+IM++ G+G AMFS GLFMA+Q++II+CG TLTV+G+VLRF+ GPA  AIGA
Sbjct  232   PSIMEGSILIMSRAGTGTAMFSMGLFMAMQEKIIACGTTLTVFGMVLRFIAGPAAMAIGA  291

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I + LHGDVL+I I+Q+A+PQ++T+FI+AKEYGLHADVLSTA+I G I+SLP+++GYY +
Sbjct  292   IAVGLHGDVLRIAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPLLVGYYAV  351

Query  147   LELL  136
             LE L
Sbjct  352   LEFL  355



>ref|XP_002512623.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50075.1| conserved hypothetical protein [Ricinus communis]
Length=357

 Score =   332 bits (851),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 205/359 (57%), Positives = 269/359 (75%), Gaps = 6/359 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+VAM PLYVA++LGYGSIRWW +F P+   A+NR  C+F LP FTF F A V
Sbjct  3     GWEDVYKVIVAMVPLYVALLLGYGSIRWWKIFTPEQGGAVNRLVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+ +D ++K ++VV L  WA F   G   WSIT+FSLSTL N+LVVGVPLM+
Sbjct  63    DPFKMNYLFIGADAISKFIIVVVLACWAKFSSKGSYTWSITSFSLSTLTNSLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG +  DLV+Q++ +QA++WLT+LLF LEFRRTRL   S+  +     +  DLEG+  
Sbjct  123   AMYGPMAVDLVVQSSVVQAIIWLTILLFVLEFRRTRLDISSSNYNKNSDNLEKDLEGSGS  182

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                 A  +       GPS+  +MK V ++LA NPN+YAC LGL+WA I   WHF MPSI+
Sbjct  183   AGNMAISSS------GPSFWVLMKVVGVKLAMNPNSYACILGLVWAFIANRWHFEMPSIM  236

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMFS G+FMA+Q+++I+CG  LTV G++LRF+ GPA  AIG+I + 
Sbjct  237   EGSILIMSKAGTGTAMFSMGIFMAVQEKVIACGAGLTVVGMILRFIAGPAAMAIGSIAVG  296

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G I+SLPV+I YY ILE 
Sbjct  297   LHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPVLIAYYAILEF  355



>ref|XP_009603485.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
tomentosiformis]
Length=361

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 270/366 (74%), Gaps = 14/366 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAMAPLYVA+ILGY S++WW +F  D CDAIN+  C+F LP FTF F A V
Sbjct  3     GWEDVYKVVVAMAPLYVALILGYASVKWWRIFTADQCDAINQLVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+ +D ++KA++V  L  WA   + G   WSIT+FSLS L N+LVVGVPLM+
Sbjct  63    DPFDMNYKFLGADAISKAIIVAVLAFWAKCSRKGSYRWSITSFSLSALTNSLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA------DNARPEMGTD  694
             AMYG     LV+Q++  QA++WLT+LLF LE RRTR    S +A      +N   E G D
Sbjct  123   AMYGEEAVHLVVQSSVTQAIVWLTVLLFVLEVRRTRTDFSSDSAVGDVNNNNIVSENGKD  182

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHF  514
             LEGN ++   +           PS+  + K+V L+LA NPN+YAC  GL WA+I+  WHF
Sbjct  183   LEGNNRKVVTSITR--------PSFWCLTKTVWLKLATNPNSYACIFGLTWALISNRWHF  234

Query  513   TMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAI  334
              MPSI++ SI+IM++ G+G AMFS G+F+ALQ+++I+CG +LTV+G+VLRF+ GPA  AI
Sbjct  235   QMPSIMEGSILIMSRAGTGTAMFSMGMFVALQEKVIACGASLTVFGMVLRFIAGPAAMAI  294

Query  333   GAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYY  154
              +IL+ LHG+VL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G ++SLPV++GY+
Sbjct  295   ASILIGLHGNVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYF  354

Query  153   VILELL  136
              ILE L
Sbjct  355   AILEFL  360



>gb|KDP23297.1| hypothetical protein JCGZ_23130 [Jatropha curcas]
Length=350

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 265/360 (74%), Gaps = 13/360 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLYVA+ILGYGS++WW +F P+ C A+NR  C+F LP FTF F A +
Sbjct  3     GWEDVYKVVVAMVPLYVALILGYGSVKWWKIFTPEQCGAVNRLVCYFTLPLFTFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+ +D ++K ++V  L  WA F   G   WSIT+FSL TL N+LVVGVPL+ 
Sbjct  63    DPFKMNYLFMGADAISKLIIVAVLAFWAKFSSKGSYTWSITSFSLCTLTNSLVVGVPLIG  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG++  DLV+Q++ +QA++WLT+LLF LEFRR  L      + N     G DLEG+  
Sbjct  123   AMYGQMAVDLVVQSSVIQAIIWLTILLFVLEFRRANLD----ISSNTNGSDGKDLEGS--  176

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                       A  N+ PS+  +M+ V ++LA NPN+YAC +G++WA I   WHF MPSI+
Sbjct  177   -------NVNAIDNVRPSFWTLMRVVWIKLAMNPNSYACIIGIVWAFIANRWHFEMPSIM  229

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM+K G+G AMFS G+FMALQ+++ISCG  LTV G++LRF+ GPA  AIG+I + 
Sbjct  230   EGSLLIMSKAGTGTAMFSMGIFMALQEKVISCGAGLTVIGMILRFIAGPAAMAIGSIAVG  289

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GDVL++ I+Q+ALPQ++T+FI+AKEYGLHA+VLSTA+I G I+SLP++I YY ILE +
Sbjct  290   LRGDVLRVAIIQAALPQSITSFIYAKEYGLHAEVLSTAVIFGMIVSLPLLIAYYAILEFV  349



>ref|XP_002325466.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
 gb|EEE99847.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
Length=346

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 269/360 (75%), Gaps = 17/360 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVVAM PLYVA++LGYGS+RWW +F P+ C AINRF C+F LPFFTF F A V
Sbjct  3     GWADIYKVVVAMVPLYVALMLGYGSVRWWKVFTPEQCGAINRFVCYFTLPFFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+ +D ++K ++VV L +WA +   G   WSIT+FSL TL N+LV+GVPL++
Sbjct  63    DPFKMNYLFIGADAISKLIIVVVLAVWAKWSGKGSYGWSITSFSLCTLTNSLVLGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+Q++ +Q+++WLTMLL  LEFRR+ LG  S+  D        DLEGN  
Sbjct  123   AMYGPTAVDLVVQSSVIQSIIWLTMLLLVLEFRRSGLGVSSSNPDK-------DLEGNAD  175

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                ++           P++  +MK+V ++LA NPN+YAC +GL+WA I K W F MPSI+
Sbjct  176   STVSSR----------PAFWCLMKTVGVKLAMNPNSYACIIGLVWAFIAKRWRFEMPSIM  225

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMFS G+FMALQ+++I+CG +LTV G+VLRF+ GPA  AIG+I + 
Sbjct  226   EGSILIMSKTGTGTAMFSMGIFMALQEKVIACGASLTVIGMVLRFIAGPAAMAIGSIAVG  285

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GDVL++ I+Q+A PQA+ +FIFA+EYGLHA+VLSTA+I GTI++LPV+I YY IL+ +
Sbjct  286   LRGDVLRVAIIQAAFPQAIISFIFAQEYGLHAEVLSTAVIFGTIVALPVLIAYYAILDFV  345



>emb|CDP04220.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 272/362 (75%), Gaps = 13/362 (4%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GDIYKVV AMAPLYVA+ LGYGS++WWHMFK D CDAINRFNC+FI+PFFTF F A V+P
Sbjct  5     GDIYKVVTAMAPLYVALGLGYGSVKWWHMFKLDQCDAINRFNCYFIIPFFTFEFTAHVNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             YTMN  F+ +DV+AK +V + L +W N  K G  DW ITTFSL++LNNTLV+G PL++AM
Sbjct  65    YTMNRGFLIADVIAKFIVGIVLALWVNLSKKGSFDWCITTFSLASLNNTLVLGAPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADN----ARPEMGTDLEGN  682
             YG LG +LV+Q++ +Q+LLW   LL  LE+R+ R   + A + N    A  EMG DLE +
Sbjct  125   YGDLGENLVVQSSVIQSLLWFIALLILLEWRQARSEAVDARSMNGDSHAEIEMGRDLEES  184

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                  A            PS+ +++ +V  +LAKNPN+YAC +GLIWA+++  WH  MP 
Sbjct  185   SSAPVAIH---------SPSFLSVLNTVRTKLAKNPNSYACIIGLIWALVSNRWHIKMPE  235

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             I++ SI+IM+K G G+AMF+ GLF+A Q++ I+CG  LT YG+VLRF++GPA +A G+  
Sbjct  236   IVEGSILIMSKAGGGVAMFTMGLFIAWQEKFIACGVGLTFYGMVLRFVVGPALTAAGSFA  295

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + L GDVL+I ++Q+ALPQ++T+F++A+EYGLHA+VLSTA+I GTI+SLP++IGYY +L+
Sbjct  296   MGLRGDVLRIAVMQAALPQSITSFVYAQEYGLHANVLSTAVIFGTIVSLPLLIGYYAVLD  355

Query  141   LL  136
             +L
Sbjct  356   IL  357



>ref|XP_007029400.1| Auxin efflux carrier component [Theobroma cacao]
 gb|EOY09902.1| Auxin efflux carrier component [Theobroma cacao]
Length=353

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 263/358 (73%), Gaps = 10/358 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+ KVVVAM PLYVA++LGYGS++WW +F  + CDAINR  C+F LP FT  F   +
Sbjct  3     GWEDVCKVVVAMVPLYVALMLGYGSVKWWRIFTAEQCDAINRLVCYFTLPLFTVEFTTHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+ +D ++K ++VV L  WA     G   WSIT+FSLSTL N LVVGVPLM+
Sbjct  63    DPFQMNYRFIGADTISKLVIVVVLAFWAKCSSKGSYCWSITSFSLSTLTNALVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+ G DLV+Q++ +QA++WLT+LLF LEFRR+ +   SA  D    E   D+EGN  
Sbjct  123   AMYGQTGVDLVVQSSVVQAIIWLTILLFVLEFRRSGVSISSATKDGNEQE--KDVEGNTD  180

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
              A           +  PS+  +MK V ++LA NPN+YAC +GL +A +   WHF MPSI+
Sbjct  181   NAGVL--------STRPSFWNLMKVVGMKLAMNPNSYACVIGLAYACVANRWHFEMPSIM  232

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMFS G FMALQ++II+CG +LT++G+VLRF+ GPA  AIGAI + 
Sbjct  233   EGSILIMSKAGTGTAMFSMGTFMALQEKIIACGTSLTIFGMVLRFIAGPAAMAIGAIAVG  292

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             LHG VL++ I+Q+ALPQ++T+FIFAKEYG+HA+VLSTA+I GTI+SLPV++ YY ILE
Sbjct  293   LHGAVLRVAIIQAALPQSITSFIFAKEYGMHAEVLSTAVIFGTIVSLPVLVAYYAILE  350



>ref|XP_010268327.1| PREDICTED: putative auxin efflux carrier component 8 [Nelumbo 
nucifera]
Length=363

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 269/360 (75%), Gaps = 0/360 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G  D+YKVVVAM PLYVA +LGYGS++WWH+F PD C AINR  C+F LP FTF F A +
Sbjct  3     GLEDVYKVVVAMVPLYVATVLGYGSVKWWHIFTPDQCQAINRLVCYFTLPLFTFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+A+D ++K ++V+ LV WA     G   WSIT+FSLSTL N+LVVGVPL++
Sbjct  63    DPFNMNYLFIAADAISKVVIVIVLVFWAKCSSKGSYPWSITSFSLSTLTNSLVVGVPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG++G DLV+Q++ +QA++WLT+LLF LE R+TR   +S+ A +   +       + K
Sbjct  123   AMYGQIGVDLVVQSSVIQAIVWLTILLFVLELRKTRSDTLSSMATSLDSQSHVVSLESAK  182

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +           +   PS+ ++MK V L+LA NPNTYA  +G++WA ++  WH   PSI+
Sbjct  183   DVQTNDHVVEGLSTTKPSFCSVMKIVWLKLALNPNTYASLVGIVWAFVSNRWHIETPSIM  242

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM++ G+G AMF+ G+FMALQ+++I+CG  LT++G+VL+F+ GPA  AIGAI + 
Sbjct  243   EGSVLIMSRAGTGTAMFNMGIFMALQEKLIACGPPLTIFGMVLKFIAGPAAMAIGAIAVG  302

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             LHGDVL++ I+Q+ALPQ++T+FI+AKEYGLHADVLSTA+I G + SLP+++GYY +LE L
Sbjct  303   LHGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMLASLPILVGYYAVLEYL  362



>ref|XP_009792134.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
sylvestris]
Length=363

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 198/363 (55%), Positives = 263/363 (72%), Gaps = 8/363 (2%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+YKVVVAMAPLYVA+ILGY S++WW +F  D C AIN+  C+F LP FTF F A VD
Sbjct  4     WEDVYKVVVAMAPLYVALILGYASVKWWRIFTTDQCAAINQLVCYFTLPLFTFEFTAHVD  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             P+ MNY F+ +D ++KA++V  L  WA   + G   WSIT+FSLS L N+LVVGVPLM+A
Sbjct  64    PFDMNYKFLGADAISKAIIVAVLTFWAKCSRKGSYRWSITSFSLSALTNSLVVGVPLMKA  123

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR----LGQISAAADNARPEMGTDLEG  685
             MYG     LV+Q++  QA++WLT+LLF LE RRTR    L       +N  P    D E 
Sbjct  124   MYGEEAVHLVVQSSVTQAIVWLTVLLFVLEVRRTRSDFSLDSAVGDTNNNVP----DEEI  179

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
             N K+           +   PS+  + K+V L+LA NPN+YAC  GL WA+I+  WHF MP
Sbjct  180   NGKDLEVMNNRKVVASITRPSFWCLTKTVWLKLATNPNSYACIFGLTWALISNRWHFQMP  239

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
             SI++ SI+IM++ G+G AMFS G+FMALQ+++I+CG +L V+G+VLRF+ GPA+ AI +I
Sbjct  240   SIMEGSILIMSRAGTGTAMFSMGMFMALQEKVIACGASLAVFGMVLRFVAGPASMAIASI  299

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             L+ LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G ++SLPV++GYY IL
Sbjct  300   LIGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYYAIL  359

Query  144   ELL  136
             E L
Sbjct  360   EFL  362



>ref|XP_006376058.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
 gb|ERP53855.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
Length=346

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 266/361 (74%), Gaps = 17/361 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLYVA++LGYGS+RWW +F P+ C AINRF C+F LP FTF F A V
Sbjct  3     GWEDVYKVVVAMVPLYVALVLGYGSVRWWKVFTPEQCGAINRFVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+ +D V+K ++VV L  WA     G   WSIT+FSL TL N+LVVGVP+++
Sbjct  63    DPFKMNYRFIGADAVSKVIIVVVLAFWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPIIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+Q++ +QA++WLT+LL  LEFRRT LG  S  +D        DLEG+  
Sbjct  123   AMYGPAAVDLVVQSSVIQAIIWLTLLLLVLEFRRTGLGFSSNNSDK-------DLEGSVD  175

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                ++           P++  +M++V ++LA NPN+YAC +GL+WA I+  WHF MP+++
Sbjct  176   NTESSR----------PAFWCLMRTVWVKLAMNPNSYACIIGLVWAFISNRWHFEMPAMM  225

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMFS G+FMALQ+++ISCG +L V G++LRF+ GPA  AIG+I + 
Sbjct  226   EGSILIMSKAGTGTAMFSMGIFMALQEKVISCGASLAVIGMILRFIAGPAAMAIGSIAVG  285

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G + +LPV+I YY ILE +
Sbjct  286   LQGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLAALPVLITYYAILEFV  345

Query  135   P  133
             P
Sbjct  346   P  346



>ref|XP_007205413.1| hypothetical protein PRUPE_ppa007621mg [Prunus persica]
 gb|EMJ06612.1| hypothetical protein PRUPE_ppa007621mg [Prunus persica]
Length=361

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 198/363 (55%), Positives = 267/363 (74%), Gaps = 8/363 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVVVAM PLYVA+ILG+GS+RWW +F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWGDVYKVVVAMMPLYVALILGFGSVRWWRIFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++V  L +WA     G   WSIT+FSL TL N+LVVGVPLM+
Sbjct  63    DPYKWNYRFIGADAISKLIIVAVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT---RLGQISAAADNARPEMGTDLEG  685
             AMYG++  DLV+Q++ +QA++WLT+LLF LEFRRT    +  IS    +   E G   EG
Sbjct  123   AMYGQVAVDLVVQSSVVQAIVWLTILLFVLEFRRTGSLDMHMISGTNTSQSVEQG---EG  179

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
                    A  +  + +   PS+  +MK+V L+L  NPN+YA F+G+ WA I+  WH  +P
Sbjct  180   GKAVEGLAAMSTMSSSR--PSFWYLMKAVWLKLGMNPNSYAVFIGIGWAFISSRWHIELP  237

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
             SI++ S++IM+K G+G AMFS G+FMALQ++ ++CG +LT+ G+VLRF+ GPA  AIG+I
Sbjct  238   SIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGPAAMAIGSI  297

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
              + LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G I+SLPV+I YY +L
Sbjct  298   AVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPVLIAYYAVL  357

Query  144   ELL  136
             E +
Sbjct  358   EFV  360



>emb|CDP04221.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 199/368 (54%), Positives = 267/368 (73%), Gaps = 22/368 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G GD+YKVV  M PLYVA++LGYGS++WW +F P+ CDAINRF  +F LP F F F + V
Sbjct  3     GLGDVYKVVATMFPLYVALVLGYGSVKWWRLFTPEQCDAINRFVAYFTLPLFIFEFTSHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY FVA+D ++K ++VV L  WA F   G   WSIT FSLSTL N+LVVGVP+ +
Sbjct  63    DPFKMNYPFVAADAISKVIIVVVLAFWAKFSSKGSYCWSITGFSLSTLTNSLVVGVPIAR  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISA--------AADNARPEMG  700
              MYG+   DLV+Q + +QA++WLT+LL  LE RRT+    S+        AADN+     
Sbjct  123   GMYGQSAVDLVVQGSVIQAIVWLTILLLVLEIRRTQTDFYSSDETVGDSKAADNSVK---  179

Query  699   TDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGW  520
              DLE N +  A             PS+ +++K V  +LA NPN+YAC +G+ WA+I   W
Sbjct  180   -DLEANSRALA----------ETKPSFWSLVKRVWQKLAMNPNSYACTVGITWALIANRW  228

Query  519   HFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATS  340
             HF MP+I++DSI+IM++ G+G AMFS GLFMALQ++I++CG +LT++G+VLRF+ GPA  
Sbjct  229   HFQMPAIMEDSILIMSRAGTGTAMFSMGLFMALQEKIVACGTSLTIFGMVLRFIAGPAAM  288

Query  339   AIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIG  160
             AIG+I + LHGDVL++ I+Q+A+PQ++T+FIFAKEYGLHADVLSTA+I G I++LPVM+G
Sbjct  289   AIGSIAVGLHGDVLRVAIIQAAVPQSITSFIFAKEYGLHADVLSTAVIFGMIVALPVMVG  348

Query  159   YYVILELL  136
             YY ILE L
Sbjct  349   YYAILEFL  356



>emb|CDP11399.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 267/365 (73%), Gaps = 13/365 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AM PL VA+ LGY S++WWHMF PD  DAINRFNCFFI+PFF F FI+ +
Sbjct  3     GWEDVYKVVTAMTPLCVALALGYASVKWWHMFTPDQFDAINRFNCFFIIPFFNFKFISHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY +NY F+ +D +AK +V++ LV W N  + G   WSIT FSL +LNNTL+VGVPL++
Sbjct  63    NPYELNYPFLGADCIAKCIVLIVLVFWTNCTRKGSCMWSITAFSLCSLNNTLIVGVPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRR------TRLGQISAAADNARPEMGTD  694
             AMYG +G DLV+Q++ +Q+L+W+  LLF LEFRR      +    I+        E G+D
Sbjct  123   AMYGEVGEDLVVQSSVIQSLVWVIFLLFMLEFRREWSKTKSVTNTINGDLQLQAIECGSD  182

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHF  514
             L+ N    + +        N  PS  +++K V L+LAKNPN YAC  GLIWA++   W F
Sbjct  183   LDQNSTPMSMSI-------NKAPSIWSILKIVWLKLAKNPNFYACIAGLIWALLASRWQF  235

Query  513   TMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAI  334
              MP II+ SI+IM+K G+G++MFS GLFMALQ+R+I+CG  LT++G+ LRF++ PAT AI
Sbjct  236   KMPEIIEGSILIMSKAGAGVSMFSMGLFMALQERVIACGTPLTLFGMALRFVVSPATMAI  295

Query  333   GAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYY  154
             G+I+  LHG+VL+I ++Q+ALPQ++ +F++A+EYGLH D+LSTA+I GTI+SLP++I YY
Sbjct  296   GSIVSGLHGNVLRIALIQAALPQSIASFVYAQEYGLHPDILSTAVIFGTIVSLPLLIAYY  355

Query  153   VILEL  139
              +LE+
Sbjct  356   ALLEV  360



>gb|AIF28449.1| PIN-like protein, partial [Euptelea pleiosperma]
Length=360

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 201/367 (55%), Positives = 263/367 (72%), Gaps = 17/367 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVVAM PLYVA++LGYGS++WWH+F P+ C AIN F C+F LP FTF F A V
Sbjct  3     GWDDIYKVVVAMTPLYVALVLGYGSVKWWHIFTPEQCGAINSFVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+ +D ++K ++VV L  WA     G   WSIT+FSLSTL N+LVVGVPL++
Sbjct  63    DPFDMNYPFIGADAISKFIIVVVLAFWAKCSSKGXXXWSITSFSLSTLTNSLVVGVPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR----LGQISAAADNARP---EMGT  697
             AMYG    DLV+QA+ +Q ++WLT+LLF LEFR+TR    L   +A   +A     E   
Sbjct  123   AMYGPNSVDLVVQASVVQGIIWLTILLFVLEFRKTRSNVSLMTTTATITDAHVVSVEPTK  182

Query  696   DLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWH  517
             D+ GN                  PS+ ++MK V L+LA NPN+YA  +G+ WA I+  WH
Sbjct  183   DVVGNENVVHTTR----------PSFCSLMKIVWLKLALNPNSYASIIGITWAFISNRWH  232

Query  516   FTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSA  337
             F MPSI++ SI+IM+K G+G AMFS GLFMA Q++ I+CG +LT++G+VLRF+ GPA  A
Sbjct  233   FQMPSIMEGSILIMSKAGTGTAMFSMGLFMAQQEKFIACGPSLTIFGMVLRFIAGPAAMA  292

Query  336   IGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGY  157
             IG I + LHGD L++ I+Q+ALPQ++T+FI+AKEYGLHADVLSTA+I G I+SLPV+IGY
Sbjct  293   IGCIAVGLHGDALRVSIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPVLIGY  352

Query  156   YVILELL  136
             Y +L  L
Sbjct  353   YAVLGFL  359



>ref|XP_009338007.1| PREDICTED: putative auxin efflux carrier component 8 [Pyrus x 
bretschneideri]
Length=359

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 192/357 (54%), Positives = 263/357 (74%), Gaps = 4/357 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVA  PLYVA+ILGYGS+RWWH+F  + C AINRF CFF LP FTF F A V
Sbjct  3     GWEDVYKVVVATVPLYVALILGYGSVRWWHIFTTEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++VV L +WA     G   WSIT+FSL TL N+LVVGVPL++
Sbjct  63    DPYKWNYRFIGADFISKLIIVVVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+QA+ +QA++WLT+LLF LEFRRT  G I     ++R  +GT ++    
Sbjct  123   AMYGSSSVDLVVQASVVQAIVWLTILLFVLEFRRT--GSIDIV--SSRTNVGTRVQSVDP  178

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +            + GPS+  +MK+V ++L  NPN+YA F+G+ WA+I   WH  +PSI+
Sbjct  179   QGNDVEAMEEITISTGPSFWYLMKAVWVKLGMNPNSYAVFIGIAWALIASRWHIELPSIM  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM+K G+G AMFS G+FMALQ++ ++CG +LT+ G+VLRF+ GPA  AIG+I + 
Sbjct  239   EGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGPAAMAIGSIAVG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             LHGDVL++ I+Q+A+PQ++T+FI+AKEYGLHA+VLSTA+I G ++SLPV+I YY +L
Sbjct  299   LHGDVLRVAIIQAAVPQSITSFIYAKEYGLHAEVLSTAVIFGMLVSLPVLIAYYAVL  355



>ref|XP_011014382.1| PREDICTED: putative auxin efflux carrier component 8 [Populus 
euphratica]
Length=346

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 197/361 (55%), Positives = 268/361 (74%), Gaps = 17/361 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVA+ PLYVA++LGYGS+RWW +F P+ C AINRF C+F LP FTF F A V
Sbjct  3     GWEDVYKVVVAVVPLYVALVLGYGSVRWWKVFTPEQCGAINRFVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+ +D V+K ++V  L  WA     G   WSIT+FSL TL N+LVVGVP+++
Sbjct  63    DPFKMNYLFIGADAVSKVIIVAVLAFWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPIIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG  G DLV+Q++ +QA++WLT+LL  LEFRRT LG  S  +D        DLEG+  
Sbjct  123   AMYGTAGVDLVVQSSVIQAIIWLTLLLLVLEFRRTGLGFSSNNSDK-------DLEGSVD  175

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                ++           P++  +MK+V ++LA NPN+YAC +GL+WA I+  WHF MP+++
Sbjct  176   NTESSR----------PAFWCLMKTVWVKLAMNPNSYACIIGLVWAFISNRWHFEMPAMM  225

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMFS G+FMALQ+++ISCG +LTV G++LRF+ GPA  AIG+I + 
Sbjct  226   EGSILIMSKAGTGTAMFSMGIFMALQEKVISCGASLTVIGMILRFIAGPAAMAIGSIAVG  285

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G + +LP++I YY ILE +
Sbjct  286   LQGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLAALPILIAYYAILEFV  345

Query  135   P  133
             P
Sbjct  346   P  346



>gb|KFK25870.1| hypothetical protein AALP_AA8G172900 [Arabis alpina]
Length=350

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 257/360 (71%), Gaps = 13/360 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKV+ AM PLYVA+ILGYGS++WW++F  D CDAINR  C+F LP FT  F A V
Sbjct  3     GWGDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTIEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+DV++K ++V  L +WA ++  G   WSIT+FSL TL N+LVVGVPL +
Sbjct  63    DPFNMNYRFIAADVLSKIIIVTVLAVWAKYINKGSYCWSITSFSLCTLTNSLVVGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+   DLV+Q++  QA++WLT+LLF LEFRR      ++ ADN   E G +      
Sbjct  123   AMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEFRRAGFSS-NSKADNINIEGGRE------  175

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                              S+  +M  V L+LA NPN Y+C LG+ WA I+  WH  MP II
Sbjct  176   ------TAVMVVVGEEKSFLEVMSVVWLKLATNPNCYSCVLGIAWAFISNRWHIEMPGII  229

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMF+ G+FMALQ+++I CG +LT+ G++L+F+ GPA  AIG+I L 
Sbjct  230   EGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTLIGMLLKFIAGPAAMAIGSIALG  289

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  290   LHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  349



>ref|XP_011009309.1| PREDICTED: putative auxin efflux carrier component 8 [Populus 
euphratica]
Length=346

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 264/360 (73%), Gaps = 17/360 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVV AM PLYVA++LGYGS+RWW +F P+ C AINR  C+F LPFFTF F A  
Sbjct  3     GWADIYKVVAAMVPLYVALMLGYGSVRWWKVFTPEQCGAINRLVCYFTLPFFTFEFTAHA  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+ +D ++K ++VV L +WA +   G   WSIT+FSL TL N+LV+GVPL++
Sbjct  63    DPFKMNYLFIGADAISKLIIVVVLAVWAKWSGKGSYSWSITSFSLCTLTNSLVLGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+    L++Q++ +Q+++WLTMLL  LE RRT LG  ++  D        DLE N  
Sbjct  123   AMYGQAAVALIVQSSVIQSIIWLTMLLLVLEIRRTGLGVSASNPDE-------DLEENAD  175

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                ++           P++  +MK+V ++LA NPN+YAC +GL+WA I   W F MPSI+
Sbjct  176   STVSSR----------PAFWCLMKTVGMKLAMNPNSYACIIGLVWAFIANRWRFEMPSIM  225

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMFS G+FMALQ+++I+CG +LTV G+VLRF+ GPA  AIG+I++ 
Sbjct  226   EGSILIMSKTGTGTAMFSMGIFMALQEKVIACGASLTVIGMVLRFIAGPAAMAIGSIIVG  285

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GDVL++ I+Q+A PQA+ +FIFA+EYGLHA+VLSTA+I GTI++LPV+I YY IL+ +
Sbjct  286   LRGDVLRVAIIQAAFPQAIISFIFAQEYGLHAEVLSTAVIFGTIVALPVLIAYYAILDFV  345



>ref|XP_008218436.1| PREDICTED: putative auxin efflux carrier component 8 [Prunus 
mume]
Length=346

 Score =   306 bits (783),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 258/360 (72%), Gaps = 19/360 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVVVAM PLYVA+ILG+GS+RWW +F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWGDVYKVVVAMVPLYVALILGFGSVRWWRIFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++V  L +WA     G   WSIT+FSL TL N+LVVGVPLM+
Sbjct  63    DPYKWNYRFIGADAISKLIIVAVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPLMR  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT-RLGQISAAADNARPEMGTDLEGNP  679
             AMYG++  DLV+Q++ +QA++WLT+LLF LEFRRT  L     +  N    + T     P
Sbjct  123   AMYGQVAVDLVVQSSVVQAIVWLTILLFVLEFRRTGSLDMHMISGTNTSQSVDTMSSSRP  182

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
                               S+  +MK+V L+L  NPN+YA F+G+ WA I+  WH  +PSI
Sbjct  183   ------------------SFWYLMKAVWLKLGMNPNSYAVFIGIGWAFISSRWHIELPSI  224

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ S++IM+K G+G AMFS G+FMALQ++ ++CG +LT+ G+VLRF+ GPA  AIG+I +
Sbjct  225   MEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGPAAMAIGSIAV  284

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              LHGDVL++ I+Q+ALPQ++T+FI+AKEYGLHA+VLSTA+I G I SLP++I YY +LE 
Sbjct  285   GLHGDVLRVAIIQAALPQSITSFIYAKEYGLHAEVLSTAVIFGMIASLPLLIAYYAVLEF  344



>ref|XP_008370812.1| PREDICTED: putative auxin efflux carrier component 8 [Malus domestica]
Length=359

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 260/357 (73%), Gaps = 4/357 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV A  PLYVA+ILGYGS+RWWH+F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWEDVYKVVAAXVPLYVALILGYGSVRWWHIFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++VV L +WA     G   WSIT+FSL TL N+LVVGVPL++
Sbjct  63    DPYKWNYRFIGADFISKLIIVVVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+QA+ +QA++WLT+LLF LEFRRT  G I     ++R  + T ++    
Sbjct  123   AMYGSSSVDLVVQASVVQAIVWLTILLFVLEFRRT--GSIDIV--SSRTNVNTRVQSVDP  178

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +            +  PS+  +MK+V ++L  NPN+YA F+G+ WA I K WH  +PSI+
Sbjct  179   QGKDVEAMEEITISXRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAXIAKRWHIELPSIM  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S+ IM+K G+G AMFS G+FMALQ++ ++CG +LT+ G+VLRF+ GPA  AIG+I + 
Sbjct  239   EGSVSIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGPAAMAIGSIAVG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             LHGDVL++ I+Q+A+PQ++T+FI+AKEYGLHA+VLSTA+I G ++SLPV+I YY +L
Sbjct  299   LHGDVLRVAIIQAAVPQSITSFIYAKEYGLHAEVLSTAVIFGMLVSLPVLIAYYAVL  355



>gb|EYU39430.1| hypothetical protein MIMGU_mgv1a007953mg [Erythranthe guttata]
Length=389

 Score =   307 bits (786),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 267/384 (70%), Gaps = 26/384 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              WGDIYKVV AM PLYVA++LGYGS++WW MFKPDHCDAINRFNC+FI+PFFTF F A V
Sbjct  3     AWGDIYKVVAAMVPLYVALVLGYGSVKWWRMFKPDHCDAINRFNCYFIIPFFTFRFTAGV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY MN+ F+A DV+AK +V VAL +WAN  + G L W++T+FSLS+LNNTLVVGVPL++
Sbjct  63    DPYHMNFRFLAGDVIAKGVVGVALALWANLCREGKLSWAVTSFSLSSLNNTLVVGVPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMG--------  700
             AMYG LG DLV+Q++ +Q+LLW   LLF L+F R         +D+ + + G        
Sbjct  123   AMYGALGEDLVVQSSVIQSLLWFPTLLFMLDFWRINNNDADGDSDDHQQQPGQTTHEVQL  182

Query  699   -----TDLEGNPKeaaaagetpaapTNIGP-------------SYTAMMKSVCLRLAKNP  574
                  TD   N    + +         +               ++   +K V  +LAKNP
Sbjct  183   CSIEITDANYNNTTTSTSANKHEDANGVNTRISSSSSSSSSSNNFRITIKKVLAKLAKNP  242

Query  573   NTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGW  394
             N YAC +GLIWA++ K W   MPS+++ SI+IMAK GSG+AMFS GLFMALQ+++I+CG 
Sbjct  243   NLYACAIGLIWALLAKRWDLEMPSVVEGSILIMAKAGSGVAMFSMGLFMALQEKMIACGV  302

Query  393   TLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADV  214
              LTVYG+VLRF+ GP T+ +G + L +    L I I+Q+ALPQA+T+F+FA+EYGLHA V
Sbjct  303   RLTVYGMVLRFIGGPVTTLVGCLALGIRSRTLHIAIIQAALPQAITSFVFAQEYGLHATV  362

Query  213   LSTAIIIGTILSLPVMIGYYVILE  142
             LSTA+I GTI+SLP++I YYV L+
Sbjct  363   LSTAVIFGTIVSLPLLISYYVALD  386



>ref|XP_008355844.1| PREDICTED: LOW QUALITY PROTEIN: putative auxin efflux carrier 
component 8 [Malus domestica]
Length=359

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 259/357 (73%), Gaps = 4/357 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AM PLYVA+ILGYGS+RWWH+F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWEDVYKVVAAMVPLYVALILGYGSVRWWHIFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++VV L +WA     G   WSIT+FSL TL N+LVVGVPL++
Sbjct  63    DPYKWNYRFIGADFISKLIIVVVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+QA+ +QA++WLT+LLF LEFRRT  G I     ++R  + T ++    
Sbjct  123   AMYGSSSVDLVVQASVVQAIVWLTILLFVLEFRRT--GSIDIV--SSRTNVNTRVQSVDP  178

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +            +  PS+  +MK+V ++L  NPN+YA F+G+ WA I K WH  +PSI+
Sbjct  179   QGKDVEAMEEITISXRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAXIAKRWHIELPSIM  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S+ IM+K G+G AMFS G+FMALQ++ ++CG +LT+ G VLRF+ GPA  AIG+I + 
Sbjct  239   EGSVSIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGXVLRFIAGPAAMAIGSIAVG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             LHGD L++ I+Q+A+PQ++T+FI+AKEYGLHA+VLSTA+I G ++SLPV+I YY +L
Sbjct  299   LHGDFLRVAIIQAAVPQSITSFIYAKEYGLHAEVLSTAVIFGMLVSLPVLIAYYAVL  355



>ref|XP_004302153.1| PREDICTED: putative auxin efflux carrier component 8-like [Fragaria 
vesca subsp. vesca]
Length=357

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 262/364 (72%), Gaps = 14/364 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLY A+ILG+GS+RWW +F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWEDVYKVVVAMVPLYFALILGFGSVRWWGIFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+  NY F+A+D ++K ++VV L  WA     G   WSIT+FSL TL N+LVVGVPLM+
Sbjct  63    DPFEWNYRFIAADAISKLIIVVVLAFWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPLMK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMG--TDLEGN  682
             AMYG +  DLV+Q++ +QA++WLT+LLF LEFRRT L   S        E+    D+EG 
Sbjct  123   AMYGPMAVDLVVQSSVVQAIIWLTVLLFVLEFRRTGLDISSNDTRVQSVELQGVKDVEGL  182

Query  681   PKeaaaagetpaapTNIGPSYT--AMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
              +   A            PSY   +++K V L+L  NPN+YA F+G+ WA I   WH  +
Sbjct  183   NQSTVAN----------SPSYYYWSLLKGVWLKLGMNPNSYAVFIGIAWAFIANRWHIEL  232

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             PSI++ S++IM+K G+G AMFS G+FMALQ++ ++CG +LT+ G+VLRF+ GPA  AIG 
Sbjct  233   PSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGPAAMAIGC  292

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I + LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV+IGYY +
Sbjct  293   IAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLIGYYAV  352

Query  147   LELL  136
             LE +
Sbjct  353   LEFV  356



>gb|AIF28452.1| PIN-like protein, partial [Sanguinaria canadensis]
Length=340

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 254/347 (73%), Gaps = 9/347 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVVAM PLYVA+ILG+GS+RWW +F  + CDAINRF CFF LPFFTF F A V
Sbjct  3     GWADIYKVVVAMTPLYVAVILGFGSVRWWKIFSREQCDAINRFVCFFTLPFFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K +++V L  WA     G   WSIT+FSLSTL N+LVVGVP+++
Sbjct  63    DPYDWNYRFIGADAISKFIILVVLAAWAKCSSKGSYCWSITSFSLSTLTNSLVVGVPMLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    +LV+Q +  Q ++WLT+LLF LEFR+ R    S    ++   M  DLEGN K
Sbjct  123   AMYGEHAVNLVVQGSVFQGIVWLTILLFVLEFRKARSDGSSTITSDS--HMVKDLEGNEK  180

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
               A    T        PS+ +MMK V L+LA NPNTYA  +G+ WA I+  WHF MPSI+
Sbjct  181   IVAITSTTR-------PSFLSMMKIVWLKLALNPNTYASIIGITWAFISNRWHFEMPSIM  233

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G G AMFS GLF+ALQ++I++CG TLTV+GL+LRF+ GPA   IG+I + 
Sbjct  234   EGSILIMSKAGIGSAMFSMGLFVALQEKILACGTTLTVFGLILRFIAGPAAMVIGSIAVG  293

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSL  175
             LHGDVL++ I+Q+ALPQ++T+FI+AKEYGLHADVLSTA+I G ++SL
Sbjct  294   LHGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMMVSL  340



>ref|XP_010038273.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
 gb|KCW84566.1| hypothetical protein EUGRSUZ_B01405 [Eucalyptus grandis]
Length=364

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 265/370 (72%), Gaps = 18/370 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G  D+YKVV AM PLYVA++LGYGS++WW +FKP+ CDA+NR  C+F LP FTF F A V
Sbjct  3     GLEDVYKVVEAMVPLYVALMLGYGSVKWWKIFKPEQCDAVNRLVCYFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+  NY F+A+DVV+K ++V+ L  WA     G   WSIT+FSL TL N+LVVGVPL++
Sbjct  63    DPFEWNYAFIAADVVSKVIIVLVLAFWAKCSTKGSYCWSITSFSLCTLTNSLVVGVPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADN-----AR----PEM  703
             AMYG +G DLV+Q +  QA++WLT+LLF LE +R+ L   S  +       AR    P  
Sbjct  123   AMYGSMGVDLVIQGSVFQAIVWLTLLLFVLEMKRSGLDISSTPSSTEGDSPARTVVDPVA  182

Query  702   GTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKG  523
               +LEG  +   ++           PS+ ++M+ V ++LA NPN+YAC +G++WA+I   
Sbjct  183   KFNLEGGLEMMVSSSR---------PSFWSLMRVVWMKLAMNPNSYACIVGIVWALIANR  233

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
             WHF MP IID  I I++K G+G AMFS G+FMA Q+++I+CG +LTV+G+VLRF+ GPA 
Sbjct  234   WHFEMPGIIDGCITILSKAGTGTAMFSMGMFMAQQEKLIACGPSLTVFGMVLRFIAGPAA  293

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMI  163
              AIG+I L L G+VL++ I+Q+ALPQ++T+FI+AKEY LHADVLSTA+I G I+S PV++
Sbjct  294   MAIGSIALGLRGNVLRVAIIQAALPQSITSFIYAKEYALHADVLSTAVIFGMIVSFPVLL  353

Query  162   GYYVILELLP  133
              YY ILEL+P
Sbjct  354   AYYAILELVP  363



>ref|XP_010525085.1| PREDICTED: putative auxin efflux carrier component 8 [Tarenaya 
hassleriana]
Length=385

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 252/363 (69%), Gaps = 22/363 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AM PLYVA+ILGYGS++WW +F  D CDAINR  C+F LP FT  F A V
Sbjct  41    GWEDVYKVVEAMFPLYVALILGYGSVKWWKIFSHDQCDAINRLVCYFTLPLFTIEFTAHV  100

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+D ++K +V+  L  WA F   G   WSIT+FSL TL N+LVVGVPL +
Sbjct  101   DPFNMNYPFMAADALSKLLVMAVLGFWAKFSSKGSYCWSITSFSLCTLTNSLVVGVPLAR  160

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL---GQISAAADNARPEMGTDLEG  685
             AMYG+   DLV+Q +  QA++WLT LLF LEFRR+ L   G++          + T +E 
Sbjct  161   AMYGKQAVDLVVQNSVFQAIVWLTFLLFVLEFRRSGLEGDGEVVDVEGRGGERVVTKMEE  220

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
                                 S+  +MK V L+LA NPN Y+C +G+ WA I+  WH  MP
Sbjct  221   K-------------------SFRTVMKVVWLKLATNPNCYSCVIGIAWAFISNRWHIQMP  261

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
              I++ SI IM+K G+G AMF+ G+ MALQ ++I+CG +LTV G+VL+F+ GPA  AIG+I
Sbjct  262   GIVEGSISIMSKAGTGTAMFNMGISMALQKKVIACGASLTVIGMVLKFVAGPAAMAIGSI  321

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             ++ LHGDVL++ I+Q+ALPQ++T+F+FAKEYGLHADVLSTA+I G ++SLPV+IGYY  L
Sbjct  322   VVGLHGDVLRVAIIQAALPQSITSFVFAKEYGLHADVLSTAVIFGMLVSLPVLIGYYAAL  381

Query  144   ELL  136
             E +
Sbjct  382   EFV  384



>ref|XP_011077194.1| PREDICTED: putative auxin efflux carrier component 8 [Sesamum 
indicum]
Length=394

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 195/391 (50%), Positives = 271/391 (69%), Gaps = 31/391 (8%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+V +APLYVA+ILGY S++WW MF PD C+AINR  C+F  P F F F A V
Sbjct  3     GWEDVYKVLVGIAPLYVALILGYCSVKWWRMFTPDQCEAINRLVCYFTYPLFVFEFTASV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYLF+A+D ++K ++V AL  WA     G   WSIT+FSLSTL ++LVVGVPL++
Sbjct  63    DPFKMNYLFMAADAISKLIIVTALACWAKCSSKGSYCWSITSFSLSTLTSSLVVGVPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG----------------------  742
             +MYG +  DLV+Q++  QAL+WL++LLF LE RRTR                        
Sbjct  123   SMYGPMAVDLVVQSSVFQALVWLSILLFVLELRRTRNQLHCFDDDDHHHDNNIIIIHDQT  182

Query  741   ---QISAAADNARPEMGTDLEGN------PKeaaaagetpaapTNIGPSYTAMMKSVCLR  589
                 + AAA     + G +LE              +  T +  +N  PS+ ++MK V L+
Sbjct  183   TDVHVVAAATTTTTDEGNNLENQLSNDINNNNICDSKSTTSTSSNRQPSFWSLMKRVWLK  242

Query  588   LAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRI  409
             LAKNPN+YAC +G+ WA ++  W+F MP+I++ SI+IM++ G+G AMFS GLFMALQ+++
Sbjct  243   LAKNPNSYACIIGIAWAFLSNRWNFKMPNIMEGSILIMSRAGTGTAMFSMGLFMALQEKV  302

Query  408   ISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYG  229
             I+CG +LTV+G+ LRF+ GP   A+G++ + LHGDVL++ I+Q+ALPQ++T+FIFAKEYG
Sbjct  303   IACGASLTVFGMALRFIAGPLAMALGSVAVGLHGDVLRVAIIQAALPQSITSFIFAKEYG  362

Query  228   LHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             LHA+VLSTA+I G I+SLPV+IGYY +LE +
Sbjct  363   LHAEVLSTAVIFGMIVSLPVLIGYYALLEFV  393



>ref|NP_197157.4| auxin transporter PIN5 [Arabidopsis thaliana]
 sp|Q9FFD0.2|PIN8_ARATH RecName: Full=Putative auxin efflux carrier component 8; Short=AtPIN8 
[Arabidopsis thaliana]
 gb|AED92305.1| auxin transporter PIN5 [Arabidopsis thaliana]
Length=351

 Score =   298 bits (763),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 256/364 (70%), Gaps = 24/364 (7%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WWH+F  D CDAINR  C+F LP FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  L +WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKVIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAA---ADNARPEMG---TDLE  688
             YG+   DLV+Q++  QA++WLT+LLF LEFR+      + +    DN   E G   T + 
Sbjct  125   YGQQAVDLVVQSSVFQAIVWLTLLLFVLEFRKAGFSSNNISDVQVDNINIESGKRETVVV  184

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
             G                    S+  +M  V L+LA NPN Y+C LG+ WA I+  WH  +
Sbjct  185   GEK------------------SFLEVMSLVWLKLATNPNCYSCILGIAWAFISNRWHLEL  226

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P I++ SI+IM+K G+G AMF+ G+FMALQ+++I CG +LTV G+VL+F+ GPA  AIG+
Sbjct  227   PGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGS  286

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I+L LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  
Sbjct  287   IVLGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAA  346

Query  147   LELL  136
             LE +
Sbjct  347   LEFI  350



>ref|XP_006400192.1| hypothetical protein EUTSA_v10013986mg [Eutrema salsugineum]
 gb|ESQ41645.1| hypothetical protein EUTSA_v10013986mg [Eutrema salsugineum]
Length=348

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 257/361 (71%), Gaps = 21/361 (6%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WW++F  D CDAINR  C+F LP FTF F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTFEFAAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  LV WA + K G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FDMNYRFIAADVLSKVIIVTVLVFWAKYSKKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMG---TDLEGNP  679
             YG+   DLV+Q++  QA++WLT+LLF LEFRR      +  ADN   E G   T + G  
Sbjct  125   YGQQAVDLVVQSSVFQAIVWLTLLLFVLEFRRAGFSS-NTKADNINIEGGRRETLVVGEE  183

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             K                 S   ++  V L+LA NPN Y+C LG+ WA I+  WHF MP I
Sbjct  184   K-----------------SLLEVLSIVWLKLATNPNCYSCILGVAWAFISNRWHFGMPGI  226

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ SI+IM+K G+G AMF+ G+FMALQ+++I CG +LTV G+ L+F+ GPA  AIG+I +
Sbjct  227   MEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVLGMFLKFIAGPAAMAIGSIAV  286

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE 
Sbjct  287   GLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEF  346

Query  138   L  136
             +
Sbjct  347   I  347



>ref|XP_009384295.1| PREDICTED: putative auxin efflux carrier component 8 [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 253/357 (71%), Gaps = 2/357 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              WGDIYKVVVAMAPLYVA+ LGYGS+RWW +  P+ C+AINR      LP FTF F   V
Sbjct  3     SWGDIYKVVVAMAPLYVALGLGYGSVRWWRIITPEQCEAINRLVSCITLPLFTFEFTLHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+D V+K  + V L  W      G   WS+T+FSLSTL N+LVVGVPL+ 
Sbjct  63    DPFAMNYRFIAADAVSKVTIAVLLAAWPKCSSKGSYCWSVTSFSLSTLTNSLVVGVPLVS  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYGR   DLV+Q + +QA++WLT+LLF  E R+   G  S AA  A    G +L     
Sbjct  123   AMYGRWAQDLVVQLSVVQAIVWLTLLLFVFELRKAGCGLFSMAA--APSSAGGELASVES  180

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                   +         PS+ ++MK+V L+LA NPN+YA  +G+ WA I   WHF MPSI+
Sbjct  181   PPLKDVDGGGPEVTPRPSFWSLMKTVWLKLALNPNSYASIVGITWAFIASRWHFEMPSIM  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM+K G+G+AMFS GLFMALQ++I++CG +LT +G+VL+F+ GPA +AIGAI + 
Sbjct  241   EGSVLIMSKAGTGMAMFSMGLFMALQEKILACGPSLTAFGMVLKFIAGPAATAIGAIAVG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             L GDVL + I+Q+ALPQ++T+FIFA+EYGLHADVLSTA+I G ++SLPV++ YYV+L
Sbjct  301   LRGDVLHLAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPVLVAYYVVL  357



>ref|XP_006480409.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=340

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 188/361 (52%), Positives = 255/361 (71%), Gaps = 25/361 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+VAM PLY A+ILGYGS++WW +  P+ C AINR  C+F LP FT  F   V
Sbjct  3     GWEDVYKVIVAMVPLYFALILGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTTHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGG-LDWSIttfslstlnntLVVGVPLM  859
             DP+ MNY F+ +D ++K ++V+ L  W    K G    W IT FSL TL NTLV+GVPLM
Sbjct  63    DPFNMNYRFIGADAISKLIIVIVLAFWGMCSKKGSCFSWCITNFSLCTLTNTLVLGVPLM  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             +AMYG++  DLV+Q++  Q+++W T+ LF LEFRR         A NA  ++    EG+ 
Sbjct  123   KAMYGQMAVDLVVQSSVFQSIVWFTIFLFILEFRR---------AGNALEDLE---EGHA  170

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
               ++             PS+  +MK V L+LAKNPN+YAC +GL WA +   WHF MPSI
Sbjct  171   TSSSR------------PSFWHLMKVVWLKLAKNPNSYACVIGLAWAFVANRWHFKMPSI  218

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             I+ SI+IM+K G+G AMFS G+FMALQ+++++CG +LT +G+VL+F+ GPA  AIG+I  
Sbjct  219   IEGSILIMSKAGTGTAMFSMGIFMALQEKLLACGPSLTAFGMVLKFIAGPAAMAIGSIAT  278

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L GDVL++ I+Q+ALP+A+TTF+FAKEYGLH DVLSTA+I GTI+SLPV+I YY IL++
Sbjct  279   GLRGDVLRVSIIQAALPEAITTFVFAKEYGLHTDVLSTAVIFGTIVSLPVLIAYYAILDI  338

Query  138   L  136
             +
Sbjct  339   I  339



>ref|XP_008388803.1| PREDICTED: putative auxin efflux carrier component 8 [Malus domestica]
Length=359

