BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24394_g2_i2 len=1691 path=[839:0-50 890:51-162 8756:163-183
2034:184-290 @2141@!:291-521 @2372@!:522-850 9051:851-854
@2702@!:855-1153 3001:1154-1690]

Length=1691
                                                                      Score     E

ref|XP_008242337.1|  PREDICTED: uncharacterized protein LOC103340...    149   4e-47   
ref|XP_008242339.1|  PREDICTED: uncharacterized protein LOC103340...    149   4e-47   
ref|XP_008242338.1|  PREDICTED: uncharacterized protein LOC103340...    149   4e-47   
ref|XP_009604268.1|  PREDICTED: uncharacterized protein LOC104099...    176   1e-45   
ref|XP_009604252.1|  PREDICTED: uncharacterized protein LOC104099...    176   1e-45   
ref|XP_007202845.1|  hypothetical protein PRUPE_ppa014668mg             147   1e-45   
ref|XP_009604238.1|  PREDICTED: uncharacterized protein LOC104099...    176   1e-45   
ref|XP_009774392.1|  PREDICTED: uncharacterized protein LOC104224...    175   9e-45   
ref|XP_009774390.1|  PREDICTED: uncharacterized protein LOC104224...    175   9e-45   
ref|XP_007012849.1|  Uncharacterized protein isoform 1                  174   1e-43   
ref|XP_006346563.1|  PREDICTED: uncharacterized protein LOC102595100    168   8e-43   
ref|XP_007012851.1|  Uncharacterized protein isoform 3                  169   3e-42   
ref|XP_007012850.1|  Uncharacterized protein isoform 2                  169   4e-42   
ref|XP_004243763.2|  PREDICTED: uncharacterized protein LOC101245...    164   2e-40   
ref|XP_009604260.1|  PREDICTED: uncharacterized protein LOC104099...    159   2e-40   
ref|XP_010324069.1|  PREDICTED: uncharacterized protein LOC101245...    164   3e-40   
ref|XP_010324068.1|  PREDICTED: uncharacterized protein LOC101245...    164   3e-40   
gb|KDP33827.1|  hypothetical protein JCGZ_07398                         160   3e-39   
ref|XP_006451456.1|  hypothetical protein CICLE_v10010605mg             160   5e-39   
gb|KHG12429.1|  Dystrophin-1                                            158   3e-38   
emb|CBI27917.3|  unnamed protein product                                158   4e-38   
gb|ABK96358.1|  unknown                                                 146   2e-37   Populus trichocarpa x Populus deltoides
ref|XP_006475430.1|  PREDICTED: uncharacterized protein LOC102627...    154   4e-37   
ref|XP_010656201.1|  PREDICTED: uncharacterized protein LOC100250...    154   7e-37   
ref|XP_002514104.1|  conserved hypothetical protein                     153   1e-36   Ricinus communis
ref|XP_011077975.1|  PREDICTED: uncharacterized protein LOC105161...    153   1e-36   
ref|XP_011077974.1|  PREDICTED: uncharacterized protein LOC105161...    153   1e-36   
ref|XP_008337704.1|  PREDICTED: uncharacterized protein LOC103400809    151   2e-36   
ref|XP_011048528.1|  PREDICTED: uncharacterized protein LOC105142...    151   3e-36   
ref|XP_011048530.1|  PREDICTED: uncharacterized protein LOC105142...    150   3e-36   
ref|XP_002279676.2|  PREDICTED: uncharacterized protein LOC100250...    151   6e-36   Vitis vinifera
gb|EPS63424.1|  hypothetical protein M569_11360                         140   1e-35   
ref|XP_010656203.1|  PREDICTED: uncharacterized protein LOC100250...    149   3e-35   
ref|XP_006381679.1|  hypothetical protein POPTR_0006s15560g             149   3e-35   
ref|XP_004157921.1|  PREDICTED: uncharacterized protein LOC101223934    140   3e-35   
ref|XP_004141055.1|  PREDICTED: uncharacterized protein LOC101205190    140   3e-35   
ref|XP_009361719.1|  PREDICTED: uncharacterized protein LOC103951948    148   4e-35   
ref|XP_009352649.1|  PREDICTED: uncharacterized protein LOC103943...    146   2e-34   