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 257/360 (71%), Gaps = 4/360 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AM PLY A+ILGYGS+RWW +F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWEDVYKVVAAMVPLYFALILGYGSVRWWGVFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++VV LV+W      G   WSIT+FSL TL N+LVVGVPL++
Sbjct  63    DPYKWNYRFIGADAISKVIIVVVLVLWGKCSSKGSYSWSITSFSLCTLTNSLVVGVPLIK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+Q++ +QA++WLT+LLF LEFRRT  G I   + +   +  T ++    
Sbjct  123   AMYGSSAVDLVVQSSVVQAIIWLTILLFVLEFRRT--GSIDIVSSSTTVD--TRVQSVDP  178

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +               PS+  +MK+V ++L  NPN+YA F+G+ WA I   WH  +PSI+
Sbjct  179   QGKDVEAMEEITITTRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAFIANRWHIELPSIM  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM+K G+G AMFS G+FMALQ++ ++CG + T+ G+VLRF+ GPA  AIG I + 
Sbjct  239   EGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSRTIIGMVLRFIAGPAAMAIGCIAVG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I G ++SLPV+I YY +LE +
Sbjct  299   LHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLIAYYAVLEFV  358



>ref|XP_004155098.1| PREDICTED: putative auxin efflux carrier component 8-like [Cucumis 
sativus]
Length=371

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 261/370 (71%), Gaps = 13/370 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AMAPLY A+ILGYGS++WW +F    CDAIN+  C+F LP FTF F + +
Sbjct  3     GWQDVYKVVAAMAPLYFALILGYGSVKWWKIFSTQQCDAINKLVCYFTLPLFTFDFTSHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ +N+ F+A+D + K ++V+ L  WA     G   WSIT+FSLSTL N LV+GVPL +
Sbjct  63    DPFHLNFPFIAADAIGKLIIVLVLTFWAKCTTKGSYCWSITSFSLSTLTNALVIGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA------DNARPEMG--  700
              MYG++  DLV+Q + +QA++WLT+LLF LE RRT L  ++A A      +    E+G  
Sbjct  123   VMYGQMAVDLVVQGSVVQAIVWLTILLFVLELRRTGLDLVAAEASSGVVSEEKTVEVGGE  182

Query  699   --TDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITK  526
                DLEG   E      +  +     PS   +MK V +++A NPN+YAC +G  WA + K
Sbjct  183   GEKDLEGEDMEVEEMRRSSKSHR---PSLKPLMKKVWVKMAGNPNSYACTIGFAWAFVAK  239

Query  525   GWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPA  346
              WH  MPSI++ SI+IM+K G G AMF+ G+FMALQ+++I+CG TLT+ G+VL+F+ GPA
Sbjct  240   RWHVEMPSIMEGSILIMSKAGIGTAMFNMGIFMALQEKLIACGPTLTIVGMVLKFIAGPA  299

Query  345   TSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVM  166
               AIG+I + LHGDVL++ I+Q+A+PQ++T+FI+AKEYGLHADVLSTA+I G I+SLPV+
Sbjct  300   AMAIGSIAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSLPVL  359

Query  165   IGYYVILELL  136
             + YY  LE +
Sbjct  360   VAYYAALEFI  369



>ref|XP_006480407.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=340

 Score =   293 bits (750),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 252/361 (70%), Gaps = 25/361 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+VAM PLY A++LGYGS++WW +  P+ C AINR  C+F LP FT  F   V
Sbjct  3     GWEDVYKVIVAMVPLYFALMLGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTTHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGG-LDWSIttfslstlnntLVVGVPLM  859
             DP+ MNY F+ +D ++K ++V+ L  W+   K G    W IT FSL TL NTLV+GVPLM
Sbjct  63    DPFNMNYRFIGADAISKLIIVIVLAFWSMCSKKGSYFSWCITNFSLCTLTNTLVLGVPLM  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             +AMYG++  DLV+Q++  Q+++WLT+ LF LEFRR+         D+   E G     + 
Sbjct  123   KAMYGQMAVDLVVQSSVFQSIVWLTIFLFVLEFRRS-------GNDSKDLEEGHVTSSS-  174

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
                              P +  +MK V L+LAKNPN+YAC +GL WA +   WHF +PSI
Sbjct  175   ----------------RPPFWHLMKVVWLKLAKNPNSYACVIGLAWAFVANRWHFKLPSI  218

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             I+ SI+IM+K G+G AMFS G+FMALQ+++++CG  LT  G+VL+F+ GPA  AIG+I  
Sbjct  219   IEGSILIMSKAGTGTAMFSMGIFMALQEKLLACGPGLTALGMVLKFIAGPAAMAIGSIAA  278

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              LHGDVL++ I+Q+ALP+A+TTFIFAKEYGLHADVLSTA+I GTI+SLPV+I YY IL++
Sbjct  279   GLHGDVLRVSIIQAALPEAITTFIFAKEYGLHADVLSTAVIFGTIVSLPVLIAYYAILDI  338

Query  138   L  136
             +
Sbjct  339   I  339



>ref|XP_003624144.1| Auxin Efflux Carrier [Medicago truncatula]
 gb|AAT48629.1| putative auxin efflux carrier protein 9 [Medicago truncatula]
 gb|ABD28360.1| Auxin Efflux Carrier [Medicago truncatula]
 gb|AES80362.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=363

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 258/361 (71%), Gaps = 2/361 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+VA+ PLY A+ILGYGS+RWW +F  + CDAIN+  C+F LP F F F A +
Sbjct  3     GWEDVYKVIVAVVPLYFALILGYGSVRWWKIFTREQCDAINKLVCYFTLPLFAFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MN+LF+ +D ++K ++V  + +WA         WSIT+FSL TL N+LVVG+P+++
Sbjct  63    DPFKMNFLFIGADTLSKLIIVAVIALWAKCSSKVSYSWSITSFSLCTLTNSLVVGIPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL-GQISAAADNARPEMGTDLEGNP  679
              MYG +G DLV+QA+ +QA++WLT+LLF LEFRRT + G I+     A        EG  
Sbjct  123   PMYGPMGVDLVVQASVVQAIIWLTLLLFVLEFRRTGIEGTITTLKPKASSISNVTCEGEE  182

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
              +   A       ++  P +  +MK V L+L  NPN+Y C +G+ WA I+  W+  +PS+
Sbjct  183   SKDVEANNIVEYTSSRLP-FLQLMKRVWLKLIANPNSYGCVIGISWAFISNRWNLELPSM  241

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ SI+IM+K G+G AMFS G+FMALQ+++ISCG +LTV+GLVL+F+ GPA  AI A ++
Sbjct  242   VEGSILIMSKAGTGTAMFSMGIFMALQEKVISCGPSLTVFGLVLKFIAGPAAMAISAFIV  301

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L GDVL+I I+Q+A+PQ++T+FIFAKEY LHA+VLSTA+I G I+SLP+++ YY ILE 
Sbjct  302   GLRGDVLRIAIIQAAVPQSITSFIFAKEYELHAEVLSTAVIFGMIVSLPILVAYYAILEF  361

Query  138   L  136
             +
Sbjct  362   V  362



>gb|AIF28451.1| PIN-like protein, partial [Papaver somniferum]
Length=355

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 258/357 (72%), Gaps = 8/357 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G GDIYKVVVAM PLYVA+ILGYGS++WW MF  + CDAIN+F C+F LP FTFHF +QV
Sbjct  3     GMGDIYKVVVAMTPLYVALILGYGSVKWWKMFSREQCDAINKFVCYFTLPLFTFHFTSQV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+  NY F+A+D ++K ++V+ L+ WA    NG   W IT+FSLSTL N+LVVGVP+++
Sbjct  63    DPFGWNYKFLAADAISKVIIVIVLIAWAKGSSNGCYTWLITSFSLSTLTNSLVVGVPMLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG +G ++V+++   Q ++WL++LLF LE R       S++ +    +M  DLE N  
Sbjct  123   AMYGDIGVNIVVESTVFQGIVWLSVLLFVLEIRNAN--DSSSSVNILDSQMVNDLERNDN  180

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
              A+             PS+ +MMK+VC++L  NPN  A  +G+ WA I+  WH  MP II
Sbjct  181   SASVTTVPSR------PSFLSMMKTVCVKLILNPNAQASVIGITWAFISSRWHIEMPIII  234

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM+K G G AMFS GLF ALQ++I++CG  LT++GLVLRF+ GPA  A+G + + 
Sbjct  235   ERSVLIMSKAGIGSAMFSMGLFTALQEKILACGVRLTLFGLVLRFIAGPAAMAMGCLAVG  294

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             L GDVL++ +VQ+ALPQA+ +FI+AKEYGLHADVLSTA+I+G I+SLPV+I Y++ L
Sbjct  295   LRGDVLRVAVVQAALPQAIASFIYAKEYGLHADVLSTAVIVGMIVSLPVLIVYFIAL  351



>ref|XP_006288060.1| hypothetical protein CARUB_v10001290mg [Capsella rubella]
 gb|EOA20958.1| hypothetical protein CARUB_v10001290mg [Capsella rubella]
Length=352

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 258/360 (72%), Gaps = 11/360 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              +GD YKV+ AM PLYVA+ILGYGS++WW++F  D CDAINR  C+F LP FT  F A V
Sbjct  3     SFGDAYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTIEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+DV++KA++V  L  WA +   G   WSIT+FSL TL N+LVVGVPL +
Sbjct  63    DPFNMNYRFIAADVLSKAIIVTVLAFWAKYSNKGSYSWSITSFSLCTLTNSLVVGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+   DLV+Q++  QA++WLT+LLF LE+RR   G  S  + +++ E   ++E   +
Sbjct  123   AMYGKQAVDLVVQSSVFQAIVWLTLLLFVLEYRRA--GFSSNGSGDSKVE-NINIESGKR  179

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             E    GE          S+  +M  V  +LA NPN Y+C LG+ WA I+  WH  MP I+
Sbjct  180   ETVVVGEE--------KSFLEVMSLVWWKLAMNPNCYSCILGIAWAFISNRWHLAMPGIL  231

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G AMF+ G+FMALQ+++I CG +LTV G++L+F+ GPA  A+G+I   
Sbjct  232   EGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMLLKFIAGPAAMAVGSIAFG  291

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             LHGDVL++ IVQ+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  292   LHGDVLRVAIVQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  351



>ref|XP_004152830.1| PREDICTED: putative auxin efflux carrier component 8-like [Cucumis 
sativus]
Length=371

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 261/367 (71%), Gaps = 7/367 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AMAPLY A+ILGYGS++WW +F    CDAIN+  C+F LP FTF F + +
Sbjct  3     GWQDVYKVVAAMAPLYFALILGYGSVKWWKIFSTQQCDAINKLVCYFTLPLFTFDFTSHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ +N+ F+A+D + K ++V+ L  WA     G   WSIT+FSLSTL N LV+GVPL +
Sbjct  63    DPFHLNFPFIAADAIGKLIIVLVLAFWAKCTTKGSYCWSITSFSLSTLTNALVIGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA------DNARPEMGTD  694
              MYG++  DLV+Q + +QA++WLT+LLF LE RRT L  ++A A      +    E+G +
Sbjct  123   VMYGQMAVDLVVQGSVVQAIVWLTILLFVLELRRTGLDLVAAEASSGVVSEEKTVEVGGE  182

Query  693   LEGN-PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWH  517
              E +   E     E   +  +  PS   +MK V +++A NPN+YAC +G  WA + K WH
Sbjct  183   GEKDLEGEGMEVEEMRRSSKSHRPSLKPLMKKVWVKMAGNPNSYACTIGFAWAFVAKRWH  242

Query  516   FTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSA  337
               MPSI++ SI+IM+K G G AMF+ G+FMALQ+++I+CG TLT+ G+VL+F+ GPA  A
Sbjct  243   VEMPSIMEGSILIMSKAGIGTAMFNMGIFMALQEKLIACGPTLTIVGMVLKFIAGPAAMA  302

Query  336   IGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGY  157
             IG+I + LHGDVL++ I+Q+A+PQ++T+FI+AKEYGLHADVLSTA+I G I+SLPV++ Y
Sbjct  303   IGSIAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSLPVLVAY  362

Query  156   YVILELL  136
             Y  LE +
Sbjct  363   YAALEFI  369



>emb|CDY67254.1| BnaCnng54140D [Brassica napus]
Length=348

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 254/357 (71%), Gaps = 15/357 (4%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+YKV+ AM PLYVA+ILGYGS++WWH+F  D CDAINR  C+F LP FT  F A VDP+
Sbjct  6     DVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDPF  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MNY F+A+D+++K ++V  L  WA +  NG   WSIT+FSL TL N+LVVGVPL +AMY
Sbjct  66    NMNYRFIAADIISKVIIVAVLAFWAKYSNNGSYCWSITSFSLCTLTNSLVVGVPLAKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G+   DLV+Q++  QA++WLT+LLF LE RR       A  +    E   ++E   K+ A
Sbjct  126   GQAAVDLVVQSSVFQAIVWLTLLLFVLELRR-------AGFNTNSKEENINIEDGRKDIA  178

Query  666   aagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidds  487
               GE          S+  +M  V L+LA NPN Y+C LG+ WA I+  WHF MP I++ S
Sbjct  179   VVGEQ--------KSFVEVMSVVWLKLATNPNCYSCILGIAWAFISSRWHFEMPGIMEGS  230

Query  486   imiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHG  307
             I+IM+K G+G AMF+ G+FMALQ++ I CG +LT  G+VL+F+ GPA  AIG+I + LHG
Sbjct  231   ILIMSKAGTGTAMFNMGIFMALQEKFIVCGASLTALGMVLKFIAGPAAMAIGSIAVGLHG  290

Query  306   DVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             DVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  291   DVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  347



>gb|EYU39429.1| hypothetical protein MIMGU_mgv1a009388mg [Erythranthe guttata]
Length=344

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 255/360 (71%), Gaps = 19/360 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G  D+YKVVV +APLYVA++LGY S++W  MF P+ C+AINR  C+F  P F F F A V
Sbjct  3     GREDVYKVVVGIAPLYVALMLGYSSVKWCRMFSPEQCEAINRLVCYFTYPLFVFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNYL + +DV++K ++V+ L  WA   K G   WSIT+FSLSTL N+LVVGVPL++
Sbjct  63    DPFKMNYLMMGADVISKVIIVMVLGCWAKCCK-GSYCWSITSFSLSTLTNSLVVGVPLLK  121

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG +  DLV+Q++  QAL+WL++LLF LE RRT    ++AA          DLE    
Sbjct  122   AMYGPMAVDLVVQSSVFQALVWLSILLFVLELRRTYHDHVAAA----------DLENQSS  171

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                A             ++  +M+ V L+LA NPN+YAC LG+ WA ++  WHF MPS++
Sbjct  172   GVIADASRI--------NFWNLMRRVSLKLAINPNSYACILGITWAFLSNRWHFEMPSVM  223

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM++ G+G  MFS GLFMALQ+++I+CG +LTV+G+ LRF+ GP   A+ +  + 
Sbjct  224   EGSILIMSRAGTGTTMFSMGLFMALQEKVIACGASLTVFGMALRFIAGPLAMALASFAVG  283

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             LHGDVL+I I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G I+SLPV+I YY ILE +
Sbjct  284   LHGDVLRIAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPVLIAYYAILEFV  343



>ref|XP_009121478.1| PREDICTED: putative auxin efflux carrier component 8 [Brassica 
rapa]
 emb|CDX69445.1| BnaA10g17940D [Brassica napus]
Length=348

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 256/357 (72%), Gaps = 15/357 (4%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+YKV+ AM PLYVA+ILGYGS++WWH+F  D CDAINR  C+F LP FT  F A VDP+
Sbjct  6     DVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDPF  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MNY F+A+D+++K ++V  L  WA +  NG   WSIT+FSL TL N+LVVGVPL +AMY
Sbjct  66    NMNYRFIAADIISKVIIVAVLAFWAKYSNNGSYCWSITSFSLCTLTNSLVVGVPLAKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G+   DLV+Q++  QA++WLT+LLF LE RR         + N++ E   ++E   K+ A
Sbjct  126   GQAAVDLVVQSSVFQAIVWLTLLLFVLELRRAGF------STNSKEE-NINIEDGRKDIA  178

Query  666   aagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidds  487
               GE          S+  +M  V L+LA NPN Y+C LG+ WA I+  WHF MP I++ S
Sbjct  179   VVGEQ--------KSFVEVMSVVWLKLATNPNCYSCILGIAWAFISSRWHFEMPGIMEGS  230

Query  486   imiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHG  307
             I+IM+K G+G AMF+ G+FMALQ++ I CG +LT  G+VL+F+ GPA  AIG+I + LHG
Sbjct  231   ILIMSKAGTGTAMFNMGIFMALQEKFIVCGASLTALGMVLKFIAGPAAMAIGSIAVGLHG  290

Query  306   DVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             DVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  291   DVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  347



>ref|XP_010420348.1| PREDICTED: putative auxin efflux carrier component 8 [Camelina 
sativa]
Length=352

 Score =   290 bits (743),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 254/364 (70%), Gaps = 23/364 (6%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WW++F  D CDAINR  C+F +P FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTMPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  L  WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL---GQISAAADNARPEMG---TDLE  688
             YG+   DLV+Q++  QA++WLT+LLF LE RR      G   A  DN   E G   T++ 
Sbjct  125   YGQQAVDLVIQSSVFQAIVWLTLLLFVLELRRAGFNSNGSSDAKVDNINIESGKRETEVV  184

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
             G  K                 S+  +M  V  +LA NPN Y+C LG+ WA I+  WH  M
Sbjct  185   GEEK-----------------SFLQVMSLVWWKLATNPNCYSCILGIAWAFISNRWHLEM  227

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P I++ SI+I++K G+G AMF+ G+FMALQ+++I CG +LTV G+VL+F+ GPA  AIG+
Sbjct  228   PGILEGSILIISKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGS  287

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I   LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I GT++SLPV++ YY  
Sbjct  288   IAFGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGTLVSLPVLVAYYAA  347

Query  147   LELL  136
             LE +
Sbjct  348   LEFI  351



>ref|XP_010492564.1| PREDICTED: putative auxin efflux carrier component 8 [Camelina 
sativa]
Length=352

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 253/364 (70%), Gaps = 23/364 (6%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WW +F  D CDAINR  C+F +P FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWKIFTRDQCDAINRLVCYFTMPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  L  WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL---GQISAAADNARPEMG---TDLE  688
             YG+   DLV+Q++  QA++WLT+LLF LE RR      G   A  DN   E G   T++ 
Sbjct  125   YGQQAVDLVIQSSVFQAIVWLTLLLFVLELRRAGFNSNGSSDAKVDNINIESGKRETEVV  184

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
             G  K                 S+  +M  V  +LA NPN Y+C LG+ WA I+  WH  M
Sbjct  185   GEEK-----------------SFLQVMSLVWWKLATNPNCYSCILGIAWAFISNRWHMEM  227

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P I++ SI+IM+K G+G AMF+ G+FMALQ+++I CG +LTV G+VL+F+ GPA  AIG+
Sbjct  228   PGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGS  287

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I   LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I GT++SLPV++ YY  
Sbjct  288   IAFGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGTLVSLPVLVAYYAA  347

Query  147   LELL  136
             LE +
Sbjct  348   LEFI  351



>gb|AIF28459.1| PIN-like protein, partial [Ludovia sp. SFB-2014]
Length=353

 Score =   288 bits (737),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 250/357 (70%), Gaps = 10/357 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              WGDIYKVVVAM PLYVA+ LGYGS+RWW +F P+ C+AINR    F LP FTF F    
Sbjct  3     AWGDIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRLVSCFTLPLFTFEFACHA  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+  NY  +A+D ++K ++V+AL  WA     G   WSIT+FSLSTL N+LV+GVPL+ 
Sbjct  63    DPFAWNYRCIAADAISKIIIVLALAAWAKCSSKGSYCWSITSFSLSTLTNSLVIGVPLLN  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+Q + +QA+         +EFR+ R G ++  AD A     + +     
Sbjct  123   AMYGAGAQDLVVQLSLLQAI---------VEFRKARSG-VAMVADTAASSGSSHVVSIES  172

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                    + +      PS+ A+MK V L+LA NPN+YA  +G+ WA I   W F MPSI+
Sbjct  173   PTKEGDGSRSNENARRPSFWALMKIVWLKLALNPNSYASIMGISWAFIANRWQFGMPSIM  232

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM++ G+G+AMFS GLFMALQ+++++CG +LTV+G+ LRF+ GPA  AIG+I + 
Sbjct  233   EGSVLIMSRAGAGMAMFSMGLFMALQEKLVACGASLTVFGMALRFIAGPAAMAIGSIAVG  292

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             LHGDVL++ I+Q+ALPQ++T+FIFA+EYGLHADVLSTA+I G ++SLPV+IGYYV+L
Sbjct  293   LHGDVLRVAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPVLIGYYVVL  349



>gb|KGN61255.1| hypothetical protein Csa_2G074170 [Cucumis sativus]
Length=369

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 250/367 (68%), Gaps = 9/367 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AMAPLY A+ILGYGS++WW +F    CDAIN+  C+F LP FTF F + +
Sbjct  3     GWQDVYKVVAAMAPLYFALILGYGSVKWWKIFSTQQCDAINKLVCYFTLPLFTFDFTSHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ +N+ F+A+D + K ++V+ L  WA     G   WSIT+FSLSTL N LV+GVPL +
Sbjct  63    DPFHLNFPFIAADAIGKLIIVLVLAFWAKCTTKGSYCWSITSFSLSTLTNALVIGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA------DNARPEMGTD  694
              MYG++  DLV         L + +  F LE RRT L  ++A A      +    E+G +
Sbjct  123   VMYGQMAVDLVGSVVQAIVWLTILL--FVLELRRTGLDLVAAEASSGVVSEEKTVEVGGE  180

Query  693   LEGN-PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWH  517
              E +   E     E   +  +  PS   +MK V +++A NPN+YAC +G  WA + K WH
Sbjct  181   GEKDLEGEGMEVEEMRRSSKSHRPSLKPLMKKVWVKMAGNPNSYACTIGFAWAFVAKRWH  240

Query  516   FTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSA  337
               MPSI++ SI+IM+K G G AMF+ G+FMALQ+++I+CG TLT+ G+VL+F+ GPA  A
Sbjct  241   VEMPSIMEGSILIMSKAGIGTAMFNMGIFMALQEKLIACGPTLTIVGMVLKFIAGPAAMA  300

Query  336   IGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGY  157
             IG+I + LHGDVL++ I+Q+A+PQ++T+FI+AKEYGLHADVLSTA+I G I+SLPV++ Y
Sbjct  301   IGSIAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSLPVLVAY  360

Query  156   YVILELL  136
             Y  LE +
Sbjct  361   YAALEFI  367



>ref|XP_002871722.1| hypothetical protein ARALYDRAFT_326097 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47981.1| hypothetical protein ARALYDRAFT_326097 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 258/358 (72%), Gaps = 11/358 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WW++F  D CDAINR  C+F LP FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  L  WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG+   DLV+Q++  QA++WLT+LLF LE R+   G  S  + + + +   ++E   +E 
Sbjct  125   YGQQAVDLVVQSSVFQAIVWLTLLLFVLELRKA--GSSSNYSSDVKVD-SINIENGKREI  181

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                GE          S+  +M  V L+LA NPN Y+C LG+ WA+I+  WH  MP I++ 
Sbjct  182   VVVGEE--------KSFLEVMSLVWLKLATNPNCYSCILGIAWALISNRWHLEMPGILEG  233

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI+IM+K G+G AMF+ G+FMALQ+++I CG +LTV G+VL+F+ GPA  AIG+I L LH
Sbjct  234   SILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGSIALGLH  293

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  294   GDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  351



>ref|XP_010453817.1| PREDICTED: putative auxin efflux carrier component 8 [Camelina 
sativa]
Length=352

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 253/364 (70%), Gaps = 23/364 (6%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WW++F  D CDAINR  C+F +P FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTMPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  L  WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRR---TRLGQISAAADNARPEMG---TDLE  688
             YG+   DLV+Q++  QA++WLT+LLF LE RR   +  G      DN   E G   T + 
Sbjct  125   YGQQAVDLVIQSSVFQAIVWLTLLLFVLELRRAGFSSNGSSDTKVDNISIESGKGETVVV  184

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
             G  K                 S+  +M  V  +LA NPN Y+C LG+ WA I+  WH  M
Sbjct  185   GEEK-----------------SFLQVMSLVWWKLATNPNCYSCILGIAWAFISNRWHLEM  227

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P I++ SI+IM+K G+G AMF+ G+FMALQ+++I CG +LTV G+VL+F+ GPA  AIG+
Sbjct  228   PGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGS  287

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I   LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA+I GT++SLPV++ YY  
Sbjct  288   IAFGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGTLVSLPVLVAYYAA  347

Query  147   LELL  136
             LE +
Sbjct  348   LEFI  351



>ref|XP_006480408.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=334

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 254/361 (70%), Gaps = 31/361 (9%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AM PLY A++LGYGS++WW +  P+ C A+NRF C+F LP FT  F  QV
Sbjct  3     GWEDVYKVVEAMVPLYFALMLGYGSVKWWKIIAPEECAAVNRFVCYFTLPLFTIEFTTQV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGL-DWSIttfslstlnntLVVGVPLM  859
             DP+ +NY  + +D ++K ++V  L  WA   KN     W IT FSL TL N+LVVGVPL+
Sbjct  63    DPFNLNYRLIGADAISKLIIVFVLAFWAMCSKNESCYSWCITNFSLCTLTNSLVVGVPLL  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             + MYG++  DLV+Q++ +Q++LWLT+ LF LE+RR+           AR ++    EG+ 
Sbjct  123   KPMYGQMAVDLVVQSSVLQSILWLTIFLFVLEYRRS-----------ARIDLE---EGHG  168

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             +                PS+  +MK V L++AKNPN+YAC LGL WA +   WH  MP I
Sbjct  169   R----------------PSFWHLMKIVWLKMAKNPNSYACILGLAWAFVAHRWHLKMPGI  212

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             I+ SI+IM++ G+G AMFS G+FMALQ+++I+CG  LTV+G+VL+F+ GPA  AIG+I  
Sbjct  213   IEGSILIMSRAGTGTAMFSMGIFMALQEKLIACGPKLTVFGMVLKFIAGPAAMAIGSIAA  272

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L GDVL++ I+Q+ALP+A+T+FIFAKEYGLHADVLSTA+I GTI+SLP++I YY IL++
Sbjct  273   GLRGDVLRVSIIQAALPEAITSFIFAKEYGLHADVLSTAVIFGTIVSLPLLIAYYAILDI  332

Query  138   L  136
             +
Sbjct  333   V  333



>gb|KDO41492.1| hypothetical protein CISIN_1g019021mg [Citrus sinensis]
Length=347

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 254/359 (71%), Gaps = 16/359 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLYVA++LGYGS++WW +F  + CDAINR  C+F LP FT  F A V
Sbjct  3     GWEDVYKVVVAMVPLYVALMLGYGSVKWWRIFTLEQCDAINRLVCYFTLPLFTVEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+  NY  +A+D ++K ++ + L +WA     G   WSIT+FSL TL ++LVVGVPL +
Sbjct  63    DPFKWNYRCIAADALSKLIIAIVLALWAKCSSKGSYCWSITSFSLCTLTSSLVVGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG++  DLV+Q + +QA++WL +LL  LE RR      +   D     +  DLEG   
Sbjct  123   AMYGQMAVDLVVQFSVIQAIVWLPVLLLVLEIRR------AGTTDAGAVHVDKDLEGTIN  176

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
               A++           P +  +MK V L++A NPN YAC  G+ WA ++  WHF MPSI+
Sbjct  177   AEASSR----------PDFWHLMKLVWLKVAMNPNAYACIFGIAWAFVSNRWHFEMPSIM  226

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM++ G+G AMFS G+FMA Q+++I+CG +LT++G+VL+F+ GPA  AIGAI + 
Sbjct  227   EGSILIMSRAGTGTAMFSMGIFMASQEKLIACGTSLTIFGMVLKFIAGPAAMAIGAIAMG  286

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G I+SLP+MI Y+ ILE 
Sbjct  287   LHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPLMIAYFAILEF  345



>ref|XP_006480404.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=347

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 253/359 (70%), Gaps = 16/359 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLYVA++LGYGS++WW +F  + CDAINR  C+F LP FT  F A V
Sbjct  3     GWEDVYKVVVAMVPLYVALMLGYGSVKWWRIFTLEQCDAINRLVCYFTLPLFTVEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+  NY  +A+D ++K ++ + L +WA     G   WSIT+FSL TL ++LVVGVPL +
Sbjct  63    DPFKWNYRCIAADALSKLIIAIVLALWAKCSSKGSYCWSITSFSLCTLTSSLVVGVPLAK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG++  DLV+Q + +QA++WL +LL  LE RR      +   D     +  DLEG   
Sbjct  123   AMYGQMAVDLVVQFSVIQAIVWLPVLLLVLEIRR------AGTTDAGAVHVDKDLEGTIN  176

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
               A++           P +  +MK V L++A NPN YAC  G+ WA ++  WHF MPSI+
Sbjct  177   AEASSR----------PDFWYLMKLVWLKVAMNPNAYACIFGIAWAFVSNRWHFEMPSIM  226

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+I+++ G+G AMFS G+FMA Q+++I+CG +LT++G+VL+F+ GPA  AIGAI + 
Sbjct  227   EGSILIISRAGTGTAMFSMGIFMASQEKLIACGTSLTIFGMVLKFIAGPAAMAIGAIAMG  286

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G I+SLP+ I YY ILE 
Sbjct  287   LHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPLTIAYYAILEF  345



>ref|XP_009383317.1| PREDICTED: putative auxin efflux carrier component 8 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 251/361 (70%), Gaps = 10/361 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              WGDIYKVV AMAPLYVA+ LGYGS++WW +  P+ C+AINR      LP FTF F    
Sbjct  3     SWGDIYKVVDAMAPLYVALGLGYGSVKWWRVITPEQCEAINRLVSCITLPLFTFQFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY FVA+D ++K  + + L  W      G   WS+T+FSL+TL N+LVVGVPL+ 
Sbjct  63    DPFAMNYRFVAADAISKVTIALLLAAWPKCSSKGSYCWSVTSFSLATLTNSLVVGVPLVG  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGT-DLEGNP  679
             AMYG    DLV+Q + +QA++WLT+LLF  E R+   G  S A     P +G   +E  P
Sbjct  123   AMYGPWAQDLVVQLSVVQAIVWLTLLLFVFELRKAGCGLFSVAT---APSIGNASIESPP  179

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
              + A             PS+ ++MK+V L+LA NPN+YA  +G+ WA I   WHF MPSI
Sbjct  180   AKDADVDVASQ------PSFWSLMKTVWLKLALNPNSYASIVGITWAFIANRWHFEMPSI  233

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ S++IM+K G+G+AMFS GLFMALQ++I++CG +LT +G+ L+F+ GP  +AIGAI +
Sbjct  234   MEGSVLIMSKAGTGMAMFSMGLFMALQEKILACGPSLTAFGMALKFVAGPVATAIGAIAV  293

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L GD+L + I+Q+ALPQ++T+FIFA+EYGLHADVLSTA+I G ++SLPV++ YYV+L  
Sbjct  294   GLRGDILHLAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPVLVTYYVVLGF  353

Query  138   L  136
             L
Sbjct  354   L  354



>ref|XP_006645238.1| PREDICTED: probable auxin efflux carrier component 6-like [Oryza 
brachyantha]
Length=360

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 259/363 (71%), Gaps = 9/363 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A  PLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGG--LDWSIttfslstlnntLVVGVPL  862
             DP+ +NY  VA+DV++KA++V  + +WA F+  GG  + WSIT+FSLSTL N+LVVGVP+
Sbjct  63    DPFEVNYRAVAADVISKAVIVAVIGVWARFMSKGGCAVSWSITSFSLSTLTNSLVVGVPM  122

Query  861   MQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQ-ISAAADNARPEMGTDLEG  685
              +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G  + AAAD A+     D+E 
Sbjct  123   ARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIGMYVDAAADPAK----VDVEA  178

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
                 AA       A     PS  A++K V  +LA+NPNTYA F+G+ WA +    H  +P
Sbjct  179   TASAAAGTVSGAGAGGK--PSLWALVKVVAHKLARNPNTYASFVGITWACVANRLHIALP  236

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
             S  + S++IM+K G+G+AMFS GLFMA Q++II+CG +    GLVL+F +GPA  AIG+I
Sbjct  237   SAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKIIACGPSFAALGLVLKFALGPAAMAIGSI  296

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
              + L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLP+++G+Y++L
Sbjct  297   AVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPLLVGFYIVL  356

Query  144   ELL  136
             EL+
Sbjct  357   ELI  359



>ref|XP_008802247.1| PREDICTED: putative auxin efflux carrier component 8 [Phoenix 
dactylifera]
Length=360

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 254/367 (69%), Gaps = 23/367 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVVAM PLYVA+ LGYGS+RWW +F P+ C+AINR   +F LPFFTF F    
Sbjct  3     GWADIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRLVVYFSLPFFTFEFTVHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY  +A+D ++K + V+ L  WA +   G   WSIT+FSLS L NTLVVG PL+ 
Sbjct  63    DPFAMNYRVIAADAISKVLTVLVLAAWAKWSSKGSYGWSITSFSLSALTNTLVVGAPLLN  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA----------RPE  706
             AMYGR   DLV+Q + +Q ++W+T LLF LE R+  +   + AA +           +PE
Sbjct  123   AMYGRWAQDLVVQLSVVQGIVWMTFLLFMLELRKAGILVTTVAATSNGGGDVVSVELQPE  182

Query  705   MGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITK  526
                D+E N + A+             PS+ ++M +V L+LA NPN YA  LG+ WA I+ 
Sbjct  183   -AKDVEENAEVASR------------PSFCSLMMTVWLKLALNPNFYASVLGVAWAFISN  229

Query  525   GWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPA  346
              WHF MPSII+ S++IM++ G+G+AMFS GLFMALQ++II+CG  LT +G+VLRF+ GPA
Sbjct  230   RWHFEMPSIIEGSVLIMSRSGAGLAMFSMGLFMALQEKIIACGLNLTAFGMVLRFVAGPA  289

Query  345   TSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVM  166
               AIGAI + L GD L++ I+ +ALPQ++++FIFA+EYGLHA+VLSTA+I GT++SLP++
Sbjct  290   AMAIGAIAVGLRGDFLRVAIIVAALPQSISSFIFAREYGLHAEVLSTAVIFGTLVSLPLL  349

Query  165   IGYYVIL  145
             +  Y  L
Sbjct  350   VACYFAL  356



>gb|AIF28460.1| PIN-like protein, partial [Dioscorea villosa]
Length=384

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 266/381 (70%), Gaps = 21/381 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G GDIYKVVVAMAPLY A+ LGYGS+RWWH+F P+ C+AINR   +F LPFFTF F    
Sbjct  3     GLGDIYKVVVAMAPLYTALGLGYGSVRWWHIFTPEQCEAINRLVSYFTLPFFTFEFTVHA  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+ +DV++K ++V  L  WA     G   WSITTFSL+TL N+LVVGVPL+ 
Sbjct  63    DPFLMNYRFILADVISKLVIVSILFAWAKCSSKGSYCWSITTFSLTTLTNSLVVGVPLLN  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD---NARPEMGTDLEG  685
             AMYG    DLV+Q++ +Q ++WL +LLF LEFR+ ++G  +   D   N    +  D   
Sbjct  123   AMYGPSAQDLVVQSSIIQGIVWLVLLLFVLEFRKLKIGIPTNKPDVVSNQSHVVSIDTSV  182

Query  684   NPKeaaaagetpaapTNI------------------GPSYTAMMKSVCLRLAKNPNTYAC  559
              PK+AAAA    A   N                    PS+ ++M++V  +LA NPN+YA 
Sbjct  183   PPKDAAAAAAAAATNNNNNNDENTNSSVADHELVVAKPSFCSLMRTVWFKLALNPNSYAS  242

Query  558   FLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVY  379
              +G+ WA I+  WHF MPSI++ SI++M+K G+G+AMFSTGLFMALQ+++++ G +L  +
Sbjct  243   IIGITWAFISNRWHFEMPSIMEGSILVMSKAGTGMAMFSTGLFMALQEKLVASGPSLMAF  302

Query  378   GLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAI  199
             G+V++F+ GPA  AIGAI + LHGDVL++ I+Q+ALPQ++ +FIFA++YGLHA+VLSTA+
Sbjct  303   GMVMKFIAGPAAMAIGAIAVGLHGDVLRVAIIQAALPQSIVSFIFARDYGLHAEVLSTAV  362

Query  198   IIGTILSLPVMIGYYVILELL  136
             I G ++SLPV++ YY +L L+
Sbjct  363   IFGMLVSLPVLVAYYFLLGLM  383



>ref|XP_004492828.1| PREDICTED: putative auxin efflux carrier component 8-like [Cicer 
arietinum]
Length=366

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 186/374 (50%), Positives = 263/374 (70%), Gaps = 25/374 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVA+ PLYVA++LGYGS+RWW +F  + CDAIN+  C+F LP FTF F A +
Sbjct  3     GWEDVYKVVVAVVPLYVALVLGYGSVRWWKIFTREQCDAINKLVCYFTLPLFTFEFTANI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MN+LF+ +D ++K ++V  L +WA   + G   WSIT+FSL TL N+LVVG+P+++
Sbjct  63    DPFKMNFLFIGADTLSKLIIVAVLALWAKCSRKGSYCWSITSFSLCTLTNSLVVGIPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGT-------  697
              MYG +G DLV+QA+ +QA++WLT+LL  LEFRRT  G   A + N +P+  +       
Sbjct  123   PMYGPMGVDLVVQASVVQAIVWLTLLLIVLEFRRT--GIEGANSTNLKPKASSISNVVIG  180

Query  696   -------DLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWA  538
                    D+E N      +             +  +MK V LR   NPN+Y C +G+ WA
Sbjct  181   DEVVERKDVEANTIVEDTSSRL---------PFFQLMKRVWLRFIVNPNSYGCVVGISWA  231

Query  537   IITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFL  358
              I+  W+  MPS+++ S++IM++ G+G AMFS G+FMALQ+++ISCG +LTV GLVL+F+
Sbjct  232   FISNRWNLKMPSMVEGSVLIMSRAGTGTAMFSMGIFMALQEKVISCGPSLTVIGLVLKFI  291

Query  357   IGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILS  178
              GPA  AI AI++ L GDVL++ I+Q+A+PQ++T+FIFAKEYGLHA+VLSTA+I G I+S
Sbjct  292   AGPAAMAISAIIVGLRGDVLRVAIIQAAVPQSITSFIFAKEYGLHAEVLSTAVIFGMIVS  351

Query  177   LPVMIGYYVILELL  136
             LP++I YYVILE +
Sbjct  352   LPILIAYYVILEFI  365



>ref|XP_007139738.1| hypothetical protein PHAVU_008G055200g [Phaseolus vulgaris]
 gb|ESW11732.1| hypothetical protein PHAVU_008G055200g [Phaseolus vulgaris]
Length=378

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 263/376 (70%), Gaps = 17/376 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVA+ PLYVA++LGYGS++WW +F  + C+AIN+  C+F LP FTF F A +
Sbjct  3     GWEDVYKVVVAVVPLYVALVLGYGSVKWWKIFTREQCEAINKLVCYFTLPLFTFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MN+ F+A+D ++K ++++ L +WA   K G   WSIT+FSL TL N LVVGVP+++
Sbjct  63    DPFKMNFSFIAADTISKFIIMLVLALWAKCTK-GSFCWSITSFSLCTLTNALVVGVPMVK  121

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQ-------------ISAAADNA  715
              MYG LG DLV+Q++ +QA++WLT LLF LEFRRT +               + +  +N 
Sbjct  122   PMYGALGEDLVVQSSVVQAIIWLTFLLFVLEFRRTAIEGTTNTFKPKSKAMIVDSNTNNK  181

Query  714   RPE--MGTDLEGNP-KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLI  544
               E  MG D+E N                +       +MK V ++L  NPN+Y C +G+ 
Sbjct  182   TGEGGMGKDVEENTVAIDVKEELALEETVSSRIPLCKLMKLVWIKLVMNPNSYGCVIGIS  241

Query  543   WAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLR  364
             WA I+  W+  MPS+++ SI IM+K G+G AMFS G+FMALQD++I+CG +LTV+GLVL+
Sbjct  242   WAFISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGIFMALQDKLIACGPSLTVFGLVLK  301

Query  363   FLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTI  184
             F+ GPA  AIGAI + LHGDVL++ I+Q+A+PQ++T+FIFAKEYGLH +VLSTA+I G I
Sbjct  302   FIAGPAAMAIGAIAVGLHGDVLRVAIIQAAVPQSITSFIFAKEYGLHPEVLSTAVIFGMI  361

Query  183   LSLPVMIGYYVILELL  136
             +SLP+++ YY ILEL+
Sbjct  362   ISLPILVAYYGILELI  377



>emb|CDX70699.1| BnaC03g07830D [Brassica napus]
Length=348

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 249/358 (70%), Gaps = 15/358 (4%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YK + AM PLYVA+I GYGS++WW++F  D CDAIN+   +F LP FT  F   VDP
Sbjct  5     GDVYKAIEAMVPLYVALISGYGSVKWWNIFTRDQCDAINQLVYYFTLPLFTIEFTTHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K +++  L  WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKIIIIAVLAFWAKYSSKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG+   DLV+Q++  QA++WLT+LLF LE RR      +   D        ++EG  KE 
Sbjct  125   YGQEAVDLVVQSSVFQAIVWLTLLLFVLELRRAGFSSNNKVDD-------INIEGGRKET  177

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E          S+  +M  V L+LA NPN Y+C LG+ WA I+  WHF MP II+ 
Sbjct  178   VVVREE--------KSFLEVMSVVWLKLATNPNCYSCILGIAWAFISNRWHFEMPGIIEG  229

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI+IM+K G+G AMF+ G+FMALQD++I CG +LT  G+VL+F+ GPA  AIG+I + L+
Sbjct  230   SILIMSKAGTGTAMFNMGIFMALQDKLIVCGTSLTAMGMVLKFIAGPAAMAIGSIAVGLY  289

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  290   GDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  347



>ref|NP_001234230.1| auxin efflux facilitator SlPIN10 [Solanum lycopersicum]
 gb|ADR30413.1| auxin efflux facilitator SlPIN10 [Solanum lycopersicum]
Length=347

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 247/358 (69%), Gaps = 16/358 (4%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W DIYKV+ AM PLY+A+ LGYGS++WWH    +HCDAINR N FF+LPFFTF FI+QV+
Sbjct  4     WLDIYKVIEAMMPLYLALGLGYGSVKWWHKLSAEHCDAINRLNYFFVLPFFTFDFISQVN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MNYLF+  D++AKA++   L +WANF   G L WSITTFS  +L N LV+G+P+M A
Sbjct  64    PYKMNYLFICGDLIAKAIIGFFLTLWANFYSKGNLSWSITTFSFCSLTNALVMGIPVMNA  123

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKe  673
             +  ++G DLV+Q+ A+Q L+W  ++ F +EF+  +   ++    N       DLEGN   
Sbjct  124   VSPQVGVDLVIQSLAIQFLIWSIIIQFMMEFKNAKDEIMACEGAN------QDLEGNNNA  177

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
             +           N  PS  ++M  V  +L+KNPN YACFLG++W+++   WHF +P+I+ 
Sbjct  178   SK----------NTTPSLGSVMTIVWTKLSKNPNFYACFLGIMWSLVADRWHFGLPNIVK  227

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
             + I IM+K GSGI MF+ G+F+A+Q +I++ G  + ++GL LRF IGPAT  IG+ L+ L
Sbjct  228   ECISIMSKAGSGIGMFTIGVFVAMQQKIMAGGTGVIIFGLFLRFFIGPATMTIGSFLVGL  287

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             HG+V +  I+Q+ALP  + +F+ AKEYG+H +++S  +IIG ++SLP+MI YY I EL
Sbjct  288   HGNVFRASILQAALPPGIASFVLAKEYGVHPEIVSAVVIIGILVSLPIMIAYYAISEL  345



>ref|XP_006848440.1| hypothetical protein AMTR_s00013p00241000 [Amborella trichopoda]
 gb|ERN10021.1| hypothetical protein AMTR_s00013p00241000 [Amborella trichopoda]
Length=365

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 183/368 (50%), Positives = 255/368 (69%), Gaps = 14/368 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G  D+Y V+ AM PLY+ + LGYGS+RWW +  P+HC+ INR    F LP FTF+F A +
Sbjct  3     GLRDVYLVLSAMVPLYIPLGLGYGSVRWWGVLNPEHCNGINRVVALFTLPLFTFNFTASI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWAN----FVKNGGLDWSIttfslstlnntLVVGV  868
             DP+TMN+ F+ +D ++K  VV A+ +WA       K     W+IT FSLSTL NTLVVGV
Sbjct  63    DPFTMNFRFLGADALSKVFVVAAVALWAKTRGTCCKGPACSWAITGFSLSTLTNTLVVGV  122

Query  867   PLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL-GQISAAAD---NARPEMG  700
             PL++AMYG +  DLV+Q + +QA++WL++LLF LE R + + G +  A++   N    + 
Sbjct  123   PLLKAMYGGIAQDLVVQVSVIQAIVWLSILLFVLECRSSCINGGVVVASETVGNEGSHVA  182

Query  699   TDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGW  520
              D+ G                   PS  ++MK V  +LA NPN+YA  +G+IWA I+  W
Sbjct  183   VDVAGTDTGVKVVQVHKR------PSLGSLMKVVWRKLALNPNSYASIVGVIWAFISSRW  236

Query  519   HFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATS  340
             HF+MP ++++S+ +MAK GSG+AMFS GLFMA Q+++I CG +LTV  +VLRFL GPA  
Sbjct  237   HFSMPLLMENSVSMMAKAGSGMAMFSMGLFMASQEKLIGCGPSLTVLSMVLRFLAGPAAM  296

Query  339   AIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIG  160
             A+ +I + LHGDVL I I+Q+ALPQ++T+FI+A+EYGLHA+VLSTA+I G ++SLPV+I 
Sbjct  297   AVASIAVGLHGDVLHIAIIQAALPQSITSFIYAREYGLHAEVLSTAVIFGMLVSLPVLIA  356

Query  159   YYVILELL  136
             YYV+LELL
Sbjct  357   YYVVLELL  364



>gb|AIF28456.1| PIN-like protein, partial [Typha angustifolia]
Length=359

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 182/366 (50%), Positives = 245/366 (67%), Gaps = 22/366 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+YKVV+AM PLYVA+ LG+GS+RWW +F  D C+AINR    FILPF TF F    
Sbjct  3     SWRDVYKVVIAMVPLYVALGLGFGSVRWWKIFTADQCNAINRLVTLFILPFLTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+ +D V+K +VV+ L IW  +   G   WSIT FSLSTL NTLVVGVPL+ 
Sbjct  63    DPFAMNYRFLLADAVSKIVVVIILAIWVKYSSKGSYSWSITMFSLSTLTNTLVVGVPLVS  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG--QISAAADN-------ARPEM  703
             AMYG+   DLV+Q + +QA+ W T+LL   E ++  +G   +SA ++N           +
Sbjct  123   AMYGKWAQDLVVQLSVVQAIAWFTLLLLAFELKKAGVGLSSVSAQSNNGGNQVMLVESSI  182

Query  702   GTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKG  523
               D E   +              +   + ++MK    +LA NPN YA  LG+ WA I   
Sbjct  183   VNDAEEKSEI-------------VSRPFRSLMKIAWFKLALNPNVYAGILGITWAFIANR  229

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
             W F MPSII+ S++IM++ G+G+AMFS GLFMALQ++II+CG  LTV+G+VL+ + GPA 
Sbjct  230   WRFEMPSIIEGSVLIMSRAGTGMAMFSMGLFMALQEKIIACGPILTVFGMVLKLVAGPAA  289

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMI  163
             + IGA+ L L GDVL++ I+Q+ALPQ++T+FIFAKEY +HADVLSTA+I GT+ SLPV+I
Sbjct  290   AVIGAMALGLRGDVLRLAIIQAALPQSITSFIFAKEYEVHADVLSTAVIFGTLASLPVLI  349

Query  162   GYYVIL  145
              YY+ L
Sbjct  350   AYYIFL  355



>ref|XP_010673920.1| PREDICTED: putative auxin efflux carrier component 8 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 252/369 (68%), Gaps = 19/369 (5%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             DI KV+VA  PLYVA+ILGYGS++WW +FK D CDAINR  C+F LP F   F A  +P+
Sbjct  6     DISKVIVATVPLYVALILGYGSVKWWRLFKADQCDAINRLVCYFTLPLFNLDFTAHSNPF  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
               NY F+A+D ++K ++V  L +W      G   WSIT+FSLSTL N+LVVGVPL+ AMY
Sbjct  66    EWNYKFLAADAMSKVIIVAVLALWVTCSSKGSYCWSITSFSLSTLTNSLVVGVPLLGAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRL------GQISAAADNARP--------  709
             G +G DLV+Q +  QA++WLT+LLF LEFR++R+        +S + +   P        
Sbjct  126   GPMGVDLVVQFSVTQAIIWLTVLLFVLEFRQSRIDLPSTINCVSTSVEIKDPSQVHSFGV  185

Query  708   EMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIIT  529
             +   D+EG                 + PS  +++K V +++  NPN+Y+C +G+ WA   
Sbjct  186   DQNKDMEGK-----IISTNDGLGDVVRPSLWSLIKGVGVKILANPNSYSCIIGIAWAFFA  240

Query  528   KGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGP  349
               +H  +PSI+D SI+IM+K G+G AMFS G+FMA Q+++ISCG  LT++ ++L+F+ GP
Sbjct  241   SRFHLQLPSIVDGSILIMSKAGTGTAMFSMGMFMASQEKLISCGPKLTIFAMILKFIAGP  300

Query  348   ATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
             A  AI +++L LHGDVL++ I+Q+ALPQ++T+FI+AKEYGLHADVLSTA+I G + SLP+
Sbjct  301   AAMAISSLVLGLHGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMMASLPI  360

Query  168   MIGYYVILE  142
             +I YY ILE
Sbjct  361   LIAYYAILE  369



>ref|XP_009131547.1| PREDICTED: putative auxin efflux carrier component 8 [Brassica 
rapa]
Length=348

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 248/358 (69%), Gaps = 15/358 (4%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+I GYGS++WW++F  D CDAIN+   +F LP FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALISGYGSVKWWNIFTRDQCDAINQLVYYFTLPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K +++  L  WA +   G   W IT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKIIIIAVLAFWAKYSSKGSYCWYITSFSLCTLTNSLVVGVPLGKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG+   DLV+Q++  Q ++WLT+LLF LE RR      +   D        ++EG  KE 
Sbjct  125   YGQEAVDLVVQSSVFQGIVWLTLLLFVLELRRAGFSSNNNVDD-------INIEGGRKET  177

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E          S+  +M  V L+LA NPN Y+C LG+ WA I+  WHF MP II+ 
Sbjct  178   VVVREE--------KSFLEVMSVVWLKLATNPNCYSCILGIAWAFISNRWHFEMPGIIEG  229

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI+IM+K G+G AMF+ G+FMALQD++I CG +LT  G+VL+F+ GPA  AIG+I + LH
Sbjct  230   SILIMSKAGTGTAMFNMGIFMALQDKLIVCGTSLTAIGMVLKFIAGPAAMAIGSIAVGLH  289

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             G+VL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLP ++ YY  LE +
Sbjct  290   GNVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPALVAYYAALEFI  347



>ref|NP_001045214.1| Os01g0919800 [Oryza sativa Japonica Group]
 sp|Q5JLM1.1|PIN6_ORYSJ RecName: Full=Probable auxin efflux carrier component 6; AltName: 
Full=OsPIN6 [Oryza sativa Japonica Group]
 dbj|BAD87633.1| auxin efflux carrier-like [Oryza sativa Japonica Group]
 dbj|BAF07128.1| Os01g0919800 [Oryza sativa Japonica Group]
 gb|EEC72049.1| hypothetical protein OsI_04955 [Oryza sativa Indica Group]
 tpd|FAA00683.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
 gb|AGV28596.1| auxin efflux carrier 5a [Oryza sativa Indica Group]
Length=363

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 257/362 (71%), Gaps = 4/362 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A  PLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGG--LDWSIttfslstlnntLVVGVPL  862
             DP+ +NY  VA+DV++KA++V  +  WA F+  GG  + WSIT+FSLSTL N+LVVGVP+
Sbjct  63    DPFQVNYRAVAADVISKAVIVAVIGAWARFMSKGGCAVSWSITSFSLSTLTNSLVVGVPM  122

Query  861   MQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGN  682
              +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G +      A    G D+E  
Sbjct  123   ARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIG-MYVDGAEAAAAAGKDVE-A  180

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                AAAAG    A     PS  A++K V  +LA+NPNTYA F+G+ WA +    H  +PS
Sbjct  181   AGAAAAAGTVVVAAAAGKPSLWALVKVVAHKLARNPNTYASFVGITWACLANRLHIALPS  240

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
               + S++IM+K G+G+AMFS GLFMA Q++II+CG +    GLVL+F +GPA  AIG+I 
Sbjct  241   AFEGSVLIMSKSGTGMAMFSMGLFMAQQEKIIACGTSFAALGLVLKFALGPAAMAIGSIA  300

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G ++SLP+++G+Y++LE
Sbjct  301   VGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPLLVGFYIVLE  360

Query  141   LL  136
             L+
Sbjct  361   LI  362



>ref|XP_006350420.1| PREDICTED: putative auxin efflux carrier component 8-like [Solanum 
tuberosum]
Length=349

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 247/359 (69%), Gaps = 14/359 (4%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W DIYKV+ AM PLY+A+ LGYGS++WWH    +HCDAINR N FF+LPFFTF FI+QV+
Sbjct  4     WLDIYKVIEAMMPLYLALGLGYGSVKWWHKLSAEHCDAINRLNYFFVLPFFTFDFISQVN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MNY F+  D++AKA++   L +WANF   G   WSITTFS  +L N LV+G+P+M A
Sbjct  64    PYKMNYPFICGDLIAKAIIGFFLTLWANFYSKGNFSWSITTFSFCSLTNALVMGIPVMNA  123

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKe  673
             M  ++G DLV+Q+ A+Q L+W  ++ F +E +  +   ++    N       DLEGN   
Sbjct  124   MSPQVGVDLVIQSLAIQFLIWSIIIQFMMELKNAKDEIMACEGAN------QDLEGNDNN  177

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
              A+         N  PS  ++M  V  +L+KNPN YACFLG++W+++   WHF +P+I+ 
Sbjct  178   NASK--------NTTPSLGSVMTIVWTKLSKNPNFYACFLGIMWSLVADRWHFVLPNIVK  229

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
             + I IM+K GSGI MF+ G+F+A+Q ++++ G  + V+GL LRF IGPAT  IG+ ++ L
Sbjct  230   ECISIMSKAGSGIGMFTIGVFVAMQQKVMAGGTGVIVFGLFLRFFIGPATMTIGSFVVGL  289

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             HG+VL+  I+Q+ALP  + +F+ AKEYG+H +++S  +IIG ++SLP+MI YY + EL+
Sbjct  290   HGNVLRASILQAALPPGIASFVLAKEYGVHPEIVSAVVIIGILVSLPIMIAYYAVSELI  348



>gb|AIF28450.1| PIN-like protein, partial [Papaver rhoeas]
Length=338

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 249/347 (72%), Gaps = 10/347 (3%)
 Frame = -3

Query  1176  PLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFvasd  997
             PLYVA++LGYGS++WW +F  + CDAIN+F C+F LP FTF F + VDP+  NY F+A+D
Sbjct  1     PLYVALVLGYGSVKWWKIFTREQCDAINKFVCYFTLPLFTFEFSSHVDPFEWNYKFIAAD  60

Query  996   vvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMYGRLGYDlvlq  817
              ++K ++V+ LV WA    NG   W IT+FSLSTL N+LVVGVP+++AMYG  G +LV+Q
Sbjct  61    GISKVIIVLVLVAWAKGSSNGCYTWLITSFSLSTLTNSLVVGVPMLRAMYGDHGVNLVVQ  120

Query  816   aaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaaaagetpaapT  637
             ++  Q ++WL++LLF LEFR+        ++ +    M  DLEGN K  +    T     
Sbjct  121   SSVFQGIVWLSILLFVLEFRK---ANNDCSSVDVESHMVKDLEGNDKMISVTTITR----  173

Query  636   NIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSG  457
                PS+ +MMK V ++L  NPN YA  +G+IWA I+  WH  MP IID S++IM+K G G
Sbjct  174   ---PSFWSMMKIVWVKLIVNPNVYASVIGIIWAFISNRWHVQMPEIIDGSVLIMSKAGIG  230

Query  456   IAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQS  277
              AMFS GLF A Q+++++CG +LT++G+VL+F+ GPA  AIG I + LHGDVL++ I+Q+
Sbjct  231   SAMFSMGLFTAQQEKLLACGTSLTLFGVVLKFIAGPAAMAIGCIAVGLHGDVLRVAIIQA  290

Query  276   ALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             ALPQ++T+FI+AKEYGLHADVLSTA+I G I+SLPV+I Y++ L  L
Sbjct  291   ALPQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPVLIVYFIALGFL  337



>ref|XP_010111063.1| Putative auxin efflux carrier component 8 [Morus notabilis]
 gb|EXC29925.1| Putative auxin efflux carrier component 8 [Morus notabilis]
Length=326

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 247/337 (73%), Gaps = 14/337 (4%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D YKVV AM PLYVA+ILGYGS++WW +F P+ C AINR  CFF LP FTF F A VD
Sbjct  4     WQDAYKVVEAMFPLYVALILGYGSVKWWKIFTPEQCGAINRLVCFFTLPIFTFEFTAHVD  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             P+  N  F+ +DV++K ++V+ L  WA     G   WSIT+FSL TL N+LVVGVPLM+A
Sbjct  64    PFLWNLPFIGADVISKVIIVIVLAFWAKCSPKGSYCWSITSFSLCTLTNSLVVGVPLMKA  123

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKe  673
             MYG +  DLV+Q++ +QA++WLT+LLF LEFRRT LG  S A++    + G DLE +   
Sbjct  124   MYGPMAVDLVVQSSVVQAIIWLTILLFVLEFRRTGLGVTSNASNG---DQGKDLEED---  177

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                        ++  PS+ ++MK V L+LA NPN+YA ++G+IWA+I   WH  MPSI++
Sbjct  178   --------VVNSSDRPSFWSLMKVVWLKLAMNPNSYAVYIGIIWALIANRWHLEMPSILE  229

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
              SI+IM+K G+G AMFS G+FMA+Q++ I+CG  LTV+G+VLRF+ GPA  AIGAI   L
Sbjct  230   GSILIMSKAGTGTAMFSMGVFMAMQEKTIACGARLTVFGMVLRFIAGPAAMAIGAIAAGL  289

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTA  202
             HGDVL++ I+Q+ALPQ++T+FIFAKEYGLHA+VLSTA
Sbjct  290   HGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTA  326



>ref|XP_008794580.1| PREDICTED: putative auxin efflux carrier component 8 [Phoenix 
dactylifera]
Length=353

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 255/358 (71%), Gaps = 12/358 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVVVAM PLYVA+ LGYGS+RWW +F P+ C+AINR   +F LPFFTF F   +
Sbjct  3     GWADIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRMVAYFSLPFFTFEFTLHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY  +A+D ++K ++V+ L  WA     G   WSIT+FSL TL N+LVVG PL+ 
Sbjct  63    DPFAMNYRAIAADAISKLIIVLVLAAWAKCSSKGSYCWSITSFSLCTLTNSLVVGAPLLN  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGT-DLEGNP  679
              MYGR   DLV+Q + +QA++WLT+LLF LE R+            +  +    D+EGN 
Sbjct  123   EMYGRWAQDLVVQLSVVQAIVWLTLLLFVLELRKAGTSNGGGGGVVSVEQQPVKDVEGNM  182

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
              E A+            P++ ++MK+V L+LA NPN+YA  +G+ WA +   +HF MPSI
Sbjct  183   TEVASR-----------PAFWSLMKTVWLKLALNPNSYASIVGITWAFLANRFHFGMPSI  231

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ S++IM+K G+G+AMFS GLFMA+Q++I++CG +LT +G+ LRF+ GPA  AIG+I +
Sbjct  232   MEGSVLIMSKAGTGLAMFSMGLFMAMQEKIVACGPSLTAFGMALRFVAGPAAMAIGSIAV  291

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
              L GD+L++ I+Q+A+PQ++T+FIFA+EYGLHADVLSTA+I G ++SLP+++ YY+ L
Sbjct  292   GLRGDLLRVAIIQAAVPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPLLVAYYIAL  349



>ref|XP_003564940.1| PREDICTED: probable auxin efflux carrier component 6 [Brachypodium 
distachyon]
Length=366

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 260/363 (72%), Gaps = 3/363 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A APLY A++LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATAPLYFALLLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVK--NGGLDWSIttfslstlnntLVVGVPL  862
             DP+ +NY  VA+DVV+KA++V A+ +WA F +  +G   W+IT+FSLSTL N+LVVGVP+
Sbjct  63    DPFQVNYRAVAADVVSKAVIVAAIAVWARFHRGVDGAGAWAITSFSLSTLTNSLVVGVPM  122

Query  861   MQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGN  682
              +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G     A++A         G 
Sbjct  123   ARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIGMYIVPAESASSPEAVIKGGG  182

Query  681   PKeaaaagetpaapTNIG-PSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
                 AA GE  AA   +G P+   + K+V  +LA NPNTYA F+G+ WA +    H  +P
Sbjct  183   VDVEAANGEAAAAVVGVGRPTVWRLFKTVAHKLALNPNTYASFVGITWACVANRLHIELP  242

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
             S+++ S++IM+K G+G+AMFS GLFMA Q++I++CG +L   GL L+F +GPA  A+G+I
Sbjct  243   SVLEGSVLIMSKSGTGMAMFSMGLFMAQQEKILACGPSLAALGLALKFALGPAAMAVGSI  302

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
              + L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I G + SLP+++G+Y++L
Sbjct  303   AVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLFSLPLLVGFYIVL  362

Query  144   ELL  136
             E++
Sbjct  363   EII  365



>ref|XP_010927704.1| PREDICTED: putative auxin efflux carrier component 8 [Elaeis 
guineensis]
Length=362

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 182/368 (49%), Positives = 256/368 (70%), Gaps = 23/368 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W DIYKVVVAM PLYVA+ LGYGS+RWW +F P+ C+AINR   +F  PFFTF F    
Sbjct  3     AWADIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRMVAYFSFPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY  +A+DV++K ++V+ L  WA     G   WSIT+FSL TL N+LVVG PL+ 
Sbjct  63    DPFAMNYRVIAADVISKLIIVLVLAAWAKCSSKGSYCWSITSFSLCTLTNSLVVGAPLVN  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD-----------NARP  709
              MYGR   DLV+Q + +QA++WLT+LLF LE R+  +G+   AA            + +P
Sbjct  123   QMYGRWAQDLVVQLSVVQAIMWLTLLLFVLELRKAGMGEAVVAATSSGGGGGGGSVDQQP  182

Query  708   EMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIIT  529
                 D+EGN  E  A+           P++ ++MK+V L+LA NPN+YA   G+ WA + 
Sbjct  183   V--KDVEGNMTEVVASR----------PAFWSLMKTVWLKLALNPNSYASIAGITWAFVA  230

Query  528   KGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGP  349
               WHF MP+I++ SI+IM+K G+G+AMFS GLFM ++++I++CG +LT +G+ L+F+ GP
Sbjct  231   NRWHFEMPNIMEGSILIMSKTGTGLAMFSMGLFMGMKEKIVACGPSLTAFGMALKFVAGP  290

Query  348   ATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
             A  AIGAI + L GD+L + I+Q+A+PQ++T+FIFA+EYGLHADVLSTA+I G ++SLP+
Sbjct  291   AAMAIGAITVGLRGDLLSVAIIQAAVPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPL  350

Query  168   MIGYYVIL  145
             ++ YY +L
Sbjct  351   LVAYYFVL  358



>gb|AIF28457.1| PIN-like protein, partial [Heliconia sp. SFB-2014]
Length=359

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 255/360 (71%), Gaps = 4/360 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              WGDIYKVVVAM PLYVA+ LGYGS+RWW +  P+ C+AINR      LP FT  F    
Sbjct  3     SWGDIYKVVVAMVPLYVALGLGYGSVRWWRIITPEQCEAINRLVSCITLPLFTLEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+D ++K M+V+ L  W      G   WSIT+FSLSTL N+LVVGVPL+ 
Sbjct  63    DPFAMNYRFIAADAISKIMIVLLLAAWPKCSSKGSYCWSITSFSLSTLTNSLVVGVPLVT  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+   DLV+Q + +QA++WLT+LLF  E R+   G  S+    A  ++ + +E  P 
Sbjct  123   AMYGQWAQDLVVQLSVVQAIVWLTLLLFIFEVRQAGCGLFSSGVGGAAGQIAS-VESPPV  181

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +    G          PS+ ++MK V L+LA NPN+YA  +G+ WA +   WHF MPSI+
Sbjct  182   KDVDGGNAQVVAR---PSFWSLMKIVWLKLALNPNSYASLVGITWAFLANRWHFEMPSIM  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI+IM+K G+G+AMFS GLFMALQ++I++CG +LT +G+VL+F+ GPA +AI AI + 
Sbjct  239   EGSILIMSKAGTGMAMFSMGLFMALQEKILACGPSLTAFGMVLKFIAGPAATAIAAIAVG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GD+L + I+Q+ALPQ++T+FIFA+EYGLHADVLSTA+I G ++SLP+++ YYV+L LL
Sbjct  299   LRGDILHLAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPLLVTYYVVLGLL  358



>ref|XP_002272306.1| PREDICTED: putative auxin efflux carrier component 8 [Vitis vinifera]
 emb|CBI17639.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 248/362 (69%), Gaps = 14/362 (4%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             WGD+YKVV AMAPLYVA++LGY S+RWWHMF  D C AINRF C+FI PF++F F + +D
Sbjct  4     WGDVYKVVEAMAPLYVALLLGYASVRWWHMFSSDQCAAINRFICYFIFPFYSFDFTSHID  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFV-KNGGLDWSIttfslstlnntLVVGVPLMQ  856
             P++MNY ++ +D+++K + V AL +W     + G   W +T FSL T+ N+L +GVP+++
Sbjct  64    PFSMNYKYMGADIMSKFICVAALGLWCKCSSRTGSYGWFVTCFSLCTMTNSLFIGVPILE  123

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT--RLGQISAAADNARP--EMGTDLE  688
             AMYGR G +LVLQA+ +Q +++ T+ L  LEF ++   L +      N  P      DLE
Sbjct  124   AMYGRTGVNLVLQASVVQVIIYSTVFLILLEFWKSFVSLNKTIPEDSNIAPVGAAEEDLE  183

Query  687   GNPKeaaaagetpaapTNIGPS-YTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
             G+     +           GPS +  +M++  L+L KNPN YAC LGLIWA ++K WH  
Sbjct  184   GHRTTEVSESS--------GPSSFWPLMRNALLKLVKNPNIYACVLGLIWAFLSKRWHIG  235

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             MP I++ S+ IM++ G+  AMFS G FMA+Q ++++CG TLT +G+++RF+  P T  + 
Sbjct  236   MPKIVEGSVQIMSRAGTSTAMFSLGFFMAMQGKVMACGATLTAFGMIIRFIATPVTMGVV  295

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             A+ + L G+VL+I I+Q+ALPQ++ +F+F KEYGLH +V+STA+I+G I+ LP+++ YY 
Sbjct  296   ALAIGLRGNVLRIAIIQAALPQSLASFVFVKEYGLHTEVISTAVILGIIICLPLLVAYYA  355

Query  150   IL  145
             IL
Sbjct  356   IL  357



>ref|XP_009402744.1| PREDICTED: probable auxin efflux carrier component 4 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 243/369 (66%), Gaps = 24/369 (7%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+ KV+ AM PLYVA+ LGYGS+RWWH+F  + C+AINR   +F +PFFTF F + ++P+
Sbjct  6     DVLKVIEAMTPLYVALGLGYGSVRWWHVFTREQCEAINRLVVYFAIPFFTFDFTSHINPF  65

Query  1026  TMNY--LFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             TMNY  +   +      + V+A   W +        W+IT FSLS L+N LVVG PL+ A
Sbjct  66    TMNYRVIAADAISKLLTVAVLAAWTWCSSSDKSSYSWAITIFSLSQLSNILVVGAPLLDA  125

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD----------NARPEM  703
             MYGR   D+++Q + +Q + W+ +LLF LE R+ R     A A              P+ 
Sbjct  126   MYGRWAQDIIVQLSVVQLIAWMALLLFALEMRKARGAASFAPATVVAGAGGQMVAPEPQQ  185

Query  702   GTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKG  523
               D+E N   AA             P+  ++MK+V L+L  NPN YA  LG+IWA+I   
Sbjct  186   AMDVERNADVAAR------------PTLGSLMKTVWLKLVINPNIYASVLGVIWALIANR  233

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
             WHF MP II+ S+++M+K G+G++MFS GLFMALQD+I++CG  L+ +G+VL+F+ GPA 
Sbjct  234   WHFEMPRIIEGSVLVMSKTGTGMSMFSMGLFMALQDKIVACGPKLSAFGMVLKFIAGPAA  293

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMI  163
             +AI A+ + L GD+L++ I+Q+ALPQ++++FIFA+EYGLH  VLSTA+I GT++SLPV+I
Sbjct  294   TAISAVSVGLRGDLLRVAIIQAALPQSISSFIFAREYGLHPGVLSTAVIFGTLVSLPVLI  353

Query  162   GYYVILELL  136
              YY +L LL
Sbjct  354   AYYEVLGLL  362



>ref|XP_003534521.1| PREDICTED: putative auxin efflux carrier component 8-like [Glycine 
max]
Length=377

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 253/374 (68%), Gaps = 14/374 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW ++YKVVVA+ PLY A++LGYGS++WW++F  + C+AIN+  C+F LP F F F A +
Sbjct  3     GWEEVYKVVVAVVPLYFALLLGYGSLKWWNIFTREQCEAINKLVCYFTLPLFIFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+D ++K +++V L +WA     G   WSIT+FSL  L N LVVGVP+++
Sbjct  63    DPFKMNYSFIAADTISKFIIMVVLALWAKCTPKGTFSWSITSFSLCNLTNALVVGVPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT-RLGQISAAADNARPEMGTDLEGNP  679
              MYG LG DLV+QA+ +QA +W  +LLF LEF RT   G         +P   T +  N 
Sbjct  123   PMYGALGVDLVVQASVIQATIWFPLLLFVLEFWRTGSEGTTITTTTTLKPRPKTMIIDNE  182

Query  678   KeaaaagetpaapTNIGPS-------------YTAMMKSVCLRLAKNPNTYACFLGLIWA  538
                    E      ++                +  +MK V  +LA NPN++ C +G+ WA
Sbjct  183   SGGGKDVEATTVAIDVKEEMMLEESVTSSRLPFCKVMKLVWRKLATNPNSFGCVIGISWA  242

Query  537   IITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFL  358
              I+  W+  MPS+++ SI IM+K G+G AMFS G FMALQ+++I+CG ++T+ GLVL+F+
Sbjct  243   FISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGTFMALQEKVIACGPSMTIIGLVLKFI  302

Query  357   IGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILS  178
              GPA +AIGAI++ L GDVL++VI+Q+A+PQ++T+FIFAKEYGLH +VLSTA+I G I+S
Sbjct  303   AGPAATAIGAIVVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLSTAVIFGMIVS  362

Query  177   LPVMIGYYVILELL  136
             LPV++ YY ILE +
Sbjct  363   LPVLVAYYAILEFV  376



>dbj|BAJ91285.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 187/380 (49%), Positives = 261/380 (69%), Gaps = 20/380 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A APLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFV-KNGG----LDWSIttfslstlnntLVVG  871
             DP+ +NY  VA+DV++KA++V  + +WA F+ +NGG      WSIT FSLSTL N+LVVG
Sbjct  63    DPFQVNYRAVAADVISKAVIVAVIAVWARFLGRNGGGKGAAGWSITGFSLSTLTNSLVVG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT------RLGQISAAADNARP  709
             VP+ +AMYG     LV+Q +  QA++WLT+LLF LE R+        +G+ S   D   P
Sbjct  123   VPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIGMYVNVGKTSVVHDAPLP  182

Query  708   E--MGTDLEGNPKeaaaage-----tpaapTNIG--PSYTAMMKSVCLRLAKNPNTYACF  556
             E  +  D+E      A A             ++G  PS   ++K+V  +LA+NPNTYA F
Sbjct  183   ESPVKADVEAAAGNGAVAVLVVGGGAQEVAVSVGGKPSVWRLVKTVAHKLARNPNTYASF  242

Query  555   LGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYG  376
             +G+ WA +    H  +PS++++S++IM+K G+G+AMFS GLFMA Q+RI++CG +    G
Sbjct  243   VGITWACVANRLHIELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQERILACGPSYAALG  302

Query  375   LVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAII  196
             L L+F +GP   AIG+I + L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I
Sbjct  303   LALKFGLGPVAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVI  362

Query  195   IGTILSLPVMIGYYVILELL  136
              G ++SLP+++G Y++LEL+
Sbjct  363   FGMLVSLPLLVGLYIVLELI  382



>ref|XP_010927702.1| PREDICTED: putative auxin efflux carrier component 8 [Elaeis 
guineensis]
Length=351

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 246/360 (68%), Gaps = 12/360 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIY VV AM PLYVA+ LGYGS+RWW +F P+ C+AINR   +F  PFFT  F    
Sbjct  3     GWADIYNVVAAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRMVAYFSFPFFTLEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY MNY  + +D ++K ++V+ L  WA     G   WSIT++SL TL N+LVVG PL+ 
Sbjct  63    DPYAMNYRVIGADAISKLIIVLVLAAWAKCSSKGSYCWSITSYSLCTLTNSLVVGAPLLN  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG+   DLV+Q + +QA++WLT+LLF LE R+ R+ +   AA      + +D +G+  
Sbjct  123   GMYGQWAQDLVVQLSVVQAIVWLTLLLFVLELRKARIQEAMVAA------ISSDHDGSGG  176

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
              A              P++ ++MK V L+LA NPN+YA  +G+ WA +   WH  MPSI+
Sbjct  177   GARIVSVVHR------PAFWSLMKIVWLKLAVNPNSYASIVGITWAFVANRWHLEMPSIM  230

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM++ G+G+AMFS GLFMA Q++II+CG  LT +G+ LRF  GPA  AIGAI + 
Sbjct  231   EGSVLIMSRAGTGLAMFSMGLFMATQEKIIACGPRLTAFGMALRFAAGPAAMAIGAIAVG  290

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             L GD+L++ I+Q+A+PQ++T+FIFA+EYGLHA+VLSTA+I G ++SLP+++ YY  L  +
Sbjct  291   LRGDLLRVAIIQAAIPQSITSFIFAREYGLHAEVLSTAVIFGMLVSLPLLVAYYFALSFM  350



>gb|AIF28455.1| PIN-like protein, partial [Lepidosperma gibsonii]
Length=363

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 242/359 (67%), Gaps = 4/359 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWG IYKVV AM PLY+A+ LGYGS+RWW +F P+ CD INR   +F  PFF F F    
Sbjct  3     GWGGIYKVVEAMVPLYMALGLGYGSVRWWRIFTPEECDTINRLVAYFAFPFFAFQFTLHC  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+TMNY   A      +  +++L +WA     G   WSIT+FSLSTL N+LVVGVPL+ 
Sbjct  63    DPFTMNY--RAIAADMISXTILSLAVWAKCSSKGSYCWSITSFSLSTLTNSLVVGVPLLG  120

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRR--TRLGQISAAADNARPEMGTDLEGN  682
             AMYG     LV+Q +  QA+ WLT+LLF LE R+    + +++  A+    E   +    
Sbjct  121   AMYGPWAAQLVVQLSVFQAISWLTLLLFVLEVRKAGNNMIEVTKVANGNTNEHKEETATK  180

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
               EA    +      +   S+ ++MK   L+LA NPN+YA  +G+ WA++    HF +PS
Sbjct  181   DPEAGNGTDVVVVVASSRRSFCSLMKVAGLKLAINPNSYASIVGITWALVANRLHFELPS  240

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             I+D  + IMAK G+G+AMFS GLFMA Q++II+CG  LT +G+ LRF+ GPA  AIG+I 
Sbjct  241   ILDGCVQIMAKAGTGMAMFSMGLFMATQEKIIACGPGLTAFGMALRFIAGPAAMAIGSIA  300

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             + LHGDVL++ I+Q+A+PQ++T+F++A+EYGLHA+V+STA+I G ++SLPV+I YY++L
Sbjct  301   VGLHGDVLRVAIIQAAVPQSITSFVYAREYGLHANVISTAVIFGMLVSLPVLILYYILL  359



>dbj|BAJ96544.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 261/380 (69%), Gaps = 20/380 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A APLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFV-KNGG----LDWSIttfslstlnntLVVG  871
             DP+ +NY  VA+DV++KA++V  + +WA F+ +NGG      WSIT FSLSTL N+LVVG
Sbjct  63    DPFQVNYRAVAADVISKAVIVAVIAVWARFLGRNGGGKGAAGWSITGFSLSTLTNSLVVG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT------RLGQISAAADNARP  709
             VP+ +AMYG     LV+Q +  QA++WLT+LLF LE R+        +G+ S   D   P
Sbjct  123   VPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIGMYVNVGKTSVVHDAPLP  182

Query  708   E--MGTDLEGNPKeaaaage-----tpaapTNIG--PSYTAMMKSVCLRLAKNPNTYACF  556
             E  +  D+E      A A             ++G  PS   ++K++  +LA+NPNTYA F
Sbjct  183   ESPVKADVEAAAGNGAVAVLVVGGGAQEVAVSVGGKPSVWRLVKTLAHKLARNPNTYASF  242

Query  555   LGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYG  376
             +G+ WA +    H  +PS++++S++IM+K G+G+AMFS GLFMA Q+RI++CG +    G
Sbjct  243   VGITWACVANRLHIELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQERILACGPSYAALG  302

Query  375   LVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAII  196
             L L+F +GP   AIG+I + L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I
Sbjct  303   LALKFGLGPVAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVI  362

Query  195   IGTILSLPVMIGYYVILELL  136
              G ++SLP+++G Y++LEL+
Sbjct  363   FGMLVSLPLLVGLYIVLELI  382



>ref|XP_009402745.1| PREDICTED: probable auxin efflux carrier component 4 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 244/369 (66%), Gaps = 24/369 (7%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+ KV+ AM PLYVA+ LGYGS+RWWH+F  + C+AINR   +F +PFFTF F + +DP+
Sbjct  6     DVIKVIEAMTPLYVAVGLGYGSVRWWHVFTREQCEAINRLVVYFTIPFFTFEFTSHIDPF  65

Query  1026  TMNY--LFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             TMNY  +   +      + V+A   W +        W+IT FSLS L NTL+VG PL+ A
Sbjct  66    TMNYRVIAADAISKLLTVGVLAAWTWCSSSSKSSYSWAITIFSLSQLTNTLLVGAPLLDA  125

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR------LGQISAAADNA----RPEM  703
             MYGR   D+V+Q + +Q + W+ +LLF LE R+           I A A        P+ 
Sbjct  126   MYGRWAQDIVVQLSVVQGIAWMALLLFALEMRKASGAAGFAPAAIVAGAGGQVVAPEPQQ  185

Query  702   GTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKG  523
              TD+E N   AA             P+  ++MK+V L+LA NPN YA  LG+IWA+I   
Sbjct  186   ATDVECNTDVAAR------------PTLGSLMKTVWLKLALNPNIYASVLGVIWALIANR  233

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
             WHF MP I++ S+++M+K G+G++MFS GLFMALQD+I++CG  L+ +G++L+F+ GPA 
Sbjct  234   WHFEMPRIMEGSVLVMSKAGTGMSMFSMGLFMALQDKIVACGQKLSAFGMLLKFIAGPAV  293

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMI  163
             + I A+ + L GD+L++ I+Q+ALPQ++++FIFA+EYGLH DVLSTA+I GT++SL V+I
Sbjct  294   TTICAVAVGLRGDLLRVAIIQAALPQSISSFIFAREYGLHPDVLSTAVIFGTLVSLSVLI  353

Query  162   GYYVILELL  136
              YY +L LL
Sbjct  354   AYYEVLGLL  362



>ref|XP_009781685.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
sylvestris]
Length=347

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 169/364 (46%), Positives = 247/364 (68%), Gaps = 26/364 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW DIYKVV AMAPLYVA+ LGYGS++WWH F  +HCDAINR N FF+LPFFTF FI+QV
Sbjct  3     GWADIYKVVEAMAPLYVALGLGYGSVKWWHKFSAEHCDAINRLNYFFVLPFFTFDFISQV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY M+YLF+  D++AKA++   L +WANF + G   WSIT+FS  +L N LV+G+P++ 
Sbjct  63    NPYKMSYLFICGDLIAKAIIGFVLTLWANFYRKGNFSWSITSFSFCSLTNALVIGIPVLH  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEM-----GTDL  691
             AM  ++G DLV+Q+ A+Q L+W  ++ F +E R            NA+ EM       DL
Sbjct  123   AMSPQVGVDLVIQSLAIQFLIWSIIIQFMMELR------------NAKNEMTFDNTNQDL  170

Query  690   EGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
             EGN   + A                ++MK V  +L+KNPN YACFLG++W+++    ++ 
Sbjct  171   EGNNTTSTATKTPTLG---------SVMKVVWTKLSKNPNFYACFLGIMWSLVANSTNYN  221

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
               S   + I IM+K GSGI MF+ G+F+A+Q++I++ G  + ++GL+LRF++GPAT  +G
Sbjct  222   YISHSKECISIMSKAGSGIGMFTIGVFVAMQEKIMAGGTRVVMFGLLLRFVVGPATMTVG  281

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             + ++ LHG+VL+  I+Q+ALP  + +F+ AKEYG+H +++S  +IIG ++SL +MI YY 
Sbjct  282   SFVVGLHGNVLRAAILQAALPPRIASFVLAKEYGVHPEIVSAVVIIGILVSLSIMIAYYA  341

Query  150   ILEL  139
             I EL
Sbjct  342   ISEL  345



>ref|XP_010038261.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
 gb|KCW84564.1| hypothetical protein EUGRSUZ_B01403 [Eucalyptus grandis]
Length=365

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 247/360 (69%), Gaps = 2/360 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVV+M PLY+A++LGYGS++WW +F  + CD INRF   FILP F F F A +
Sbjct  3     GWDDVYKVVVSMFPLYMALMLGYGSVKWWRLFTHEQCDGINRFIVLFILPLFGFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN+  +A+D ++K   +  L +W  F      +WSITTFSL TL N LVVGVP+M+
Sbjct  63    NPYAMNFRLLAADALSKLATLAILGLWGRFSSRASYNWSITTFSLCTLTNLLVVGVPVMR  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMG--TDLEGN  682
             AMYG+ G D+V+Q   +Q+L+W+ +LL  LEFR TR+   + ++    PE     D E +
Sbjct  123   AMYGQWGVDMVVQLCMVQSLVWIPLLLLLLEFRNTRMMDSTTSSSPPPPENNGVVDEERD  182

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
              + +           +   SY +  K V +++A NPN YA  LGL WA++   + FTMPS
Sbjct  183   VEMSVVITMEGGGDHHEKRSYWSFAKVVWMKMAMNPNVYANVLGLAWALMASRFKFTMPS  242

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             I++ S+ IM+K G+G AMF+ G+F+A+Q ++I+CG   TV GLV RF++GPA +A+ ++ 
Sbjct  243   IMEGSVEIMSKAGTGTAMFNIGIFIAMQTKVIACGTGPTVLGLVSRFVVGPAITALCSLA  302

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + LHG  L I I+Q+ALPQA+ +F+FA EYGLHA+VLSTA++ GT++SLP++IGYY+ LE
Sbjct  303   VGLHGPTLHIAIIQAALPQAIASFVFANEYGLHANVLSTAVVFGTVISLPLLIGYYIGLE  362



>ref|XP_004971070.1| PREDICTED: probable auxin efflux carrier component 6-like [Setaria 
italica]
Length=364

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 181/364 (50%), Positives = 250/364 (69%), Gaps = 7/364 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A  PLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLD----WSIttfslstlnntLVVGV  868
             DP+ +NY  VA+DV++KA++V  + +WA F    G      WSIT+FSLSTL N+LVVGV
Sbjct  63    DPFQVNYRAVAADVISKAVIVAVIAVWARFAAAKGAGSAAGWSITSFSLSTLTNSLVVGV  122

Query  867   PLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLE  688
             PL +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G   AA     P    +  
Sbjct  123   PLARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIGMYVAAEP---PVKDVEAA  179

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
                   AAA        +  PS  A++K V  +L++NPNTYA F+G+ WA +    H  +
Sbjct  180   SADAAPAAAAVVVVPVASGKPSLWALVKVVAHKLSRNPNTYASFVGITWACVANRLHLEL  239

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             PS  + S++IM+K G+G+AMFS GLFMA Q+++++CG      GLVL+F +GPA  AIG+
Sbjct  240   PSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGPCFAALGLVLKFALGPAAMAIGS  299

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I + L GDVL++ I+Q+A+PQ++T+FIFAKEYGLHADVLSTA+I G ++SLP+++G+Y++
Sbjct  300   IAVGLRGDVLRVAIIQAAVPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPLLVGFYIV  359

Query  147   LELL  136
             LEL+
Sbjct  360   LELI  363



>gb|KHN29283.1| Putative auxin efflux carrier component 8 [Glycine soja]
Length=376

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 174/373 (47%), Positives = 252/373 (68%), Gaps = 13/373 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW ++YKVVVA+ PLY A++LGYGS++WW++F  + C+AIN+  C+F LP F F F A +
Sbjct  3     GWEEVYKVVVAVVPLYFALLLGYGSLKWWNIFTREQCEAINKLVCYFTLPLFIFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MN+ F+A+D ++K +++V L +WA     G   WSIT+FSL  L N LVVGVP+++
Sbjct  63    DPFKMNFSFIAADTISKFIIMVVLALWAKCTPKGTFSWSITSFSLCNLTNALVVGVPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG LG DLV+QA+ +QA +W  +LLF LEF RT     +      +P   T +  N  
Sbjct  123   PMYGALGVDLVVQASVIQATIWFPLLLFVLEFWRTGSEGTTITTTTLKPRPKTMIIDNES  182

Query  675   eaaaagetpaapTNIGPS-------------YTAMMKSVCLRLAKNPNTYACFLGLIWAI  535
                   E      ++                +  +MK V  +LA NPN++ C +G+ WA 
Sbjct  183   GGGKDVEATTVAIDVKEEMMLEESVTSSRLPFCKVMKLVWRKLATNPNSFGCVIGISWAF  242

Query  534   ITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLI  355
             I+  W+  MPS+++ SI IM+K G+G AMFS G FMALQ+++I+CG ++T+ GLVL+F+ 
Sbjct  243   ISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGTFMALQEKVIACGPSMTIIGLVLKFIA  302

Query  354   GPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSL  175
             GPA +AIGAI++ L  DVL++VI+Q+A+PQ++T+FIFAKEYGLH +VLSTA+I G I+SL
Sbjct  303   GPAATAIGAIVVGLRDDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLSTAVIFGMIVSL  362

Query  174   PVMIGYYVILELL  136
             PV++ YY ILE +
Sbjct  363   PVLVAYYAILEFV  375



>gb|AIF28454.1| PIN-like protein, partial [Hakea drupacea]
Length=297

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 229/306 (75%), Gaps = 13/306 (4%)
 Frame = -3

Query  1044  AQVDPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVP  865
             A ++P+ MN+LF+A+D ++K ++VV L  WA     G   WSIT+FSLSTL N+LVVGVP
Sbjct  1     ANINPFKMNFLFIAADAISKVVIVVVLAFWAKCSSKGSYCWSITSFSLSTLTNSLVVGVP  60

Query  864   LMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADN---ARPEMGTD  694
             L++AMYG++  DLV+Q++ +Q ++WLT LLF LEFR+TR   IS  A++   ++ E   D
Sbjct  61    LLKAMYGQMAVDLVVQSSVIQGIVWLTFLLFVLEFRKTRSDTISMIAESHAVSQLESVKD  120

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHF  514
             +EGN +  A +           PS+ ++MK V L+LA NPN+YACF+G+ WA +   W  
Sbjct  121   VEGNEQMVAISK----------PSFRSLMKMVGLKLALNPNSYACFIGMAWAFVASRWKL  170

Query  513   TMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAI  334
              MPSII+ SI+IM++ G G+AMFS GLFMALQ++ I+CG +LTV+GLVLRF+ GPA  AI
Sbjct  171   EMPSIIEGSILIMSRAGIGMAMFSMGLFMALQEKFIACGPSLTVFGLVLRFVAGPAAMAI  230

Query  333   GAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYY  154
             G+I + L GDVL++ I+Q+ALPQ++T+FI+AKEYGLHADVLSTA+I+G ILSLP+++GYY
Sbjct  231   GSIAVGLRGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVILGMILSLPILVGYY  290

Query  153   VILELL  136
              ILE +
Sbjct  291   AILEFM  296



>ref|XP_010045960.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
Length=363

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 236/358 (66%), Gaps = 0/358 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVVV+M PLYV ++LGY S++WW +F  D CD INRF   FILP F F F A +
Sbjct  3     GWGDMYKVVVSMFPLYVPLMLGYSSVKWWRLFSHDQCDGINRFISLFILPLFGFGFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +P+ MN+  +A+D ++K   +  L +W  F   G   W ITTFSL TL N LVVGVP++Q
Sbjct  63    NPFAMNFRLLAADGLSKLATLSILALWGRFSSRGSYSWCITTFSLCTLPNLLVVGVPMLQ  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+   DL +Q   +Q+L+W  ++L  LEFR+ R+  ++        E G   E    
Sbjct  123   AMYGKWAVDLAVQLCMLQSLIWYPLVLLFLEFRKRRMMDLATPPPPPLEENGVVDEERDI  182

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
               +    +     ++        + V +++A NPN YA  LGL WA++     FTMPSI+
Sbjct  183   GMSVVNTSEVGGDDLEKRSRGTFQMVWIKMAMNPNVYANVLGLAWALMASRLKFTMPSIM  242

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI IM+KGG+G AMF+ G+FMA+Q ++I+CG    V G+V RF +GPAT A+ ++ L 
Sbjct  243   EGSIEIMSKGGTGTAMFNIGIFMAMQTKVIACGTGPAVLGMVSRFALGPATMALCSLALG  302

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             LHG  L++ I+Q+ALPQA+ +F+FA +YGLHA V+STA++ GT++SLP++IGYYV+LE
Sbjct  303   LHGPSLRVAIIQAALPQAIASFVFANDYGLHAKVISTAVVFGTLISLPLLIGYYVVLE  360



>ref|NP_001276305.1| uncharacterized protein LOC100784879 [Glycine max]
 gb|AGJ95067.1| PIN9b [Glycine max]
Length=369

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 250/369 (68%), Gaps = 12/369 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVA+ PLY A++LGYGS++WW++F  + C+AIN+  C+F LP F F F A +
Sbjct  3     GWEDVYKVVVAVVPLYFALLLGYGSLKWWNIFTKEQCEAINKLVCYFTLPLFIFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MN+ F+A+D ++K +++V L +WA         WSI +FSL  L N +VVGVP+++
Sbjct  63    DPFKMNFSFIAADTISKFIIMVVLALWAKCTPKCTFCWSIISFSLCNLTNAVVVGVPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEM---------  703
              MYG LG DLV+Q++ +QA +WL +LLF +EF RT +   +      R +          
Sbjct  123   PMYGALGVDLVVQSSVLQATIWLPLLLFVMEFWRTGIEGTTTTTVKPRSKTMINKNEGGG  182

Query  702   GTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKG  523
             G D+E                      +  +MK V  +LA NPN+Y C +G+ WA I+  
Sbjct  183   GKDVEA---VDVKEELMLEESVTSRLPFCKVMKLVWRKLATNPNSYGCVIGISWAFISNR  239

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
             W+  MPS+++ SI IM+K G+G AMFS G+FMALQ+++I+CG ++T+ GLVL+F+ GPA 
Sbjct  240   WNLEMPSMLEGSIQIMSKAGTGTAMFSMGIFMALQEKLIACGPSMTLIGLVLKFIAGPAA  299

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMI  163
             +AIGAI + L GDVL++VI+Q+A+PQ++T+FIFAKEYGLH +VLST +I G I+SLPV++
Sbjct  300   TAIGAIAVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLSTGVIFGMIVSLPVLV  359

Query  162   GYYVILELL  136
              YY ILE +
Sbjct  360   AYYAILEFV  368



>ref|XP_010068801.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
 gb|KCW65010.1| hypothetical protein EUGRSUZ_G02549 [Eucalyptus grandis]
Length=360

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 240/364 (66%), Gaps = 15/364 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVV+M PLYVA++LGYGS++WW +F  + CD INRF   FILP F F F A +
Sbjct  3     GWDDVYKVVVSMFPLYVALMLGYGSVKWWRLFTHEQCDGINRFVALFILPLFGFEFTAHM  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN+  +A+D ++K   +  L +W  F      +WSITTFSL TL N LVVGVP+MQ
Sbjct  63    NPYAMNFRLLAADALSKLATLAILGLWGRFSSRASYNWSITTFSLCTLTNLLVVGVPVMQ  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL------GQISAAADNARPEMGTD  694
             AMY + G DLV+Q   +Q+L+W+ +LL  LEFR TR+             +N   +   D
Sbjct  123   AMYDQWGVDLVVQLCMVQSLVWIPLLLLLLEFRNTRMMDSTTSSSPPPPVNNGMVDEERD  182

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHF  514
             +E                   G SY ++ + V +++A NPN YA  LGL WA++     F
Sbjct  183   VE---------MSLVITREGGGESYWSLARVVWMKMAMNPNVYANVLGLTWALMASRLKF  233

Query  513   TMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAI  334
             TMPSI++ S+ IM+K G G +MF+ G+F+ALQ R+I+CG   TV GLV RF++GPA +A+
Sbjct  234   TMPSIMEGSVEIMSKAGKGTSMFNIGIFIALQTRVIACGTGPTVLGLVSRFVVGPAITAL  293

Query  333   GAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYY  154
              ++ + LHG  L I I+Q+A+ QA+ +F+FA EYGLHA+VLSTA++ GT++SLP++IGYY
Sbjct  294   CSLAVGLHGPALHIAIIQAAISQAIASFVFANEYGLHANVLSTAVVFGTVISLPLLIGYY  353

Query  153   VILE  142
             + LE
Sbjct  354   IGLE  357



>ref|NP_001148155.1| auxin efflux carrier component 6 [Zea mays]
 gb|ACG29945.1| auxin efflux carrier component 6 [Zea mays]
Length=382

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 255/379 (67%), Gaps = 19/379 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A  PLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF------VKNGGLDWSIttfslstlnntLVV  874
             DP+ +NY  VA+DV++KA++V  +  WA           G + WSIT FSLSTL N+LVV
Sbjct  63    DPFQVNYRAVAADVISKAVIVGVIGCWAGSRVSSAGKGKGAVGWSITGFSLSTLTNSLVV  122

Query  873   GVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQI-----SAAADNARP  709
             GVP+ +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G       +A +D+  P
Sbjct  123   GVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLETRKAAIGMYVVPGGAADSDDGVP  182

Query  708   E---MGTDLEG-----NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFL  553
             +      D+E       P    AA  T      + PS  A++K V  +L++NPNTYA F+
Sbjct  183   DSPVKDKDVEAAAGDRRPAAGPAAAATVVVVVPVKPSLWALVKVVAHKLSRNPNTYASFV  242

Query  552   GLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGL  373
             G+ WA +    H  +PS  + S++IM+K G+G+AMFS GLFMA Q+++++CG +    GL
Sbjct  243   GITWACVANRLHIELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGPSFAALGL  302

Query  372   VLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIII  193
             VL+F +GPA  AIG+I + L GDVL++ I Q+ALPQ++T+FIFAKEYGLHADVLSTA+I 
Sbjct  303   VLKFALGPAAMAIGSIAVCLRGDVLRVAITQAALPQSITSFIFAKEYGLHADVLSTAVIF  362

Query  192   GTILSLPVMIGYYVILELL  136
             G ++SLP+++G+Y++LEL+
Sbjct  363   GMLVSLPLLVGFYIVLELI  381



>gb|AFK32343.1| putative auxin efflux carrier PIN5a [Zea mays]
 tpg|DAA56125.1| TPA: auxin efflux carrier component 6 [Zea mays]
Length=382

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 184/379 (49%), Positives = 254/379 (67%), Gaps = 19/379 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A  PLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF------VKNGGLDWSIttfslstlnntLVV  874
             DP+ +NY  VA+DV++KA++V  +  WA           G + WSIT FSLSTL N+LVV
Sbjct  63    DPFQVNYRAVAADVISKAVIVGVIGCWAGSRVGSAGKGKGAVGWSITGFSLSTLTNSLVV  122

Query  873   GVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQI---SAAADNA----  715
             GVP+ +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G       AAD+     
Sbjct  123   GVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLETRKAAIGMYVVPGGAADSDGGVP  182

Query  714   -RPEMGTDLEG-----NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFL  553
               P    D+E       P    AA  T      + PS  A++K V  +L++NPNTYA F+
Sbjct  183   DSPVKDKDVEAAAGDRRPAAGPAAAATVVVVVPVKPSLWALIKVVAHKLSRNPNTYASFV  242

Query  552   GLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGL  373
             G+ WA +    H  +PS  + S++IM+K G+G+AMFS GLFMA Q+++++CG +    GL
Sbjct  243   GITWACVANRLHIELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGPSFAALGL  302

Query  372   VLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIII  193
             VL+F +GPA  AIG+I + L GDVL++ I+Q+ALPQ++T+FIFAKEYGLHADVLSTA+I 
Sbjct  303   VLKFALGPAAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIF  362

Query  192   GTILSLPVMIGYYVILELL  136
             G ++SLP+++G+Y++LEL+
Sbjct  363   GMLVSLPLLVGFYIVLELI  381



>emb|CDX78697.1| BnaA03g06090D [Brassica napus]
Length=394

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 250/404 (62%), Gaps = 61/404 (15%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+I GYGS++WW++F  D CDAIN+   +F LP FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALISGYGSVKWWNIFTRDQCDAINQLVYYFTLPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K +++  L  WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKIIIIAVLAFWAKYSSKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG+   DLV+Q++  Q ++WLT+LLF LE RR      +   D        ++EG  KE 
Sbjct  125   YGQEAVDLVVQSSVFQGIVWLTLLLFVLELRRAGFSSNNNVDD-------INIEGGRKET  177

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E          S+  +M  V L+LA NPN Y+C LG+ WA I+  WHF MP II+ 
Sbjct  178   VVVREE--------KSFLEVMSVVWLKLATNPNCYSCILGIAWAFISNRWHFEMPGIIEG  229

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI+IM+K G+G AMF+ G+FMALQD++I CG +LT  G+VL+F+ GPA  AIG+I + LH
Sbjct  230   SILIMSKAGTGTAMFNMGIFMALQDKLIVCGTSLTAIGMVLKFIAGPAAMAIGSIAVGLH  289

Query  309   GDVLKIVIVQ----------------------------------------------SALP  268
             G+VL++ I+Q                                              +ALP
Sbjct  290   GNVLRVAIIQVIIHFLYFCSGLSDQTNLMLFHFFCHHLFHFSEDTKLNSFEFSDKLAALP  349

Query  267   QAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
             Q++T+FIFAKEYGLHADVLSTA+I G ++SLPV++ YY  LE +
Sbjct  350   QSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFI  393



>gb|KHN40463.1| Putative auxin efflux carrier component 8 [Glycine soja]
Length=381

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 251/381 (66%), Gaps = 24/381 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVA+ PLY A++LGYGS++WW++F  + C+AIN+  C+F LP F F F A +
Sbjct  3     GWEDVYKVVVAVVPLYFALLLGYGSLKWWNIFTKEQCEAINKLVCYFTLPLFIFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MN+ F+A+D ++K +++V L +WA         WSI +FSL  L N +VVGVP+++
Sbjct  63    DPFKMNFSFIAADTISKFIIMVVLALWAKCTPKCTFCWSIISFSLCNLTNAVVVGVPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEM---------  703
              MYG LG DLV+Q++ +QA +WL +LLF +EF RT +   +      R +          
Sbjct  123   PMYGALGVDLVVQSSVLQATIWLPLLLFVMEFWRTGIEGTTTTTVKPRSKTMINKNEGGG  182

Query  702   GTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAII---  532
             G D+E                      +  +MK V  +LA NPN+Y C +G+   ++   
Sbjct  183   GKDVEA---VDVKEELMLEESVTSRLPFCKVMKLVWRKLATNPNSYGCVIGIYPTVLSDH  239

Query  531   ---------TKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVY  379
                      T+ W+  MPS+++ SI IM+K G+G AMFS G+FMALQ+++I+CG ++T+ 
Sbjct  240   MLPLESRHNTRMWNLEMPSMLEGSIQIMSKAGTGTAMFSMGIFMALQEKLIACGPSMTLI  299