ref|XP_009352648.1|  PREDICTED: uncharacterized protein LOC103943...    146   2e-34   
gb|KDO57758.1|  hypothetical protein CISIN_1g048506mg                   144   2e-34   
ref|XP_004243957.2|  PREDICTED: uncharacterized protein LOC101245...    142   8e-33   
gb|KGN60539.1|  hypothetical protein Csa_2G000470                       140   1e-32   
emb|CDP03167.1|  unnamed protein product                                137   2e-32   
ref|XP_008459327.1|  PREDICTED: uncharacterized protein LOC103498...    139   4e-32   
ref|XP_008459318.1|  PREDICTED: uncharacterized protein LOC103498...    139   5e-32   
gb|ACU23282.1|  unknown                                                 128   2e-31   Glycine max [soybeans]
ref|XP_010049551.1|  PREDICTED: uncharacterized protein LOC104438166    130   3e-31   
gb|EYU28413.1|  hypothetical protein MIMGU_mgv11b019606mg               132   7e-31   
ref|XP_010049736.1|  PREDICTED: uncharacterized protein LOC104438...    132   1e-30   
ref|XP_010049738.1|  PREDICTED: uncharacterized protein LOC104438...    132   1e-30   
ref|XP_010049737.1|  PREDICTED: uncharacterized protein LOC104438...    132   1e-30   
ref|XP_010049735.1|  PREDICTED: uncharacterized protein LOC104438...    132   1e-30   
ref|XP_010262149.1|  PREDICTED: uncharacterized protein LOC104600734    135   1e-30   
gb|KEH37469.1|  hypothetical protein MTR_2g038710                       134   5e-30   
ref|XP_010049733.1|  PREDICTED: uncharacterized protein LOC104438...    132   1e-29   
ref|XP_010049734.1|  PREDICTED: uncharacterized protein LOC104438...    132   2e-29   
ref|XP_010049732.1|  PREDICTED: uncharacterized protein LOC104438...    132   2e-29   
gb|KCW82501.1|  hypothetical protein EUGRSUZ_C03893                     132   2e-29   
gb|KCW82500.1|  hypothetical protein EUGRSUZ_C03893                     132   2e-29   
gb|KCW82231.1|  hypothetical protein EUGRSUZ_C03649                     130   5e-29   
ref|XP_003534912.1|  PREDICTED: transcriptional regulator ATRX ho...    127   1e-28   
ref|XP_006587006.1|  PREDICTED: transcriptional regulator ATRX ho...    127   2e-28   
ref|XP_006597814.1|  PREDICTED: uncharacterized protein LOC100780...    124   1e-27   
ref|XP_006597812.1|  PREDICTED: uncharacterized protein LOC100780...    124   1e-27   
ref|XP_006597813.1|  PREDICTED: uncharacterized protein LOC100780...    124   2e-27   
ref|XP_007138733.1|  hypothetical protein PHAVU_009G232800g             124   2e-27   
ref|XP_010090038.1|  hypothetical protein L484_027269                   125   4e-27   
ref|XP_004488038.1|  PREDICTED: uncharacterized protein LOC101498...    121   5e-27   
ref|XP_004488035.1|  PREDICTED: uncharacterized protein LOC101498...    121   5e-27   
ref|XP_010941459.1|  PREDICTED: uncharacterized protein LOC105059...    122   2e-26   
ref|XP_010941198.1|  PREDICTED: uncharacterized protein LOC105059...    123   4e-26   
ref|XP_008797707.1|  PREDICTED: uncharacterized protein LOC103712...    120   2e-25   
ref|XP_008797706.1|  PREDICTED: uncharacterized protein LOC103712...    120   2e-25   
ref|XP_010545340.1|  PREDICTED: uncharacterized protein LOC104817...    117   3e-25   
ref|XP_008797705.1|  PREDICTED: uncharacterized protein LOC103712...    120   3e-25   
ref|XP_010545339.1|  PREDICTED: uncharacterized protein LOC104817...    117   4e-25   
ref|XP_010545337.1|  PREDICTED: uncharacterized protein LOC104817...    117   4e-25   
ref|XP_010667283.1|  PREDICTED: uncharacterized protein LOC104884...    118   2e-24   
ref|XP_006597815.1|  PREDICTED: uncharacterized protein LOC100780...    114   4e-24   
ref|XP_010545338.1|  PREDICTED: uncharacterized protein LOC104817...    112   2e-23   