Query  378   GLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAI  199
             GLVL+F+ GPA +AIGAI + L GDVL++VI+Q+A+PQ++T+FIFAKEYGLH +VLSTA+
Sbjct  300   GLVLKFIAGPAATAIGAIAVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLSTAV  359

Query  198   IIGTILSLPVMIGYYVILELL  136
             I G I+SLPV++ YY ILE +
Sbjct  360   IFGMIVSLPVLVAYYAILEFV  380



>ref|XP_006659591.1| PREDICTED: probable auxin efflux carrier component 4-like [Oryza 
brachyantha]
Length=353

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 238/359 (66%), Gaps = 13/359 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              WGDIYKVV AMAPLY A+ LGYGS+RWW  F P+ C AIN    +F +PFFTF F+ + 
Sbjct  3     AWGDIYKVVAAMAPLYFALGLGYGSVRWWRFFSPEQCAAINTMVVYFSMPFFTFDFVVRT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWAN-FVKNGGLDWSIttfslstlnntLVVGVPLM  859
             DP++MNY  +A+D V+K + ++A+  WA    K G   WSIT FSL+ LNNTLVVGVPL+
Sbjct  63    DPFSMNYRVIAADAVSKVITILAMAAWARCCAKAGAQSWSITGFSLAALNNTLVVGVPLL  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMG-TDLEGN  682
              AMYG+   DLV+Q A +Q+++W  +LL   E R+  +   +A +  A  ++    L+G+
Sbjct  123   NAMYGKWAQDLVVQIAVVQSMVWFPLLLMAFELRKAWVAGAAAPSTAADGDVDHVHLDGS  182

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                                 +    + V L+LA+NPN YA  LG++WA I   W+ ++P 
Sbjct  183   DGGRGXRL-----------RFWPTARGVGLKLARNPNVYASVLGVVWACIAYRWNLSLPG  231

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             I+  S+ +M+K G+G++MFS GLFMA Q R+I+CG  LT  GL LRF+ GP  + +GA  
Sbjct  232   IVTGSLQVMSKTGTGMSMFSMGLFMAQQKRMIACGAGLTALGLALRFVAGPIATLVGAAA  291

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             L L GDVL +  +Q+ALPQ++ +F+FAKEYGLHADVLSTA+I GT++SLP++I YYV+L
Sbjct  292   LGLRGDVLHLACMQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLISLPILIAYYVVL  350



>ref|XP_010070144.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
Length=358

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 168/365 (46%), Positives = 236/365 (65%), Gaps = 14/365 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpff-tfhFIAQ  1039
             G+ DIYKV+ AM PLYVA+ LGYGS+RWW MF  + CD INR  C+FILP F      A 
Sbjct  3     GFEDIYKVIAAMVPLYVALTLGYGSVRWWRMFTSEQCDGINRMVCYFILPLFGFEFTAAH  62

Query  1038  VDPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLM  859
              + + MNY  +A+D ++K + V+ L + A         W ITTFSL TL N L+VGVPL+
Sbjct  63    ANLFEMNYSVMAADAISKLLAVLILALCARCCSKMDYSWCITTFSLLTLTNVLIVGVPLL  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG----QISAAADNARPEMGTDL  691
             +AMYG++G D+V+Q + MQA+LW  +LL  LEFR+  +       SA  D+  P    D+
Sbjct  123   RAMYGQVGVDIVVQLSVMQAVLWFPLLLCFLEFRKMGMDYSPTTTSATTDDLVPG-EKDV  181

Query  690   EGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
             EG  +             +  P     +K V  +LA NPN YAC +G+ WA+I   +   
Sbjct  182   EGTAEAVRTN--------STRPRLWTAVKIVAPKLALNPNIYACIIGVAWAVIAHRFKVK  233

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             MP I+ +SI I+++ G G AMF+ G+F+A+Q ++I+CG  LT  G+VLRF+ GPA   + 
Sbjct  234   MPGIVKESIEILSRAGLGTAMFNIGIFIAMQRKVIACGVKLTFVGMVLRFIAGPALMTVS  293

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             + ++ L GDVL++ I+Q+ALPQ++TTFIFAKEYGLHA VLSTA++ GT+ SLP++I YY 
Sbjct  294   SFIMGLRGDVLRMAIMQAALPQSITTFIFAKEYGLHASVLSTAVVFGTLASLPLLIAYYA  353

Query  150   ILELL  136
              LE++
Sbjct  354   ALEVM  358



>gb|AIF28462.1| PIN-like protein, partial [Persea borbonia]
Length=295

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 160/304 (53%), Positives = 222/304 (73%), Gaps = 14/304 (5%)
 Frame = -3

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+D ++K ++V+ L  WA     G   WSIT FSLSTL NTLVVGVPL++
Sbjct  1     DPFDMNYRFIAADAISKVIIVLVLGAWAKCSSKGSYCWSITNFSLSTLTNTLVVGVPLLK  60

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR----LGQISAAADNARPEMGTDLE  688
             AMYG LG DLV+QA+ +Q ++WLT+LLF  E RRTR    +  I+  +D A      D+E
Sbjct  61    AMYGPLGQDLVVQASVVQGIIWLTILLFVFEVRRTRSDVSVPAITGDSDQAADYSNKDVE  120

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
             GN      +            S+ ++MK V L+LA NPN+YA  +G+ WA I+  WHF M
Sbjct  121   GNQTVIIPSRY----------SFWSVMKIVWLKLALNPNSYASIVGVTWAFISNRWHFAM  170

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             PSI++ S++IM+K G+G+AMFS GLFMA+Q+++I+CG +LTV+G+VLRF+ GPA  AIG+
Sbjct  171   PSIMEGSVLIMSKAGAGMAMFSMGLFMAMQEKLIACGISLTVFGMVLRFIAGPAAMAIGS  230

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I + LHGDVL+I I+Q+ALPQ++T+FI+A+EYGLHADVLSTA+I G +++LPV+IGYY++
Sbjct  231   IAMGLHGDVLRISIIQAALPQSITSFIYAREYGLHADVLSTAVIFGMLVALPVLIGYYLV  290

Query  147   LELL  136
             L  L
Sbjct  291   LGFL  294



>ref|NP_001062317.1| Os08g0529000 [Oryza sativa Japonica Group]
 sp|Q6ZIB5.1|PIN4_ORYSJ RecName: Full=Probable auxin efflux carrier component 4; AltName: 
Full=OsPIN4 [Oryza sativa Japonica Group]
 dbj|BAD09105.1| PIN1-like auxin transport protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF24231.1| Os08g0529000 [Oryza sativa Japonica Group]
 tpd|FAA00685.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
Length=370

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 242/369 (66%), Gaps = 16/369 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A+ LGYGS+RWW  F  + C AIN    +F +PFFTF F+ + 
Sbjct  3     GWGDVYKVVGAMAPLYFALGLGYGSVRWWRFFTAEQCAAINTMVVYFSMPFFTFDFVVRT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWAN------FVKNGGLDWSIttfslstlnntLVV  874
             DP+ MNY  +A+D V+KA+ + A+  WA         K G   WSIT FSL+ LNNTLVV
Sbjct  63    DPFAMNYRVIAADAVSKAIAIAAMAAWARTRCGCAAAKAGAQSWSITGFSLAALNNTLVV  122

Query  873   GVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT------RLGQISAAADNAR  712
             GVPL+ AMYGR   DLV+Q A +Q+++W  +LL   E R+            +  + ++ 
Sbjct  123   GVPLLDAMYGRWAQDLVVQIAVVQSMVWFPLLLMAFELRKAWVVGGGGGVGPAVMSSSSP  182

Query  711   PEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAII  532
             PE  +D+E N    AA G            + A  ++V L+LA+NPN YA  LG++WA I
Sbjct  183   PEKQSDVEMNGAVVAAPGGGGGVRL----PFWATARTVGLKLARNPNVYASVLGVVWACI  238

Query  531   TKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIG  352
                WH ++P I+  S+ +M++ G+G++MFS GLFM  Q+R+I+CG  LT  G+ LRF+ G
Sbjct  239   AYRWHLSLPGIVTGSLQVMSRTGTGMSMFSMGLFMGQQERVIACGAGLTALGMALRFVAG  298

Query  351   PATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLP  172
             P  + +GA  L L GDVL + I+Q+ALPQ++ +F+FAKEYGLHADVLSTA+I GT++SLP
Sbjct  299   PLATLVGAAALGLRGDVLHLAIIQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLISLP  358

Query  171   VMIGYYVIL  145
             ++I YY +L
Sbjct  359   ILIAYYAVL  367



>ref|NP_001276122.1| uncharacterized protein LOC100788225 [Glycine max]
 gb|AGJ95060.1| PIN9a [Glycine max]
Length=354

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 165/352 (47%), Positives = 236/352 (67%), Gaps = 14/352 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW ++YKVVVA+ PLY A++LGYGS++WW++F  + C+AIN+  C+F LP F F F A +
Sbjct  3     GWEEVYKVVVAVVPLYFALLLGYGSLKWWNIFTREQCEAINKLVCYFTLPLFIFEFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DP+ MNY F+A+D ++K +++V L +WA     G   WSIT+FSL  L N LVVGVP+++
Sbjct  63    DPFKMNYSFIAADTISKFIIMVVLALWAKCTPKGTFSWSITSFSLCNLTNALVVGVPMVK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT-RLGQISAAADNARPEMGTDLEGNP  679
              MYG LG DLV+QA+ +QA +W  +LLF LEF RT   G         +P   T +  N 
Sbjct  123   PMYGALGVDLVVQASVIQATIWFPLLLFVLEFWRTGSEGTTITTTTTLKPRPKTMIIDNE  182

Query  678   KeaaaagetpaapTNIGPS-------------YTAMMKSVCLRLAKNPNTYACFLGLIWA  538
                    E      ++                +  +MK V  +LA NPN++ C +G+ WA
Sbjct  183   SGGGKDVEATTVAIDVKEEMMLEESVTSSRLPFCKVMKLVWRKLATNPNSFGCVIGISWA  242

Query  537   IITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFL  358
              I+  W+  MPS+++ SI IM+K G+G AMFS G FMALQ+++I+CG ++T+ GLVL+F+
Sbjct  243   FISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGTFMALQEKVIACGPSMTIIGLVLKFI  302

Query  357   IGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTA  202
              GPA +AIGAI++ L GDVL++VI+Q+A+PQ++T+FIFAKEYGLH +VLSTA
Sbjct  303   AGPAATAIGAIVVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLSTA  354



>ref|XP_002320435.2| hypothetical protein POPTR_0014s14390g [Populus trichocarpa]
 gb|EEE98750.2| hypothetical protein POPTR_0014s14390g [Populus trichocarpa]
Length=370

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 160/366 (44%), Positives = 237/366 (65%), Gaps = 11/366 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y V+ A+ PLYV M L Y S++WW++F P+ C  INRF  +F +P  +  FI++++PY
Sbjct  6     DLYGVLCAVVPLYVTMFLAYASVKWWNIFTPEQCSGINRFVAYFAVPLLSMEFISRINPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              M+ LF+A+D V+K +++V L+ WANF + G L+W+IT FSLSTL NTLV+G+PL+++MY
Sbjct  66    KMDLLFMAADGVSKVLILVVLLCWANFSRRGSLEWAITLFSLSTLPNTLVMGIPLLKSMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQI----------SAAADNARPEMGT  697
             G     L++Q   +Q ++W T+LLF  E+R  RL  +          S         M  
Sbjct  126   GDDKEGLMIQVVVLQCIIWYTLLLFLFEYREARLAMLKNFKGSFCEQSVQVLRKEESMKR  185

Query  696   DLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWH  517
              +E    E         +  +       ++K+V L+L +NPN+YA  +GL WA+++  + 
Sbjct  186   GVESEKTEGIENNTAAISSLS-SVMLLQILKTVWLKLVRNPNSYASLIGLSWALVSCRYG  244

Query  516   FTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSA  337
                P I+D+S+ I++K G G+AMFS GLFMALQ RII+CG  + +YG++ RFL GPA  A
Sbjct  245   IMKPQIVDNSVTILSKAGLGMAMFSLGLFMALQPRIIACGNRMAIYGMLARFLAGPAVMA  304

Query  336   IGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGY  157
             + +I + L G +LK+ IVQ+ALPQ +  F+FA+EYGLH DVLSTA+I G I+SLP+ I Y
Sbjct  305   VASIGVGLRGTMLKLSIVQAALPQGIVPFVFAREYGLHPDVLSTAVIFGMIVSLPITILY  364

Query  156   YVILEL  139
             Y+ L L
Sbjct  365   YIFLGL  370



>dbj|BAB09622.1| unnamed protein product [Arabidopsis thaliana]
Length=351

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 229/365 (63%), Gaps = 47/365 (13%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+YKV+ AM PLYVA+ILGYGS++WWH+F  D CDAINR  C+F LP FT  F A VDP
Sbjct  5     GDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             + MNY F+A+DV++K ++V  L +WA +   G   WSIT+FSL TL N+LVVGVPL +AM
Sbjct  65    FNMNYRFIAADVLSKVIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAA---ADNARPEMG---TDLE  688
             YG+   DLV+Q++  QA++WLT+LLF LEFR+      + +    DN   E G   T + 
Sbjct  125   YGQQAVDLVVQSSVFQAIVWLTLLLFVLEFRKAGFSSNNISDVQVDNINIESGKRETVVV  184

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
             G                    S+  +M  V L+LA NPN Y+C LG+ WA I+       
Sbjct  185   GE------------------KSFLEVMSLVWLKLATNPNCYSCILGIAWAFISNRDSGDY  226

Query  507   PsiiddsimiMAKGGSG-IAMFST----------------------GLFMALQDRIISCG  397
              +    S   MA G +G I  F +                      G+FMALQ+++I CG
Sbjct  227   INSTPYSEATMASGAAGHIRGFDSYNVKSRNRNGHVQYGEYMHIYAGIFMALQEKLIVCG  286

Query  396   WTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHAD  217
              +LTV G+VL+F+ GPA  AIG+I+L LHGDVL++ I+Q+ALPQ++T+FIFAKEYGLHAD
Sbjct  287   TSLTVMGMVLKFIAGPAAMAIGSIVLGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAD  346

Query  216   VLSTA  202
             VLSTA
Sbjct  347   VLSTA  351



>gb|EMS56061.1| putative auxin efflux carrier component 4 [Triticum urartu]
Length=367

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 235/374 (63%), Gaps = 27/374 (7%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GDIYKVV AMAPLY A+ LGYGS+RWW  F  + C AIN     F +PFFTF F+ + DP
Sbjct  5     GDIYKVVEAMAPLYFALGLGYGSVRWWRFFTAEQCGAINTLVVCFSMPFFTFDFVVRADP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKN--GGLDWSIttfslstlnntLVVGVPLMQ  856
             Y MNY  +A+D VAK + V+A   WA   K   G   WSIT FSL   NNTLVVGVPL+ 
Sbjct  65    YAMNYRVIAADAVAKLLAVLAAAGWARCAKAKAGAYSWSITGFSLGAYNNTLVVGVPLLD  124

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL--GQISAAADNAR----------  712
             AMYG+   DL++Q A +QA++W  +LL   E R+  +  G  S +A  AR          
Sbjct  125   AMYGKWAQDLIVQIAVVQAIVWFPLLLLAFELRKAWVVGGASSLSATTARDDGSTTSDDD  184

Query  711   --PEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWA  538
                 +  D+E  P               + P    M  +V ++LA+NPN YA  LG+ WA
Sbjct  185   RAQHVEMDVEAAPPTGGRRI-------RLWP----MASTVGMKLARNPNVYASVLGVAWA  233

Query  537   IITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFL  358
              I   W   MP ++  S+ +M++ G+G++MFS GLFMA Q+RI++CG  L   G+VLRF+
Sbjct  234   CIAYRWRIGMPGVVTGSLQVMSRTGTGMSMFSMGLFMAQQERIVACGGGLAALGMVLRFV  293

Query  357   IGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILS  178
              GP ++  GA    L GDVL+  I+Q+ALPQ++ +F+FAKEYGLHADVLSTA+I GT++S
Sbjct  294   AGPLSALAGAAAFGLRGDVLRFAIIQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLVS  353

Query  177   LPVMIGYYVILELL  136
             LPV+IGYY +L+++
Sbjct  354   LPVLIGYYGVLDIV  367



>gb|KCW65009.1| hypothetical protein EUGRSUZ_G02548 [Eucalyptus grandis]
Length=338

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 160/362 (44%), Positives = 237/362 (65%), Gaps = 33/362 (9%)
 Frame = -3

Query  1215  GWGDIYKVVV----AMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhF  1048
             GW D+YKVV     +M PLYVA++LGYGS++WW +F  + C+ INRF    +LP F F F
Sbjct  3     GWDDVYKVVYKVVKSMFPLYVALMLGYGSVKWWRLFTHEQCNGINRFIALIVLPLFGFEF  62

Query  1047  IAQVDPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGV  868
              A ++PYTMN+  +A+D ++K  ++  L +          DW ITTFSL TL N LVVGV
Sbjct  63    TAHINPYTMNFRLLAADALSKLAILAILGLLGRISSRASYDWIITTFSLCTLTNLLVVGV  122

Query  867   PLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLE  688
             P+M+AMYG+ G DLV+Q   +Q+L+W+ ++L  LEFR TR+ + +   D  R        
Sbjct  123   PVMRAMYGQWGVDLVVQLFMVQSLVWIPLVLLLLEFRNTRIPENNGVVDEER--------  174

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
                                  SY ++ + + +++A NPN YA  LGL WA++   + FTM
Sbjct  175   ---------------------SYWSLARVMGMKMAMNPNVYANVLGLAWALMANRFKFTM  213

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             PSI++ S+ IM+K G+G AMF+ G+F+A+Q R+I+CG   TV GLV RF++GP   A+ +
Sbjct  214   PSIMEGSVEIMSKAGTGTAMFNIGIFIAMQTRVIACGTGPTVLGLVSRFVVGPTIMAVCS  273

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             + + LHG  L+I I+Q+A+PQA+ +F+F  EYGLHA+VLSTA+++GT++SLP++IGYY+ 
Sbjct  274   LAVGLHGPALQIAIIQAAIPQAIASFVFGNEYGLHANVLSTAVVLGTVISLPLLIGYYIG  333

Query  147   LE  142
             L+
Sbjct  334   LD  335



>ref|XP_004957280.1| PREDICTED: probable auxin efflux carrier component 4-like [Setaria 
italica]
Length=363

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 171/374 (46%), Positives = 236/374 (63%), Gaps = 29/374 (8%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A+ LGYGS+RWW +F PD CDA+NR   +F +PFF F F A++
Sbjct  3     GWGDVYKVVAAMAPLYFALGLGYGSVRWWKLFTPDQCDAVNRLVAYFSVPFFAFDFAARI  62

Query  1035  DPYTMNY-------------LFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslst  895
             DP+ ++Y             +   +   A               K+    W IT FSL+ 
Sbjct  63    DPFALSYRVLAADALAKLAVVVSLAAWAAACASARRGGGDGKGNKDRAFSWCITGFSLAA  122

Query  894   lnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT-RLGQISAAADN  718
             LNNTLVVGVPL+ AMYG+   DL++Q + +Q +++  +LL   E RR    G+  AA + 
Sbjct  123   LNNTLVVGVPLLDAMYGKWARDLIVQISVVQIIVYFPLLLLTFEARRAWGAGKRPAAEEE  182

Query  717   ARPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWA  538
                  G D+E +                   S+  ++++V +++AKNPN YA  LG+ WA
Sbjct  183   G---AGGDVEES------------GGETAARSFWPLVRAVWMKVAKNPNVYAGVLGVAWA  227

Query  537   IITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFL  358
              +T  WH   PSII+ S+++M+K G G+AMFS GLFMALQ++II CG   T  G+ LRF+
Sbjct  228   CVTNRWHIETPSIIEGSVLVMSKTGVGLAMFSMGLFMALQEKIIVCGAGPTFLGMALRFV  287

Query  357   IGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILS  178
              GPA +A GA+ + L GDVL++ I+Q+ALPQA+TTF+FAKEY LHADVLSTA+I GT+ S
Sbjct  288   AGPAATAAGALAMGLRGDVLRLAIIQAALPQAITTFVFAKEYSLHADVLSTAVIFGTLAS  347

Query  177   LPVMIGYYVILELL  136
             LPV+I YY++L L+
Sbjct  348   LPVLIVYYIVLGLI  361



>ref|XP_002462627.1| hypothetical protein SORBIDRAFT_02g029210 [Sorghum bicolor]
 gb|EER99148.1| hypothetical protein SORBIDRAFT_02g029210 [Sorghum bicolor]
Length=371

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 251/373 (67%), Gaps = 20/373 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A+ LGYGS+RWW MF PD CDAINR   +F +PFF F F +++
Sbjct  4     GWGDVYKVVAAMAPLYFALGLGYGSVRWWKMFTPDQCDAINRLVSYFAVPFFAFDFASRI  63

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFV-------------KNGGLDWSIttfslst  895
             DP++++Y  +A+D ++K  V +AL  WA                K+  L W IT FSL+T
Sbjct  64    DPFSLSYRVLAADALSKLAVALALAAWATAAAAAAAARPGGGKGKDRALSWCITVFSLAT  123

Query  894   lnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA  715
             LNNTLVVGVPL+ AMYG+   DL++Q + +Q +++   LL  LE RR      +AA + A
Sbjct  124   LNNTLVVGVPLLDAMYGKWARDLIVQISVVQFIVYFPALLLALEARRAGKMAAAAAVEPA  183

Query  714   RPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAI  535
                 G D++   +             +   S+  ++++V  ++A+NPN YA  LG+ WA 
Sbjct  184   ----GDDVD---ESGGGGSGGEITAAHQSSSFWPLVRAVGTKVARNPNIYAGILGVSWAC  236

Query  534   ITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLI  355
             +T  WH   PSII+ S+++M+K G G+AMFS GLFMALQ++II CG   T+ G+ LRF+ 
Sbjct  237   VTNRWHIETPSIIEGSVLVMSKTGVGLAMFSMGLFMALQEKIIVCGAGPTMLGMALRFVA  296

Query  354   GPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSL  175
             GPA +A GA+ L L GDVL++ ++Q+ALPQ++TTF+FA+EYGLHADVLSTA+I GT+ SL
Sbjct  297   GPAATAAGAVALGLRGDVLRLAVMQAALPQSITTFVFAREYGLHADVLSTAVIFGTLASL  356

Query  174   PVMIGYYVILELL  136
             PV+I YY++L L+
Sbjct  357   PVLIVYYIVLGLI  369



>ref|NP_001140977.1| uncharacterized protein LOC100273056 [Zea mays]
 gb|ACF85087.1| unknown [Zea mays]
 gb|AFK32345.1| putative auxin efflux carrier PIN5c [Zea mays]
 tpg|DAA40475.1| TPA: hypothetical protein ZEAMMB73_821028 [Zea mays]
Length=365

 Score =   234 bits (596),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 241/373 (65%), Gaps = 25/373 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A+ LGYGS+RWW +F PD CDA+NR   +F +PFF F F A++
Sbjct  3     GWGDVYKVVAAMAPLYFALGLGYGSVRWWKLFSPDQCDAVNRLVAYFAVPFFAFDFAARI  62

Query  1035  DPYTMNYLFvas-------------dvvakamvvvalVIWANFVKNGGLDWSIttfslst  895
             DP+ ++Y  +A+                  A    A        K+  L W IT FSL+T
Sbjct  63    DPFALSYRVLAADALSKLAVALALAAWATAAASASARRGGGGKGKDRALSWCITGFSLAT  122

Query  894   lnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA  715
             LNNTLVVGVPL+ AMYG+   DL++Q + +Q +++   LL  LE RR   G+++  A+ A
Sbjct  123   LNNTLVVGVPLLDAMYGKWARDLIVQISVVQIIVYFPALLLALEARRA--GKLAVVAEEA  180

Query  714   RPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAI  535
               +       +      +G    A  ++ P  TA+ K V    A+NPN YA  LG+ WA 
Sbjct  181   AGD------ADESGGGGSGGGTTAAQSLWPLVTAVWKKV----ARNPNVYAGILGVSWAC  230

Query  534   ITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLI  355
             +T  WH   PSII+ S+++M+K G G++MFS GLFMALQ+++I CG   TV G+ LRF+ 
Sbjct  231   VTNRWHIETPSIIEGSVLVMSKTGVGLSMFSMGLFMALQEKVIVCGAWPTVLGMALRFVA  290

Query  354   GPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSL  175
             GPA +A GA+ L L GDVL++ ++Q+ALPQ++TTF+FA+EYGLH +VLSTA+I GT+ SL
Sbjct  291   GPAATAAGAVALGLRGDVLRLAVMQAALPQSITTFVFAREYGLHPEVLSTAVIFGTLASL  350

Query  174   PVMIGYYVILELL  136
             PV+I YY++L L+
Sbjct  351   PVLIVYYIVLGLI  363



>ref|XP_003576710.1| PREDICTED: probable auxin efflux carrier component 4 [Brachypodium 
distachyon]
Length=365

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 183/376 (49%), Positives = 248/376 (66%), Gaps = 30/376 (8%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A+ LGY S+R W +F PD CDA+NR   +F +PFF F F A++
Sbjct  3     GWGDVYKVVAAMAPLYFALALGYCSVRRWKLFTPDQCDAVNRLVAYFAVPFFAFDFSARI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFV----KNGGLD--------WSIttfslstl  892
             +PY +NY  +A+D ++K  V +AL  WA  V    +  G D        W IT FSL+TL
Sbjct  63    NPYALNYRVLAADALSKLAVALALAAWAAAVKAKQRGAGGDKLLAASSGWCITGFSLATL  122

Query  891   nntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNAR  712
             NNTLVVGVPL+ AMYG    DLV+Q + +Q +++  +LL   E RR   G  +     A 
Sbjct  123   NNTLVVGVPLLDAMYGPWARDLVVQLSVVQIIVYFPLLLLAFEARRACAGG-AGNKPAAP  181

Query  711   PEMGTDLEGNPKeaaaagetpaapTNIGP----SYTAMMKSVCLRLAKNPNTYACFLGLI  544
             P    D+EG             A   I P    S  A++++V L++A+NPN YA  LG+ 
Sbjct  182   PASDDDVEG-------------AAGRIEPVDYQSAWALVRAVGLKVARNPNVYAGVLGVA  228

Query  543   WAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLR  364
             W+ +T  WH   PSII+ S++IM++ G G+AMFS GLFMALQ+RI++CG   T  G+ LR
Sbjct  229   WSCVTNRWHIETPSIIEGSVLIMSRTGVGLAMFSMGLFMALQERIVACGAGPTALGMALR  288

Query  363   FLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTI  184
             F+ GPA +A GA+ L L GDVL++ I+Q+ALPQ++TTF+FA+EYGLHADVLSTA+I GT+
Sbjct  289   FVAGPAATAAGAVALGLRGDVLRLAIIQAALPQSITTFVFAREYGLHADVLSTAVIFGTL  348

Query  183   LSLPVMIGYYVILELL  136
             +SLPV+I YY+ L  +
Sbjct  349   VSLPVLIVYYIALAFV  364



>ref|XP_009346849.1| PREDICTED: putative auxin efflux carrier component 8 [Pyrus x 
bretschneideri]
Length=323

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 159/317 (50%), Positives = 217/317 (68%), Gaps = 4/317 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVVVAM PLY A+ILGYGS+RWW +F P+ C AINRF CFF LP FTF F A V
Sbjct  3     GWEDVYKVVVAMVPLYFALILGYGSVRWWGVFTPEQCGAINRFVCFFTLPLFTFEFTAHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY  NY F+ +D ++K ++VV LV+W      G   WSIT+FSL TL N+LVVGVPL++
Sbjct  63    DPYKWNYRFIGADAISKVIIVVVLVLWGKCSSKGSYSWSITSFSLCTLTNSLVVGVPLIR  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG    DLV+Q++ +QA++WLT+LLF LEFRRT  G I   + +    + T ++    
Sbjct  123   AMYGSSAVDLVVQSSVVQAIIWLTILLFVLEFRRT--GSIDIVSSST--SVDTRVQSVDP  178

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +            +  PS+  +MK+V ++L  NPN+YA F+G+ WA I   WH  +PSI+
Sbjct  179   QGKDVEAMEEITISTRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAFIANRWHIELPSIM  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + S++IM+K G+G AMFS G+FMALQ++ ++CG + T+ G+VLRF+ GPA  AIG I + 
Sbjct  239   EGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSRTIIGMVLRFIAGPAAIAIGCIAVG  298

Query  315   LHGDVLKIVIVQSALPQ  265
             LHGDVL++ I+Q    Q
Sbjct  299   LHGDVLRVAIIQVVYLQ  315



>tpd|FAA00684.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
Length=368

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 241/370 (65%), Gaps = 21/370 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A+ LGYGS+RWW +F  D CDA+NR    F +PFF F F A++
Sbjct  3     GWGDVYKVVAAMAPLYFALGLGYGSVRWWRLFTADQCDAVNRLVACFAVPFFAFDFAARI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKN-------------GGLDWSIttfslst  895
             DP+ ++Y  +A+D ++K  V +AL   A                  GG  W IT FSL+T
Sbjct  63    DPFALSYRVLAADALSKLAVALALAACAAAASTRCCGSGGGKRGGGGGFSWCITGFSLAT  122

Query  894   lnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA  715
             LNNTLVVGVPL+ AMYG+   DL++Q + +Q +++  +LL   E RR      +      
Sbjct  123   LNNTLVVGVPLLDAMYGKWARDLIVQISVVQTIVYFPLLLLAFEVRRATTAAAAPPPPPT  182

Query  714   RPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAI  535
               +     +G    A AA            S   ++++V L++A+NPN YA  LG+ WA 
Sbjct  183   GTDDDDVEDGAAAAATAAAARR--------SLWPLVRAVWLKVARNPNVYAGVLGVAWAC  234

Query  534   ITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLI  355
             +T  WH   PSII+ S++IM+K G G++MFS GLFMALQD+II CG  LTV G+ LRF+ 
Sbjct  235   VTNRWHVETPSIIEGSVLIMSKTGVGLSMFSMGLFMALQDKIIVCGAGLTVLGMALRFVA  294

Query  354   GPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSL  175
             GPA +A+GA  L L GD+L++ I+Q+ALPQ++TTF+FAKEYGLHA++LSTA+I GT+ SL
Sbjct  295   GPAATAVGAFALGLRGDLLRLAIIQAALPQSITTFVFAKEYGLHAEILSTAVIFGTLASL  354

Query  174   PVMIGYYVIL  145
             PV+I YY++L
Sbjct  355   PVLIVYYIVL  364



>ref|XP_010068800.1| PREDICTED: uncharacterized protein LOC104455763 [Eucalyptus grandis]
Length=688

 Score =   234 bits (598),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 160/362 (44%), Positives = 237/362 (65%), Gaps = 33/362 (9%)
 Frame = -3

Query  1215  GWGDIYKVVV----AMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhF  1048
             GW D+YKVV     +M PLYVA++LGYGS++WW +F  + C+ INRF    +LP F F F
Sbjct  3     GWDDVYKVVYKVVKSMFPLYVALMLGYGSVKWWRLFTHEQCNGINRFIALIVLPLFGFEF  62

Query  1047  IAQVDPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGV  868
              A ++PYTMN+  +A+D ++K  ++  L +          DW ITTFSL TL N LVVGV
Sbjct  63    TAHINPYTMNFRLLAADALSKLAILAILGLLGRISSRASYDWIITTFSLCTLTNLLVVGV  122

Query  867   PLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLE  688
             P+M+AMYG+ G DLV+Q   +Q+L+W+ ++L  LEFR TR+ + +   D  R        
Sbjct  123   PVMRAMYGQWGVDLVVQLFMVQSLVWIPLVLLLLEFRNTRIPENNGVVDEER--------  174

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
                                  SY ++ + + +++A NPN YA  LGL WA++   + FTM
Sbjct  175   ---------------------SYWSLARVMGMKMAMNPNVYANVLGLAWALMANRFKFTM  213

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             PSI++ S+ IM+K G+G AMF+ G+F+A+Q R+I+CG   TV GLV RF++GP   A+ +
Sbjct  214   PSIMEGSVEIMSKAGTGTAMFNIGIFIAMQTRVIACGTGPTVLGLVSRFVVGPTIMAVCS  273

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             + + LHG  L+I I+Q+A+PQA+ +F+F  EYGLHA+VLSTA+++GT++SLP++IGYY+ 
Sbjct  274   LAVGLHGPALQIAIIQAAIPQAIASFVFGNEYGLHANVLSTAVVLGTVISLPLLIGYYIG  333

Query  147   LE  142
             L+
Sbjct  334   LD  335



>gb|EAZ07744.1| hypothetical protein OsI_29999 [Oryza sativa Indica Group]
 gb|EAZ43431.1| hypothetical protein OsJ_28036 [Oryza sativa Japonica Group]
 dbj|BAG94538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 232/358 (65%), Gaps = 16/358 (4%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             MAPLY A+ LGYGS+RWW  F  + C AIN    +F +PFFTF F+ + DP+ MNY  +A
Sbjct  1     MAPLYFALGLGYGSVRWWRFFTAEQCAAINTMVVYFSMPFFTFDFVVRTDPFAMNYRVIA  60

Query  1002  sdvvakamvvvalVIWAN------FVKNGGLDWSIttfslstlnntLVVGVPLMQAMYGR  841
             +D V+KA+ + A+  WA         K G   WSIT FSL+ LNNTLVVGVPL+ AMYGR
Sbjct  61    ADAVSKAIAIAAMAAWARTRCGCAAAKAGAQSWSITGFSLAALNNTLVVGVPLLDAMYGR  120

Query  840   LGYDlvlqaaamqallwltmlLFGLEFRRT------RLGQISAAADNARPEMGTDLEGNP  679
                DLV+Q A +Q+++W  +LL   E R+            +  + ++ PE  +D+E N 
Sbjct  121   WAQDLVVQIAVVQSMVWFPLLLMAFELRKAWVVGGGGGVGPAVMSSSSPPEKQSDVEMNG  180

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
                AA G            + A  ++V L+LA+NPN YA  LG++WA I   WH ++P I
Sbjct  181   AVVAAPGGGGGVRL----PFWATARTVGLKLARNPNVYASVLGVVWACIAYRWHLSLPGI  236

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             +  S+ +M++ G+G++MFS GLFM  Q+R+I+CG  LT  G+ LRF+ GP  + +GA  L
Sbjct  237   VTGSLQVMSRTGTGMSMFSMGLFMGQQERVIACGAGLTALGMALRFVAGPLATLVGAAAL  296

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
              L GDVL + I+Q+ALPQ++ +F+FAKEYGLHADVLSTA+I GT++SLP++I YY +L
Sbjct  297   GLRGDVLHLAIIQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLISLPILIAYYAVL  354



>gb|KDO47605.1| hypothetical protein CISIN_1g041301mg, partial [Citrus sinensis]
Length=291

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 211/313 (67%), Gaps = 25/313 (8%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+VAM PLY A+ILGYGS++WW +  P+ C AINR  C+F LP FT  F   V
Sbjct  3     GWEDVYKVIVAMVPLYFALILGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTTHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGG-LDWSIttfslstlnntLVVGVPLM  859
             DP+ MNY F+ +D ++K ++V+ L  W    K G    W IT FSL TL NTLV+GVPLM
Sbjct  63    DPFNMNYRFIGADAISKLIIVIVLAFWGMCSKKGSCFSWCITNFSLCTLTNTLVLGVPLM  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             +AMYG++  DLV+Q++  Q+++W T+ LF LEFRR         A NA  ++    EG+ 
Sbjct  123   KAMYGQMAVDLVVQSSVFQSIVWFTIFLFILEFRR---------AGNALEDLE---EGHA  170

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
               ++             PS+  +MK V L+LAKNPN+YAC +GL WA +   WHF MPSI
Sbjct  171   TSSSR------------PSFWHLMKVVWLKLAKNPNSYACVIGLAWAFVANRWHFKMPSI  218

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             I+ SI+IM+K G+G AMFS G+FMALQ+++++CG +LT +G+VL+F+ GPA  AIG+I  
Sbjct  219   IEGSILIMSKAGTGTAMFSMGIFMALQEKLLACGPSLTAFGMVLKFIAGPAAMAIGSIAT  278

Query  318   RLHGDVLKIVIVQ  280
              L GDVL++ I+Q
Sbjct  279   GLRGDVLRVSIIQ  291



>ref|XP_009342872.1| PREDICTED: putative auxin efflux carrier component 5 [Pyrus x 
bretschneideri]
Length=357

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 209/356 (59%), Gaps = 4/356 (1%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYVAMIL Y S++WW +F PD C  IN+F   F +P  +F  I+  DPY
Sbjct  6     DVYHVVAATVPLYVAMILAYLSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQIISSNDPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN+  + +D + K    +AL     F   GGL+  IT  SLSTL NTL++G+PL++AMY
Sbjct  66    KMNHKLILADCLQKLTAFLALAAVTKFSSYGGLNSIITGLSLSTLPNTLILGIPLLKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G     LV Q   +Q+L+W  MLLF  EFR  +   ++ +++    EM    E   K+  
Sbjct  126   GDEAAKLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPSSEPTAEEMDVPHEAQSKDET  185

Query  666   aagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidds  487
                        I     +++ +V  +L  NPNT+A  LGLIWA I   W   +P II  S
Sbjct  186   EDETRANNTKKI----KSILLTVGRKLITNPNTHATLLGLIWASIHYRWEVKLPEIIAQS  241

Query  486   imiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHG  307
             I I++ GG G+AMFS GLFMA +  II CG    +  + L+F+ GPA  A+ +  + L G
Sbjct  242   IAILSNGGLGMAMFSLGLFMASRGSIIVCGTRKAMIAMGLKFIAGPAIMAVSSFAVGLRG  301

Query  306   DVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              VL++ +VQ+ LPQ +  F+FAKEY +H D+LST +I G +++LP+ + YY +L L
Sbjct  302   RVLRVAVVQATLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPIALAYYFLLGL  357



>ref|XP_004302355.1| PREDICTED: probable auxin efflux carrier component 1b-like [Fragaria 
vesca subsp. vesca]
Length=357

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 216/360 (60%), Gaps = 12/360 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYVAMIL Y S++WW +F P+ C  IN+F   F +P  +F  I+  +PY
Sbjct  6     DVYHVVAATVPLYVAMILAYVSVKWWKLFTPEQCSGINKFVAKFSIPLLSFQVISANNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN   + SD + KA+  +AL     F  +GGL+  IT  SLSTL NTL++G+PL++AMY
Sbjct  66    KMNLKLILSDGLQKAIAFLALTAITKFSSHGGLNSIITGLSLSTLPNTLILGIPLLKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
                   LV Q   +Q+L+W  +LLF  EFR  +   ++ +++    EM    E   K+  
Sbjct  126   AEEAGALVSQIVVLQSLVWYNLLLFLFEFRAAKAASVTPSSEATAEEMEAPNEAQSKDEE  185

Query  666   aagetpaapTNIGPSYTAMMKSVCL----RLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
                E    P N        MKS+ L    +L  NPNT+A  L LIWA I   W   MP I
Sbjct  186   GGEERTRNPKN--------MKSILLTVGRKLFANPNTHATLLSLIWASIHFRWGVKMPEI  237

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             +  SI IMA GG G+A FS GLFMA +  II+CG  +T+  + L+FL GPA  A+ + ++
Sbjct  238   VTQSISIMANGGLGMATFSLGLFMASRPSIIACGARMTMVAMGLKFLAGPAVMALSSFVI  297

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L G  L+I IVQ+ALPQ +  F+FAKEY +H ++LSTA+I G +++LPV + YY +L++
Sbjct  298   GLRGRALRIAIVQAALPQGIVPFVFAKEYNVHPEILSTAVIFGMLIALPVALAYYFLLDI  357



>ref|XP_008230728.1| PREDICTED: putative auxin efflux carrier component 5 [Prunus 
mume]
Length=357

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/357 (42%), Positives = 215/357 (60%), Gaps = 4/357 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYVAMIL Y S++WW +F PD C  IN+F   F +P  +F  I+  +P
Sbjct  5     ADVYHVVAATVPLYVAMILAYVSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQVISGNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + SD + K +  +AL     F  +GGL+  IT  SLST+ NTL++G+PL++AM
Sbjct  65    YKMNLKLILSDCLQKLIAFLALTAITKFSSHGGLNSIITGLSLSTMPNTLILGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     LV Q   +Q+L+W  MLLF  EFR  +   ++ ++++   EM    E   KE 
Sbjct  125   YGDEAAMLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPSSESTAEEMEVPQEAQSKEE  184

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
             A        P  I     +++ +V  +L  NPNT+A  LGLIWA I   W   +P I+  
Sbjct  185   AEDETRSRTPKKI----KSILLTVGRKLITNPNTHATLLGLIWASIHYKWGVKLPDIVTQ  240

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFMA +  II+CG    +  + L+F+ GPA  A+ +  + L 
Sbjct  241   SIAILSNGGLGMAMFSLGLFMASRGSIIACGTRTGMLAMGLKFIAGPALMAVSSFAVGLR  300

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G +L++ IVQ+ALPQ +  F+FAKEY +H D+LST +I G +++LP+ + YY +L L
Sbjct  301   GRILRVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPIALAYYFLLGL  357



>ref|XP_007216395.1| hypothetical protein PRUPE_ppa021573mg [Prunus persica]
 gb|EMJ17594.1| hypothetical protein PRUPE_ppa021573mg [Prunus persica]
Length=357

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 149/357 (42%), Positives = 215/357 (60%), Gaps = 4/357 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYVAMIL Y S++WW +F PD C  IN+F   F +P  +F  I+  +P
Sbjct  5     ADVYHVVAATVPLYVAMILAYVSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQVISGNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + SD + K +  +AL     F  +GGL+  IT  SLST+ NTL++G+PL++AM
Sbjct  65    YKMNLKLILSDCLQKLIAFLALTAITKFSSHGGLNSIITGLSLSTMPNTLILGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     LV Q   +Q+L+W  MLLF  EFR  +   ++ ++++   EM    E   KE 
Sbjct  125   YGDEAAMLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPSSESTAEEMEAPQEAQSKEE  184

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
             A        P  I     +++ +V  +L  NPNT+A  LGLIWA I   W   +P I+  
Sbjct  185   AEDETRSRTPKKI----KSILLTVGRKLIANPNTHATLLGLIWASIHYKWGVKLPDIVTQ  240

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFMA +  II+CG    +  + L+F+ GPA  A+ +  + L 
Sbjct  241   SIAILSNGGLGMAMFSLGLFMASRGSIIACGTRTGMLAMGLKFIAGPALMAVSSFAVGLR  300

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G +L++ IVQ+ALPQ +  F+FAKEY +H D+LST +I G +++LP+ + YY +L L
Sbjct  301   GRILRVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPIALAYYFLLGL  357



>ref|XP_004978371.1| PREDICTED: probable auxin efflux carrier component 6-like [Setaria 
italica]
Length=361

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 237/362 (65%), Gaps = 11/362 (3%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             WGD+YKV  A+ PLYV ++LG+ S+R W +F P+ C+++N    FF +PFFTF F    D
Sbjct  4     WGDVYKVASALVPLYVPLLLGFCSVRRWKIFTPEQCESVNSLVAFFAIPFFTFGFTVHTD  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFV--KNGGLDWSIttfslstlnntLVVGVPLM  859
             P+  NY  +A+DV++KA++   +  W      +   + WSIT FSLSTL ++LVVGVP+ 
Sbjct  64    PFRANYRAIAADVISKAVIAAVIGGWVLLTGGRKNAVSWSITGFSLSTLTSSLVVGVPMA  123

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG---QISAAADNARPEMGTDLE  688
             QAMYG     LV+Q +  QA++W+T+LLF LE R+  LG   QI  AAD       +D+E
Sbjct  124   QAMYGDWAQQLVVQLSVFQAIVWITLLLFALEVRKAALGTTTQIRRAADVPV----SDIE  179

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
                   A             PS   ++K V  +L +NPNTYA   G++WA I      ++
Sbjct  180   ATSNAEAIGVAPTVGGGR--PSIWKLVKVVLYKLGRNPNTYASVGGIMWACIANTLQISL  237

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P II +SI IMA+ G+G+AMFS GLFMA QD++I CG +LT   LVL+F++ P    IG+
Sbjct  238   PIIIKNSIGIMAQCGNGLAMFSMGLFMAQQDKLIPCGPSLTFLSLVLKFVLDPIAMTIGS  297

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             I + L GDV+++ I+Q+A+PQ++T+FIFAKEYGLH DVLSTA+I+G ++S+P+++ +YV 
Sbjct  298   IAVGLRGDVVRVAIIQAAVPQSITSFIFAKEYGLHPDVLSTAVIVGMLVSVPLIVLFYVG  357

Query  147   LE  142
             LE
Sbjct  358   LE  359



>ref|XP_007138460.1| hypothetical protein PHAVU_009G210900g [Phaseolus vulgaris]
 gb|ESW10454.1| hypothetical protein PHAVU_009G210900g [Phaseolus vulgaris]
Length=399

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 175/394 (44%), Positives = 243/394 (62%), Gaps = 38/394 (10%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y+VV A+ PLYVA+ L YGS+RWW +F P+ C  INRF   F +PF  FHFI+  +PY
Sbjct  6     DLYEVVAAIVPLYVALFLAYGSVRWWKIFTPEQCSGINRFVSVFAVPFLFFHFISNNNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
             TMN+ F+A+D + K +++VALV+W  F K G ++ +IT FSLSTL NTL++GVPL++AMY
Sbjct  66    TMNFRFLAADSLQKVLILVALVLWNTFTKWGSINLTITLFSLSTLPNTLIMGVPLLKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRL----------GQI-------SAAADN  718
             G     L++Q    Q ++W T+LLF  E+R  +L          G I       S ++ N
Sbjct  126   GDFTTTLMIQIVVFQIVIWFTLLLFMFEYRGAKLLISEQFPETAGAIASLRVDSSVSSLN  185

Query  717   ARPEMGTDLE-GNPKeaaaagetpaapTNIGP------SYT---------AMMKSVCL--  592
              R  +  D E G   E      + +   +I        SY+         A+M ++ L  
Sbjct  186   GREPLHADAEIGENGELHVVVRSMSRSMSINKPSAFNKSYSTPIPSSLQNAVMINLILTM  245

Query  591   ---RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMAL  421
                 L +NPNTYA  LGLIW++I   W+  MPSII  SI I++  G GI MFS GLFMAL
Sbjct  246   VWRNLIRNPNTYASILGLIWSLIFFRWNIKMPSIIKGSIEIISNTGLGIVMFSLGLFMAL  305

Query  420   QDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFA  241
             Q +II+CG TLT+  L L+FL+GP      + ++ +HG +L++ IVQ+ALPQ +  F+FA
Sbjct  306   QPKIITCGKTLTLLALALKFLVGPFIILATSKIVGMHGILLRVTIVQAALPQGIVPFVFA  365

Query  240   KEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +EY LHAD+LST +I G ++ LPV I YYVIL L
Sbjct  366   REYNLHADILSTTVIFGMVVVLPVTIIYYVILGL  399



>ref|XP_006853065.1| hypothetical protein AMTR_s00038p00074050 [Amborella trichopoda]
 gb|ERN14532.1| hypothetical protein AMTR_s00038p00074050 [Amborella trichopoda]
Length=386

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 154/377 (41%), Positives = 227/377 (60%), Gaps = 25/377 (7%)
 Frame = -3

Query  1200  YKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTM  1021
             Y V  AM PLYVAM L YGS++WW +F  D C  INRF   F +PF +   I+ ++PY M
Sbjct  8     YDVFTAMVPLYVAMFLAYGSVKWWRIFTTDQCSVINRFVAIFAIPFLSLQIISSINPYQM  67

Query  1020  NYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMYGR  841
             N  F+ +D + K +++  LV+W +F   G LDW IT FS+STL NTL++G+PL++AMYG 
Sbjct  68    NLKFILADTLQKLLILFVLVLWGSFSSWGSLDWVITLFSISTLPNTLIIGIPLLRAMYGV  127

Query  840   LGYDlvlqaaamqallwltmlLFGLEFR-RTRLG-QISAA-------------ADNARPE  706
                 L++Q   +Q L+W T+LLF  E + +  +G QI  +             A ++   
Sbjct  128   EINGLLVQIVVLQGLVWYTLLLFLFELKAKIEMGPQIPVSMGSQVGSDVSPVHAQSSVVS  187

Query  705   MGTDLEGN----PKeaaaagetpaapTNIGPSYTAMMKSVCL------RLAKNPNTYACF  556
                DLEG+     KE            + G +  + +K + L      ++ KNPNTYA  
Sbjct  188   CKGDLEGDGEMHSKEIEDEEAPSKDSEDEGEATCSSVKMIHLFFLVLSKVIKNPNTYASV  247

Query  555   LGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYG  376
             LGL+W +I   W+  MP I+ +SI I+A  G G+AMFS GLFMA Q++II+CG       
Sbjct  248   LGLVWGLIACRWNIHMPKIVQNSISILADAGLGMAMFSLGLFMASQNKIIACGKRRATLA  307

Query  375   LVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAII  196
             +V+RFL+GPA  A  ++ + L G +L + IVQ+AL QA+T F++AKEY ++ D+LST ++
Sbjct  308   MVVRFLLGPAVMAACSLAVGLRGKLLHVAIVQAALSQAITPFVYAKEYNVYPDILSTMVV  367

Query  195   IGTILSLPVMIGYYVIL  145
              G ++SLP+ + YYV+L
Sbjct  368   FGMLVSLPITLAYYVLL  384



>ref|XP_008379330.1| PREDICTED: putative auxin efflux carrier component 5 [Malus domestica]
Length=357

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 209/356 (59%), Gaps = 4/356 (1%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLY AMIL Y S++WW +F PD C  IN+F   F +P  +F  I+  +PY
Sbjct  6     DVYHVVAATVPLYXAMILAYLSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQIISSNNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN+  + SD + K    +AL     F   GGL+  IT  SLSTL NTL++G+PL++AMY
Sbjct  66    KMNHKLILSDCLQKLTAFLALAAVTKFSSYGGLNSIITGLSLSTLPNTLILGIPLLKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G     LV Q   +Q+L+W  MLLF  EFR  +   ++ +++    +M    E   K+  
Sbjct  126   GDEAAKLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPSSEPTAEDMEVPHEAQSKDET  185

Query  666   aagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidds  487
                        I     +++ +V  +L  NPNT+A  LGLIWA I   W   +P II  S
Sbjct  186   EDETRADNTRKI----KSILLTVGRKLITNPNTHATMLGLIWASIHYKWGVKLPEIIAQS  241

Query  486   imiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHG  307
             I I++ GG G+AMFS GLFMA +  II+CG    +  + L+F+ GPA  A+ +  + L G
Sbjct  242   ISILSNGGLGMAMFSLGLFMATRGSIIACGTRKAMLAMGLKFIAGPAIMALSSFAVGLRG  301

Query  306   DVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              VL++ +VQ+ LPQ +  F+FAKEY +H DVLST +I G +++LP+ + YY +L L
Sbjct  302   KVLRVAVVQATLPQGIVPFVFAKEYNVHPDVLSTGVIFGMLIALPIALAYYFLLGL  357



>ref|XP_006663186.1| PREDICTED: probable auxin efflux carrier component 1b-like [Oryza 
brachyantha]
Length=411

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 166/407 (41%), Positives = 233/407 (57%), Gaps = 52/407 (13%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y V+ A+ PLYVAM L Y S+RWW +F PD C  INRF   F +P  +FHFI+  +P+
Sbjct  6     DLYHVLTAVVPLYVAMTLAYASVRWWRIFSPDQCSGINRFVALFAVPLLSFHFISTNNPF  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN  F+A+D + K +V+  L +W      G LDW IT FSLSTL NTLV+G+PL++ MY
Sbjct  66    AMNLRFLAADSLQKLIVLALLALWCRLSCRGSLDWLITLFSLSTLPNTLVMGIPLLRGMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA------RP--------  709
             G     L++Q   +Q ++W T++LF  E+R  RL  +    D A      RP        
Sbjct  126   GADSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLVMEQFPDTAASIISFRPAAAGAVHV  185

Query  708   --EMGTDLEGNPKeaaaagetpaapTN-----------IGPSYTAMMK------------  604
                 G D  G  K A A  E      N           +G + TA ++            
Sbjct  186   FGSAGAD-HGAAKGAQAYDEYSFGNKNEKDGHGPTLSKLGSNSTAQLRPKDDGEERPAAL  244

Query  603   ---SVCLRLA---------KNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGS  460
                SV  RL          +NPNTY+  LG+IW++++  W   MP+II  SI I++  G 
Sbjct  245   PPASVMTRLILIMVWRKLIRNPNTYSSLLGIIWSLVSYRWGIEMPAIIARSISILSDAGL  304

Query  459   GIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQ  280
             G+AMFS GLFMALQ RII+CG ++  + + +RFL+GPA  A  +I + L G +L I IVQ
Sbjct  305   GMAMFSLGLFMALQPRIIACGNSVASFAMAVRFLMGPAVMAAVSIAVGLRGVLLHIAIVQ  364

Query  279   SALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +ALPQ +  F+FAKEY +H D+LSTA+I G +++LP+ + YY++L L
Sbjct  365   AALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITLVYYILLGL  411



>ref|XP_003569680.1| PREDICTED: probable auxin efflux carrier component 1b [Brachypodium 
distachyon]
Length=362

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 214/358 (60%), Gaps = 2/358 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+ A  PLYVAMIL Y SI+WW +F P+ C  IN+F   F +P  +F  I+  
Sbjct  3     SWIAIYHVLEATVPLYVAMILAYLSIKWWKLFTPEQCSGINKFVAKFSIPLLSFQVISTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN   + +D++ K + ++     +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYDMNLKLILADILQKLLALLGFAAISRACCAEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG    +L+ Q   +Q+L+W T+LLF LEFR  + G +   +     E      G  +
Sbjct  123   GMYGDEALNLISQIVVLQSLIWYTLLLFLLEFRAAK-GIVPTTSSEITAEEEPGTLGTTQ  181

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +    G+          ++  ++  V  +L  NPN YAC +GLIWA+++  W   +P II
Sbjct  182   QRYQEGQAKGVSAKCSSAFNFLL-VVGKKLVMNPNMYACLIGLIWALVSFRWQIQLPVII  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +SI I++ GG G+AMFS GLF ALQ +II CG    +  L +RF +GPA   I +  + 
Sbjct  241   SNSIRILSDGGLGMAMFSLGLFTALQTKIIVCGTKRMLLSLGIRFFLGPALMVISSYAVG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + G +LK+ IVQ+ALPQ +  F+FAKEY LHAD+LSTAII+G ++++P  + YY +L+
Sbjct  301   MRGILLKVAIVQAALPQGIVPFVFAKEYNLHADILSTAIIVGMMVAVPAALAYYFVLD  358



>ref|XP_010912889.1| PREDICTED: probable auxin efflux carrier component 1b [Elaeis 
guineensis]
Length=357

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/356 (41%), Positives = 216/356 (61%), Gaps = 5/356 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
               +Y V+ A  PLY AM L Y SI+WW +F PD C  IN+F   F +P  +FH I+  +P
Sbjct  5     ATVYHVLAATVPLYAAMFLAYLSIKWWKLFTPDQCTGINKFVAKFSIPLLSFHVISTNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   V SD + K   ++   +       G LDW +T FSLSTL NTL++G+PL++ M
Sbjct  65    YKMNLKLVVSDSLQKIFALLVFAVLTKACFRGSLDWLLTGFSLSTLPNTLIIGIPLLKGM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W T+LLF  EFR  +   I+A   ++  E+ +    +P+  
Sbjct  125   YGAEAAKLLAQIVVLQSLVWYTLLLFLFEFRAAK--AIAANPTDSTGELESSGGIHPRPE  182

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 ++ +   NI      +++ V  +L  NPNTYA   G +W++I+  W   +P II +
Sbjct  183   EDEVKSLSIR-NIKSFL--ILQMVGKKLMINPNTYATLAGFVWSLISFRWGIELPLIIRN  239

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
              I +++ GG G+AMFS GLFMA Q  II+CG  + V  + LRF+IGPA  AI +  + + 
Sbjct  240   CISMLSDGGLGMAMFSLGLFMASQSSIIACGTRMMVLSMALRFIIGPALIAIPSYAIGMR  299

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
               +LK+ IVQ+ALPQ + TF+FAKEYG+H D+LST +I+G I+++P+ + YY IL+
Sbjct  300   ATLLKVAIVQAALPQGIVTFVFAKEYGVHPDILSTGVIVGMIIAVPIALAYYFILD  355



>ref|XP_004963479.1| PREDICTED: probable auxin efflux carrier component 6-like [Setaria 
italica]
Length=346

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 227/346 (66%), Gaps = 11/346 (3%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+YKV +A+ PLYV ++LG+  +R W +F P+ C+++N    FF +PFFTF F    D
Sbjct  4     WSDVYKVALALVPLYVPLLLGFCLVRRWKIFTPEQCESVNSLVAFFAIPFFTFGFTVHTD  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFV--KNGGLDWSIttfslstlnntLVVGVPLM  859
             P+  NY  +A+D+V+KA++   +  W      +   + WSIT FSLST+ ++LVVGVP+ 
Sbjct  64    PFRANYRAIAADIVSKAVIAAIIGGWVLLAGGRKNAVSWSITGFSLSTVTSSLVVGVPMA  123

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG---QISAAADNARPEMGTDLE  688
             QAMYG  G  LV+Q +  QA++W+T+LLF LE R+  LG   QI  AAD       +D+E
Sbjct  124   QAMYGDWGQQLVVQLSVFQAIVWITLLLFALEVRKAALGTTTQIRHAADVPV----SDIE  179

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
                  AA             PS   ++K V  +L +NPNTYA   G+IWA I      ++
Sbjct  180   ATSNAAAIGVAPTVGSGR--PSIWKLVKVVLYKLGRNPNTYASVGGIIWACIANRLQISL  237

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P II++SI IMA+ G+G+AMFS GLFMA QD++I CG +LT  GLVL+F++ P    IG+
Sbjct  238   PIIIENSIGIMARCGNGLAMFSMGLFMAQQDKLIPCGLSLTFLGLVLKFILDPIVMTIGS  297

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIG  190
             I + LHGDVL++ I+Q+A+PQ++T+FIFAKEYGLH DVLST +I+G
Sbjct  298   IAVGLHGDVLRVAIIQAAVPQSITSFIFAKEYGLHPDVLSTVVIVG  343



>ref|XP_004969744.1| PREDICTED: auxin efflux carrier component 4-like [Setaria italica]
Length=361

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 216/358 (60%), Gaps = 3/358 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+    PLYVAMI+ Y SI+WW +F P+ C  IN+F   F +P  +F  ++  
Sbjct  3     SWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILSTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY MN   + SD++ K++ ++   + +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    DPYDMNLKLIFSDILQKSLSLLGFAVISKACCGEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG     L+ Q  A+Q+L+W T+LLF  EFR  R    + ++     E GT     P 
Sbjct  123   GMYGNEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGLATTTSSGTNEGESGTP---GPM  179

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             E           +    S    +  V  +L  NPN YA  +GLIWA+I+  W   +PSII
Sbjct  180   EERHEEGRAKGVSARCYSAFCFLLVVGRKLVINPNMYASLIGLIWALISFRWRVQLPSII  239

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +SI I++ GG G+AMFS GLF ALQ +II+CG    +  L +RF +GPA   I +  + 
Sbjct  240   SNSIRILSDGGLGMAMFSLGLFTALQTKIIACGTKKMLLSLGIRFFLGPALMVISSYAIG  299

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             +HG +LK+ I+Q+ALPQ +  F+FAKEY +HAD++STAII+G ++++PV +GYY +++
Sbjct  300   MHGILLKVAIIQAALPQGIVPFVFAKEYNVHADIVSTAIIVGMMVAVPVALGYYFVID  357



>ref|XP_010087804.1| Putative auxin efflux carrier component 5 [Morus notabilis]
 gb|EXB30111.1| Putative auxin efflux carrier component 5 [Morus notabilis]
Length=360

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 144/359 (40%), Positives = 212/359 (59%), Gaps = 7/359 (2%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYVAMIL Y S+RWW +F PD C  IN+F   F +P  +F  ++  +PY
Sbjct  6     DVYHVVTATVPLYVAMILAYVSVRWWKIFTPDQCSGINKFVAKFSIPLLSFQILSDNNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN   + SD + K +  VAL +   F   GGLD+ IT  S+S L NTL++G+PL++AMY
Sbjct  66    KMNLRLILSDFLQKLLAFVALTVMTRFTSKGGLDFVITGLSVSILPNTLILGIPLLKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G     L+ Q   +Q+L+W  +LLF  EF   +    SAA+ +   E   D+E   +   
Sbjct  126   GEQAAVLLSQIVVLQSLIWYNLLLFLYEFNAAK----SAASVSPSSEATEDMEAPQESQP  181

Query  666   aagetpaapTNIGPSYTAMMK---SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                   A   +  P     M    +V  +L  NPNT+A  +GL+WA I   W   +P+I+
Sbjct  182   KEEVEEARNRSSSPRKIKTMLILLTVGRKLIGNPNTHATIIGLVWACIKFRWKVELPAIV  241

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             D SI +++ GG G+AMFS GLFMA +  II+CG  + V  + L+F+ GP   A  ++ + 
Sbjct  242   DQSITVLSSGGLGMAMFSLGLFMASRSSIIACGTRMGVLAMGLKFIGGPFLMAAASLAIG  301

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G  L++ IVQ+ALPQ +  F+FAKEY ++ D+LST +I G +++LP+ + Y+ +L L
Sbjct  302   LRGTQLRVAIVQAALPQGIVPFVFAKEYNIYPDILSTGVIFGMLIALPIALVYFFMLAL  360



>gb|EMS67819.1| Putative auxin efflux carrier component 5 [Triticum urartu]
Length=357

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 146/357 (41%), Positives = 217/357 (61%), Gaps = 2/357 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+ A  PLYVAMIL Y SI+WW +F P+ C  IN+F   F +P  +F  I+  
Sbjct  3     SWVAIYHVLEATTPLYVAMILAYLSIKWWKLFTPEQCSGINKFVANFSIPLLSFQVISTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN   + +D++ K++ ++     +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYDMNLKLIFADILQKSIALLGFAAISRACCAEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG     L+ Q   +Q+L+W T+LLF LEFR  + G  +A +     E      G  +
Sbjct  123   GMYGDEAVKLISQIVVLQSLIWYTLLLFLLEFRAAK-GIAAAPSSEIVDEEEAGTLGATQ  181

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +    G++         ++  ++  + ++L  NPN YAC +GLIWA+I+  W   +P II
Sbjct  182   QTYQEGQSKGVSARCSRAFRFLL-VIGMKLVMNPNIYACLIGLIWALISFRWQIQLPLII  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +SI I++ GG G+AMFS GLF ALQ +II+CG    +  L +RF +GPA   I +  + 
Sbjct  241   SNSIRILSDGGLGMAMFSLGLFTALQTKIIACGTKKMLLSLGIRFFLGPALMMISSYAVG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             + G +LK+ IVQ+ALPQ V  F+FAKEY +HAD+LSTAII+G ++++P  + YY ++
Sbjct  301   MRGILLKVAIVQAALPQGVVPFVFAKEYNVHADILSTAIIVGMMVAVPAALAYYFVI  357



>gb|KDO39721.1| hypothetical protein CISIN_1g035534mg [Citrus sinensis]
Length=291

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 202/313 (65%), Gaps = 28/313 (9%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKV+VAM PLY A++LGYGS++WW +  P+ C AINR  C+F LP FT  F   V
Sbjct  3     GWEDVYKVIVAMVPLYFALMLGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTTHV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGG-LDWSIttfslstlnntLVVGVPLM  859
             DP+ MNY F+ +D ++K ++V+ L  W+   K G    W IT FSL TL NTLV+GVPLM
Sbjct  63    DPFNMNYRFIGADAISKLIIVIVLAFWSMCSKKGSYFSWCITNFSLCTLTNTLVLGVPLM  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             +AMYG++  DLV+Q++  Q+++WLT+ LF LEFRR+         D+   E G     + 
Sbjct  123   KAMYGQMAVDLVVQSSVFQSIVWLTIFLFVLEFRRS-------GNDSKDLEEGHVTSSSR  175

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
                              P +  +MK V L+LAKNPN+YAC +GL WA +   WHF +PSI
Sbjct  176   -----------------PPFWHLMKVVWLKLAKNPNSYACVIGLAWAFVANRWHFKLPSI  218

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             I+ SI+IM+K G+G AMFS G    L +++++CG  LT  G+VL+F+ GPA  AIG+I  
Sbjct  219   IEGSILIMSKAGTGTAMFSMG---ELGEKLLACGPGLTALGMVLKFIAGPAAMAIGSIAA  275

Query  318   RLHGDVLKIVIVQ  280
              LHGDVL++ I+Q
Sbjct  276   GLHGDVLRVSIIQ  288



>ref|XP_008775592.1| PREDICTED: probable auxin efflux carrier component 1c [Phoenix 
dactylifera]
Length=357

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 145/356 (41%), Positives = 211/356 (59%), Gaps = 5/356 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
               +Y V+VA  PLY AMIL Y SI+WW +F PD C  IN+F   F +P  +FH I+  +P
Sbjct  5     ATVYHVLVATVPLYAAMILAYLSIKWWKLFTPDQCTGINKFVAKFSVPLLSFHVISTNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + +    + +     G LDW IT FSLSTL NTL++G+PL++ +
Sbjct  65    YKMNLKLLVADSLQKILALFVFAVLSKACFRGSLDWLITGFSLSTLPNTLIIGIPLLKGL  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W T+LL   EFR  +   I+A   ++  E+ +  EG     
Sbjct  125   YGDEAAKLLGQIVVLQSLIWYTLLLILFEFRAAK--AIAANPTDSTGELESS-EGVRPRP  181

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                     +  NI       M     +L  NPNTYA   G +WA+I+  W   +P II +
Sbjct  182   EEDEVKSLSIRNIRSLLILWMAGK--KLMINPNTYASLAGFVWALISFRWRIELPLIISN  239

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
              I I++ GG G+AMFS GLF A Q  II+CG  + +  + LRF+IGPA  AI +  + + 
Sbjct  240   CISILSDGGLGMAMFSLGLFTASQSSIIACGIRMMILSMGLRFIIGPALIAITSYAIGMR  299

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
               +LK+ IVQ+ALPQ + TF+FAKEYG+H D+LST +I+G I+++P+ + YY IL+
Sbjct  300   AKLLKVAIVQAALPQGIVTFVFAKEYGVHPDILSTGVIVGMIIAVPIALAYYFILD  355



>emb|CDM83606.1| unnamed protein product [Triticum aestivum]
Length=357

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 216/357 (61%), Gaps = 2/357 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+ A  PLYVAMIL Y SI+WW +F P+ C  IN+F   F +P  +F  I+  
Sbjct  3     SWVAIYHVLEATTPLYVAMILAYLSIKWWKLFTPEQCSGINKFVANFSIPLLSFQVISTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN   + +D++ K++ ++     +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYDMNLKLIFADILQKSIALLGFAAISRACCVEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG     L+ Q   +Q+L+W T+LLF LEFR  + G  +A +     E      G  +
Sbjct  123   GMYGDEAVKLISQIVVLQSLIWYTLLLFLLEFRAAK-GIAAAPSSEIVDEEEAGTLGATQ  181

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             +    G++         ++  ++  + ++L  NPN YAC +GLIWA+I+  W   +P I+
Sbjct  182   QTYQEGQSKGVSARCSRAFRFLL-VIGMKLVMNPNIYACLIGLIWALISFRWQIQLPLIV  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +SI I++ GG G+AMFS GLF ALQ +II+CG    +  L  RF +GPA   + +  + 
Sbjct  241   SNSIRILSDGGLGMAMFSLGLFTALQTKIIACGTKKMLLSLGFRFFLGPALMMVSSYAVG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             + G +LK+ IVQ+ALPQ V  F+FAKEY +HAD+LSTAII+G ++++P  + YY ++
Sbjct  301   MRGILLKVAIVQAALPQGVVPFVFAKEYNVHADILSTAIIVGMMVAVPAALAYYFVI  357



>ref|XP_004147461.1| PREDICTED: probable auxin efflux carrier component 1b-like [Cucumis 
sativus]
 ref|XP_004168626.1| PREDICTED: probable auxin efflux carrier component 1b-like [Cucumis 
sativus]
Length=357

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 215/359 (60%), Gaps = 8/359 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYVAM+L Y S++WW  F  + C  IN+F   F +P  +F  I++ + 
Sbjct  5     SDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVISENNL  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L         GGL+W IT  SLST+ NTL++G+P+++AM
Sbjct  65    YKMNRQLILADFLQKILAIILLGAVTKITSRGGLNWIITGLSLSTMPNTLILGLPVLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q++LW  +LLF  EF  T+   + A A  A  E+    EG PKE 
Sbjct  125   YGSEADVLLAQIVVLQSILWYNILLFLFEFTTTKAASL-APASEATAEIEITHEGRPKEE  183

Query  669   aaagetpaapTNIGPSY--TAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                          G S    +++ +V  +L  NPNT+A  LGLIWA I   W   +P +I
Sbjct  184   IEEARDRN-----GRSLRTKSILLTVARKLIINPNTHATILGLIWASIRFRWGVKLPEVI  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             D SI I++ GG G+AMFS GLFM  +  II+CG  +T+  + ++FL+GPA  A  ++ L 
Sbjct  239   DRSISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLVGPALMAACSLALG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G +L++ IVQ+ALPQ +  F+F+KEY +H DVLST +++G +++LPV + YY +L L
Sbjct  299   LRGKLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPVALAYYYLLSL  357



>ref|XP_002458404.1| hypothetical protein SORBIDRAFT_03g032850 [Sorghum bicolor]
 gb|EES03524.1| hypothetical protein SORBIDRAFT_03g032850 [Sorghum bicolor]
Length=362

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 220/368 (60%), Gaps = 22/368 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+    PLYVAMI+ Y SI+WW +F P+ C  IN+F   F +P  +F  ++  
Sbjct  3     SWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILSTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN   + SD++ K++ ++   + +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYNMNLKLIFSDILQKSLSLLGFAVISKACCKEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA-RPEMGT------  697
              MYG     L+ Q  A+Q+L+W T+LLF  EFR  R   I+ +++     E GT      
Sbjct  123   GMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSETTNEAESGTTGPMQQ  182

Query  696   -DLEGNPKeaaaagetpaapTNIGPSYTAM--MKSVCLRLAKNPNTYACFLGLIWAIITK  526
                EG  K  +               Y A   +  V  +L  NPN YA  +GLIWA+I+ 
Sbjct  183   RHEEGQEKRVS------------ARCYGAFQFLLVVGKKLVTNPNMYASLIGLIWALISF  230

Query  525   GWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPA  346
              W   +PSI+++SI I++ GG G+AMFS GLF ALQ +I++CG    +  L +RF +GPA
Sbjct  231   RWRIQLPSIVNNSIRILSDGGLGMAMFSLGLFTALQTKIVACGTKKMLLSLGIRFFLGPA  290

Query  345   TSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVM  166
                + +  + + G +LK+ I+Q+ALPQ +  F+FAKEY +HAD+LSTAII+G I+++PV 
Sbjct  291   LMVVSSYAIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMIVAVPVA  350

Query  165   IGYYVILE  142
             +GYY +++
Sbjct  351   LGYYFVMD  358



>tpg|DAA57876.1| TPA: hypothetical protein ZEAMMB73_331388 [Zea mays]
Length=362

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 217/363 (60%), Gaps = 12/363 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+    PLYVAMI+ Y SI+WW +F P+ C  IN+F   F +P  +F  ++  
Sbjct  3     SWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILSTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY+MN   + SDV+ K++ ++   + +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR---LGQISAAADNARPEMGTDLEG  685
              MYG     L+ Q  A+Q+L+W T+LLF  EFR  R   +   S A D A         G
Sbjct  123   GMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSEAIDEAE-------SG  175

Query  684   NPKeaaaagetpaapTNIGPSYTAM--MKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
              P       E   A       Y A   +  V  +L  NPN YA   GLIWA+I+  W   
Sbjct  176   TPGPMQQGHEEGQAKGVSARCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALISFRWRIQ  235

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             +PSI+++SI I++ GG G+AMFS G+F ALQ +I++CG    +  L +RF +GP    I 
Sbjct  236   LPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGIRFFLGPGLMVIS  295

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             + L+ + G +LK+ I+Q+ALPQ +  F+FAKEY +HAD+LSTAII+G ++++PV +GYY 
Sbjct  296   SYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPVALGYYF  355

Query  150   ILE  142
             +++
Sbjct  356   VMD  358



>ref|XP_003574813.1| PREDICTED: probable auxin efflux carrier component 4 [Brachypodium 
distachyon]
Length=370

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 235/368 (64%), Gaps = 8/368 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMF-KPDHCDAINRFNCffilpfftfhFIAQ  1039
              WGDI KVV AMAPLY A+ LGYGS RWWH+   P+ C A+N    FF +PFFTF F++ 
Sbjct  3     AWGDIRKVVSAMAPLYFALGLGYGSSRWWHLLASPEQCAAVNTLVAFFSMPFFTFDFVSG  62

Query  1038  VDPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLM  859
             VDP  +N+  +A+D +AK + ++A   WA   +     W IT FSL+TL+NTLVVGVPL+
Sbjct  63    VDPSAVNFRVLAADALAKLLAILAAWAWAWARQYDDWSWPITGFSLATLSNTLVVGVPLL  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR-LGQISAAADNARPEMGTDLEGN  682
             +AMYG    +L++Q A  Q+++W+ +LL   E R    +  +    +    + G D+E  
Sbjct  123   EAMYGDWARELMVQVAVAQSVVWVPLLLLAFELRNACCVLHLQPEPETKTKDGGGDVELA  182

Query  681   PKeaaaagetpaapTNIGPSYT------AMMKSVCLRLAKNPNTYACFLGLIWAIITKGW  520
                AA     P A    G          AM ++V +++A NPN YA  LG+ WA     W
Sbjct  183   AAAAARVERDPNARAGNGNGNKKIRRCWAMARTVGIKVASNPNVYASVLGVAWACAAYRW  242

Query  519   HFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATS  340
                MP ++  ++ +M++ G+G++MFS GL MA Q+R+++CG  L   G+ LRF+ GPA +
Sbjct  243   RVGMPGVVTGALQVMSRTGTGMSMFSMGLSMAQQERMVACGAGLAALGMALRFVAGPAAA  302

Query  339   AIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIG  160
               GA  + + G+VL+ V+VQ+ALPQ++ +F+FAKEYGLHADVLSTA+I GT+LSLPV+I 
Sbjct  303   LAGAAAMGIRGNVLRFVVVQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLLSLPVLIA  362

Query  159   YYVILELL  136
             YY +L+++
Sbjct  363   YYALLDII  370



>ref|XP_011098572.1| PREDICTED: auxin efflux carrier component 4 isoform X2 [Sesamum 
indicum]
 ref|XP_011098573.1| PREDICTED: auxin efflux carrier component 4 isoform X2 [Sesamum 
indicum]
Length=359

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 213/359 (59%), Gaps = 6/359 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y V++A+ PLYVAMI  Y SI+WW +F PD C  IN+F   F +P  +F  I+  +P
Sbjct  5     ADVYHVIIAIIPLYVAMIAAYLSIKWWKLFTPDQCAGINKFVANFSIPLLSFQVISSNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   V++D + K + ++ L + A     G L W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YRMNLKLVSADFLQKLLALIVLAVIAKLRSRGNLSWVITGLSLSTLPNTLILGIPLIRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEG--NPK  676
             YG     L+ Q   +Q+L+W  +LL   E   T      +    +  E+  +LEG   P+
Sbjct  125   YGEEAAILLAQIVVLQSLIWYNLLLILFEIDATE----ESINMTSPSEVTGELEGPQGPE  180

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                   E       +  +   ++ +V  +L +NPNT+A   GLIWA I   W   +P +I
Sbjct  181   RIDGDKEGGRFKNQMKRNIRIILLTVGKKLIRNPNTHATLAGLIWASIHFRWGVKLPKVI  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +S+ +++ GG G+AMFS GLFMA Q R+I+CG    V  + ++FL GP   A+ ++ L 
Sbjct  241   QNSVSLLSDGGLGMAMFSLGLFMASQARVIACGTRKAVLAMAMKFLAGPFLMAVPSVALG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G +LK+ IVQ+ALPQ +  F+FAKEY LH DVLST +I G ++++P+ + YY +L L
Sbjct  301   LRGTLLKVAIVQAALPQGIVPFVFAKEYNLHPDVLSTGVIFGLLIAVPIGLAYYFLLGL  359



>gb|KGN59594.1| hypothetical protein Csa_3G827360 [Cucumis sativus]
Length=356

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 216/359 (60%), Gaps = 9/359 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYVAM+L Y S++WW  F  + C  IN+F   F +P  +F  I++ + 
Sbjct  5     SDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVISENNL  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L         GGL+W IT  SLST+ NTL++G+P+++AM
Sbjct  65    YKMNRQLILADFLQKILAIILLGAVTKITSRGGLNWIITGLSLSTMPNTLILGLPVLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q++LW  +LLF  EF  T+   ++ A++    E+    EG PKE 
Sbjct  125   YGSEADVLLAQIVVLQSILWYNILLFLFEFTTTKAASLAPASEATEIEITH--EGRPKEE  182

Query  669   aaagetpaapTNIGPSY--TAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                          G S    +++ +V  +L  NPNT+A  LGLIWA I   W   +P +I
Sbjct  183   IEEARDRN-----GRSLRTKSILLTVARKLIINPNTHATILGLIWASIRFRWGVKLPEVI  237

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             D SI I++ GG G+AMFS GLFM  +  II+CG  +T+  + ++FL+GPA  A  ++ L 
Sbjct  238   DRSISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLVGPALMAACSLALG  297

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G +L++ IVQ+ALPQ +  F+F+KEY +H DVLST +++G +++LPV + YY +L L
Sbjct  298   LRGKLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPVALAYYYLLSL  356



>ref|NP_001168208.1| uncharacterized protein LOC100381964 [Zea mays]
 gb|ACN27457.1| unknown [Zea mays]
 tpg|DAA57877.1| TPA: hypothetical protein ZEAMMB73_331388 [Zea mays]
Length=359

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 217/360 (60%), Gaps = 9/360 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+    PLYVAMI+ Y SI+WW +F P+ C  IN+F   F +P  +F  ++  
Sbjct  3     SWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILSTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY+MN   + SDV+ K++ ++   + +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG     L+ Q  A+Q+L+W T+LLF  EFR  R   I+ +++           G P 
Sbjct  123   GMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSEAIE-------SGTPG  175

Query  675   eaaaagetpaapTNIGPSYTAM--MKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                   E   A       Y A   +  V  +L  NPN YA   GLIWA+I+  W   +PS
Sbjct  176   PMQQGHEEGQAKGVSARCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALISFRWRIQLPS  235

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             I+++SI I++ GG G+AMFS G+F ALQ +I++CG    +  L +RF +GP    I + L
Sbjct  236   IVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGIRFFLGPGLMVISSYL  295

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + + G +LK+ I+Q+ALPQ +  F+FAKEY +HAD+LSTAII+G ++++PV +GYY +++
Sbjct  296   IGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPVALGYYFVMD  355



>gb|AFK32346.1| putative auxin efflux carrier PIN8 [Zea mays]
Length=359

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 217/360 (60%), Gaps = 9/360 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+    PLYVAMI+ Y SI+WW +F P+ C  IN+F   F +P  +F  ++  
Sbjct  3     SWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILSTN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY+MN   + SDV+ K++ ++   + +        DW IT FSLSTL NTL+VG+PL++
Sbjct  63    NPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MYG     L+ Q  A+Q+L+W T+LLF  EFR  R   I+ +++           G P 
Sbjct  123   GMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSEAIE-------SGTPG  175

Query  675   eaaaagetpaapTNIGPSYTAM--MKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                   E   A       Y A   +  V  +L  NPN YA   GLIWA+I+  W   +PS
Sbjct  176   PMQQGHEEGQAKGVSARCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALISFRWRIQLPS  235

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             I+++SI I++ GG G+AMFS G+F ALQ +I++CG    +  L +RF +GP    I + L
Sbjct  236   IVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGVRFFLGPGLMVISSYL  295

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + + G +LK+ I+Q+ALPQ +  F+FAKEY +HAD+LSTAII+G ++++PV +GYY +++
Sbjct  296   IGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPVALGYYFVMD  355



>gb|EMT25709.1| Putative auxin efflux carrier component 5 [Aegilops tauschii]
Length=387

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 152/379 (40%), Positives = 222/379 (59%), Gaps = 42/379 (11%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             M PLYVAMIL YGS+RWW +   D C  INRF   F +P  +F  I+  + Y M+  F A
Sbjct  1     MVPLYVAMILAYGSVRWWGVITADQCAGINRFVAVFAVPLLSFKVISGSNLYAMDLRFAA  60

Query  1002  sdvvakamvvvalVIWANF-VKNGGLDWSIttfslstlnntLVVGVPLMQAMYGRLGYDl  826
             +D + K +V+ +L +W+   V   GLDWSIT FS +T+ NTL++G+PL+ AMYGR   DL
Sbjct  61    ADTLQKLLVLASLAVWSRLPVPFAGLDWSITVFSSATMPNTLIMGIPLLVAMYGRHAGDL  120

Query  825   vlqaaamqallwltmlLFGLEFRRTRL---GQISAAA---DNA--------RP-------  709
             ++Q   +Q ++W T+LLF  EFR  RL   G+  AAA    N+        RP       
Sbjct  121   MVQIVVLQCIIWCTLLLFLFEFRAARLLISGRFPAAAVADKNSNVNFVAANRPGATGGER  180

Query  708   --------------EMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCL----RLA  583
                           E GT+  G  +E     +         P  + M++ +      RL 
Sbjct  181   VKSGAAAQESLERLEAGTEATGKEQEQDETKKDGGEVGK--PPASVMLRLILTMVWRRLI  238

Query  582   KNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIIS  403
             +NPNTYA  +GL+W++I   +H TMP+I+  SI I++  G G+AMFS GLFMALQ ++I+
Sbjct  239   RNPNTYASVVGLVWSLIEFRYHVTMPAIVAKSISILSDAGLGMAMFSLGLFMALQPKLIA  298

Query  402   CGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLH  223
             CG ++    + +RFL+GPA  A+ +  + L G +L+I +VQ+ALPQ +  F+FAKEY LH
Sbjct  299   CGKSVAASTMAVRFLLGPAVMAVSSAAVGLRGTLLRIAVVQAALPQGIVPFVFAKEYNLH  358

Query  222   ADVLSTAIIIGTILSLPVM  166
             A +L T +I G +++LP++
Sbjct  359   AAILCTGVIFGMLIALPIV  377



>ref|XP_008673108.1| PREDICTED: uncharacterized protein LOC100381964 isoform X1 [Zea 
mays]
Length=410

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 217/363 (60%), Gaps = 12/363 (3%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  IY V+    PLYVAMI+ Y SI+WW +F P+ C  IN+F   F +P  +F  ++  
Sbjct  51    SWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILSTN  110

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY+MN   + SDV+ K++ ++   + +        DW IT FSLSTL NTL+VG+PL++
Sbjct  111   NPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPLLK  170

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR---LGQISAAADNARPEMGTDLEG  685
              MYG     L+ Q  A+Q+L+W T+LLF  EFR  R   +   S A D A         G
Sbjct  171   GMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSEAIDEAE-------SG  223

Query  684   NPKeaaaagetpaapTNIGPSYTAM--MKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
              P       E   A       Y A   +  V  +L  NPN YA   GLIWA+I+  W   
Sbjct  224   TPGPMQQGHEEGQAKGVSARCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALISFRWRIQ  283

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             +PSI+++SI I++ GG G+AMFS G+F ALQ +I++CG    +  L +RF +GP    I 
Sbjct  284   LPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGIRFFLGPGLMVIS  343

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             + L+ + G +LK+ I+Q+ALPQ +  F+FAKEY +HAD+LSTAII+G ++++PV +GYY 
Sbjct  344   SYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPVALGYYF  403

Query  150   ILE  142
             +++
Sbjct  404   VMD  406



>ref|XP_011005065.1| PREDICTED: putative auxin efflux carrier component 5 [Populus 
euphratica]
Length=356

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 146/357 (41%), Positives = 213/357 (60%), Gaps = 5/357 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY AMIL Y S+RWW +F PD C  IN F   F +P  +F  I+ ++P
Sbjct  5     ADVYHVVAATVPLYFAMILAYISVRWWKLFTPDQCAGINTFVAKFSIPLLSFQVISSINP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L   A     G L+W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGLPLLRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W  +LLF  E   T+   ++ ++     E   D E   +  
Sbjct  125   YGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATKEATVAPSS-----ETTGDQETLQESQ  179

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                GE   + T        ++ +V  +L +NPN YA  + LIWA I   W   +P I+D 
Sbjct  180   YKEGEEVQSRTRRKVKTMLILLTVGKKLMRNPNFYATMVALIWASIHFRWGVKLPDIVDK  239

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFMAL+ RIISCG  + V  + ++F++GPA  A+ +  +RL 
Sbjct  240   SIAILSTGGLGMAMFSLGLFMALRPRIISCGIRMAVVAMAVKFIVGPALMAVASFAVRLE  299

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G VL++ IVQ+ALPQ +  F+FAKEY +H D LST +I G ++++P+ + YY +L L
Sbjct  300   GTVLRVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLIAMPIALAYYSLLAL  356



>emb|CDM85668.1| unnamed protein product [Triticum aestivum]
Length=343

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 213/326 (65%), Gaps = 21/326 (6%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A APLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVK-----NGGLDWSIttfslstlnntLVVG  871
             DP+ +NY  VA+DV++KA++V  + +WA F+       G   WSIT FSLSTL N+LVVG
Sbjct  63    DPFQVNYRAVAADVISKAVIVAVIAVWARFLARNGNGKGAAGWSITGFSLSTLTNSLVVG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG------QISAAADNARP  709
             VP+ +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G      + S   D A P
Sbjct  123   VPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEVRKAAIGMYVDVGKTSVVHDAAMP  182

Query  708   E--MGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAI  535
             E  +  D+E  P  A   G          PS   ++K+V  +LA+NPNTYA F+G+ WA 
Sbjct  183   ESPVKADVEAAPTGAEEVGGK--------PSVWRLVKTVAHKLARNPNTYASFVGITWAC  234

Query  534   ITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLI  355
             +    H  +PS++++S++IM+K G+G+AMFS GLFMA Q++I++CG +    GL L+F +
Sbjct  235   VANRLHMELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQEKILACGPSYAALGLALKFGL  294

Query  354   GPATSAIGAILLRLHGDVLKIVIVQS  277
             GP   AIG+I + L GDVL++ I+Q+
Sbjct  295   GPVAMAIGSIAVGLRGDVLRVAIIQA  320



>ref|XP_011077192.1| PREDICTED: putative auxin efflux carrier component 8 [Sesamum 
indicum]
Length=417

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 137/167 (82%), Gaps = 4/167 (2%)
 Frame = -3

Query  636  NIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSG  457
            N+GP+    MK VC +L KNPN YAC +GLIWA++ K W F MPSI+D S+MIMAK GSG
Sbjct  254  NLGPT----MKKVCAKLGKNPNCYACAIGLIWALLAKRWDFEMPSIVDGSVMIMAKAGSG  309

Query  456  IAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQS  277
            +AMF+ GLFMALQ+++I+CG  LTVYG+ LRF+ GP T A+G++ L L  +VL+I ++Q+
Sbjct  310  VAMFTMGLFMALQEKVIACGVRLTVYGMFLRFVSGPLTVAVGSLALGLRSNVLRIAVIQA  369

Query  276  ALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
            ALPQA+ +F+FA+EYGLHA+VLSTA+I GTI+SLP++I YYV+L+++
Sbjct  370  ALPQAIASFVFAQEYGLHANVLSTAVIFGTIISLPLLIAYYVVLDVV  416


 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV  MAPLYVA+ LGYGS++WW MFKPD CDAINRFNC+FI+PFFTFHF A V
Sbjct  3     GWGDVYKVVACMAPLYVALALGYGSVKWWRMFKPDQCDAINRFNCYFIIPFFTFHFTAGV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             DPY MNY F+A+DV+AKA+    L +WAN  + G L W+IT+FSLS+LNNTLVVGVPL++
Sbjct  63    DPYHMNYRFLAADVIAKAIAGSVLALWANLCRKGDLSWAITSFSLSSLNNTLVVGVPLLE  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT  751
             AMYG +G DLV+Q++ +Q+LLW  +LLF L+F RT
Sbjct  123   AMYGPVGQDLVVQSSVLQSLLWFPILLFLLQFWRT  157



>ref|XP_006373306.1| hypothetical protein POPTR_0017s11440g [Populus trichocarpa]
 gb|ERP51103.1| hypothetical protein POPTR_0017s11440g [Populus trichocarpa]
Length=356

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 145/357 (41%), Positives = 212/357 (59%), Gaps = 5/357 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY AMIL Y S+RWW +F PD C  IN+F   F +P  +F  I+ ++P
Sbjct  5     ADVYHVVAATVPLYFAMILAYISVRWWKLFTPDQCAGINKFVAKFSIPLLSFQVISSINP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L   A     G L+W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGLPLLRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W  +LLF  E   T+   ++ ++     E   D E   +  
Sbjct  125   YGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATKEATVAPSS-----ETTGDQEALQESQ  179

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                G    + T        ++ +V  +L  NPN YA  + LIWA I   W   +P I+D 
Sbjct  180   YKEGGEVHSRTTRKVKAMLVLLTVGKKLMSNPNFYATMVALIWASIHFRWGVKLPDIVDK  239

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI+I++ GG G+AMFS GLFMAL+  IISCG  + V  + ++F++GPA  A+ +  +RL 
Sbjct  240   SIVILSTGGLGMAMFSLGLFMALRPSIISCGIRMAVVAMAMKFIVGPALMAVASFAVRLE  299

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G VLK+ IVQ+ALPQ +  F+FAKEY +H D LST +I G ++++P+ + YY +L L
Sbjct  300   GTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLIAMPIALAYYSLLAL  356



>ref|XP_010242365.1| PREDICTED: probable auxin efflux carrier component 1b [Nelumbo 
nucifera]
Length=357

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 211/357 (59%), Gaps = 6/357 (2%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y V+ A  PLY AMIL Y S++WW +F  D C  IN+F   F +P  +F  I+  +PY
Sbjct  6     DVYHVLAATIPLYFAMILAYVSLKWWKLFSADQCSGINKFVAKFSIPLLSFSVISANNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              M+   + +D + K +  + LVI A     G  DW IT  SLSTL NTL+VG+PL++AMY
Sbjct  66    QMDLKLILADGLQKLLAFLLLVILAKISSRGHTDWVITGLSLSTLPNTLIVGIPLLRAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G     L+ Q   MQ+L+W  +LLF  EFR         A++    E+  +LE   +   
Sbjct  126   GNKASALLSQIVVMQSLVWYNLLLFLFEFRAAE-----TASETPPLEVTGELEAPQEAQP  180

Query  666   aagetpaapTNIGPSYTAM-MKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
              A    A    +    T + + +V  +L +NPNT+A  +GLIWA+I+  W   +P I+++
Sbjct  181   KAVGEEAKARTLRKMNTKLILMTVGRKLVRNPNTHATLIGLIWAVISFRWRVKLPLIVNN  240

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFMA Q  II+CG       + ++FL+GPA   + +  + L 
Sbjct  241   SISILSDGGLGMAMFSLGLFMASQPSIIACGTRKAALAMGIKFLVGPALMVVSSYAIGLK  300

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
               + K+ IVQ+ALPQ +  F+FAKEY +H D+LST +I G +++LP+ + YY +L L
Sbjct  301   SILFKVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPIALAYYFLLGL  357



>ref|XP_007032452.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY03378.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=356

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 149/355 (42%), Positives = 209/355 (59%), Gaps = 5/355 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY AMIL Y S++WW +F P+ C  IN+F   F +P  +F  I++ +P
Sbjct  5     ADVYHVVAATVPLYFAMILAYTSVKWWKLFTPEQCAGINKFVAKFSIPLLSFQVISENNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K +  V L+    F   GGL   IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLILADFLQKLLAFVVLMAIEKFSSRGGLPSIITGLSLSTLPNTLILGIPLLRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W  +LLF  E   T+     AA++    +   DLE   +  
Sbjct  125   YGDKSATLLAQIVVLQSLIWYNILLFLYELNATK-----AASETPPSQDSGDLEAPEEAQ  179

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
             A  G   A           +  +V  +L  NPNT+A  LGLIWA I   W+   P+II+ 
Sbjct  180   AKEGGEEAHTRPRKSKAMLIFLTVGKKLMANPNTHATLLGLIWASIQFRWNIKFPAIIEK  239

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFMA +  II+CG  +    + ++F+ GPA  A  +  L L 
Sbjct  240   SIAILSSGGLGMAMFSLGLFMASRPSIIACGIRMAAVAMAMKFMAGPALMAASSAALGLR  299

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             G VL++ IVQ+ALPQ V  F+FAKEY +H DVLST +I G +++LPV + YY+IL
Sbjct  300   GKVLRVAIVQAALPQGVVPFVFAKEYNVHPDVLSTGVIFGLLIALPVALVYYLIL  354



>gb|AIF28458.1| PIN-like protein, partial [Xerophyta villosa]
Length=243

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  627  PSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAM  448
            PS+ ++MK V L+LA NPN+YA  +G+ WA I   WH  MPSI++ S++IM+K G+G+AM
Sbjct  79   PSFWSLMKIVWLKLAMNPNSYASIIGISWAFIANRWHIDMPSIMEGSVLIMSKAGTGMAM  138

Query  447  FSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALP  268
            FS GLFMA Q++I++CG +LTV+G++L+F+ GPA +AIGAI + L GD+L++ I+Q+A+P
Sbjct  139  FSMGLFMASQEKIVACGTSLTVFGMILKFVAGPAATAIGAIAVGLRGDILRVAIIQAAVP  198

Query  267  QAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
            Q++T+FIFA+EYGLHADVLSTA+I G + +LPV++ YYVIL L+
Sbjct  199  QSITSFIFAREYGLHADVLSTAVIFGMLAALPVLVAYYVILGLM  242



>gb|AGW52147.1| PIN13 [Populus tomentosa]
Length=355

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 212/357 (59%), Gaps = 6/357 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY AMIL Y S++WW +F PD C  IN+F   F +P  +F  I+ ++P
Sbjct  5     ADVYHVVTATVPLYFAMILAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVISGINP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L   A     G L+W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGIPLLRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W  +LLF  E   T+   ++ ++++       DLE   +  
Sbjct  125   YGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATKEATVAPSSEST-----GDLEALQEAQ  179

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E     T    +   ++ +V  +L  NPN YA  + LIWA I   W   +P I+D 
Sbjct  180   HKEDEGVQRRTRKVKAMVILL-TVVRKLMSNPNFYATLVALIWASIHSRWRVNLPDIVDK  238

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             S+ I++ GG G+AMFS GLFMA +  II+CG  + +  + ++F++GPA  A+ +I + L 
Sbjct  239   SVRILSTGGLGMAMFSLGLFMASRPSIIACGIRMAMVAMAMKFIVGPALMAVASIAVGLK  298

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G VLK+ IVQ+ALPQ +  F+FAKEY +H D LST +I G ++SLP+ + YY +L L
Sbjct  299   GTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLISLPIALAYYSLLAL  355



>ref|XP_010686765.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 129/357 (36%), Positives = 196/357 (55%), Gaps = 42/357 (12%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V+  + PLYV MI  YGS++WW +F P+    INRF   F +P  +  FI+  
Sbjct  3     SWKDLYNVLSNVVPLYVVMISAYGSVKWWKIFTPNEISGINRFVALFAVPLLSIKFISNN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN+ F+ +D + K +V++ L IW      G L+W IT FSLS L NTLVVG+PL+ 
Sbjct  63    NPYAMNFRFILADTLQKLIVILLLFIWCKLSSKGSLEWCITLFSLSALPNTLVVGIPLLG  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
              MY                       +  +E     + +    + N  P +G+       
Sbjct  123   GMYES-------------------SSVLKVEVHVETVAECKPKSTNTLPAVGSV------  157

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                              +   ++  VC +L +NPN Y+  + L W++I+  WH  +P+++
Sbjct  158   -----------------TTRQILIMVCKKLMRNPNFYSSLVALTWSLISFRWHVEIPAVV  200

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +SI I +  G G+AMFS GLFMA Q +IIS G  L      +RF++GPA +A  +  + 
Sbjct  201   ANSIKIFSDTGLGMAMFSLGLFMASQPKIISGGSALAALAAAMRFIVGPAITAATSSAIG  260

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             L G +L+I+I+Q+ALPQA+ +F+FA EY +H  VLSTA+  G ++SLP+ + YY+IL
Sbjct  261   LRGTLLQIIIMQAALPQAIVSFVFAHEYNVHPGVLSTAVSFGMLISLPITLVYYIIL  317



>gb|EYU34112.1| hypothetical protein MIMGU_mgv1a024604mg [Erythranthe guttata]
Length=350

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 206/357 (58%), Gaps = 11/357 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              ++Y V  A+ PLYVAMI  Y SI+WW +F PD C  IN+F   F +P  +F  I+  +P
Sbjct  5     ANVYHVFTAIIPLYVAMIAAYLSIKWWKLFTPDQCSGINKFVANFSIPLLSFQVISSNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN    ++D + K +  V L + A     G L W IT  SLSTL N+L++G+PL++AM
Sbjct  65    YKMNLKLASADFLQKLIAFVVLAVIARMRSRGSLSWIITGLSLSTLPNSLILGIPLIRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W  +LL   E           AA+   P        NP+  
Sbjct  125   YGDEAAVLLAQIVVLQSLVWYNLLLILFEID---------AANAVPPSQVPGESENPQVP  175

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                       +    S   ++ +V  +L  NPNT+A   GL+W+ I   W   +P +I++
Sbjct  176   EPITNGVKHQSE--RSIRIILLTVGKKLITNPNTHATLAGLVWSSIHFRWEVKLPKVIEN  233

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI++++ GG G+AMFS GLFMA Q R+I+CG    V  + L+F+ GP+  A+ +I L L 
Sbjct  234   SILLLSNGGLGMAMFSLGLFMASQARLIACGTRKAVLAMALKFIAGPSLMAVPSIALGLR  293

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G +LK+ +VQ+ALPQ +  F+FAKEY  H D+LSTA+I G ++++P+ + YY +L L
Sbjct  294   GTLLKVALVQAALPQGIVPFVFAKEYNRHPDILSTAVIFGMLVAVPIGLAYYFLLAL  350



>gb|AIF28442.1| PIN-like protein, partial [Freycinetia multiflora]
Length=399

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 148/395 (37%), Positives = 223/395 (56%), Gaps = 38/395 (10%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+Y V+ A+ PLY  + L Y ++RWW +F  + C  INRF   F +P   F FI+++D 
Sbjct  5     GDLYNVLSALVPLYFVIFLAYAAVRWWKLFTAEQCAGINRFVAMFAVPLLNFEFISRIDL  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
               M+  F+++D ++K +V+VAL  WA     G L+W IT FSL TL NTL++G+PL++AM
Sbjct  65    SKMDLPFISADTLSKILVLVALFAWARMSPKGSLEWCITLFSLCTLPNTLLMGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFR--------RTRLGQISAAADNAR------  712
             YG     L+ Q   +Q ++W TML+F  E+R        R R   + +    AR      
Sbjct  125   YGDEQESLMTQVVVLQGMIWYTMLIFLYEYRAASNAIAQRFRESSVKSVCSEARNVGKEE  184

Query  711   ----------PEMGTDL------EGNPKeaaaa------getpaapTNIGPSYTA--MMK  604
                        ++G  +      E N K                   +  PS T   +++
Sbjct  185   AAHVVIACNSEDLGAQMGACSRDEDNKKAEKKLGYGEVGAAKKYVEKSTMPSGTIGFILR  244

Query  603   SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMA  424
              V  +L KNPN YA   GL WA+ +  W+   P I+++S+ I++    G+AMFS G FMA
Sbjct  245   MVWYKLMKNPNFYASVGGLCWALASSRWNIKKPMIMENSVTILSNCALGVAMFSLGNFMA  304

Query  423   LQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIF  244
             LQ + I+CG  +  YG+ +RF++GPA  A+ ++++ + G  LK+ I+Q+ALPQAV  F+F
Sbjct  305   LQPKFIACGNKMAAYGMFIRFIVGPAIMALASLVVGIGGKELKVSIIQAALPQAVVPFVF  364

Query  243   AKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             A+EY +H + LST ++ G I+SLPV I YYV LEL
Sbjct  365   AREYDVHPEELSTVVMFGMIVSLPVTILYYVFLEL  399



>ref|XP_008664247.1| PREDICTED: LOW QUALITY PROTEIN: probable auxin efflux carrier 
component 4 [Zea mays]
Length=364

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 233/368 (63%), Gaps = 16/368 (4%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             WGDIY VV  MAPLY A++LGYGS+RWW +F    C AIN     F +PFFT  F+A+ D
Sbjct  4     WGDIYNVVSGMAPLYFALVLGYGSVRWWRLFTAAQCGAINTLVANFSMPFFTLDFLARAD  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MNY  +A+D V+KA++ VA         +    W+IT FSL+  NNTLVVGVPL+ A
Sbjct  64    PYAMNYRVLAADAVSKALLAVAA---GGGAGSRSSSWAITGFSLAGFNNTLVVGVPLLFA  120

Query  852   MYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAA---------ADNARPEMG  700
             MYG+   DLV+Q A +QAL+W  +LL G E RR  +G +  A           +   +  
Sbjct  121   MYGKWAQDLVVQVAVVQALVWFPLLLLGFELRRAWVGGVPRAQGVGVGVGRCSSDDDDGD  180

Query  699   TDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGW  520
               L G  + A       A    + P+    +++V L+L  NP  YA  +G++WA I   W
Sbjct  181   GHLGGREEAADDDAPAAAGAIRLWPT----VRTVGLKLVGNPXVYASVVGVVWACIAYRW  236

Query  519   HFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATS  340
               ++P I+  S+ +M++ G+G++MFS G+FMA Q+R+I+CG  L   GL LRF+ GP  +
Sbjct  237   DLSLPGIVTGSLGVMSRTGTGMSMFSMGMFMAQQERVIACGAGLAALGLALRFVAGPLAT  296

Query  339   AIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIG  160
              +GA    L GDVL+  I+Q+ALPQ++ +F++AKEYG+HADVLSTA+I+GT++SLPV+I 
Sbjct  297   LVGAAAFGLRGDVLRFAIIQAALPQSIASFVYAKEYGVHADVLSTAVILGTLVSLPVLIA  356

Query  159   YYVILELL  136
             YY +L +L
Sbjct  357   YYAVLGIL  364



>ref|XP_006482537.1| PREDICTED: putative auxin efflux carrier component 5-like [Citrus 
sinensis]
Length=354

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 135/356 (38%), Positives = 201/356 (56%), Gaps = 7/356 (2%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D Y VV A  PLYVAM+L Y S++WW +F PD C  IN+F   F +P  +F  I++ +PY
Sbjct  6     DAYHVVAACVPLYVAMLLAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVISKNNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN   + +D + K +  + LV        GGL W IT  SLSTL N+L++G+PL++AMY
Sbjct  66    KMNLKLIYADFLQKLLAFLVLVAITKISSRGGLRWIITGLSLSTLPNSLILGIPLLRAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
                           Q ++  +++ + L      L    +A+    PE   + + +  +  
Sbjct  126   SE-----EAALLLAQIVVLQSLIWYNLLLFLFELNAAKSASVTPNPETPEEHDASQAKEG  180

Query  666   aagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidds  487
                      T +    T ++ +V  +L  NPNT+A  LGLIWA I   W   +P+IID S
Sbjct  181   EEEAQNRTATRV--RTTHILLTVGRKLIINPNTHATLLGLIWASIEFRWGVKLPAIIDQS  238

Query  486   imiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHG  307
             + I++ GG G+AMFS GLFMA +  II+CG  +    + L+F++GPA  A  +  + L G
Sbjct  239   VRILSNGGLGMAMFSLGLFMASRPSIIACGTRMAAAAMALKFIVGPALMAASSFAIGLRG  298

Query  306   DVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              + KI  VQ+ALPQ +  F+FAKEY +H D+LST ++ G I++LPV + YY +L L
Sbjct  299   TLFKIAFVQAALPQGIVPFVFAKEYNVHPDILSTGVLFGMIITLPVTLAYYFLLAL  354



>gb|KDP45475.1| hypothetical protein JCGZ_09724 [Jatropha curcas]
Length=357

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 205/361 (57%), Gaps = 12/361 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY AM+L Y S++WW +F PD C  IN F   F +P  +F  I+  +P
Sbjct  5     ADVYHVVAATIPLYFAMMLAYISMKWWRLFTPDQCAGINMFVAKFSIPLLSFQVISSNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + V+ L         G L+W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLILADFLQKILAVLVLTAITKISSRGRLNWVITGLSLSTLPNTLILGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA----DNARPEMGTDLEGN  682
             YG     L+ Q   +Q+L+W  +LLF  E   T    ++ ++    D   PE     EG 
Sbjct  125   YGEEADSLLSQIIVLQSLVWYNLLLFLFELNATYAAPVTPSSETTEDQEAPEEAQLKEGE  184

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
              +                     ++ +V  +L +NPN +A  LGLIWA I   W   +P 
Sbjct  185   DETHTRPTRRVKTML--------ILLTVGKKLLRNPNFHATSLGLIWASIHFRWEVKLPD  236

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             ++D SI I++ GG G+AMFS GLFMA +  II+CG  + +  + ++F+ GPA  A+ +  
Sbjct  237   VVDQSIRILSTGGLGMAMFSLGLFMASRTSIIACGIRMAIVSMAIKFISGPALMAVSSFA  296

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             L L G V K+ IVQ+ALPQ +  F+FAKEY +H D+LST +I G +++LP+ + YY +L 
Sbjct  297   LVLKGTVFKVAIVQAALPQGIVPFVFAKEYNIHPDILSTGVIFGMLIALPIALAYYSLLA  356

Query  141   L  139
             L
Sbjct  357   L  357



>ref|XP_002305371.1| hypothetical protein POPTR_0004s12310g [Populus trichocarpa]
 gb|EEE85882.1| hypothetical protein POPTR_0004s12310g [Populus trichocarpa]
Length=355

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 212/357 (59%), Gaps = 6/357 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY AMIL Y S++WW +F PD C  IN+F   F +P  +F  I+ ++P
Sbjct  5     ADVYHVVTATVPLYFAMILAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVISGINP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L   A     G L+W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGIPLLRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             +G     L+ Q   +Q+L+W  +LLF  E   T+   ++ ++++       DLE   +  
Sbjct  125   HGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATKEATVAPSSEST-----GDLEALQEAQ  179

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E     T    +   ++ +V  +L  NPN YA  + LIWA I   W   +P I+D 
Sbjct  180   HKDDEGVQRRTRKVKAMVILL-TVGRKLMSNPNFYATLVALIWASIHSRWGVNLPDIVDK  238

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             S+ I++ GG G+AMFS GLFMA +  II+CG  + +  + ++F++GPA  A+ +I + L 
Sbjct  239   SVRILSTGGLGMAMFSLGLFMASRPSIIACGIRMAMVAMAMKFIVGPALIAVASIAVGLK  298

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G VLK+ IVQ+ALPQ +  F+FAKEY +H D LST +I G ++S+P+ + YY +L L
Sbjct  299   GTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLISMPIALAYYSLLAL  355



>ref|XP_007151202.1| hypothetical protein PHAVU_004G026500g [Phaseolus vulgaris]
 gb|ESW23196.1| hypothetical protein PHAVU_004G026500g [Phaseolus vulgaris]
Length=361

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 210/362 (58%), Gaps = 12/362 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYV M+L Y S++WW +F P+ C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADVYHVVTATVPLYVTMVLAYISVKWWKLFTPEQCSGINKFVANFSVPILSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   V +D V K +  +           GGL W IT  SLSTL NTL++G+PLM+AM
Sbjct  65    YKMSLKLVYADFVQKLLAFLIFTAIIKIKGRGGLKWIITGLSLSTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFR-----RTRLGQISAAADNARPEMGTDLEG  685
             Y      L+ Q   +Q++LW  +LLF  E       RT       + D    E   +++ 
Sbjct  125   YRDEASLLLPQIIFLQSMLWYNLLLFLHELDAAIPARTMPVVAPPSQDTGESETSQEIQS  184

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
               +E     ++      I      +MK V  +L  NPNTYA F+GLIWA I   W   MP
Sbjct  185   KEEEEEHRTQSKTRMLLI------LMK-VGNKLTINPNTYATFIGLIWASIHFRWGVDMP  237

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
              +++ SI I+A GG G+A FS GLFMA  +RII+CG  +T+  + L+FL+GPA  A+ +I
Sbjct  238   DVVNQSIEILASGGLGMATFSLGLFMASNNRIIACGPRMTMVAMGLKFLVGPAIMAVASI  297

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             ++ L   +LK+ I+Q+ALPQ +  F+FA+EY +H  +LST +++G +++LPV + YY++L
Sbjct  298   VIGLRDRMLKVAIIQAALPQGIVPFVFAREYNVHPGILSTGVLLGMLMALPVALTYYLLL  357

Query  144   EL  139
              L
Sbjct  358   SL  359



>gb|EMT05834.1| Putative auxin efflux carrier component 6 [Aegilops tauschii]
Length=334

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 214/328 (65%), Gaps = 15/328 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A APLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFV-KNGG----LDWSIttfslstlnntLVVG  871
             DP+ +NY  VA+DV++KA++V  + +WA  + +NGG      WSIT FSLSTL N+LVVG
Sbjct  63    DPFQVNYRAVAADVISKAVIVAVIAVWARLLGRNGGGKGAAGWSITGFSLSTLTNSLVVG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG------QISAAADNARP  709
             VP+ +AMYG     LV+Q +  QA++WL  LLF LE R+  +G      + +   D A P
Sbjct  123   VPMARAMYGEWAQQLVVQLSVFQAIVWLPFLLFVLEVRKAAIGMYVDVGRKNVVHDAAMP  182

Query  708   E--MGTDLEGNPKeaaaagetpaapTNIG--PSYTAMMKSVCLRLAKNPNTYACFLGLIW  541
             E  +  D+E      A A         +G  PS   ++K+V  +LA+NPNTYA F+G+ W
Sbjct  183   ESRIKADVEAAAGGGAVAVLVVGGAEEVGGKPSVWRLVKTVAHKLARNPNTYASFVGITW  242

Query  540   AIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRF  361
             A +    H  +PS++++S++IM+K G+G+AMFS GLFMA Q++I++CG +    GL L+F
Sbjct  243   ACVANRLHMELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQEKILACGPSYAALGLALKF  302

Query  360   LIGPATSAIGAILLRLHGDVLKIVIVQS  277
              +GP   AIG+I + L GDVL++ I+Q+
Sbjct  303   GLGPVAMAIGSIAVGLRGDVLRVAIIQA  330



>ref|XP_011098571.1| PREDICTED: probable auxin efflux carrier component 2 isoform 
X1 [Sesamum indicum]
Length=362

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 205/350 (59%), Gaps = 9/350 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y V++A+ PLYVAMI  Y SI+WW +F PD C  IN+F   F +P  +F  I+  +P
Sbjct  5     ADVYHVIIAIIPLYVAMIAAYLSIKWWKLFTPDQCAGINKFVANFSIPLLSFQVISSNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   V++D + K + ++ L + A     G L W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YRMNLKLVSADFLQKLLALIVLAVIAKLRSRGNLSWVITGLSLSTLPNTLILGIPLIRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEG--NPK  676
             YG     L+ Q   +Q+L+W  +LL   E   T      +    +  E+  +LEG   P+
Sbjct  125   YGEEAAILLAQIVVLQSLIWYNLLLILFEIDATE----ESINMTSPSEVTGELEGPQGPE  180

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                   E       +  +   ++ +V  +L +NPNT+A   GLIWA I   W   +P +I
Sbjct  181   RIDGDKEGGRFKNQMKRNIRIILLTVGKKLIRNPNTHATLAGLIWASIHFRWGVKLPKVI  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
              +S+ +++ GG G+AMFS GLFMA Q R+I+CG    V  + ++FL GP   A+ ++ L 
Sbjct  241   QNSVSLLSDGGLGMAMFSLGLFMASQARVIACGTRKAVLAMAMKFLAGPFLMAVPSVALG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVM  166
             L G +LK+ IVQ+ALPQ +  F+FAKEY LH DVLST  +   ILS+ VM
Sbjct  301   LRGTLLKVAIVQAALPQGIVPFVFAKEYNLHPDVLSTGYL---ILSVTVM  347



>gb|AIF28463.1| PIN-like protein, partial [Nuphar advena]
Length=172

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  627  PSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAM  448
            PS   +MK V L+LA NPN+YA  +G++WA I+  WHF MPS+++ S+ I++K G G+AM
Sbjct  10   PSVRTIMKVVWLKLALNPNSYASIVGVVWAFISNRWHFGMPSLMEGSVTILSKAGGGMAM  69

Query  447  FSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALP  268
            FS G+FMA Q++ ++CG +L V+GLVLRF++GPA  AI +I++ L G VL++ I+Q+A+P
Sbjct  70   FSMGVFMAQQEKFVACGPSLAVFGLVLRFVVGPAAMAIASIVVGLRGTVLRVAIIQAAVP  129

Query  267  QAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
            Q++T+FI+A+EY LHA+VLSTA+I G I+ LP++I YYVIL
Sbjct  130  QSITSFIYAREYDLHAEVLSTAVIFGIIVCLPLLIAYYVIL  170



>ref|XP_007139602.1| hypothetical protein PHAVU_008G043700g [Phaseolus vulgaris]
 gb|ESW11596.1| hypothetical protein PHAVU_008G043700g [Phaseolus vulgaris]
Length=359

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 204/359 (57%), Gaps = 6/359 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D Y VV A  PLYV MIL Y S++WW +F PD C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADAYHVVAATLPLYVTMILAYVSVKWWKIFTPDQCSGINKFVAKFSIPLLSFQIISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   V +D V K++  + L+        GGL W IT  SL+TL NTL++G+PLM+AM
Sbjct  65    YDMSLKLVYADFVQKSLAFLVLIAITKISGRGGLKWIITGLSLTTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAA--DNARPEMGTDLEGNPK  676
             Y      L+ Q   +Q+++W  +LLF  E        ++AA     +  E   D E   K
Sbjct  125   YKGEAVVLLAQIIFLQSMIWYNLLLFLYELDAVNTRPVAAAPPPQGSAGETDRDREVQSK  184

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                 A         + P    ++  V  +L KNPNTYA  +G IW+ I   W   MP ++
Sbjct  185   GEEDADPRTKRKLKVLP----ILAKVGKKLIKNPNTYATLVGFIWSSIHFRWGLHMPEVV  240

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
               SI I++ GG G+AMFS GLFMA Q  II+CG  +T+  + L+ ++GP    + ++L+ 
Sbjct  241   TQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMTMVAIGLKVVVGPGLMTVASLLIG  300

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L   + K+ IVQ+ALPQ +  F+FAKEY +H  VLSTAI++G +++LPV + +Y +L +
Sbjct  301   LRNTLFKVTIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPVELAFYFLLAI  359



>gb|KCW58740.1| hypothetical protein EUGRSUZ_H01382 [Eucalyptus grandis]
Length=262

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 177/268 (66%), Gaps = 13/268 (5%)
 Frame = -3

Query  927  DWSIttfslstlnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR  748
             W ITTFSL TL N L+VGVPL++AMYG++G D+V+Q + MQA+LW  +LL  LEFR+  
Sbjct  4    SWCITTFSLLTLTNVLIVGVPLLRAMYGQVGVDIVVQLSVMQAVLWFPLLLCFLEFRKMG  63

Query  747  LG----QISAAADNARPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAK  580
            +       SA  D+  P    D+EG  +             +  P     +K V  +LA 
Sbjct  64   MDYSPTTTSATTDDLVPG-EKDVEGTAEAVRTN--------STRPRLWTAVKIVAPKLAL  114

Query  579  NPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISC  400
            NPN YAC +G+ WA+I   +   MP I+ +SI I+++ G G AMF+ G+F+A+Q ++I+C
Sbjct  115  NPNIYACIIGVAWAVIAHRFKVKMPGIVKESIEILSRAGLGTAMFNIGIFIAMQRKVIAC  174

Query  399  GWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHA  220
            G  LT  G+VLRF+ GPA   + + ++ L GDVL++ I+Q+ALPQ++TTFIFAKEYGLHA
Sbjct  175  GVKLTFVGMVLRFIAGPALMTVSSFIMGLRGDVLRMAIMQAALPQSITTFIFAKEYGLHA  234

Query  219  DVLSTAIIIGTILSLPVMIGYYVILELL  136
             VLSTA++ GT+ SLP++I YY  LE++
Sbjct  235  SVLSTAVVFGTLASLPLLIAYYAALEVM  262



>ref|XP_010686764.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 144/412 (35%), Positives = 223/412 (54%), Gaps = 55/412 (13%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V+  + PLYV MI  YGS++WW +F P+    INRF   F +P  +  FI+  
Sbjct  3     SWKDLYNVLSNVVPLYVVMISAYGSVKWWKIFTPNEISGINRFVALFAVPLLSIKFISNN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN+ F+ +D + K +V++ L IW      G L+W IT FSLS L NTLVVG+PL+ 
Sbjct  63    NPYAMNFRFILADTLQKLIVILLLFIWCKLSSKGSLEWCITLFSLSALPNTLVVGIPLLG  122

Query  855   AMYG-RLGYDlvlqaaamqallwltmlLFGLEFRR---------TRLGQISAAA-----D  721
              MYG  L   L++Q + +Q  +W  ++LF  E+RR         T +   S+++     +
Sbjct  123   GMYGEELSQSLMVQLSVIQFNIWFPIMLFLYEYRRATVLIPEQETEISTNSSSSHECSKN  182

Query  720   NARPEMGTDLEGN-------PKeaaaagetpaapTNIGPSYTAMMKSV------------  598
             +    +  D E +       P  ++          NI P+ ++ +  V            
Sbjct  183   DCSQTLKYDEEKDLDNVSVLPSRSSNKIIDHDNEENICPTESSSVLKVEVHVETVAECKP  242

Query  597   ---------------------CLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsim  481
                                  C +L +NPN Y+  + L W++I+  WH  +P+++ +SI 
Sbjct  243   KSTNTLPAVGSVTTRQILIMVCKKLMRNPNFYSSLVALTWSLISFRWHVEIPAVVANSIK  302

Query  480   iMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDV  301
             I +  G G+AMFS GLFMA Q +IIS G  L      +RF++GPA +A  +  + L G +
Sbjct  303   IFSDTGLGMAMFSLGLFMASQPKIISGGSALAALAAAMRFIVGPAITAATSSAIGLRGTL  362

Query  300   LKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             L+I+I+Q+ALPQA+ +F+FA EY +H  VLSTA+  G ++SLP+ + YY+IL
Sbjct  363   LQIIIMQAALPQAIVSFVFAHEYNVHPGVLSTAVSFGMLISLPITLVYYIIL  414



>ref|XP_003552512.1| PREDICTED: auxin efflux carrier component 3-like [Glycine max]
 gb|KHN13653.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=359

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 207/363 (57%), Gaps = 14/363 (4%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D Y VV A  PLYV +IL Y S++WW +F PD C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADAYHVVAATVPLYVTLILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + +D + K +  + L+        GGL W IT  SL+TL NTL++G+PLM+AM
Sbjct  65    YKMSLKLMYADFLQKLLAFLLLIAITKISGRGGLKWIITGLSLTTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             Y      L+ Q   +Q+++W  +LLF  E       + +AAA  ++    TD     +  
Sbjct  125   YKGEAVVLLAQIIFLQSMIWYNLLLFLYELDAVNKTRPTAAAPPSQGSGETDTAREVQSK  184

Query  669   aaagetpaapTNIGPSYTAMMK------SVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
                        +  P     MK      +V  +L +NPNTYA  LG IW+ I   W   M
Sbjct  185   REE--------DAEPRIKRKMKVMLILVTVGKKLIRNPNTYATLLGFIWSSIQFRWGLHM  236

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P +++ SI I++ GG G+AMFS GLFMA Q  II+CG  +T+  + L+ ++GPA  A+ +
Sbjct  237   PEVVNQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMTMVAIGLKVVLGPALMAVAS  296

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
             +++ L   + K+ IVQ+ALPQ +  F+FAKEY +H  VLSTAI++G +++LPV + +Y +
Sbjct  297   LVIGLRDKLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPVELAFYFL  356

Query  147   LEL  139
             L +
Sbjct  357   LAI  359



>ref|XP_011009448.1| PREDICTED: putative auxin efflux carrier component 5 [Populus 
euphratica]
Length=355

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 206/347 (59%), Gaps = 6/347 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             GD+Y VV A  PLY AMIL Y S+RWW +F PD C  IN+F   F +P  +F  I+ ++P
Sbjct  5     GDVYHVVTATVPLYFAMILAYISVRWWKLFTPDQCAGINKFVAKFSIPLLSFQVISGINP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L   A     G L+W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGIPLLRAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q+L+W  +LLF  E   T+   ++ ++++       DLE   +  
Sbjct  125   YGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATKEATVAPSSEST-----GDLEALQEAQ  179

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E     T    +   ++ +V  +L  NPN YA  + LIWA I   W   +P I+D 
Sbjct  180   HKEDEGVQRRTRKVKAMVILL-TVGRKLMSNPNFYATLVALIWASIHSRWGVNLPDIVDK  238

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             S+ I++ GG G+AMFS GLFMA +  II+CG  + +  + ++F++GPA  A+ +I   L 
Sbjct  239   SVRILSTGGLGMAMFSLGLFMASRPSIIACGIRMAMVAMAMKFIVGPALMAVASIAGGLK  298

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
             G VLK+ IVQ+ALPQ +  F+FAKEY +H D LST +I G ++S+P+
Sbjct  299   GTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLISMPI  345



>ref|NP_001063602.1| Os09g0505400 [Oryza sativa Japonica Group]
 dbj|BAF25516.1| Os09g0505400 [Oryza sativa Japonica Group]
 gb|EEC84847.1| hypothetical protein OsI_31952 [Oryza sativa Indica Group]
Length=398

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 231/402 (57%), Gaps = 64/402 (16%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             MAPLY A+ LGYGS+RWW +F  D CDA+NR    F +PFF F F A++DP+ ++Y  +A
Sbjct  1     MAPLYFALGLGYGSVRWWRLFTADQCDAVNRLVACFAVPFFAFDFAARIDPFALSYRVLA  60

Query  1002  sdvvakamvvvalVIWANFVKN-------------GGLDWSIttfslstlnntLVVGVPL  862
             +D ++K  V +AL   A                  GG  W IT FSL+TLNNTLVVGVPL
Sbjct  61    ADALSKLAVALALAACAAAASTRCCGSGGGKRGGGGGFSWCITGFSLATLNNTLVVGVPL  120

Query  861   MQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGN  682
             + AMYG+   DL++Q + +Q +++  +LL   E RR      +        +     +G 
Sbjct  121   LDAMYGKWARDLIVQISVVQTIVYFPLLLLAFEVRRATTAAAAPPPPPTGTDDDDVEDGA  180

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                A AA            S   ++++V L++A+NPN YA  LG+ WA +T  WH   PS
Sbjct  181   AAAATAAAARR--------SLWPLVRAVWLKVARNPNVYAGVLGVAWACVTNRWHVETPS  232

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             II+ S++IM+K G G++MFS GLFMALQD+II CG  LTV G+ LRF+ GPA +A+GA  
Sbjct  233   IIEGSVLIMSKTGVGLSMFSMGLFMALQDKIIVCGAGLTVLGMALRFVAGPAATAVGAFA  292

Query  321   LRLHGDVLKIVIV-------------------------------------------QSAL  271
             L L GD+L++ I+                                           Q+AL
Sbjct  293   LGLRGDLLRLAIIQAYTHLHEIHSPSSFFLLSPEICLNSNGCMHDTSPHDETARDEQAAL  352

Query  270   PQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             PQ++TTF+FAKEYGLHA++LSTA+I GT+ SLPV+I YY++L
Sbjct  353   PQSITTFVFAKEYGLHAEILSTAVIFGTLASLPVLIVYYIVL  394



>ref|XP_006431075.1| hypothetical protein CICLE_v10012051mg [Citrus clementina]
 gb|ESR44315.1| hypothetical protein CICLE_v10012051mg [Citrus clementina]
 gb|KDO72484.1| hypothetical protein CISIN_1g018360mg [Citrus sinensis]
Length=357

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 202/359 (56%), Gaps = 10/359 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D Y VV A  PLYVAM+L Y S++WW +F PD C  IN+F   F +P  +F  I++ +PY
Sbjct  6     DAYHVVAACVPLYVAMLLAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVISKNNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN   + +D + K +  + LV         GL W IT  SLS+L N+L++G+PL++AMY
Sbjct  66    KMNLKLIYADFLQKLLAFLVLVALTKISSRSGLRWIITGLSLSSLPNSLILGIPLLRAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
                      +AA + A + +   L             +A + +  P   T  E +  + +
Sbjct  126   SE-------EAALLLAQIVVLQSLIWYNLLLFLFELNAAKSASVTPNPETPEEHDASQES  178

Query  666   aagetpaapTNIGPSY---TAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
              A E      N   +    T ++ +V  +L  NPNT+A  LGLIWA I   W   +P+II
Sbjct  179   QAKEGEEEAQNRTATRVRTTHILLTVGRKLIINPNTHATLLGLIWASIEFRWGVKLPAII  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             D S+ I++ GG G+AMFS GLFMA +  II+CG  +    + L+F++GPA  A  +  + 
Sbjct  239   DQSVRILSNGGLGMAMFSLGLFMASRPSIIACGTRMAAVAMALKFIVGPALMAASSFAIG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G + KI  VQ+ALPQ +  F+FAKEY +H D+LST ++ G I++LPV + YY +L L
Sbjct  299   LRGTLFKIAFVQAALPQGIVPFVFAKEYNVHPDILSTGVLFGMIITLPVTLAYYFLLAL  357



>ref|XP_008443437.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X1 [Cucumis melo]
Length=357

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 211/357 (59%), Gaps = 4/357 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYVAM+L Y S++WW  F  + C  IN+F   F +P  +F  I+  + 
Sbjct  5     SDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVISDNNL  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L         GGL+W IT  SLST+ NTL++G+P+++AM
Sbjct  65    YKMNLQLILADFLQKILAIILLGAITKITSRGGLNWIITGLSLSTMPNTLILGLPVLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q++LW  +LLF  EF  T+   + A A  A  E+    EG  KE 
Sbjct  125   YGSEADVLLAQIVVLQSILWYNILLFLFEFTTTKAASL-APASEATAEIEITQEGRAKEE  183

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                               +++ +V  +L  NPNT+A  LGLIW+ I   W   +P +ID 
Sbjct  184   IEEARDRNGR---SLKTKSILLTVARKLIINPNTHATILGLIWSSIRFRWGVKLPVVIDR  240

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFM  +  II+CG  +T+  + ++FL+GPA  A  ++ L L 
Sbjct  241   SISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLMGPALMAACSLALGLR  300

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G +L++ IVQ+ALPQ +  F+F+KEY +H DVLST +++G +++LPV + YY +L L
Sbjct  301   GRLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPVALAYYYLLSL  357



>gb|EAZ45288.1| hypothetical protein OsJ_29930 [Oryza sativa Japonica Group]
Length=370

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 226/402 (56%), Gaps = 92/402 (23%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             MAPLY A+ LGYGS+RWW +F  D CDA+NR    F +PFF F F A++DP+ ++Y  +A
Sbjct  1     MAPLYFALGLGYGSVRWWRLFTADQCDAVNRLVACFAVPFFAFDFAARIDPFALSYRVLA  60

Query  1002  sdvvakamvvvalVIWANFVKN-------------GGLDWSIttfslstlnntLVVGVPL  862
             +D ++K  V +AL   A                  GG  W IT FSL+TLNNTLVVGVPL
Sbjct  61    ADALSKLAVALALAACAAAASTRCCGSGGGKRGGGGGFSWCITGFSLATLNNTLVVGVPL  120

Query  861   MQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGN  682
             + AMYG+                          + R  + QIS        + GTD +  
Sbjct  121   LDAMYGK--------------------------WARDLIVQISVQ------QTGTDDDDV  148

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
                AAAA    AA  ++ P    ++++V L++A+NPN YA  LG+ WA +T  WH   PS
Sbjct  149   EDGAAAAATAAAARRSLWP----LVRAVWLKVARNPNVYAGVLGVAWACVTNRWHVETPS  204

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             II+ S++IM+K G G++MFS GLFMALQD+II CG  LTV G+ LRF+ GPA +A+GA  
Sbjct  205   IIEGSVLIMSKTGVGLSMFSMGLFMALQDKIIVCGAGLTVLGMALRFVAGPAATAVGAFA  264

Query  321   LRLHGDVLKIVIV-------------------------------------------QSAL  271
             L L GD+L++ I+                                           Q+AL
Sbjct  265   LGLRGDLLRLAIIQAYTHLHEIHSPSSFFLLSPEICLNSNGCMHDTSPHDETARDEQAAL  324

Query  270   PQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             PQ++TTF+FAKEYGLHA++LSTA+I GT+ SLPV+I YY++L
Sbjct  325   PQSITTFVFAKEYGLHAEILSTAVIFGTLASLPVLIVYYIVL  366



>ref|XP_006338481.1| PREDICTED: putative auxin efflux carrier component 5-like [Solanum 
tuberosum]
Length=370

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 211/365 (58%), Gaps = 9/365 (2%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV MIL Y S+RW  +F P+ C  IN+F   F +P  +F  I+  + Y
Sbjct  6     DVYHVVAATIPLYVVMILAYISVRWGKLFSPEQCSGINKFVAKFSIPLLSFQVISGSNLY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              +N   + +D + K + V  L I+A     G L W IT  S+STL NTL++G+PL++A++
Sbjct  66    KVNLKLLLADFIQKFLAVFLLAIFAKLKPKGNLTWIITGLSVSTLPNTLILGIPLIKAIF  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA---------RPEMGTD  694
             G    +L+ Q  A+Q+L+W  +LL   E   T+   + + ++ A          P++  +
Sbjct  126   GDAAAELLAQLIALQSLVWYNLLLLLFELNATKESYMMSPSEVAGTYTDNRIMVPKLELE  185

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHF  514
             + G P+      E          +   ++ +V  +L  NPNT+A   G+IW+ I   W  
Sbjct  186   VPGEPELEKDGEEEATDRPPRKKTIMVILLTVGRKLIINPNTHATLAGIIWSSIHFRWGV  245

Query  513   TMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAI  334
              +P I++ SI I++ GG G+AMFS G+FMA Q  II+CG    +  + L+F++GP   AI
Sbjct  246   NLPKIVEQSISILSDGGLGMAMFSIGVFMASQASIIACGTKKAILAMALKFVLGPVLMAI  305

Query  333   GAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYY  154
              +I + L G + ++ IVQ+ALPQ +  F+FAKEY +H  +LST +I G ++++P+ + YY
Sbjct  306   SSIAVGLRGQLFRLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIPIALAYY  365

Query  153   VILEL  139
              +LE+
Sbjct  366   FLLEI  370



>gb|KDO36786.1| hypothetical protein CISIN_1g048649mg, partial [Citrus sinensis]
Length=256

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 188/284 (66%), Gaps = 31/284 (11%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GW D+YKVV AM PLY A++LGYGS++WW +  P+ C A+NRF C+F LP FT  F  QV
Sbjct  3     GWEDVYKVVEAMVPLYFALMLGYGSVKWWKIIAPEECAAVNRFVCYFTLPLFTIEFTTQV  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGL-DWSIttfslstlnntLVVGVPLM  859
             DP+ +NY  + +D ++K ++V  L  WA   KN     W IT FSL TL N+LVVGVPL+
Sbjct  63    DPFNLNYRLIGADAISKLIIVFVLAFWAMCSKNESCYSWCITNFSLCTLTNSLVVGVPLL  122

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             + MYG++  DLV+Q++ +Q++LWLT+ LF LE+RR+           AR ++    EG+ 
Sbjct  123   KPMYGQMAVDLVVQSSVLQSILWLTIFLFVLEYRRS-----------ARIDLE---EGHG  168

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             +                PS+  +MK V  ++AKNPN+YAC LGL WA +   WH  MPSI
Sbjct  169   R----------------PSFWHLMKIVWPKMAKNPNSYACILGLAWAFVAHRWHLKMPSI  212

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVL  367
             I+ SI+IM++ G+G AMFS G+FMALQ+++I+CG  LTV+G+VL
Sbjct  213   IEGSILIMSRAGTGTAMFSMGIFMALQEKLIACGPKLTVFGMVL  256



>ref|XP_008443438.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X2 [Cucumis melo]
Length=356

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 212/357 (59%), Gaps = 5/357 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYVAM+L Y S++WW  F  + C  IN+F   F +P  +F  I+  + 
Sbjct  5     SDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVISDNNL  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + +D + K + ++ L         GGL+W IT  SLST+ NTL++G+P+++AM
Sbjct  65    YKMNLQLILADFLQKILAIILLGAITKITSRGGLNWIITGLSLSTMPNTLILGLPVLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             YG     L+ Q   +Q++LW  +LLF  EF  T+   ++ A++    E+    EG  KE 
Sbjct  125   YGSEADVLLAQIVVLQSILWYNILLFLFEFTTTKAASLAPASEATEIEITQ--EGRAKEE  182

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                               +++ +V  +L  NPNT+A  LGLIW+ I   W   +P +ID 
Sbjct  183   IEEARDRNGR---SLKTKSILLTVARKLIINPNTHATILGLIWSSIRFRWGVKLPVVIDR  239

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+AMFS GLFM  +  II+CG  +T+  + ++FL+GPA  A  ++ L L 
Sbjct  240   SISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLMGPALMAACSLALGLR  299

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             G +L++ IVQ+ALPQ +  F+F+KEY +H DVLST +++G +++LPV + YY +L L
Sbjct  300   GRLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPVALAYYYLLSL  356



>ref|NP_001234211.1| auxin efflux facilitator SlPIN8 [Solanum lycopersicum]
 gb|ADR30415.1| auxin efflux facilitator SlPIN8 [Solanum lycopersicum]
Length=357

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 135/359 (38%), Positives = 210/359 (58%), Gaps = 10/359 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV MIL Y S+RW  +F P+ C  IN+F   F +P  +F  I+  + Y
Sbjct  6     DVYHVVAATIPLYVVMILAYISVRWGKLFSPEQCSGINKFVAKFSIPLLSFQVISGSNLY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              +N   + +D V K + V  L I +     G L W IT  S+STL NTL++G+PL++A++
Sbjct  66    KVNLKLLLADFVQKFLAVFLLAILSKLKPKGNLTWIITGLSVSTLPNTLILGIPLIKAIF  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G    +L+ Q  A+Q+L+W  +LL   E   T+   + + ++ A  E+       P E  
Sbjct  126   GDAAAELLAQLIALQSLVWYNLLLLLFELNATKESYVMSPSEVAELEV-------PGEPE  178

Query  666   aagetpaapTNIGPSYTAMMK---SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                +     T+  P    +M    +V  +L  NPNT+A   G+IW+ I   W   +P I+
Sbjct  179   LEEDGEEEATDRPPRKKTIMVILLTVGRKLIINPNTHATLAGIIWSSIHFRWGVNLPKIV  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI I++ GG G+AMFS G+FMA QD II+CG    +  + L+F++GP   AI +I++ 
Sbjct  239   EQSISILSDGGLGMAMFSIGVFMASQDSIIACGTKKAILAMALKFVLGPVLMAISSIVVG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G + ++ IVQ+ALPQ +  F+FAKEY +H  +LST +I G ++++P+ + YY +LE+
Sbjct  299   LKGKLFRLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIPIALAYYFLLEI  357



>ref|XP_002282480.1| PREDICTED: putative auxin efflux carrier component 5 [Vitis vinifera]
 emb|CAN79928.1| hypothetical protein VITISV_042448 [Vitis vinifera]
 emb|CBI22158.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 210/358 (59%), Gaps = 6/358 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLY  MIL Y S++WW +F P+ C  IN+F   F +P  +F  I++ +P
Sbjct  5     ADVYHVVAATIPLYFVMILAYISVKWWKIFTPEQCSGINKFVAKFSIPLLSFQLISENNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN   + SD + K + ++ L   A     G L W IT  SLSTL NTL++G+PL++AM
Sbjct  65    YQMNMRLILSDFLQKLLALILLATIAKINSRGSLTWVITGLSLSTLPNTLILGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD-NARPEMGTDLEGNPKe  673
             YG     L+ Q   +Q+L+W  +LLF  E    +   +SA     A  E+    E  PKE
Sbjct  125   YGDKAAGLLSQIVVLQSLVWYNLLLFLFELNAMK--AVSATTPLEAAVELEAPQEAQPKE  182

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                 G+T A           +++ V  +L  NPNT+A  + LIWA I   W+  +P ++D
Sbjct  183   EREEGKTTATRKT---KTMLILRIVGRKLMMNPNTHATIVSLIWACIRFRWNVKLPGVVD  239

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
             DSI I++KGG G+AMFS GLFMA +  II+CG  L V  + ++FL+GPA  A  A +   
Sbjct  240   DSISILSKGGLGMAMFSLGLFMASRPSIIACGTRLAVLAMGMKFLVGPAIMAASASITLS  299

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              G + K+ IVQ+ LPQ +  F+FAKEY +H D+LST +I G +++LP+ + YY +L L
Sbjct  300   RGTLFKVSIVQACLPQGIVPFVFAKEYDVHPDILSTGVIFGMLIALPIALVYYFLLAL  357



>ref|XP_002458992.1| hypothetical protein SORBIDRAFT_03g043960 [Sorghum bicolor]
 gb|EES04112.1| hypothetical protein SORBIDRAFT_03g043960 [Sorghum bicolor]
Length=336

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 207/330 (63%), Gaps = 17/330 (5%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV A  PLY A+ LGYGS+RWW +F  + CDA+NR   FF LPFFTF F    
Sbjct  3     GWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTLHT  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLD---------------WSIttfsl  901
             DP+ +NY  VA+DV++KA++V  +  WA  V + G                 WSIT FSL
Sbjct  63    DPFQVNYRAVAADVISKAVIVGVIACWAARVTSAGKGAGAGGGGGWAGCAVGWSITGFSL  122

Query  900   stlnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD  721
             STL N+LVVGVP+ +AMYG     LV+Q +  QA++WLT+LLF LE R+  +G      D
Sbjct  123   STLTNSLVVGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEIRKAAIGMYVDVPD  182

Query  720   NARPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIW  541
             +  P    +   +   AA     P    +  PS  A++K V  +L++NPNTYA F+G+ W
Sbjct  183   S--PVKDVEAAADAASAATVVVVPVVVASDKPSLWALVKVVAHKLSRNPNTYASFVGITW  240

Query  540   AIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRF  361
             A +    H  +PS  + S++IM+K G+G+AMFS GLFMA Q+++++CG +    GLVL+F
Sbjct  241   ACVANRLHIELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGPSFAALGLVLKF  300

Query  360   LIGPATSAIGAILLRLHGDVLKIVIVQSAL  271
              +GPA  AIG+I + L GDVL++ I+Q +L
Sbjct  301   ALGPAAMAIGSIAVGLRGDVLRVAIIQVSL  330



>ref|XP_010315851.1| PREDICTED: auxin efflux facilitator SlPIN8 isoform X1 [Solanum 
lycopersicum]
Length=358

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 136/359 (38%), Positives = 211/359 (59%), Gaps = 9/359 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV MIL Y S+RW  +F P+ C  IN+F   F +P  +F  I+  + Y
Sbjct  6     DVYHVVAATIPLYVVMILAYISVRWGKLFSPEQCSGINKFVAKFSIPLLSFQVISGSNLY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              +N   + +D V K + V  L I +     G L W IT  S+STL NTL++G+PL++A++
Sbjct  66    KVNLKLLLADFVQKFLAVFLLAILSKLKPKGNLTWIITGLSVSTLPNTLILGIPLIKAIF  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G    +L+ Q  A+Q+L+W  +LL   E   T+   + + +     E+  +LE  P E  
Sbjct  126   GDAAAELLAQLIALQSLVWYNLLLLLFELNATKESYVMSPS-----EVAVELE-VPGEPE  179

Query  666   aagetpaapTNIGPSYTAMMK---SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                +     T+  P    +M    +V  +L  NPNT+A   G+IW+ I   W   +P I+
Sbjct  180   LEEDGEEEATDRPPRKKTIMVILLTVGRKLIINPNTHATLAGIIWSSIHFRWGVNLPKIV  239

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI I++ GG G+AMFS G+FMA QD II+CG    +  + L+F++GP   AI +I++ 
Sbjct  240   EQSISILSDGGLGMAMFSIGVFMASQDSIIACGTKKAILAMALKFVLGPVLMAISSIVVG  299

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G + ++ IVQ+ALPQ +  F+FAKEY +H  +LST +I G ++++P+ + YY +LE+
Sbjct  300   LKGKLFRLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIPIALAYYFLLEI  358



>gb|KHN11585.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=358

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/358 (37%), Positives = 202/358 (56%), Gaps = 5/358 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D Y VV +  PLYV MIL Y S++WW +F PD C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADAYHVVASTVPLYVTMILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + +D + K +  + L+        GGL W IT  S++TL NTL++G+PL++AM
Sbjct  65    YKMSLKLIYADFLQKLLAFLVLIAITKISGRGGLKWIITGLSITTLPNTLILGIPLVKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA-RPEMGTDLEGNPKe  673
             Y      L+ Q   +Q+++W  + LF  E    +    +AA+ +    E  T  E   K 
Sbjct  125   YKSEAVVLLAQIIFLQSMIWYNLSLFLYELDAVKTRPTAAASSSQGSGETDTGREVQSKG  184

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                A         +      ++ +V  +L KNPNTYA  LG IW+ I   W   MP ++ 
Sbjct  185   EEDAEPRIKRKRKV----LLILVTVGKKLIKNPNTYATLLGFIWSSIKFRWGLHMPEVVS  240

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
              SI I++ GG G+AMFS GLFMA Q  II+CG  + +  + L+ ++GP   A+ + ++ L
Sbjct  241   QSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMAMVAIGLKVVLGPTLMAVASFVIGL  300

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
                + K+ IVQ+ALPQ +  F+FAKEY +H  VLSTAI++G +++LPV + +Y +L +
Sbjct  301   RDTLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPVELAFYFLLAI  358



>ref|XP_003534463.1| PREDICTED: probable auxin efflux carrier component 1b-like isoform 
X1 [Glycine max]
Length=358

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 203/358 (57%), Gaps = 5/358 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D Y VV +  PLYV MIL Y S++WW +F PD C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADAYHVVASTVPLYVTMILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + +D + K +  + L+        GGL W IT  S++TL NTL++G+PL++AM
Sbjct  65    YKMSLKLIYADFLQKLLAFLVLIAITKISGRGGLKWIITGLSITTLPNTLILGIPLVKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA-RPEMGTDLEGNPKe  673
             Y      L+ Q   +Q+++W  +LLF  E    +    +AA+ +    E  T  E   K 
Sbjct  125   YKSEAVVLLAQIIFLQSMIWYNLLLFLYELDAVKTRPTAAASSSQGSGETDTGREVQSKG  184

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                A         +      ++ +V  +L KNPNTYA  LG IW+ I   W   MP ++ 
Sbjct  185   EEDAEPRIKRKRKV----LLILVTVGKKLIKNPNTYATLLGFIWSSIKFRWGLHMPEVVS  240

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
              SI I++ GG G+AMFS GLFMA Q  II+CG  + +  + L+ ++GP   A+ + ++ L
Sbjct  241   QSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMAMVAIGLKVVLGPTLMAVASFVIGL  300

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
                + K+ IVQ+ALPQ +  F+FAKEY +H  VLSTAI++G +++LPV + +Y +L +
Sbjct  301   RDTLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPVELAFYFLLAI  358



>ref|XP_009795990.1| PREDICTED: putative auxin efflux carrier component 5 [Nicotiana 
sylvestris]
Length=358

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 210/359 (58%), Gaps = 9/359 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV MIL Y S+RWW +F P+ C  IN+F   F +P  +F  I++ + Y
Sbjct  6     DVYHVVAATIPLYVVMILAYISVRWWKLFSPEQCSGINKFVAKFSIPLLSFQVISESNLY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              +N   V +D + K + +  L ++A     G L W IT  S+STL NTL++G+PL++A++
Sbjct  66    KVNLKLVLADFIQKFLALFLLAVFAKLKPKGNLTWIITGLSVSTLPNTLILGIPLVKAIF  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G    +L++Q   +Q+L+W  +LLF  E   T+   + + ++ A      +         
Sbjct  126   GDAAAELLVQIIVLQSLIWYNLLLFLFELNATKESYVPSPSEVAVELEVPEES------E  179

Query  666   aagetpaapTNIGPSYTAMMKSVCL---RLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                +       I P  T +M  + +   +L  NPNT+A   G+IW+ I   W   +P+I+
Sbjct  180   LEEDREEEAKAICPRKTKIMLILLIVGKKLIINPNTHATLAGIIWSSIHFRWGINLPTIV  239

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
               SI I++ GG G+AMFS G+FMA Q  II+CG    +  + L+F++GP   AI +I + 
Sbjct  240   GRSISILSDGGLGMAMFSIGVFMASQASIIACGTRKAILAMALKFVLGPVLMAISSIAVG  299

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G +LK+ IVQ+ALPQ +  F+FAKEY +H  +LST +I G ++++P+ + YY +LE+
Sbjct  300   LRGKLLKLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIPIALAYYFLLEI  358



>ref|XP_009617494.1| PREDICTED: putative auxin efflux carrier component 5 [Nicotiana 
tomentosiformis]
Length=358

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 209/359 (58%), Gaps = 9/359 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV MIL Y S+RWW +F P+ C  IN+F   F +P  +F  I++ + Y
Sbjct  6     DVYHVVAATIPLYVVMILAYISVRWWKLFSPEQCSGINKFVAKFSIPLLSFQVISESNLY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              +N   + +D + K + +  L ++A     G L W IT  S STL NTL++G+PL++A++
Sbjct  66    KVNLKLLLADFIQKILALFLLAVFAKLKPRGNLTWIITGLSASTLPNTLILGIPLVKAIF  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G    +L++Q   +Q+L+W  +LLF  E   T+   + + ++ A      +         
Sbjct  126   GDAAAELLVQIIVLQSLIWYNLLLFLFELNATKESYVPSPSEVAVELEVPEES------E  179

Query  666   aagetpaapTNIGPSYTAMMK---SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                +       I P  T +M    +V  +L  NPNT+A   G+IW+ I   W   +P+I+
Sbjct  180   LEEDREEEAKAICPRKTKIMLILLTVGRKLIINPNTHATLAGIIWSGIHFRWGINLPTIV  239

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
               SI I++ GG G+AMFS G+FMA Q  II+CG    +  + L+F++GP   AI +I + 
Sbjct  240   GRSISILSDGGLGMAMFSIGVFMASQASIIACGTRKAILAMALKFVLGPVLMAISSIAVG  299

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L G +LK+ IVQ+ALPQ +  F+FAKEY +H  +LST +I G ++++P+ + YY +LE+
Sbjct  300   LRGKLLKLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIPIALAYYFLLEI  358



>tpg|DAA05219.1| TPA_exp: auxin efflux carrier protein [Medicago truncatula]
 gb|AES77331.2| auxin efflux carrier family transporter [Medicago truncatula]
Length=357

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 136/359 (38%), Positives = 210/359 (58%), Gaps = 8/359 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              ++Y V+    PLYV MIL Y S++W+ +F  + C  IN+F   F +P  +F  I+  + 
Sbjct  5     ANVYHVITTTVPLYVTMILAYVSVKWFKIFTQEQCSGINKFVAKFSIPLLSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + SD + K +  V L         GGL W IT FSLSTL NTL++G+PL++AM
Sbjct  65    YKMSLKLMFSDFIQKLLAFVLLTAIIKISGKGGLKWIITGFSLSTLPNTLILGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISA--AADNARPEMGTDLEGNPK  676
             Y      L+ Q   +Q+++W  +LLF  EF   +   +SA  + D    E  ++++   +
Sbjct  125   YKDEAIVLLAQIVFLQSMIWYNLLLFLYEFDAAK-NMLSAPPSQDTGESESASEIQSK-R  182

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
             E             I P    ++ +V  +L +NPNT+A  +G+IW+ I   W   MP +I
Sbjct  183   EEDEEPVGTKRKMKIFP----ILVTVGKKLIRNPNTFASLIGIIWSSIQFRWGIHMPQVI  238

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             + SI +++ GG G+AMFS GLFMA Q  II+CG   TV  + L+ L+GPA  A+ +I++ 
Sbjct  239   NHSIELLSNGGLGMAMFSLGLFMASQSSIIACGPRNTVVAIGLKVLVGPALMALASIVIG  298

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             L   + K+ IVQ+ALPQ +  F+FAKEY +H  +LSTAI++G +++LPV + +Y +L L
Sbjct  299   LRNTLFKVAIVQAALPQGIVPFVFAKEYNVHPSILSTAILLGMLIALPVELAFYFLLAL  357



>ref|XP_004489167.1| PREDICTED: auxin efflux carrier component 1-like [Cicer arietinum]
Length=357

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 204/358 (57%), Gaps = 6/358 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+  VV    PLYV MIL Y S++WW +F  + C  IN+F   F +P  +F  I+  + 
Sbjct  5     SDVNHVVTKTVPLYVTMILAYVSVKWWKIFTQEQCSGINKFVAKFSVPLLSFQVISSNNF  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + +D + K + ++ L+        GGL W IT FSLS+L NTL++G+PL++AM
Sbjct  65    YKMSLKLMYADFIQKLLAIILLIAITKISGRGGLKWIITGFSLSSLPNTLILGIPLIKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK-e  673
             Y      L+ Q   +Q+++W  +LLF  EF   +   +SA       E+ T  E   K E
Sbjct  125   YKEEAVVLLAQVVFLQSMIWYNLLLFLYEFDAAK-NMVSATPSQGTGELETAREMQLKGE  183

Query  672   aaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                          I P    ++ +V  +L +NPNT+A  +G IW+ I   W   MP ++ 
Sbjct  184   EDEDPVLTKRKKKIFP----ILVTVGKKLIRNPNTFASLIGFIWSSIKFRWGIHMPEVVS  239

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
              SI +++ GG G+AMFS GLFMA Q  +I+CG   T+  + L+ L+GPA   + + L+ L
Sbjct  240   QSIELLSNGGLGMAMFSLGLFMASQSSMITCGPRNTMVAIGLKVLVGPALMVVASFLIGL  299

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
                + K+ IVQ+ALPQ +  F+FAKEY +H  +LSTAI++G +++LPV + +Y +L L
Sbjct  300   RNTLFKVAIVQAALPQGIVPFVFAKEYNVHPSILSTAILLGMLIALPVELAFYFLLAL  357



>ref|XP_004489373.1| PREDICTED: putative auxin efflux carrier component 5-like [Cicer 
arietinum]
Length=364

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 201/360 (56%), Gaps = 5/360 (1%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV M L Y  ++WW +F PD C  IN+F   F +P  +F  I+  + Y
Sbjct  6     DVYHVVTATVPLYVTMFLAYICVKWWKLFTPDQCVGINKFVANFSVPLLSFQVISSNNIY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              M+   + +D V K +    L++       GGL W IT  SLSTL NTL++G+PLM+AMY
Sbjct  66    KMSLKLIYADCVQKFLAFFVLIVIIKMSDRGGLKWIITGLSLSTLPNTLILGIPLMKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAAD----NARPEMGTDLEGNP  679
                   L+ Q   +Q+++W   LLF  E       +   A+         E  T LE   
Sbjct  126   KDESDILLPQIIFLQSMIWYNFLLFLHELDAAIPARTMPASSSTSSQGTGESETSLEVQS  185

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             KE                    +MK V  +L  NPNTYA F+GLIWA I   W   MP +
Sbjct  186   KEDEGEERGETRSQRKMRILIILMK-VGKKLIMNPNTYATFIGLIWASIHFRWGVDMPDV  244

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             +  SI I++ GG G+A FS GLFMA    II+CG  +T+  + L+FL+GPA  A+ +I++
Sbjct  245   VKQSITILSSGGLGMATFSLGLFMASNSSIIACGPRMTMVAMGLKFLVGPALMAVASIVI  304

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              L   +LK+ IVQ+ALPQ +  F+FA+EY +   +LST +++G +++LPV + YY++L L
Sbjct  305   GLRDTMLKVAIVQAALPQGIVPFVFAREYNVQPAILSTGVLLGMLIALPVALIYYLLLSL  364



>ref|XP_009386292.1| PREDICTED: auxin efflux carrier component 1 [Musa acuminata subsp. 
malaccensis]
Length=365

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 211/362 (58%), Gaps = 4/362 (1%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W  +Y VV AM PLY AM LGY S+R    F P+ C  IN F     +P   F  I+  
Sbjct  3     SWSSLYHVVEAMMPLYAAMALGYASVRK-KAFTPEQCAGINHFVALLAVPLLIFRMISSN  61

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PYTMN  F+A+D + K +++ AL  WA F  NG + W IT FSL+TL NT+++GVP+++
Sbjct  62    NPYTMNIRFLAADTLQKVIILAALAAWARFSNNGSIAWVITLFSLATLPNTVLMGVPVLR  121

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTR---LGQISAAADNARPEMGTDLEG  685
              MYG +  +L++Q   +Q ++W  +++F  E+   +   + Q       A      D+  
Sbjct  122   GMYGPMSENLMVQIVVLQFVVWYVLVVFLFEYMAAQNAFMEQQQMPPPQANGSHSVDIPA  181

Query  684   NPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMP  505
                + +    + A    I PS   ++     ++ K P+TYA  LGL W++I   +   MP
Sbjct  182   VNADGSDPDVSIAQEETIRPSGMLILVMAVKKILKIPSTYASLLGLFWSLIAFRFGIKMP  241

Query  504   siiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAI  325
             +IID+S+ I++    G+ MFS G FMA + + I+CG+ L V  +V+RFLIGP    + + 
Sbjct  242   AIIDNSLSIISVSAIGLGMFSVGAFMAQRKKFITCGYYLAVLAMVMRFLIGPIVMLVSSF  301

Query  324   LLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
              + L G  L + +VQ+ALP AV +F++A+EY +H D++ST +I+G  +S+P+ I YYV+L
Sbjct  302   AVGLQGVFLNVGVVQAALPLAVLSFVYAEEYNVHPDIMSTGVIVGIFISVPLTILYYVLL  361

Query  144   EL  139
              L
Sbjct  362   GL  363



>ref|XP_008788611.1| PREDICTED: probable auxin efflux carrier component 1b [Phoenix 
dactylifera]
Length=398

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 209/353 (59%), Gaps = 17/353 (5%)
 Frame = -3

Query  1197  KVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMN  1018
             +VV AMAPLY AM LGY + RWWH   PD C  INRF   F +P  TF  ++  DPY MN
Sbjct  9     RVVEAMAPLYAAMTLGYAAARWWHALTPDQCAGINRFVSVFAIPLLTFQLLSSNDPYAMN  68

Query  1017  YLFvasdvvakamvvvalVIWANFVK-------NGGLDWSIttfslstlnntLVVGVPLM  859
               F+A+D   K +++  L IWA   +       +  L W IT FSL+TL NT+++G+PL+
Sbjct  69    PRFLAADSFQKLLLLTILFIWARLRRRPASGGSSSSLPWVITIFSLATLPNTVIMGIPLL  128

Query  858   QAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNP  679
             + MYG     L++Q   +QA +W  +++F  E+   R         NA   + T L  + 
Sbjct  129   RGMYGPQTDSLMVQIVVLQAAVWYNLVIFLYEYMAARCAATEGCQTNA--SVPTTLPVSE  186

Query  678   KeaaaagetpaapTNIG-----PSYTAMMKSVCL---RLAKNPNTYACFLGLIWAIITKG  523
             KEAA A    +     G     PS  +M + + +   +L + PNT+A FLGLIW+ I  G
Sbjct  187   KEAAIAAANGSVEGGEGETKPPPSPPSMWRILTVAGRKLCRIPNTHASFLGLIWSFIAFG  246

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
             +   MP II DS+ I++    G++MFS G FMA Q R ISCG+++  + +V++FL+GP+ 
Sbjct  247   FGIRMPKIIHDSVTILSSTAIGLSMFSIGTFMARQTRFISCGYSVAAFAMVVKFLVGPSI  306

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTI  184
                 ++ + L G +L++ I+Q+ALP AV +F++AKEY +H +V+STA+ + T+
Sbjct  307   MIATSLSVGLQGLLLRVAIIQAALPLAVLSFVYAKEYNVHPEVMSTALELETL  359



>emb|CDP02197.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 195/349 (56%), Gaps = 9/349 (3%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A+ PLY AMIL Y S++WW +F  D C  IN+F   F +P  +F  I+   PY
Sbjct  6     DVYHVVEAIFPLYAAMILAYASVKWWKLFTADQCSGINKFVARFSIPLLSFQVISSNSPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN   V +D++ K +    L + A     G L W IT  SLSTL NTL++G+PL++AMY
Sbjct  66    KMNLKLVCADLLQKFLAFFVLTVIAKINSRGSLSWVITGLSLSTLPNTLILGIPLLRAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G      + Q   +Q+L+W  +LL   E    R        D   P   T+    P+ A+
Sbjct  126   GPEAAGFLAQIVVLQSLIWYNLLLLLFEINAAR------GVDATPPSTVTEELEAPEAAS  179

Query  666   aagetpaapTNIGPSYTA---MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
                E    P N     +    ++ +V  +L  NPNT+    GL+WA I   W   +P I+
Sbjct  180   QKDEEEDEPNNSQGKKSKIALLLSTVGRKLISNPNTHGTLAGLVWACIHFRWGLQLPKIV  239

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLR  316
             D SI +++ GG G+AMFS GLFMA Q  I++CG    +  + +RF++GP   A  +I + 
Sbjct  240   DRSITVLSDGGLGMAMFSLGLFMASQTGILACGTRKALLAMAMRFVVGPVVMAGCSIAVG  299

Query  315   LHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
             L G   K+ IVQ+ALPQ +  F+FAKEY +H D+LST +++G +++ P+
Sbjct  300   LRGRSFKVAIVQAALPQGIVPFVFAKEYHVHPDILSTGVLMGMLIATPI  348



>ref|XP_006853071.1| hypothetical protein AMTR_s00038p00082540 [Amborella trichopoda]
 gb|ERN14538.1| hypothetical protein AMTR_s00038p00082540 [Amborella trichopoda]
Length=359

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 199/355 (56%), Gaps = 19/355 (5%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y V  AM PLYVAM L Y S++ W +F P+ C  INRF   F +PF  F+ I+  DP
Sbjct  5     ADLYAVFTAMVPLYVAMFLAYASVKRWEIFTPEQCSGINRFVATFAIPFLAFNIISSTDP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y +N  F+ +D + K +++  L++WA F + G  +W IT FSLS + NTL++G+PL++ M
Sbjct  65    YKINLKFILADTMQKLLILFVLILWAKFTRWGSFNWMITLFSLSIMPNTLIIGIPLLRPM  124

Query  849   YGR--LGYDlvlqaaamqallwltmlLFGLEFRRTRL-GQISAAADNARPEMGTDL----  691
             YG   +G  + +    +     + + L+ L   +  + G++    D    + G ++    
Sbjct  125   YGEECIGLLVQVVVLQLVVWCPIFLCLYELHAAKVTMNGKVRFTNDTNEGKEGDEMMNVE  184

Query  690   ----------EGNPKeaaaagetpaapTNIGP--SYTAMMKSVCLRLAKNPNTYACFLGL  547
                       +  P + A + E         P  + T +  SV  ++ KNPNTY   LGL
Sbjct  185   VIFKKKNTPADECPGDLAHSNEREVQGEVTHPRMTTTNLFLSVLSKVMKNPNTYGSVLGL  244

Query  546   IWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVL  367
             IW +I+  W+ +MP II  S+ I++  G G+AMFS GLFM  Q +II+CG    +  +V+
Sbjct  245   IWGLISFRWNISMPKIIHKSVSILSVTGLGMAMFSLGLFMGSQRKIIACGKRKVILSMVV  304

Query  366   RFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTA  202
             RF+      A+ +I + + G  LK  I+Q+ALPQ V TF++AKEY +H +VLSTA
Sbjct  305   RFIFSSTVMAMCSIAIGIRGIALKTAIIQAALPQGVITFVYAKEYQVHEEVLSTA  359



>ref|XP_010492334.1| PREDICTED: putative auxin efflux carrier component 5 [Camelina 
sativa]
Length=364

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/364 (37%), Positives = 210/364 (58%), Gaps = 7/364 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V+ A  PLYV+MILGY S +   +F P+ C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDVYHVISATVPLYVSMILGYLSAKHLQLFTPEQCAGINKFVAKFSIPLLSFQIISQN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF-----VKNGGLDWSIttfslstlnntLVVG  871
             +P+ MN   + SD++ K + +V L +   F      + G L W I   S+S   NTL++G
Sbjct  63    NPFKMNPKLILSDILQKLLALVVLAVVVRFWHPTGGRGGKLGWVIIGLSVSLFPNTLILG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDL  691
             +P++ A+YG     ++ Q   MQ+L+W T+LLF  E    R    S +  N       ++
Sbjct  123   IPILAAIYGDEAASILRQIVVMQSLIWYTILLFLFEINAARAITSSGSEHNTGGNENEEV  182

Query  690   EGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
                 +E            + G +   ++K+ C +L  NPNTYA  +G+IWA +     + 
Sbjct  183   NREEEELREDEAAIVRTRSTG-TMKVLLKA-CRKLMINPNTYATLIGIIWATLHFRLGWE  240

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             +P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  +T   +VL+F++GPA     
Sbjct  241   LPEMIDKSIHMISDGGLGMAMFSLGLFMASQRSIIACGTKMTSIAMVLKFVLGPALMIAS  300

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
                +RL  ++ KI I+Q+ALPQ V  F+FAKEY LH +++ST +I G +++LP+++ YY 
Sbjct  301   VFSMRLRHNLFKIAILQAALPQGVVPFVFAKEYNLHPEIVSTGVIFGMLIALPIILAYYF  360

Query  150   ILEL  139
             +L++
Sbjct  361   VLDI  364



>ref|XP_010420162.1| PREDICTED: putative auxin efflux carrier component 5 [Camelina 
sativa]
Length=366

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 136/374 (36%), Positives = 206/374 (55%), Gaps = 25/374 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y VV A  PLYV+MILGY S +   +F P+ C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDVYHVVSATVPLYVSMILGYLSAKHLQLFTPEQCAGINKFVAKFSIPLLSFQIISQN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF-----VKNGGLDWSIttfslstlnntLVVG  871
             +P+ MN   + SD++ K + +V L +   F      + G L W I   S+S   NTL++G
Sbjct  63    NPFKMNPKLILSDILQKLLALVVLAVVLRFWHPTGGRGGRLGWVIIGLSISVFPNTLILG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDL  691
             +P++ A+YG     ++ Q   +Q+L+W T+LLF  E    R          A+   G+  
Sbjct  123   IPILAAIYGDEASSILRQIVVLQSLIWYTILLFLFEINAAR----------AKTSSGSST  172

Query  690   EGNP-------KeaaaagetpaapTNIGPSYTAMMK---SVCLRLAKNPNTYACFLGLIW  541
             E N                       +    T  MK     C +L  NPNTYA  +G+IW
Sbjct  173   EHNTGGNENEEVNREEEEPREDEVAIVRTRSTGTMKVLLKACRKLIINPNTYATLIGIIW  232

Query  540   AIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRF  361
             A +     + +P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  + V  +VL+F
Sbjct  233   ATLHFRLGWELPEMIDKSIHMISDGGLGMAMFSLGLFMASQRSIIACGTKMAVIAMVLKF  292

Query  360   LIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTIL  181
             ++GPA       ++RL  ++ KI I+Q+ALPQ V  F+FAKEY LH +++ST +I G ++
Sbjct  293   VLGPALMIASVFIMRLRHNLFKIAILQAALPQGVVLFVFAKEYNLHPEIVSTGVIFGMLI  352

Query  180   SLPVMIGYYVILEL  139
             +LP ++ YY +L++
Sbjct  353   ALPTILAYYFVLDI  366



>gb|AGJ95049.1| PIN11 [Medicago truncatula]
 gb|KEH24973.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=361

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 204/357 (57%), Gaps = 2/357 (1%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y VV A  PLYV M+L Y  ++WW +F PD C  IN+F   F +P  +F  I+  + Y
Sbjct  6     DVYHVVTATVPLYVTMLLAYICVKWWKLFTPDQCAGINKFVANFSVPLLSFQVISSNNIY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVK-NGGLDWSIttfslstlnntLVVGVPLMQAM  850
              M+   + +D V K +  + L++        GGL W IT  SLSTL NTL++G+PLM+AM
Sbjct  66    KMSLKLIYADCVQKFLAFLVLIVIIKISDIRGGLKWIITGLSLSTLPNTLILGIPLMKAM  125

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             Y      L+ Q   +Q+++W  +LLF  E       +   AA  +  E G        ++
Sbjct  126   YKDESDFLLPQIIFLQSMIWYNLLLFLHELDAAIPARTMPAAQPSH-ETGDSESSVEVQS  184

Query  669   aaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiidd  490
                 E              ++  V  +L  NPNTYA F+GLIWA I   W   MP +++ 
Sbjct  185   KEEDEGRETRPERKTRILIILMKVGKKLIMNPNTYATFIGLIWASIHFRWGVDMPDVVNQ  244

Query  489   simiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLH  310
             SI I++ GG G+A FS GLFMA    II+CG  +T+  + L+FL GPA  A+ +I++ L 
Sbjct  245   SITILSSGGLGMATFSLGLFMASNSSIIACGPKMTMVSMGLKFLFGPALMAVASIVIGLR  304

Query  309   GDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
               +LK+ IVQ+ALPQ +  F+FA+EY +H  VLST +++G +++LPV + YY++L +
Sbjct  305   DTMLKVAIVQAALPQGIVPFVFAREYNVHPAVLSTGVLLGMLIALPVALIYYLLLSI  361



>ref|XP_003621113.1| Auxin efflux carrier component [Medicago truncatula]
Length=364

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 211/364 (58%), Gaps = 11/364 (3%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              ++Y V+    PLYV MIL Y S++W+ +F  + C  IN+F   F +P  +F  I+  + 
Sbjct  5     ANVYHVITTTVPLYVTMILAYVSVKWFKIFTQEQCSGINKFVAKFSIPLLSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + SD + K +  V L         GGL W IT FSLSTL NTL++G+PL++AM
Sbjct  65    YKMSLKLMFSDFIQKLLAFVLLTAIIKISGKGGLKWIITGFSLSTLPNTLILGIPLLKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKea  670
             Y      L+ Q   +Q+++W  +LLF  EF   +   +SA       + GT+ +   +  
Sbjct  125   YKDEAIVLLAQIVFLQSMIWYNLLLFLYEFDAAK-NMLSAPPSQ---DTGTNNKQTRESE  180

Query  669   aaagetpaapTNIGPSYTA-------MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
             +A+        +  P  T        ++ +V  +L +NPNT+A  +G+IW+ I   W   
Sbjct  181   SASEIQSKREEDEEPVGTKRKMKIFPILVTVGKKLIRNPNTFASLIGIIWSSIQFRWGIH  240

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             MP +I+ SI +++ GG G+AMFS GLFMA Q  II+CG   TV  + L+ L+GPA  A+ 
Sbjct  241   MPQVINHSIELLSNGGLGMAMFSLGLFMASQSSIIACGPRNTVVAIGLKVLVGPALMALA  300

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             +I++ L   + K+ IVQ+ALPQ +  F+FAKEY +H  +LSTAI++G +++LPV + +Y 
Sbjct  301   SIVIGLRNTLFKVAIVQAALPQGIVPFVFAKEYNVHPSILSTAILLGMLIALPVELAFYF  360

Query  150   ILEL  139
             +L L
Sbjct  361   LLAL  364



>ref|XP_003550957.1| PREDICTED: putative auxin efflux carrier component 5-like isoform 
X1 [Glycine max]
 ref|XP_006600902.1| PREDICTED: putative auxin efflux carrier component 5-like isoform 
X2 [Glycine max]
 gb|KHN01714.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=363

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 198/350 (57%), Gaps = 5/350 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYV M L Y S++WW +F P+ C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADVYHVVTATVPLYVTMFLAYISVKWWKLFNPEQCSGINKFVANFSVPILSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   V +DVV K +  +           GGL W IT  SLSTL NTL++G+PLM+AM
Sbjct  65    YKMSLKLVYADVVQKLLAFLVFTAIIRIKGRGGLKWIITGLSLSTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRT---RLGQISAAADNARPEMGTDLEGNP  679
             Y      L+ Q   +Q+++W  +LLF  E       R   + A       E  T LE   
Sbjct  125   YRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVVAPPSQDTGESETSLEIQS  184

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             KE           +        ++  V  +L  NPNTYA F+GLIWA I   W   MP +
Sbjct  185   KEEEEEEAEHRTQSKT--RMLLILMKVGNKLIINPNTYATFIGLIWASIHFRWGVDMPDV  242

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ SI I+A GG G+A FS GLFMA  +R+I CG  +T+  + L+FL+GPA  A+ +I++
Sbjct  243   VNQSIEILASGGLGMATFSLGLFMASNNRVIVCGPRMTLVAMGLKFLVGPAIMAVASIVI  302

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
              L   +LK+ I+Q+ALPQ +  F+FA+EY ++  +LST +++G +++LPV
Sbjct  303   GLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTGVLLGMLMALPV  352



>ref|XP_010029286.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X1 [Eucalyptus grandis]
 gb|KCW56167.1| hypothetical protein EUGRSUZ_I01919 [Eucalyptus grandis]
Length=357

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 132/348 (38%), Positives = 200/348 (57%), Gaps = 8/348 (2%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             ++Y  V A  PLY  M L + SIR+W +F PD C  IN+F   F +P  +F  I+  +PY
Sbjct  6     NVYHCVAATVPLYATMFLAFISIRFWKLFTPDQCAGINKFVAKFSIPLLSFQVISSTNPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN   V +D   K + ++ +   A F   GGL W IT  SLSTL NTL++G+PL++AMY
Sbjct  66    KMNLRLVLADFAQKILAILIVGGVAKFRSGGGLRWIITGVSLSTLPNTLILGIPLLRAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPKeaa  667
             G     L+ Q   +Q++LW  +LLF  E   T+   ++ +++       T +    +E  
Sbjct  126   GDEAASLIAQIVCLQSILWYNLLLFLFELNATKAASVTPSSE------ATGVTATTEEDE  179

Query  666   aagetpaapTNIGPSYTAMM--KSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiid  493
                         G  Y  ++    V   L +NPNTYA  +G+IWA I   W   MP+I+ 
Sbjct  180   TKDGGDELKLRNGRKYETLLIFLKVGKNLLRNPNTYATVMGVIWASIHFRWGVEMPAIVS  239

Query  492   dsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRL  313
              SI+I+++GG G+AMFS GLFMA Q RI++CG  L    +  +F+ GP   AI ++ + L
Sbjct  240   SSILILSEGGLGMAMFSLGLFMASQTRIVACGARLAAVAMAAKFIAGPGLMAISSLAIGL  299

Query  312   HGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
                +LK+ IVQ+ALPQ +  F+FAKEY +H ++LST ++ G ++++P+
Sbjct  300   RETLLKVAIVQAALPQGIVPFVFAKEYNVHPEILSTGVLFGMLIAMPI  347



>gb|EMT08432.1| Putative auxin efflux carrier component 4 [Aegilops tauschii]
Length=355

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 205/356 (58%), Gaps = 40/356 (11%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             MAPLY A+ LGYGS+RWW  F  + C AIN     F +PFFTF F+ + DPY MNY  +A
Sbjct  1     MAPLYFALGLGYGSVRWWRFFTAEQCGAINTLGVCFSMPFFTFDFVVRADPYAMNYRVIA  60

Query  1002  sdvvakamvvvalVIWANFVKN--GGLDWSIttfslstlnntLVVGVPLMQAMYGRLGYD  829
             +D V K + V+A  +WA   K   G   WSIT FSL   NNTLVVGVPL+ AMYG+   D
Sbjct  61    ADAVTKLLAVLAAAVWARCAKAKAGAYSWSITGFSLGAYNNTLVVGVPLLDAMYGKWAQD  120

Query  828   lvlqaaamqallwltmlLFGLEFRRT-----RLGQISAA--------------ADNARP-  709
             L++Q A +QA++W  +LL   E R+       +  +SA               A    P 
Sbjct  121   LIVQIAVVQAIVWFPLLLLAFELRKAWVVGGGVSSLSATMAHDDGSTSSDDDRARRVEPV  180

Query  708   -----EMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLI  544
                  E+  D+E  P                      M  +V ++LA+NPN YA  LG+ 
Sbjct  181   SHSDVEVDLDVEAAPPTGGRRIRLWL-----------MASTVGMKLARNPNVYASVLGVA  229

Query  543   WAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLR  364
             WA I   W   MP I+  S+ +M++ G+G++MFS GLFMA Q+RI++CG  L   G+VLR
Sbjct  230   WACIAYRWRIGMPGIVTGSLQVMSRTGTGMSMFSMGLFMAQQERIVACGGGLAALGMVLR  289

Query  363   FL--IGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTA  202
             F+     A +  GA+   L GDVL+ VI+Q+ALPQ++ +F+FAKEYGLHADVLSTA
Sbjct  290   FVAGPLAALAGAGAVAFGLRGDVLRFVIIQAALPQSIASFVFAKEYGLHADVLSTA  345



>gb|KHN47561.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=362

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 197/350 (56%), Gaps = 6/350 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYV M L Y S++WW +F P+ C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADVYHVVTATVPLYVTMFLAYISVKWWKLFNPEQCSGINKFVANFSVPILSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   V +DVV K +  +           GGL W IT  SLSTL NTL++G+PLM+AM
Sbjct  65    YKMSLKLVYADVVQKLLAFLVFTAIIRIKDRGGLKWIITGLSLSTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRT---RLGQISAAADNARPEMGTDLEGNP  679
             Y      L+ Q   +Q+++W  +LLF  E       R   + A       +  T LE   
Sbjct  125   YRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVVAPPSQDTGDSETSLEIQS  184

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             KE     E              ++  V  +L  NPNTYA F+GLIWA I   W   MP +
Sbjct  185   KEEEEEAEHRTQSKT---RMLLILMKVGNKLIINPNTYATFIGLIWASIHFRWGVDMPDV  241

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ SI I+A GG G+A FS GLFMA  +RII CG  +T+  + L+FL GPA  A+ +I++
Sbjct  242   VNQSIEILASGGLGMATFSLGLFMASSNRIIVCGPRMTLVAMGLKFLAGPAIMAVASIVI  301

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
              L   +LK+ I+Q+ALPQ +  F+FA+EY ++  +LST +++G +++LPV
Sbjct  302   GLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTGVLLGMLMALPV  351



>ref|NP_001267507.1| uncharacterized protein LOC100795531 [Glycine max]
 gb|AGJ95051.1| PIN11a [Glycine max]
Length=362

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 197/350 (56%), Gaps = 6/350 (2%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYV M L Y S++WW +F P+ C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADVYHVVTATVPLYVTMFLAYISVKWWKLFTPEQCSGINKFVANFSVPILSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   V +DVV K +  +           GGL W IT  SLSTL NTL++G+PLM+AM
Sbjct  65    YKMSLKLVYADVVQKLLAFLVFTAIIRIKDRGGLKWIITGLSLSTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRT---RLGQISAAADNARPEMGTDLEGNP  679
             Y      L+ Q   +Q+++W  +LLF  E       R   + A       +  T LE   
Sbjct  125   YRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVVAPPSQDTGDSETSLEIQS  184

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             KE     E              ++  V  +L  NPNTYA F+GLIWA I   W   MP +
Sbjct  185   KEEEEEAEHRTQSKT---RMLLILMKVGNKLIINPNTYATFIGLIWASIHFRWGVDMPDV  241

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ SI I+A GG G+A FS GLFMA  +RII CG  +T+  + L+FL GPA  A+ +I++
Sbjct  242   VNQSIEILASGGLGMATFSLGLFMASSNRIIVCGPRMTLVAMGLKFLAGPAIMAVASIVI  301

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPV  169
              L   +LK+ I+Q+ALPQ +  F+FA+EY ++  +LST +++G +++LPV
Sbjct  302   GLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTGVLLGMLMALPV  351



>ref|XP_010906421.1| PREDICTED: probable auxin efflux carrier component 1b [Elaeis 
guineensis]
Length=350

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 130/361 (36%), Positives = 206/361 (57%), Gaps = 24/361 (7%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              ++Y VV AMAPLY AM LGY ++RWW +  PD C+ IN F   F LP   F  I+  +P
Sbjct  5     SNLYHVVEAMAPLYTAMALGYAAVRWWRVLSPDQCNGINHFVALFPLPILAFRLISSNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGG----LDWSIttfslstlnntLVVGVPL  862
             YTMN   +A+D + K  ++ AL  W+   + GG    L W IT F L+TL NT+++G+PL
Sbjct  65    YTMNTRLLAADSLQKLFLLAALFAWSYIRRGGGAAAALPWVITVFCLATLPNTVIMGIPL  124

Query  861   MQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGN  682
             ++ MYG     L++Q   +Q+  W   +LF  E+   R   +     N+   M    E  
Sbjct  125   LRGMYGPAAGQLMVQIVVVQSAFWWNFVLFLYEYISARHDIMEQEQMNSNHAM----EFP  180

Query  681   PKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPs  502
             P                  S   +  +V  +L + P T+A  LGL+W++I       MP+
Sbjct  181   PLM----------------SVWRVPVTVGRKLIRMPRTHAAILGLLWSLIAFRLGIKMPA  224

Query  501   iiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAIL  322
             IIDDS+ I++   +G++MF  G F+A Q + ISCG+++  + ++++F++GP      ++ 
Sbjct  225   IIDDSLSIISVTATGLSMFCVGTFIAQQSKFISCGYSMATFAVIVKFIVGPGIMVASSLA  284

Query  321   LRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILE  142
             + L G +L +  VQ+ALP A  +F++AKEY +H D++S+ +IIGT +S+P+ I YY++L 
Sbjct  285   VGLQGLLLHVAAVQAALPLATVSFVYAKEYNVHPDIMSSGVIIGTFISVPITILYYILLG  344

Query  141   L  139
             L
Sbjct  345   L  345



>ref|XP_010550069.1| PREDICTED: putative auxin efflux carrier component 5 [Tarenaya 
hassleriana]
Length=359

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 135/365 (37%), Positives = 204/365 (56%), Gaps = 14/365 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y VV +  PLYV MILGY S +   +F P+ C  IN F   F +P  +F  I+Q 
Sbjct  3     SWLDVYHVVSSTVPLYVTMILGYVSAKHLKLFSPEQCSGINTFVSKFSIPLLSFQVISQN  62

Query  1035  DPYTMNYLF----vasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGV  868
             +PY MN           ++A   +   +  W      G L   IT FS+STL NTL++G+
Sbjct  63    NPYKMNPRLILSDALQKILAAVSLAAVVRFWRPAASGGRLGLIITGFSISTLPNTLIIGI  122

Query  867   PLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLE  688
             P+++AMYG    D ++Q   +Q+L+W  +L          L +++AA  +    + T+  
Sbjct  123   PMLRAMYGDGSVDSLVQIIVLQSLIWYNLL--------LFLFELNAARSSVAARVPTEHR  174

Query  687   GNPKeaaaagetpaapTNIG--PSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHF  514
             GN    A         T +    S   ++  V  +L +NPN+YA   GLIWA I     +
Sbjct  175   GNENTDAEQEPKEEEETVLAYDSSTGRILLKVWRKLVRNPNSYATLAGLIWASIHFRLGW  234

Query  513   TMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAI  334
              MP ++D SI +++ GG G+AMFS GLFMA Q  II+CG  +    +VL+FLIGP     
Sbjct  235   EMPGMVDGSIRLLSDGGLGMAMFSLGLFMASQRSIIACGKQMLAITMVLKFLIGPILMVA  294

Query  333   GAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYY  154
              A  +RLHG +L+ +I+QSALPQ +  F+FAKEY ++ +++ST +I G +++LP+ + YY
Sbjct  295   SAFGIRLHGTLLRTMILQSALPQGIVPFVFAKEYNVYPEIVSTGVIFGMVVALPIALAYY  354

Query  153   VILEL  139
              ++ L
Sbjct  355   FVMAL  359



>ref|XP_009121614.1| PREDICTED: putative auxin efflux carrier component 5 [Brassica 
rapa]
Length=362

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 205/366 (56%), Gaps = 13/366 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V  A  PLYVAMILGY S +  ++F  + C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDVYHVFSATVPLYVAMILGYLSAKHLNIFSLEQCAGINKFVAKFSVPLLSFQVISQN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF-----VKNGGLDWSIttfslstlnntLVVG  871
             +P+ M+   + SD++ K    V L +   F      + G L W IT  S+S L NTL++G
Sbjct  63    NPFKMSPRLILSDILQKIFAFVVLAVVLRFWHPTGGRGGKLGWIITGLSVSVLPNTLILG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNAR--PEMGT  697
             +P++ A+ G    ++++Q   +Q+L+W  +LLF  E    R    S A+   R       
Sbjct  123   IPILSAIDGDAAVNILVQIVVLQSLIWYNILLFLFEINAARKITSSGASIEHRGNDNEEA  182

Query  696   DLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWH  517
             D+E  PKE  A   T        P    ++     +L  NPNTYA   GL+WA +     
Sbjct  183   DIEQEPKEEVAIVRTR------SPGTGKILLKAWQKLIINPNTYAALFGLVWATLHFRLG  236

Query  516   FTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSA  337
             + +P +I  S+ +++ GG G+AMFS GLFMA Q  II+CG  + +  +VL+F+IGPA   
Sbjct  237   WKLPEMIGKSVHMISDGGLGMAMFSLGLFMASQSSIIACGTKMAIITMVLKFVIGPALMV  296

Query  336   IGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGY  157
               A  +RL   + ++ ++Q+ALPQ +  F+FAKEY ++ ++ ST +I G I+SLP+ + Y
Sbjct  297   ASAFSIRLRSTLFRVTVLQAALPQGIVPFVFAKEYNVNPEIASTGVIFGMIISLPITLAY  356

Query  156   YVILEL  139
             Y +L+L
Sbjct  357   YFVLDL  362



>ref|XP_006286843.1| hypothetical protein CARUB_v10003844mg [Capsella rubella]
 gb|EOA19741.1| hypothetical protein CARUB_v10003844mg [Capsella rubella]
Length=370

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 208/368 (57%), Gaps = 9/368 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W DIY VV A  PLYV+MILGY + +   +F P+ C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDIYHVVSATVPLYVSMILGYVAAKHLELFTPEQCAGINKFVAKFSIPLLSFQIISQN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF------VKNGGLDWSIttfslstlnntLVV  874
             +P+ M+   + SDV+ K + +V L +   F         G L W IT  S+S   NTL++
Sbjct  63    NPFKMSLKLILSDVLQKFLALVVLGLVLRFWHPTGGRGGGKLGWVITGLSISVFPNTLIL  122

Query  873   GVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTD  694
             G+P++ A+YG     ++ Q   +Q+L+W ++LLF  E    R      A+ N    +  +
Sbjct  123   GIPILTAIYGDEAESILRQIVVLQSLIWYSILLFLFELNAARAKTSPGASSNIDHAVNIE  182

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVC---LRLAKNPNTYACFLGLIWAIITKG  523
              E   +E     E       +    T  MK V     +L  NPNTYA  +G+IWAI+   
Sbjct  183   EEPKEEEEEEEEEEEEEAAIVRTRSTGTMKVVLKAWRKLIINPNTYATLIGIIWAILHFR  242

Query  522   WHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPAT  343
               + +P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  + +  ++L+F++GPA 
Sbjct  243   LGWKLPEMIDKSIHMISDGGLGMAMFSLGLFMASQTSIIACGAKMAMITMILKFVLGPAL  302

Query  342   SAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMI  163
                     RL G++ K+ I+Q+ALPQ V  F+FAKEY LH +++ST +I G +++LP  +
Sbjct  303   MIASVFSFRLRGNLFKVAILQAALPQGVVPFVFAKEYNLHPEIVSTGVIFGMLIALPTTL  362

Query  162   GYYVILEL  139
              YY +L++
Sbjct  363   AYYFLLDI  370



>ref|XP_001765763.1| PIND AtPIN5-like auxin efflux carrier [Physcomitrella patens]
 gb|EDQ69354.1| PIND AtPIN5-like auxin efflux carrier [Physcomitrella patens]
Length=358

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 134/369 (36%), Positives = 207/369 (56%), Gaps = 27/369 (7%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
             G  Y V+ A+ PLYVA+ LGYGS++WW +  P+    I+RFN    +P   F  IA  +P
Sbjct  5     GQFYDVLCAVVPLYVALFLGYGSLKWWGVVTPEQSAGISRFNALIAMPPLIFEIIAFNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             YTMN   +A+  ++  +V+V L  W    K G LDW IT F LS + NT++VG+P++  +
Sbjct  65    YTMNNRLIAAYCLSNGIVLVGLCAWVWCTKCGNLDWVITLFQLSVMPNTIIVGIPVLSPL  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTR-LGQI---SAAADN----ARPEMGTD  694
             Y     +  + A  +  +LWL   LF  E +  R +GQ    S A  N    A  E GT 
Sbjct  125   YSVT--ESGIAAIFIGQVLWLFPTLFLYELKEVRKMGQPAVGSVAQRNSFSVANGESGTR  182

Query  693   LEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKN----PNTYACFLGLIWAIITK  526
               G                 + PS   + K + +++AK     P T+A  +G+++++I  
Sbjct  183   ENGTEHGH-----------EMAPSQMNL-KEMAIKVAKKMVQLPLTHATVMGIVYSLIAG  230

Query  525   GWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPA  346
              W F    I+ +S+ IM +   G+ M+S GLFMA Q ++++  W +  YG   RF++GP 
Sbjct  231   RWGFDPLRILRNSLDIMGRITLGLTMYSIGLFMAGQKKLVA-SWWVAFYGAFCRFIVGPG  289

Query  345   TSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVM  166
             T  + ++LL L GD L+   +Q+ALPQAV +F+FAK+Y LH DV +TA+ + TI+ +P++
Sbjct  290   TMGVASLLLGLRGDTLRFAFLQAALPQAVISFVFAKDYNLHTDVFTTAVSLQTIVFMPIV  349

Query  165   IGYYVILEL  139
             + YY +LEL
Sbjct  350   LVYYTLLEL  358



>ref|NP_197014.1| auxin transporter PIN8 [Arabidopsis thaliana]
 sp|Q9LFP6.1|PIN5_ARATH RecName: Full=Putative auxin efflux carrier component 5; Short=AtPIN5 
[Arabidopsis thaliana]
 emb|CAC01829.1| auxin transport protein-like [Arabidopsis thaliana]
 gb|AED92117.1| auxin transporter PIN8 [Arabidopsis thaliana]
Length=367

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 141/375 (38%), Positives = 211/375 (56%), Gaps = 26/375 (7%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W DIY VV A  PLYV+M LG+ S R   +F P+ C  IN+F   F +P  +F  I++ 
Sbjct  3     SWLDIYHVVSATVPLYVSMTLGFLSARHLKLFSPEQCAGINKFVAKFSIPLLSFQIISEN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF-----VKNGGLDWSIttfslstlnntLVVG  871
             +P+ M+   + SD++ K +VVV L +   F      + G L W IT  S+S L NTL++G
Sbjct  63    NPFKMSPKLILSDILQKFLVVVVLAMVLRFWHPTGGRGGKLGWVITGLSISVLPNTLILG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDL  691
             +P++ A+YG     ++ Q   +Q+L+W T+LLF  E    R          A P  G  L
Sbjct  123   MPILSAIYGDEAASILEQIVVLQSLIWYTILLFLFELNAAR----------ALPSSGASL  172

Query  690   E--GNPKeaaaagetpaapTNIGPSYTAMMKSVCL---------RLAKNPNTYACFLGLI  544
             E  GN +E A   + P    +         +SV           +L  NPNTYA  +G+I
Sbjct  173   EHTGNDQEEANIEDEPKEEEDEEEVAIVRTRSVGTMKILLKAWRKLIINPNTYATLIGII  232

Query  543   WAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLR  364
             WA +     + +P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  + +  ++L+
Sbjct  233   WATLHFRLGWNLPEMIDKSIHLLSDGGLGMAMFSLGLFMASQSSIIACGTKMAIITMLLK  292

Query  363   FLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTI  184
             F++GPA     A  +RL   + K+ I+Q+ALPQ V  F+FAKEY LH +++ST +I G +
Sbjct  293   FVLGPALMIASAYCIRLKSTLFKVAILQAALPQGVVPFVFAKEYNLHPEIISTGVIFGML  352

Query  183   LSLPVMIGYYVILEL  139
             ++LP  + YY +L+L
Sbjct  353   IALPTTLAYYFLLDL  367



>gb|KCW84567.1| hypothetical protein EUGRSUZ_B01406, partial [Eucalyptus grandis]
Length=285

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 173/282 (61%), Gaps = 0/282 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVVV+M PLYV ++LGY S++WW +F  D CD INRF   FILP F F F A +
Sbjct  3     GWGDMYKVVVSMFPLYVPLMLGYSSVKWWRLFSHDQCDGINRFISLFILPLFGFGFTAHI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +P+ MN+  +A+D ++K   +  L +W  F   G   W ITTFSL TL N LVVGVP++Q
Sbjct  63    NPFAMNFRLLAADGLSKLATLSILALWGRFSSRGSYSWCITTFSLCTLPNLLVVGVPMLQ  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLEGNPK  676
             AMYG+   DL +Q   +Q+L+W  ++L  LEFR+ R+  ++        E G   E    
Sbjct  123   AMYGKWAVDLAVQLCMLQSLIWYPLVLLFLEFRKRRMMDLATPPPPPLEENGVVDEERDI  182

Query  675   eaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsii  496
               +    +     ++        + V +++A NPN YA  LGL WA++     FTMPSI+
Sbjct  183   GMSVVNTSEVGGDDLEKRSRGTFQMVWIKMAMNPNVYANVLGLAWALMASRLKFTMPSIM  242

Query  495   ddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLV  370
             + SI IM+KGG+G AMF+ G+FMA+Q ++I+CG    V G+V
Sbjct  243   EGSIEIMSKGGTGTAMFNIGIFMAMQTKVIACGTGPAVLGMV  284



>ref|XP_009395146.1| PREDICTED: probable auxin efflux carrier component 1b [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 140/380 (37%), Positives = 213/380 (56%), Gaps = 24/380 (6%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
               +Y VV +MAPLYVAM LGY S+R+   F P+ C  IN F   F +P   F  I+  DP
Sbjct  5     SSLYHVVESMAPLYVAMGLGYASVRF-RAFTPEQCAGINHFVALFAMPLLIFRMISSNDP  63

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y MN  F+A+D + KA ++ AL +WA     G L W +T FSL+TL NT+++GVP+++ M
Sbjct  64    YAMNLRFIAADTIQKAAILAALALWARLSARGSLAWVVTLFSLATLPNTIIMGVPILRGM  123

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL-----------------------GQ  739
             YG +   L++Q   +Q   W  +++F  E+   +                         Q
Sbjct  124   YGSMSGTLMVQIVVLQFAFWYVLVVFLFEYMAAQRALVAKQQQAAAPAAVVLTVLDGDQQ  183

Query  738   ISAAADNARPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYAC  559
             I+A+A     E   + + N + A       A      PS   ++     ++ K P+ +A 
Sbjct  184   INASAVVPVTEGDRNADTNTEAAMPPPPAEAEAAMAAPSAKLILLMAAKKILKIPSIHAS  243

Query  558   FLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVY  379
              LGL+W+ I       +P+IIDDS+ I++   +G+A FS G FMA Q R ISCG ++   
Sbjct  244   MLGLVWSFIAYREGIKLPTIIDDSVAIISVSATGLATFSVGTFMAQQSRFISCGCSVASL  303

Query  378   GLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAI  199
              + +RFL+GPA  A  ++ + LHGD+L + IVQ+ALP AV +F++AKEY +H +++ST +
Sbjct  304   AMAMRFLVGPAVMAASSLAVGLHGDLLHVGIVQAALPLAVISFVYAKEYNVHPEIMSTGV  363

Query  198   IIGTILSLPVMIGYYVILEL  139
             I+GT  S P+ I YY++L L
Sbjct  364   IVGTFASFPITIIYYILLGL  383



>ref|NP_001276253.1| uncharacterized protein LOC100779697 [Glycine max]
 gb|AGJ95068.1| PIN8b [Glycine max]
Length=352

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 192/351 (55%), Gaps = 18/351 (5%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D Y VV A  PLYV +IL Y S++WW +F PD C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADAYHVVAATVPLYVTLILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   + +D + K +  + L+        GGL W IT  SL+TL NTL++G+PLM+AM
Sbjct  65    YKMSLKLMYADFLQKLLAFLLLIAITKISGRGGLKWIITGLSLTTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTD--------  694
             Y      L+ Q   +Q+++W  +LLF  E       + +AAA    P  G+         
Sbjct  125   YKGEAVVLLAQIIFLQSMIWYNLLLFLYELDAVNKTRPTAAAP---PSQGSGSNAMQYKN  181

Query  693   -LEGNPKeaaaagetpaapTNIGPSYTAMMK------SVCLRLAKNPNTYACFLGLIWAI  535
              +    +   A         +  P     MK      +V  +L +NPNTYA  LG IW+ 
Sbjct  182   LMHKYRETDTAREVQSKREEDAEPRIKRKMKVMLILVTVGKKLIRNPNTYATLLGFIWSS  241

Query  534   ITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLI  355
             I   W   MP +++ SI I++ GG G+AMFS GLFMA Q  II+CG  +T+  + L+ ++
Sbjct  242   IQFRWGLHMPEVVNQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMTMVAIGLKVVL  301

Query  354   GPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTA  202
             GPA  A+ ++++ L   + K+ IVQ+ALPQ +  F+FAKEY +H  VLSTA
Sbjct  302   GPALMAVASLVIGLRDKLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTA  352



>ref|XP_006600903.1| PREDICTED: putative auxin efflux carrier component 5-like isoform 
X3 [Glycine max]
Length=348

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 188/338 (56%), Gaps = 5/338 (1%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D+Y VV A  PLYV M L Y S++WW +F P+ C  IN+F   F +P  +F  I+  + 
Sbjct  5     ADVYHVVTATVPLYVTMFLAYISVKWWKLFNPEQCSGINKFVANFSVPILSFQVISSNNI  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAM  850
             Y M+   V +DVV K +  +           GGL W IT  SLSTL NTL++G+PLM+AM
Sbjct  65    YKMSLKLVYADVVQKLLAFLVFTAIIRIKGRGGLKWIITGLSLSTLPNTLILGIPLMKAM  124

Query  849   YGRLGYDlvlqaaamqallwltmlLFGLEFRRT---RLGQISAAADNARPEMGTDLEGNP  679
             Y      L+ Q   +Q+++W  +LLF  E       R   + A       E  T LE   
Sbjct  125   YRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVVAPPSQDTGESETSLEIQS  184

Query  678   KeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsi  499
             KE           +        ++  V  +L  NPNTYA F+GLIWA I   W   MP +
Sbjct  185   KEEEEEEAEHRTQSKT--RMLLILMKVGNKLIINPNTYATFIGLIWASIHFRWGVDMPDV  242

Query  498   iddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILL  319
             ++ SI I+A GG G+A FS GLFMA  +R+I CG  +T+  + L+FL+GPA  A+ +I++
Sbjct  243   VNQSIEILASGGLGMATFSLGLFMASNNRVIVCGPRMTLVAMGLKFLVGPAIMAVASIVI  302

Query  318   RLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLST  205
              L   +LK+ I+Q+ALPQ +  F+FA+EY ++  +LST
Sbjct  303   GLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILST  340



>emb|CDX85565.1| BnaA02g02480D [Brassica napus]
Length=362

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 130/366 (36%), Positives = 209/366 (57%), Gaps = 13/366 (4%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V  A  PLYV+MILGY S +  ++F  + C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDVYNVFSATVPLYVSMILGYLSTKHLNLFSLEQCVGINKFIAKFSIPLLSFQVISQN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANF-----VKNGGLDWSIttfslstlnntLVVG  871
             +P+TM+   + SD++ K +  V L +   F        G L W IT  S++   NTL++G
Sbjct  63    NPFTMSLRLILSDILQKILAAVVLAVVIRFWHPKGGTGGKLGWIITGLSVTVFPNTLIIG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNAR--PEMGT  697
             +P++ A+ G    ++++Q   +Q L+W  +LLF  E   T   Q S A+   R      T
Sbjct  123   IPILSAIDGDAAKNILVQIVVLQCLIWSNILLFLFEINATWDLQSSGASIEHRVNDNEET  182

Query  696   DLEGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWH  517
             D+E  P E  A   T ++ T        ++     +   NPNTYA  +GLIWA +     
Sbjct  183   DIEQEPIEEEAIVRTRSSGTG------KIILKAWRKFIVNPNTYAAMIGLIWATLHFRLG  236

Query  516   FTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSA  337
             + +P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  +++  ++L+F++GPA   
Sbjct  237   WKLPEMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMSIITMILKFILGPALMI  296

Query  336   IGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGY  157
               A  +RL G + ++ I+Q+ LPQ +  F+FAKEY ++ +++ST +I G ++ +P+ + Y
Sbjct  297   ASAFCIRLRGTLFRVTILQATLPQGIVPFVFAKEYNVNPEIVSTGVIFGMLVFVPITLAY  356

Query  156   YVILEL  139
             Y +L+L
Sbjct  357   YFVLDL  362



>ref|XP_006661411.1| PREDICTED: probable auxin efflux carrier component 4-like [Oryza 
brachyantha]
Length=251

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            ++++V L++A+NPN YA  LG+ WA +T  WH   PSII+ S++IM+K G G++MFS GL
Sbjct  92   LVRAVWLKVARNPNVYAGVLGVAWACVTNRWHVQTPSIIEGSVLIMSKTGVGLSMFSMGL  151

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ++II CG   TV G+ LRF+ GP+ +A+GA  L L GD+L++ I+Q+ALPQ++TT
Sbjct  152  FMALQEKIIVCGAGPTVLGMALRFVAGPSATAVGAFALGLRGDLLRLAIIQAALPQSITT  211

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
            F+FAKEYGLHA+VLSTA+I GT+ SLPV+I YY++L
Sbjct  212  FVFAKEYGLHAEVLSTAVIFGTLASLPVLIVYYIVL  247


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             GWGD+YKVV AMAPLY A++LGYGS+RWW +F PD CD +NR   +F +PFF F F ++V
Sbjct  3     GWGDVYKVVAAMAPLYFALVLGYGSVRWWRLFTPDQCDTVNRLVAYFAVPFFGFDFASRV  62

Query  1035  DPYTMNY  1015
             DP+ ++Y
Sbjct  63    DPFALSY  69



>ref|XP_009126029.1| PREDICTED: putative auxin efflux carrier component 5 [Brassica 
rapa]
Length=361

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 122/363 (34%), Positives = 203/363 (56%), Gaps = 8/363 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V  A  PLYV+MILGY S +  ++F  + C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDVYNVFSATVPLYVSMILGYLSTKHLNLFSLEQCVGINKFIAKFSIPLLSFQVISQN  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVI----WANFVKNGGLDWSIttfslstlnntLVVGV  868
             +P+TM+   + SD++ K +  V   +    W      G L W IT  S++   NTL++G+
Sbjct  63    NPFTMSLRLILSDILQKILAAVVFAVVIRFWHPTGGGGKLGWIITGLSVTVFPNTLIIGI  122

Query  867   PLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDLE  688
             P++ A+ G    ++++Q   +Q L+W  +LLF  E   T   Q S A+   R     + +
Sbjct  123   PILSAIDGDAAKNILVQIVVLQCLIWSNILLFLFEINATWDLQSSGASIEHRVNDNEETD  182

Query  687   GNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTM  508
              + +            +  G     ++     +   NPNTYA  +GLIWA +     + +
Sbjct  183   IDQEPIEEEAIVRTRSSGTG----KIILKAWRKFIVNPNTYAAMIGLIWATLHFRLGWKL  238

Query  507   PsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGA  328
             P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  +++  ++L+F++GPA     A
Sbjct  239   PEMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMSIITMILKFILGPALMIASA  298

Query  327   ILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVI  148
               +RL G + ++ I+Q+ LPQ +  F+FAKEY ++ +++ST +I G ++ +P+ + YY +
Sbjct  299   FCIRLRGTLFRVTILQATLPQGIVPFVFAKEYNVNPEIVSTGVIFGMLVFVPITLAYYFV  358

Query  147   LEL  139
             L+L
Sbjct  359   LDL  361



>ref|XP_003564417.1| PREDICTED: probable auxin efflux carrier component 5 [Brachypodium 
distachyon]
Length=417

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 145/411 (35%), Positives = 214/411 (52%), Gaps = 56/411 (14%)
 Frame = -3

Query  1203  IYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYT  1024
             +Y VV AMAPLY A +LGY S+RW   F  + C  IN F   + +P   FH ++  DPY 
Sbjct  7     VYHVVEAMAPLYTAALLGYASVRWLGAFSAEQCAGINHFVAIYAVPVLIFHMVSTNDPYA  66

Query  1023  MNYLFvasdvvakamvvvalVIWA----NFVKNGG--------------LDWSIttfsls  898
             M+   +A+D + KA +++ALV WA     + + G               L W +T FS++
Sbjct  67    MSGRLIAADTLQKAAMLLALVAWAAWPARWRRRGNNNKAVAAAAAAVSPLQWVVTAFSVA  126

Query  897   tlnntLVVGVPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQ-------  739
              L NT+++GVPL+  MYG +   L+ Q   MQ  +W  +++F  E+   R          
Sbjct  127   ALPNTIIMGVPLLGGMYGDVSKGLMKQIVVMQFCVWYNVVIFIYEYMAARRAATVDGTAR  186

Query  738   ---------ISAAADNAR-----------------PEMGTDLEGNPKeaaaagetpaapT  637
                      +  AA+ A                  P+ G   E      A    T     
Sbjct  187   IRDANDDDIVVVAAERAHEVTVKIEITEVAAAPPVPQEGVAGETKTTTVAKETSTAETEG  246

Query  636   NIGPSYTA-MMKSVCL----RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMA  472
                P  TA   + V L    ++ K PNTYA FLGLIWA+I       MP IIDDS+  + 
Sbjct  247   VSPPKKTAPSARHVALMAGKKVLKIPNTYASFLGLIWALIAFKCGIKMPKIIDDSLFTIH  306

Query  471   KGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKI  292
                 G++MF++G F+A Q R + CG+ +    +VL+FLIGP    + ++ + LHG +L I
Sbjct  307   TTAVGLSMFASGTFIARQSRFVPCGYAVASISMVLKFLIGPVVMLLASLAIGLHGTLLHI  366

Query  291   VIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              +VQ+ALP AVT+F++A+EY +HAD++ST +I+G  +SLPV I YY++L L
Sbjct  367   AVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVYYILLGL  417



>gb|EMT10264.1| Putative auxin efflux carrier component 4 [Aegilops tauschii]
Length=244

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -3

Query  621  YTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFS  442
            +  ++++V ++LA+NPN YA  LG+ W+ +   WH  MPSIID SI IM+K   G+ MFS
Sbjct  82   WAPLLRAVGVKLARNPNVYASLLGVAWSSVANRWHLKMPSIIDGSIAIMSKTCIGMGMFS  141

Query  441  TGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQA  262
             G+F+ LQD+ I CG  LTV  L LRF++ PA +  GA++L L GD+L++ I+Q+ALPQ+
Sbjct  142  MGMFIGLQDKFIVCGLGLTVLSLGLRFIVAPAATVAGALILGLRGDLLRVTILQAALPQS  201

Query  261  VTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
            V TF+F++EY LHA VLSTA+I+ T+ SLPV+  YY++L L+
Sbjct  202  VATFVFSREYDLHAGVLSTAVIVSTLASLPVLTAYYLVLGLV  243



>ref|NP_001267522.1| uncharacterized protein LOC100781239 [Glycine max]
 gb|AGJ95064.1| PIN7a [Glycine max]
Length=492

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
             L +NPNTYAC LGL W++I+  W+  MPSI   SI+I++K G+G+AMFS GLFMALQ +
Sbjct  342  NLIRNPNTYACVLGLAWSLISFRWNIKMPSIAKGSILILSKTGTGMAMFSLGLFMALQPK  401

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
             I+CG T T   +V RF++GPA  A+ +I++ + G +L++ IVQ+ALPQAV +F+FAKEY
Sbjct  402  TIACGKTWTTISMVARFVVGPAVIAVTSIVIGIRGVLLRVAIVQAALPQAVLSFVFAKEY  461

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             LHAD++STA+I GT++SLP+ I Y+V+L L
Sbjct  462  NLHADIISTAVIFGTVISLPITIIYFVLLGL  492


 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -3

Query  1203  IYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYT  1024
             IY +V A+ PLYV MIL Y S+ WW +F P+ C  INR    + +PF  F+F+A  +PY 
Sbjct  7     IYNIVAALVPLYVPMILAYASVLWWKIFTPEQCSGINRLVALYSVPFLNFNFLAFNNPYA  66

Query  1023  MNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMYG  844
             MN  F+A+D + K +++ AL +W+ F K G LDW+IT FSLSTL NTL+VGVPL+ AMYG
Sbjct  67    MNLRFIAADTLQKVIILGALFLWSAFTKCGNLDWTITLFSLSTLPNTLIVGVPLLTAMYG  126



>ref|XP_006400028.1| hypothetical protein EUTSA_v10016062mg [Eutrema salsugineum]
 gb|ESQ41481.1| hypothetical protein EUTSA_v10016062mg [Eutrema salsugineum]
Length=362

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 130/364 (36%), Positives = 205/364 (56%), Gaps = 9/364 (2%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W DIY VV A  PLYV+M LGY S +   +F  + C  IN+F   F +P  +F  I+Q 
Sbjct  3     SWLDIYHVVSATVPLYVSMFLGYLSAKNLKLFSLEQCAGINKFVAKFSIPLLSFQVISQN  62

Query  1035  DPYTMN-YLFvasdvvakamvvvalVIWANFVKNGG----LDWSIttfslstlnntLVVG  871
             +P+TM+  L ++  +     VVV   +  ++   GG    L W IT  S+S L NTL++G
Sbjct  63    NPFTMSPRLILSDILQKILAVVVFAAVLRSWHPTGGRGGKLGWIITGLSVSVLPNTLIIG  122

Query  870   VPLMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNARPEMGTDL  691
             +P++ A+ G    + ++Q   +Q+L+W  +LLF  E    R    S A+   R     D+
Sbjct  123   IPILSAIDGDAAVNFLVQIVMLQSLIWYNILLFLFEINAARTIISSGASIEHRGNEEADI  182

Query  690   EGNPKeaaaagetpaapTNIGPSYTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFT  511
             E  PKE           +  G     ++     +   NPNTYA  +GLIW+ +     + 
Sbjct  183   EQEPKEEEEEAIVRTRSSGTG----KILLKAWRKFITNPNTYATLVGLIWSALHFRLGWK  238

Query  510   MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
             +P +ID SI +++ GG G+AMFS GLFMA Q  II+CG  + +  ++L+FL+GP      
Sbjct  239   LPGMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMAIITMLLKFLLGPGLMIAS  298

Query  330   AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
             A  +RL   + ++ I+Q+ALPQ +  F+FAKEY ++ +++ST +IIG +++LP+ + YY 
Sbjct  299   AFCIRLRSTLFRVAILQAALPQGIVPFVFAKEYNVYPEIVSTGVIIGMLITLPITLAYYF  358

Query  150   ILEL  139
             +L+L
Sbjct  359   VLDL  362



>gb|EEE55544.1| hypothetical protein OsJ_03782 [Oryza sativa Japonica Group]
Length=413

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 139/413 (34%), Positives = 218/413 (53%), Gaps = 65/413 (16%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             MAPLY A  LGYGS+RW   F  + C  IN F   + +P   F  ++  + Y MN   +A
Sbjct  1     MAPLYTAAALGYGSVRWLKAFSNEQCAGINHFVALYAVPVLIFDMVSTNNVYKMNGRLIA  60

Query  1002  sdvvakamvvvalVIWANFVKN--------------GGLDWSIttfslstlnntLVVGVP  865
             +D + KA++++ L+ WA + ++                L W IT FS+++L NT+++GVP
Sbjct  61    ADTLQKAVLLLGLMAWALWERSRARGAGAKAKAAVSSPLQWVITCFSVASLPNTIIMGVP  120

Query  864   LMQAMYGRLGYDlvlqaaamqallwltmlLFGLEF---RRTRLG----------QISAAA  724
             L+  MYG +  DL+ Q   MQ  +W  +++F  E+   RR+ LG          +IS ++
Sbjct  121   LLNGMYGPVSKDLMKQIVVMQFCIWYNVIIFLYEYMAARRSALGPLPASSEGSAKISPSS  180

Query  723   DNARPEMGTDLEGN------PKeaaaagetpaapTN-----IGPSYTAMMKSVC------  595
                      D  GN      P+E A   E      +     +    TA  K V       
Sbjct  181   PVKAAAAAADTNGNAVAADRPQEVAVNIEITEMAASTARDGVSGETTAAAKEVSSGEVAP  240

Query  594   ---------------------LRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimi  478
                                   +L + PNTYA FLGLIW++I     F+MP I++DS+  
Sbjct  241   VEEEEAFAPAPSMKHVIWMAVKKLLQIPNTYASFLGLIWSLIAFKCGFSMPKIVEDSLFT  300

Query  477   MAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVL  298
             +     G++MFS+G F+A Q R + CG+ +  + +V++FLIGP      ++++ +HG +L
Sbjct  301   IRTTAVGLSMFSSGTFIARQSRFVPCGYKIASFSMVIKFLIGPVVMLFASLVIGMHGTLL  360

Query  297   KIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
              I +VQ+ALP AVT+F++A+EY +HAD++ST +I+G  +SLPV I YY++L L
Sbjct  361   HIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVYYILLGL  413



>gb|AIF28473.1| PIN-like protein, partial [Thujopsis dolabrata]
Length=705

 Score =   167 bits (424),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = -3

Query  636  NIGPSYTAMM----KSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAK  469
            N  P   AM+      V  +L +NPN+YA  +G+IWA+++  WH  MP I+  S+ I++ 
Sbjct  536  NKSPHAVAMISLIINMVFRKLIRNPNSYASVVGIIWALVSYRWHLEMPQIVKGSVTILSN  595

Query  468  GGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIV  289
             G G+AMFS GLFMALQ +II+CG +L ++G++LRFLIGPA  A+ +I   +   VL I 
Sbjct  596  AGLGMAMFSLGLFMALQPKIIACGTSLAIFGMILRFLIGPAVMAVASIATGIRDSVLHIA  655

Query  288  IVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            IVQ+ALPQ +  F+FA+EY LH DVLSTA+I G I+S+PV I YYV+L L
Sbjct  656  IVQAALPQGIVPFVFAREYNLHPDVLSTAVIFGMIVSMPVTILYYVLLGL  705


 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y V+ A+ PLYV M L YGS++WW +F P+ C  INRF   F +P  +F FI +++PY
Sbjct  6     DLYTVISAVVPLYVTMFLAYGSVKWWKIFSPEQCAGINRFVAIFAVPLLSFEFIYKINPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN+ F+A+D ++KA+V++ LVIW +F + G LDW IT FSLSTL NTLV+G+PL++AMY
Sbjct  66    EMNFRFIAADALSKAIVLLVLVIWVSFSEKGSLDWVITAFSLSTLPNTLVMGIPLLKAMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFR--RTRLGQISAAADNA  715
             G     L++Q   +Q ++W T++LF LE+R  + +L + S  ADN+
Sbjct  126   GEYAGTLMVQTVVLQCIIWYTLMLFLLEYRSAKMQLAEQSPGADNS  171



>ref|XP_010268329.1| PREDICTED: auxin efflux carrier component 1-like isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   166 bits (420),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  621  YTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFS  442
            +  ++K V  +L KNPN+YA  LGL WA+ +  W F  P II++S+ I++  G G+AMFS
Sbjct  383  FKLILKMVWFKLIKNPNSYASLLGLSWALASCRWSFKKPQIIENSVTILSNAGLGMAMFS  442

Query  441  TGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQA  262
             GLFMALQ RII+CG  L  YG+++RF++GPA  A+ +I + L G VL++ IVQ+ALPQ 
Sbjct  443  LGLFMALQPRIIACGNRLAAYGMLMRFVVGPAVMAVASIAVGLRGTVLRVSIVQAALPQG  502

Query  261  VTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            +  F+FA+EY LH DVLSTA+I G I+SLP+ + YYV L L
Sbjct  503  IVPFVFAREYNLHPDVLSTAVIFGMIISLPITVLYYVFLGL  543


 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              + D+Y V+ ++ PLYV M L Y S++WW++F PD C  IN+F   F +P  +F FI+++
Sbjct  92    SFSDLYCVLSSVVPLYVTMFLAYASVKWWNVFTPDQCAGINKFVAIFAVPLLSFEFISRI  151

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN LF+A+D V+K ++++ L  WA   K G LDW IT FSLSTL NTLV+G+PL++
Sbjct  152   NPYKMNLLFIAADSVSKVVILIVLFSWAKLSKRGSLDWVITLFSLSTLPNTLVMGIPLLK  211

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL  745
             +MYG    +L++Q   +Q ++W T++LF  E+R  R+
Sbjct  212   SMYGSDKENLMVQVVVLQCIIWYTLMLFLFEYREARI  248



>dbj|BAD93921.1| auxin transporter splice variant b [Arabidopsis thaliana]
Length=191

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP I+  SI I++  G G+AMFS GLFMALQ +
Sbjct  41   KLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQPK  100

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RF+ GPA  A+  I + LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  101  IIACGNSVATFAMAVRFITGPAIMAVAGIAIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  160

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LST +I+G +++LP+ + YY++L L
Sbjct  161  NVHPTILSTGVILGMLIALPITLVYYILLGL  191



>gb|EMS56676.1| putative auxin efflux carrier component 5 [Triticum urartu]
Length=453

 Score =   164 bits (415),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 130/393 (33%), Positives = 202/393 (51%), Gaps = 50/393 (13%)
 Frame = -3

Query  1182  MAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFva  1003
             MAPLY A +LGY S+RW   F  + C  IN F   + +P   F+ ++  +PY MN   VA
Sbjct  1     MAPLYTAAVLGYASVRWLKAFSEEQCAGINHFVAIYAVPVLIFNMVSTNNPYAMNGRLVA  60

Query  1002  sdvvakamvvvalVIWANF--------VKNGG------------LDWSIttfslstlnnt  883
             +D + KA++++ LV WA +          +GG            L W +T FS+++L NT
Sbjct  61    ADTLQKAVMLIGLVAWAAWESRSRRRRRSDGGGKASAAVAAASPLQWVVTAFSVASLPNT  120

Query  882   LVVGVPLMQAMYGRLGYDlvlqaaa-----------------------mqallwltmlLF  772
             +++GVPL+  MYG +  DL+ Q                             +        
Sbjct  121   IIMGVPLLGGMYGAMSKDLMKQIVVMQFCVCPGSPGAAPSAEKIAPNDEAVVAAKRAHEV  180

Query  771   GLEFRRTRLGQISAA----ADNARPEMGTDLEGNPKeaaaagetpaapTNIGPSYTAMMK  604
              +    T +   S A    ADN    +  +   + +    +        +  PS T +  
Sbjct  181   TVNIEITEVAPASTAQKDLADNTTTTVAKETSADAEAEQGSPPPAK---STAPSVTHIAL  237

Query  603   SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMA  424
                 ++ K PNTYA FLGLIWA+I       MP IIDDS+  +     G++MF++G F+A
Sbjct  238   MAGKKVLKIPNTYASFLGLIWALIAFKCGIKMPKIIDDSLFTIQTTAVGLSMFASGTFIA  297

Query  423   LQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIF  244
              Q R + CG+ +    +VL+FLIGP    + ++ + +HG +L I +VQ+ALP AVT+F++
Sbjct  298   RQSRFVPCGYAIASMSMVLKFLIGPVVMLLASLAIGMHGTLLHIAVVQAALPLAVTSFVY  357

Query  243   AKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             A+EY +HAD++ST +I+G  +SLPV I YY++L
Sbjct  358   AEEYKVHADIMSTGVILGIFISLPVTIVYYILL  390



>ref|XP_010268328.1| PREDICTED: probable auxin efflux carrier component 1c isoform 
X1 [Nelumbo nucifera]
Length=560

 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  621  YTAMMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFS  442
            +  ++K V  +L KNPN+YA  LGL WA+ +  W F  P II++S+ I++  G G+AMFS
Sbjct  400  FKLILKMVWFKLIKNPNSYASLLGLSWALASCRWSFKKPQIIENSVTILSNAGLGMAMFS  459

Query  441  TGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQA  262
             GLFMALQ RII+CG  L  YG+++RF++GPA  A+ +I + L G VL++ IVQ+ALPQ 
Sbjct  460  LGLFMALQPRIIACGNRLAAYGMLMRFVVGPAVMAVASIAVGLRGTVLRVSIVQAALPQG  519

Query  261  VTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            +  F+FA+EY LH DVLSTA+I G I+SLP+ + YYV L L
Sbjct  520  IVPFVFAREYNLHPDVLSTAVIFGMIISLPITVLYYVFLGL  560


 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              + D+Y V+ ++ PLYV M L Y S++WW++F PD C  IN+F   F +P  +F FI+++
Sbjct  92    SFSDLYCVLSSVVPLYVTMFLAYASVKWWNVFTPDQCAGINKFVAIFAVPLLSFEFISRI  151

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN LF+A+D V+K ++++ L  WA   K G LDW IT FSLSTL NTLV+G+PL++
Sbjct  152   NPYKMNLLFIAADSVSKVVILIVLFSWAKLSKRGSLDWVITLFSLSTLPNTLVMGIPLLK  211

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRL  745
             +MYG    +L++Q   +Q ++W T++LF  E+R  R+
Sbjct  212   SMYGSDKENLMVQVVVLQCIIWYTLMLFLFEYREARI  248



>ref|XP_008441865.1| PREDICTED: putative auxin efflux carrier component 8 [Cucumis 
melo]
Length=127

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  510  MPsiiddsimiMAKGGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIG  331
            MPSI++ SI+IM+K G+G AMF+ G+FMALQ+++I+CG TLT+ G+VL+F+ GPA  AIG
Sbjct  1    MPSIMEGSILIMSKAGTGTAMFNLGIFMALQEKLIACGPTLTIVGMVLKFIAGPAAMAIG  60

Query  330  AILLRLHGDVLKIVIVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYV  151
            ++ + LHGDVL++ I+Q+A+PQ++T+FI+AKEYGLHADVLSTA+I G I+SLPV++ YY 
Sbjct  61   SVAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSLPVLVAYYA  120

Query  150  ILELL  136
             LE +
Sbjct  121  ALEFI  125



>gb|AIF28472.1| PIN-like protein, partial [Glyptostrobus pensilis]
Length=705

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = -3

Query  636  NIGPSYTAMMK----SVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAK  469
            N  P   AM+      V  +L +NPN+YA  +G++WA+++  WH  MP I+  S+ I++ 
Sbjct  536  NKSPHAVAMINLIINMVFRKLVRNPNSYASVVGIVWALVSYRWHLEMPQIVRGSVTILSN  595

Query  468  GGSGIAMFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIV  289
             G G+AMFS GLFMALQ +II+CG ++ ++G++LRF+IGPA  A+ +I   +   VL I 
Sbjct  596  AGLGMAMFSLGLFMALQPKIIACGTSVAIFGMILRFIIGPAVMAVASITTGIRDSVLHIA  655

Query  288  IVQSALPQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            IVQ+ALPQ +  F+FA+EY LH DVLSTA+I G I+S+PV I YYV+L L
Sbjct  656  IVQAALPQGIVPFVFAREYNLHPDVLSTAVIFGMIVSMPVTILYYVLLGL  705


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y V+ A+ PLYV M L YGS++WW +F P+ C  INRF   F +P  +F FI +++PY
Sbjct  6     DLYTVISAVVPLYVTMFLAYGSVKWWKIFSPEQCAGINRFVAIFAVPLLSFEFIYKINPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN+ F+A+D ++KA+V++ LV+W +F + G LDW IT FSLSTL NTLV+G+PL++AMY
Sbjct  66    EMNFRFIAADALSKAIVLLVLVLWVSFSEKGSLDWVITIFSLSTLPNTLVMGIPLLKAMY  125

Query  846   G  844
             G
Sbjct  126   G  126



>ref|XP_011006097.1| PREDICTED: auxin efflux carrier component 3-like [Populus euphratica]
Length=460

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            ++K+V L+L +NPN+YA  +G+ WA++++ +    P I+D+S+ I++K G G+AMFS GL
Sbjct  303  ILKTVWLKLVRNPNSYASLIGISWALVSRRYGIAKPQIVDNSVTILSKAGLGMAMFSLGL  362

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ RII+CG  + +YG++ RFL GPA  A+ +I + L G +LK+ IVQ+ALPQ +  
Sbjct  363  FMALQPRIIACGNRMAIYGMLARFLAGPAVMAVASIGVGLRGTMLKLSIVQAALPQGIVP  422

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            F+FA+EYGLH DVLSTA+I G I+SLP+ I YY+ L L
Sbjct  423  FVFAREYGLHPDVLSTAVIFGMIVSLPITILYYIFLGL  460


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D Y V+ A+ PLYV M L Y S++WW++F P  C  INRF  +F +P  +  FI+++DPY
Sbjct  6     DFYGVLCAVVPLYVTMFLAYASVKWWNIFTPGQCSGINRFVAYFAVPLLSMEFISRIDPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              M+ LF+A+D V+K +++V L+ WANF + G L+W+IT FSLSTL NTLV+G+PL+++MY
Sbjct  66    KMDLLFMAADGVSKVLILVVLLCWANFSRRGSLEWAITLFSLSTLPNTLVMGIPLLKSMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTRLG  742
             G     L++Q   +Q ++W T+LLF  E+R  RL 
Sbjct  126   GDDKEGLMIQVVVLQCIIWYTLLLFLFEYREARLA  160



>gb|AIF28466.1| PIN-like protein, partial [Podocarpus rubens]
Length=679

 Score =   164 bits (414),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 114/158 (72%), Gaps = 0/158 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            ++  V  +L +NPN+YA  LG+IWA+++  WHF MP II  S+ I++  G G+AMFS GL
Sbjct  522  ILNMVFRKLIRNPNSYASVLGIIWALVSYRWHFKMPQIIKGSVSILSDAGLGMAMFSLGL  581

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ +II+CG  L V+G+V+RFL GPA  A  +I+  L   VL I IVQ+ALPQ +  
Sbjct  582  FMALQPKIIACGKDLAVFGMVVRFLTGPAVMAGASIIAGLRDTVLHIAIVQAALPQGIVP  641

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            F+FA+EY LH DVLSTA+I G I+++P+ I YY++L L
Sbjct  642  FVFAREYNLHPDVLSTAVIFGMIVAMPITILYYILLGL  679


 Score = 93.2 bits (230),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D+Y V+ A+ PLYV M L YGS++WW++F P+ C  INRF   F +P  +F FI  ++PY
Sbjct  6     DLYTVISAIFPLYVTMFLAYGSVKWWNIFSPEQCAGINRFVATFAVPLLSFEFIYNINPY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN+ F+A+DV++KA+V+V L +W  F +   LDW IT FSLSTL NTLV+G+PL++AMY
Sbjct  66    KMNFKFIAADVISKAIVLVVLGLWGKFARKERLDWVITLFSLSTLPNTLVMGIPLLKAMY  125

Query  846   G  844
             G
Sbjct  126   G  126



>gb|AIF28483.1| PIN-like protein, partial [Dioscorea villosa]
Length=179

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  600  VCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMAL  421
            VC +L++NPNTY+  LGL+W++I+  WH +MPS++ +SI I++  G G+AMFS GLFMAL
Sbjct  26   VCRKLSRNPNTYSSILGLLWSLISFKWHVSMPSLVMNSIKIISDAGLGMAMFSLGLFMAL  85

Query  420  QDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFA  241
            Q +II+CG  +   G+V+RF+ GP   +  ++ + L G  L   IVQ+ALPQ +  F+FA
Sbjct  86   QPKIIACGARMACIGMVIRFISGPMIMSAASMAVGLRGVRLHTAIVQAALPQGIVPFVFA  145

Query  240  KEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            +EYGLH D+LST +I G ++SLPV + YY++L L
Sbjct  146  REYGLHPDILSTGVIFGMLVSLPVTLLYYILLGL  179



>gb|AIF28348.1| PIN-like protein, partial [Strelitzia reginae]
Length=168

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GL+W+++   WH TMP I++ SI I++  G G+AMFS GLFMALQ R
Sbjct  18   KLIRNPNTYSSLIGLVWSLVAFRWHITMPKIVEKSISILSDAGLGMAMFSLGLFMALQPR  77

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG T+  + + +RFL+GP+  A  +I + L G +L + IVQ+ALPQ +  F+FAKEY
Sbjct  78   IIACGNTVAAFAMAVRFLVGPSVMAAASIAVGLRGTLLHVAIVQAALPQGIVPFVFAKEY  137

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LSTA+I G +++LP+ + YY++L L
Sbjct  138  NVHPAILSTAVIFGMLIALPITLVYYILLGL  168



>ref|XP_006848444.1| hypothetical protein AMTR_s00013p00242590 [Amborella trichopoda]
 gb|ERN10025.1| hypothetical protein AMTR_s00013p00242590 [Amborella trichopoda]
Length=419

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 113/158 (72%), Gaps = 0/158 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            +MK V  +L  NPNTYA  LGL WA+++  W+   P I+++S+ I++  G G+AMFS GL
Sbjct  262  IMKMVWFKLLANPNTYASLLGLAWALVSCKWNVKKPLILENSVTILSNAGLGMAMFSLGL  321

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ RII+CG  L  YG+++RF +GPA  A+ +  + L G +L++ IVQ+ALPQ +  
Sbjct  322  FMALQPRIIACGTRLAAYGMLIRFFLGPAIMAVASTGVGLRGPILRVAIVQAALPQGIVP  381

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            F+FA+EY LH DVLSTA+I G I+SLP+ + YYV L L
Sbjct  382  FVFAREYNLHPDVLSTAVIFGMIVSLPITVLYYVFLGL  419


 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 105/162 (65%), Gaps = 3/162 (2%)
 Frame = -3

Query  1161  MILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPYTMNYLFvasdvvaka  982
             M+L Y S++WW +F PD C  INRF   F +P  +F FI+++DPY M+ LFVA+D ++K 
Sbjct  1     MLLAYASVKWWKIFGPDQCAGINRFVAIFAVPLLSFEFISRIDPYNMDLLFVAADSLSKI  60

Query  981   mvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMYGRLGYDlvlqaaamq  802
             +++  L  WA     G +DW IT FSL+TL NTLV+G+PL++AMYG     L++QA  +Q
Sbjct  61    LILSFLASWARLSSKGSIDWVITLFSLATLPNTLVMGIPLVKAMYGDDKESLMIQAVVLQ  120

Query  801   allwltmlLFGLEFRRTRLGQI---SAAADNARPEMGTDLEG  685
              ++W TMLLF  E+R  RL  +   +  +++ R +   ++E 
Sbjct  121   CIIWYTMLLFLFEYRAARLAVMKGFNTGSESGRRDKVEEIES  162



>ref|XP_007161379.1| hypothetical protein PHAVU_001G0639000g, partial [Phaseolus vulgaris]
 gb|ESW33373.1| hypothetical protein PHAVU_001G0639000g, partial [Phaseolus vulgaris]
Length=189

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L++NPNTY+  LGL+W++I+  W+  MPS+I  S+ I++  G G+AMFS GLFMALQ R
Sbjct  39   KLSRNPNTYSSVLGLLWSLISFKWNMEMPSLIKSSVKIVSDAGLGMAMFSLGLFMALQPR  98

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG    V G+V+RFL GP   +  +I + L  D+L   IVQ+ALPQ +  F+FA+EY
Sbjct  99   IIACGTKRAVMGMVIRFLCGPLVMSASSIAIGLRHDILHTAIVQAALPQGIVPFVFAREY  158

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            GLH D+LST +I G ++SLP+ + YY+ L L
Sbjct  159  GLHPDILSTGVIFGMLVSLPITLLYYIFLGL  189



>gb|AIF28272.1| PIN-like protein, partial [Canna sp. SFB-2014]
Length=466

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +G+IW+++   W F MP II  SI I++  G G+AMFS GLFMALQ R
Sbjct  316  KLIRNPNTYSSLIGVIWSLVCFRWQFNMPDIITHSISILSDAGLGMAMFSLGLFMALQPR  375

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A+ +I + L GD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  376  IIACGNSVAAFAMAVRFLTGPAVMAVASIAVGLRGDLLRIAIVQAALPQGIVPFVFAKEY  435

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             LH D+LSTA+I G +++LP+ + YY++L L
Sbjct  436  NLHPDILSTAVIFGMLIALPITLVYYILLGL  466



>gb|AIF28445.1| PIN-like protein, partial [Persea borbonia]
Length=433

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            +M+ V  +L +NPN+YA  LGL WA+++  W    P I+++S+ I++  G G+AMFS GL
Sbjct  276  IMRMVWYKLVRNPNSYASLLGLSWALVSCRWGVKKPQIMENSVTILSNAGLGMAMFSLGL  335

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ +II+CG  LT YG++ RF+ GPA  AI +I + L G VL++ IVQ+ALPQ +  
Sbjct  336  FMALQPKIIACGTRLTGYGMIARFIAGPAVMAIASIAVGLRGTVLRVAIVQAALPQGIVP  395

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            F+FA+EY LH DVLSTA+I G ++SLP+ I YY++L L
Sbjct  396  FVFAREYNLHPDVLSTAVIFGMLVSLPITILYYILLGL  433


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             + D+Y V+ A+ PLYV M L YGS++WW +F PD C  INRF   F +P  +F  I++++
Sbjct  2     FTDLYCVLSAVVPLYVTMFLAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFEVISRIN  61

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY M++LF+A+DVV+K +V++A V    F K G LDW IT FSLSTL NTLV+G+PL+++
Sbjct  62    PYRMDFLFIAADVVSKILVLLASVFMGKFSKKGSLDWVITIFSLSTLPNTLVMGIPLLKS  121

Query  852   MYG  844
             MYG
Sbjct  122   MYG  124



>gb|AIF28438.1| PIN-like protein, partial [Euptelea pleiosperma]
Length=406

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 114/158 (72%), Gaps = 0/158 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            ++K V  +L +NPN+YA  LGL WA+ +  W F  P I+++S+ I++  G G+AMFS GL
Sbjct  249  ILKMVWFKLIRNPNSYASLLGLSWALASCRWGFKKPQIMENSVTILSNAGLGMAMFSLGL  308

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ RII+CG  L  YG+++RF+ GP   A+ +I + L G +LK+ IVQ+ALPQ +  
Sbjct  309  FMALQPRIIACGNRLAAYGMLVRFVAGPTVMALASIGVGLRGTILKVSIVQAALPQGIVP  368

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            F+FA+EY LH DVLSTA+I G I+SLP+ I YY++L L
Sbjct  369  FVFAREYNLHPDVLSTAVIFGMIVSLPITILYYILLGL  406



>ref|XP_006367982.1| PREDICTED: putative auxin efflux carrier component 8-like [Solanum 
tuberosum]
Length=106

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  450  MFSTGLFMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSAL  271
            MFS GLFMALQ +II+CG  LT+Y ++LRF++GPAT A+G ++L L G+VL+I I+Q+AL
Sbjct  1    MFSMGLFMALQGKIIACGAALTIYAMILRFVVGPATMALGCVVLGLRGNVLRIAIIQAAL  60

Query  270  PQAVTTFIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
            PQAVT+F++A+EYGLHADVLSTA+I+GTI+SLP++I YY IL+++
Sbjct  61   PQAVTSFVYAQEYGLHADVLSTAVIVGTIISLPLLIAYYAILDIM  105



>ref|XP_007034342.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOY05268.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=454

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            +++ V  +L +NPN+Y+  LGL WA+++  W    P I+++S+ I++  G G+AMFS GL
Sbjct  297  ILRKVWFKLVRNPNSYSSLLGLSWALVSCRWDIKKPQIMENSVTILSSAGLGMAMFSLGL  356

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMALQ RII+CG  L +YG++ RF+ GPA  AI ++++ L G  LK+ IVQ+ALPQ +  
Sbjct  357  FMALQPRIIACGTKLALYGMLARFITGPALMAIASVVVGLRGTALKVSIVQAALPQGIVP  416

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVIL  145
            F+F++EY LH DVLSTA+I G I+SLP+ I YY++L
Sbjct  417  FVFSREYNLHPDVLSTAVIFGMIVSLPITILYYILL  452


 Score =   103 bits (257),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
             G  D+Y V+ A+ PLYV M L Y S++WW++F P+ C  INRF   F +P  +F F++++
Sbjct  3     GIKDLYSVLTAVVPLYVTMFLAYASVKWWNIFTPEQCAGINRFVAIFAVPLLSFEFVSRI  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY M+ LF+A+D V+K +++V L  WANF K G LDWSIT FSLSTL NTLV+G+PL++
Sbjct  63    NPYKMDLLFLAADGVSKILILVVLFCWANFSKTGSLDWSITLFSLSTLPNTLVMGIPLLK  122

Query  855   AMYGRLGYDlvlqaaamqallwltmlLFGLEFRRTRLGQISAAADNA  715
             +MYG     L++Q   +Q ++W T+LLF  E+R TR    S   +++
Sbjct  123   SMYGDDKEYLMIQVVVLQCIIWYTLLLFLFEYRETRTSVFSKFKESS  169



>emb|CDY40380.1| BnaA02g26940D [Brassica napus]
Length=562

 Score =   160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP I+  SI I++  G G+AMFS GLFMALQ +
Sbjct  412  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQPK  471

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A+ ++++ LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  472  IIACGNSVATFAMAVRFLTGPAIMAVASLIIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  531

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LSTA+I G +++LP+ + YY+ L L
Sbjct  532  NVHPTILSTAVIFGMLIALPITLVYYIFLGL  562


 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  +
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTNN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MN  F+A+D + K +++V L +WA+  K G L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYAMNLRFIAADTLQKVIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>ref|XP_009129244.1| PREDICTED: auxin efflux carrier component 4 [Brassica rapa]
Length=599

 Score =   160 bits (406),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP I+  SI I++  G G+AMFS GLFMALQ +
Sbjct  449  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQPK  508

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A+ ++++ LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  509  IIACGNSVATFAMAVRFLTGPAIMAVASLIIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  568

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LSTA+I G +++LP+ + YY+ L L
Sbjct  569  NVHPTILSTAVIFGMLIALPITLVYYIFLGL  599


 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  +
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTNN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MN  F+A+D + K +++V L +WA+  K G L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYAMNLRFIAADTLQKIIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>ref|XP_006290757.1| hypothetical protein CARUB_v10016856mg [Capsella rubella]
 gb|EOA23655.1| hypothetical protein CARUB_v10016856mg [Capsella rubella]
Length=612

 Score =   160 bits (406),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP I+  SI I++  G G+AMFS GLFMALQ +
Sbjct  462  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQPK  521

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RF+ GPA  A+  I++ LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  522  IIACGNSVATFAMAVRFITGPAIMAVAGIVIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  581

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LSTA+I G +++LP+ + YY++L L
Sbjct  582  NVHPTILSTAVIFGMLIALPITLVYYILLGL  612


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS++WW +F PD C  INRF   F +P  +FHFI+  D
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTND  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MN  F+A+D + K +++  L +WAN  KNG L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYAMNLRFIAADTLQKIIMLFLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>gb|AIF28293.1| PIN-like protein, partial [Persea borbonia]
Length=214

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GL W++++  WH  MP+I+  SI I++  G G+AMFS GLFMALQ R
Sbjct  64   KLIRNPNTYSSLIGLTWSLVSFRWHVEMPAIVAKSISILSDAGLGMAMFSLGLFMALQPR  123

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A  +I + L G +L I IVQ+ALPQ +  F+FAKEY
Sbjct  124  IIACGNSIAAFAMAVRFLTGPAVMAAASIAVGLRGVLLHIAIVQAALPQGIVPFVFAKEY  183

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H D+LSTA+I G +++LP+ + YY++L L
Sbjct  184  NVHPDILSTAVIFGMLIALPITLVYYILLGL  214



>gb|AIF28268.1| PIN-like protein, partial [Curcuma sumatrana]
Length=559

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +G+IWA+I   W FTMP+I+  SI I++  G G+AMFS GLFMALQ R
Sbjct  409  KLIRNPNTYSSLIGIIWALICFRWKFTMPNIVLKSISILSDAGLGMAMFSLGLFMALQPR  468

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG  +  Y + +RFL+GPA  A+ ++++ L G +L I IVQ+ALPQ +  F+FAKEY
Sbjct  469  IIACGNKVATYAMAVRFLVGPAVMAVASVVIGLRGVLLHIAIVQAALPQGIVPFVFAKEY  528

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             +H D+LSTA+I G +++LP+ + YY++L
Sbjct  529  NVHPDILSTAVIFGMLIALPITLVYYILL  557


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = -3

Query  1209  GDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDP  1030
              D Y V+ A+ PLYVAMIL YGS++WW +F PD C  INRF   F +P  +FHFI+  +P
Sbjct  5     SDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNNP  64

Query  1029  YTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSI  916
             Y MN  F+A+D + K MV+  L  W+   + G L+W+I
Sbjct  65    YEMNLHFIAADTLQKLMVLAVLAAWSRLSRRGSLEWTI  102



>gb|AIF28294.1| PIN-like protein, partial [Persea borbonia]
Length=232

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GL W++++  WH  MP+II  SI I++  G G+AMFS GLFMALQ R
Sbjct  82   KLIRNPNTYSSLIGLTWSLVSFKWHVQMPAIIAKSISILSDTGLGMAMFSLGLFMALQPR  141

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG +   + + +RFL GPA  A+ +I + L G +L + IVQ+ALPQ +  F+FAKEY
Sbjct  142  IIACGNSTAAFAMAVRFLTGPAVMAVASIAVGLRGVLLHVAIVQAALPQGIVPFVFAKEY  201

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H D+LSTA+I G +++LP+ + YY++L L
Sbjct  202  NIHPDILSTAVIFGMLIALPITLVYYILLGL  232



>gb|AIF28269.1| PIN-like protein, partial [Curcuma sumatrana]
Length=600

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +G+IWA+I   W FTMP+I+  SI I++  G G+AMFS GLFMALQ R
Sbjct  450  KLIRNPNTYSSLIGIIWALICFRWKFTMPNIVLKSISILSDAGLGMAMFSLGLFMALQPR  509

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG  +  Y + +RFL+GPA  A+ ++++ L G +L I IVQ+ALPQ +  F+FAKEY
Sbjct  510  IIACGNKVATYAMAVRFLVGPAVMAVASVVIGLRGVLLHIAIVQAALPQGIVPFVFAKEY  569

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             +H D+LSTA+I G +++LP+ + YY++L
Sbjct  570  NVHPDILSTAVIFGMLIALPITLVYYILL  598


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D Y V+ A+ PLYVAMIL YGS++WW +F P  C  INRF   F +P  +FHFI+  + Y
Sbjct  6     DFYNVMTAVVPLYVAMILAYGSVKWWGIFTPVQCSGINRFVALFAVPLLSFHFISSNNIY  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
              MN  F+A+D + K +V+ AL +W      G LDW+IT FS+STL NTLV+G+PL+  MY
Sbjct  66    KMNLRFIAADTLQKFLVLAALAVWGRLSSRGRLDWTITIFSVSTLPNTLVMGIPLLTGMY  125

Query  846   G  844
             G
Sbjct  126   G  126



>gb|KFK33369.1| hypothetical protein AALP_AA5G004800 [Arabis alpina]
Length=605

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP +I  SI I++  G G+AMFS GLFMALQ +
Sbjct  455  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKLIQQSISILSDAGLGMAMFSLGLFMALQPK  514

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A+ +  + LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  515  IIACGNSVATFAMAVRFLTGPAIMAVASFAIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  574

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LSTA+I G +++LP+ + YY++L L
Sbjct  575  NVHPTILSTAVIFGMLIALPITLVYYILLGL  605


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  +
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTNN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PYTMN  F+A+D + K +++  L +WAN  K+G L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYTMNLRFIAADTLQKIIMLFLLALWANLTKSGNLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>gb|KFK33370.1| hypothetical protein AALP_AA5G004800 [Arabis alpina]
Length=604

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP +I  SI I++  G G+AMFS GLFMALQ +
Sbjct  454  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKLIQQSISILSDAGLGMAMFSLGLFMALQPK  513

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A+ +  + LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  514  IIACGNSVATFAMAVRFLTGPAIMAVASFAIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  573

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LSTA+I G +++LP+ + YY++L L
Sbjct  574  NVHPTILSTAVIFGMLIALPITLVYYILLGL  604


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  +
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTNN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PYTMN  F+A+D + K +++  L +WAN  K+G L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYTMNLRFIAADTLQKIIMLFLLALWANLTKSGNLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>gb|AIF28428.1| PIN-like protein, partial [Thuja plicata]
Length=211

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GL W++IT  W   MP+I++ SI I++  G G+AMFS GLFMALQ R
Sbjct  61   KLIRNPNTYSSLIGLTWSLITFRWKVEMPAILEQSIRILSDAGLGMAMFSLGLFMALQPR  120

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A  +I + L G +L + IVQ+ALPQ +  F+FAKEY
Sbjct  121  IIACGNSIAAFAMAVRFLTGPAVMAAASIAVGLRGVLLHVAIVQAALPQGIVPFVFAKEY  180

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             +H D+LSTA+I G +++LP+ + YYV+L
Sbjct  181  NVHPDILSTAVIFGMLIALPITLVYYVLL  209



>ref|XP_002444705.1| hypothetical protein SORBIDRAFT_07g026370 [Sorghum bicolor]
 gb|EES14200.1| hypothetical protein SORBIDRAFT_07g026370 [Sorghum bicolor]
Length=402

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -3

Query  612  MMKSVCLRLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGL  433
            ++++V L+LA NPN YA  LG++WA I    +     I+  S+ +M+K G+G++M S GL
Sbjct  245  LVRTVGLKLAGNPNVYASVLGVVWACIAYR-YVRGTGIVTGSLDVMSKTGTGMSMLSMGL  303

Query  432  FMALQDRIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTT  253
            FMA Q+++I+CG  L   G+ LRF+ GP  + +GA   RL GDVL+  I+Q+ALPQ++ +
Sbjct  304  FMAQQEKMIACGSGLAALGMALRFVAGPLATLVGAAAFRLRGDVLRFAIIQAALPQSIAS  363

Query  252  FIFAKEYGLHADVLSTAIIIGTILSLPVMIGYYVILELL  136
            F+FAKEYGLHADVLSTA+I GT++SLPV+I YY +L +L
Sbjct  364  FVFAKEYGLHADVLSTAVIFGTLVSLPVLIAYYAVLGIL  402


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             WGDIYKVV AMAPLY A+ LGYGS+RWW  F  + C AIN     F +PFFTF F+A+ +
Sbjct  4     WGDIYKVVAAMAPLYFALGLGYGSVRWWRFFTAEQCAAINTLVVNFSMPFFTFDFLARAN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKN----GGLDWSIttfslstlnntLVVGVP  865
             PYTMNY  +A+D V+KA+ + A+  W    +     G   W+IT FSL+  NNTLVVGVP
Sbjct  64    PYTMNYRVLAADAVSKALAIAAVSAWGCCCRGGKAAGAQAWAITGFSLAGFNNTLVVGVP  123

Query  864   LMQAMYGRLGYDlvlqaaamqallwltmlLFGLEFRRT  751
             L+ AMYG+   DL++Q A +Q+L W  +LL G E R+ 
Sbjct  124   LLYAMYGKWAQDLIVQIAVVQSLFWFPLLLLGFELRKA  161



>gb|AIF28403.1| PIN-like protein, partial [Sciadopitys verticillata]
Length=176

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  LGL+W+++   W+  MP ++  SI I++  G G+AMFS GLFMALQ R
Sbjct  26   KLIRNPNTYSSILGLVWSLVAFRWNIQMPKLVYGSIAILSDAGLGMAMFSLGLFMALQPR  85

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A  +I + L G +L + IVQ+ALPQ +  F+FAKEY
Sbjct  86   IIACGKSVATFAMAVRFLTGPAVMAAASIAIGLRGTLLHVAIVQAALPQGIVPFVFAKEY  145

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H ++LSTA+I G +++LP+ + YYV+L L
Sbjct  146  NVHPEILSTAVIFGMLIALPITLIYYVLLGL  176



>ref|XP_010033744.1| PREDICTED: auxin efflux carrier component 1-like [Eucalyptus 
grandis]
 gb|KCW84065.1| hypothetical protein EUGRSUZ_B00948 [Eucalyptus grandis]
Length=587

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +G+ W++++  WH  MP+II  SI I++  G G+AMFS GLFMALQ +
Sbjct  437  KLIRNPNTYSSLIGITWSLVSFRWHIEMPAIIAKSISILSDAGLGMAMFSLGLFMALQPK  496

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RFL GPA  A  ++++ L GD+L++ IVQ+ALPQ +  F+FAKEY
Sbjct  497  IIACGNSVATFAMAVRFLTGPAVMAAASLVIGLRGDLLRVAIVQAALPQGIVPFVFAKEY  556

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVIL  145
            GLH D+LSTA+I G +++LP+ + YY++L
Sbjct  557  GLHPDILSTAVIFGMLIALPITLVYYILL  585


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -3

Query  1206  DIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVDPY  1027
             D Y V+ AM PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  +P+
Sbjct  6     DFYHVMTAMVPLYVAMILAYGSVRWWRIFTPDQCSGINRFVALFAVPLLSFHFISSNNPF  65

Query  1026  TMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQAMY  847
             TMN  F+A+D + K ++++AL +W++  + G LDWSIT FSLSTL NTLV+G+PL++ MY
Sbjct  66    TMNLRFLAADSLQKLLILLALALWSHLSRRGSLDWSITLFSLSTLPNTLVMGIPLLRGMY  125

Query  846   GRLGYDlvlqaaamqallwltmlLFGLEFRRTR  748
             G    DL++Q   +Q ++W T++LF  EFR  R
Sbjct  126   GPYSGDLMVQIVVLQCIIWYTLMLFLFEFRAAR  158



>emb|CDY63826.1| BnaC02g47640D [Brassica napus]
Length=563

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIIT-KGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQD  415
            +L +NPNTY+  +GLIWA++  + WH  MP I+  SI I++  G G+AMFS GLFMALQ 
Sbjct  412  KLIRNPNTYSSLIGLIWALVAYRRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQP  471

Query  414  RIISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKE  235
            +II+CG ++  + + +RFL GPA  A+ ++++ LHGD+L+I IVQ+ALPQ +  F+FAKE
Sbjct  472  KIIACGNSVATFAMAVRFLTGPAIMAVASLIIGLHGDLLRIAIVQAALPQGIVPFVFAKE  531

Query  234  YGLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            Y +H  +LSTA+I G +++LP+ + YY+ L L
Sbjct  532  YNVHPTILSTAVIFGMLIALPITLVYYIFLGL  563


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  +
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTNN  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MN  F+A+D + K +++V L +WA+  K G L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYAMNLRFIAADTLQKIIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>ref|XP_002876748.1| pin-formed 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53007.1| pin-formed 4 [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP I+  SI I++  G G+AMFS GLFMALQ +
Sbjct  460  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQPK  519

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++ ++ + +RF+ GPA  A+  I + LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  520  IIACGNSVAMFAMAVRFITGPAIMAVAGIAIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  579

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LST +I G +++LP+ + YY++L L
Sbjct  580  NVHPTILSTGVIFGMLIALPITLVYYILLGL  610


 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS++WW +F PD C  INRF   F +P  +FHFI+  D
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTND  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MN+ FVA+D + K +++V L +WAN  KNG L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYAMNFRFVAADTLQKIIMLVLLGLWANLTKNGSLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>ref|NP_849923.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
 sp|Q8RWZ6.1|PIN4_ARATH RecName: Full=Auxin efflux carrier component 4; Short=AtPIN4 
[Arabidopsis thaliana]
 gb|AAM14031.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AAP40497.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AEC05449.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
Length=616

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP I+  SI I++  G G+AMFS GLFMALQ +
Sbjct  466  KLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMALQPK  525

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++  + + +RF+ GPA  A+  I + LHGD+L+I IVQ+ALPQ +  F+FAKEY
Sbjct  526  IIACGNSVATFAMAVRFITGPAIMAVAGIAIGLHGDLLRIAIVQAALPQGIVPFVFAKEY  585

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LST +I G +++LP+ + YY++L L
Sbjct  586  NVHPTILSTGVIFGMLIALPITLVYYILLGL  616


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -3

Query  1212  WGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQVD  1033
             W D+Y V+ A+ PLYVAMIL YGS++WW +F PD C  INRF   F +P  +FHFI+  D
Sbjct  4     WHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTND  63

Query  1032  PYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQA  853
             PY MN+ FVA+D + K +++V L +WAN  KNG L+W IT FSLSTL NTLV+G+PL+ A
Sbjct  64    PYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPLLIA  123

Query  852   MYG  844
             MYG
Sbjct  124   MYG  126



>emb|CBI15569.3| unnamed protein product [Vitis vinifera]
Length=283

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIW++++  W   MP+II+ SI I++  G G+AMFS GLFMALQ R
Sbjct  133  KLIRNPNTYSSLIGLIWSLVSFKWKVQMPAIIEKSIAILSDAGLGMAMFSLGLFMALQPR  192

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG ++ V+ + +RFL GPA  A  +I + L G +L++ IVQ+ALPQ +  F+FAKEY
Sbjct  193  IIACGNSIAVFAMAVRFLTGPAVMAAASIAVGLRGVLLRVAIVQAALPQGIVPFVFAKEY  252

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVIL  145
             +H D+LST +I G +++LP+ + YY++L
Sbjct  253  NVHPDILSTGVIFGMLIALPITLVYYILL  281



>ref|XP_009105760.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux carrier component 
3 [Brassica rapa]
Length=635

 Score =   158 bits (399),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L +NPNTY+  +GLIWA++   WH  MP II  SI I++  G G+AMFS GLFMALQ +
Sbjct  485  KLIRNPNTYSSLIGLIWALVAFRWHVAMPKIIQQSISILSDAGLGMAMFSLGLFMALQPK  544

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            +I+CG ++  + + +RFL GPA  A+ +I + LHGD+L++ IVQ+ALPQ +  F+FAKEY
Sbjct  545  LIACGNSVATFAMAVRFLTGPAVMAVASIAIGLHGDLLRVAIVQAALPQGIVPFVFAKEY  604

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
             +H  +LST +I G +++LP+ + YY++L L
Sbjct  605  NVHPAILSTGVIFGMLIALPITLVYYILLGL  635


 Score =   108 bits (271),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  1215  GWGDIYKVVVAMAPLYVAMILGYGSIRWWHMFKPDHCDAINRFNCffilpfftfhFIAQV  1036
              W D+Y V+ A+ PLYVAMIL YGS+RWW +F PD C  INRF   F +P  +FHFI+  
Sbjct  3     SWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTX  62

Query  1035  DPYTMNYLFvasdvvakamvvvalVIWANFVKNGGLDWSIttfslstlnntLVVGVPLMQ  856
             +PY MN  F+A+D + K +++  LV+WANF ++G L+WSIT FSLSTL NTLV+G+PL+ 
Sbjct  63    NPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPLLI  122

Query  855   AMYGR  841
             AMYG 
Sbjct  123   AMYGE  127



>gb|KHN11028.1| Putative auxin efflux carrier component 6 [Glycine soja]
Length=197

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -3

Query  591  RLAKNPNTYACFLGLIWAIITKGWHFTMPsiiddsimiMAKGGSGIAMFSTGLFMALQDR  412
            +L++NPNTY+  LGL+W++I+  W+  MPS+I  S+ I++  G G+AMFS GLFMALQ R
Sbjct  47   KLSRNPNTYSSVLGLLWSLISFKWNMEMPSLIKASVKIISDAGLGMAMFSLGLFMALQPR  106

Query  411  IISCGWTLTVYGLVLRFLIGPATSAIGAILLRLHGDVLKIVIVQSALPQAVTTFIFAKEY  232
            II+CG    V G+V+RF+ GP   +  +I + L  + L   IVQ+ALPQ +  F+FA+EY
Sbjct  107  IIACGTKRAVMGMVIRFMCGPLVMSASSISIGLRQERLHTAIVQAALPQGIVPFVFAREY  166

Query  231  GLHADVLSTAIIIGTILSLPVMIGYYVILEL  139
            GLH D+LST +I G ++SLP+ + YY+ L L
Sbjct  167  GLHPDILSTGVIFGMLISLPITLLYYIFLGL  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273381520216