ref|XP_010941402.1|  PREDICTED: uncharacterized protein LOC105059...    112   9e-23   
ref|XP_008797708.1|  PREDICTED: uncharacterized protein LOC103712...    111   2e-22   
ref|XP_010483168.1|  PREDICTED: uncharacterized protein LOC104761...    108   1e-21   
ref|XP_010483170.1|  PREDICTED: uncharacterized protein LOC104761...    107   1e-21   
ref|XP_010483169.1|  PREDICTED: uncharacterized protein LOC104761...    107   1e-21   
ref|XP_010483166.1|  PREDICTED: uncharacterized protein LOC104761...    108   1e-21   
ref|NP_200496.2|  uncharacterized protein                               107   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132172.1|  PREDICTED: uncharacterized protein LOC103856...    106   3e-21   
ref|XP_009132169.1|  PREDICTED: uncharacterized protein LOC103856...    106   5e-21   
emb|CDY65438.1|  BnaCnng47150D                                          105   5e-21   
ref|XP_009132171.1|  PREDICTED: uncharacterized protein LOC103856...    105   7e-21   
emb|CDX88592.1|  BnaA03g10570D                                          105   1e-20   
ref|XP_006401278.1|  hypothetical protein EUTSA_v10013398mg             104   2e-20   
ref|XP_002866168.1|  predicted protein                                  104   2e-20   
ref|XP_006401277.1|  hypothetical protein EUTSA_v10013398mg             103   3e-20   
ref|XP_010451535.1|  PREDICTED: uncharacterized protein LOC104733...    102   7e-20   
ref|XP_010451532.1|  PREDICTED: uncharacterized protein LOC104733...    102   7e-20   
ref|XP_006280323.1|  hypothetical protein CARUB_v10026246mg           98.2    2e-18   
ref|XP_009395790.1|  PREDICTED: uncharacterized protein LOC103980...  98.6    3e-18   
ref|XP_010443341.1|  PREDICTED: uncharacterized protein LOC104726...  97.4    4e-18   
ref|XP_009604277.1|  PREDICTED: uncharacterized protein LOC104099...  89.0    3e-15   
ref|XP_006854956.1|  hypothetical protein AMTR_s00052p00157970        89.0    4e-15   
gb|EMS59832.1|  hypothetical protein TRIUR3_17783                     81.6    5e-13   
ref|XP_008797709.1|  PREDICTED: uncharacterized protein LOC103712...  82.0    5e-13   
ref|XP_006654168.1|  PREDICTED: vitellogenin-1-like                   80.9    7e-13   
gb|EMT31459.1|  hypothetical protein F775_06131                       80.9    2e-12   
ref|XP_009774393.1|  PREDICTED: uncharacterized protein LOC104224...  78.6    6e-12   
gb|ACT34065.3|  predicted protein                                     77.0    1e-11   Aegilops tauschii
ref|XP_010230952.1|  PREDICTED: uncharacterized protein LOC100841...  77.4    1e-11   
ref|XP_010656204.1|  PREDICTED: uncharacterized protein LOC100250...  77.0    2e-11   
gb|AFW81319.1|  hypothetical protein ZEAMMB73_351941                  75.1    2e-11   
ref|XP_003567786.1|  PREDICTED: uncharacterized protein LOC100841...  76.3    2e-11   
ref|XP_008387889.1|  PREDICTED: uncharacterized protein LOC103450...  74.7    6e-11   
gb|ACT34066.1|  predicted protein                                     74.3    6e-11   Aegilops tauschii
ref|XP_008654691.1|  PREDICTED: uncharacterized protein LOC100275...  74.7    7e-11   
ref|NP_001143274.1|  uncharacterized protein LOC100275805             73.2    2e-10   Zea mays [maize]
emb|CDP03168.1|  unnamed protein product                              70.5    3e-10   
ref|XP_004961007.1|  PREDICTED: uncharacterized protein LOC101759...  72.8    3e-10   
ref|XP_008459332.1|  PREDICTED: uncharacterized protein LOC103498...  72.0    6e-10   
gb|EEC78803.1|  hypothetical protein OsI_19064                        72.0    6e-10   Oryza sativa Indica Group [Indian rice]
gb|ACU01767.2|  predicted protein                                     71.6    6e-10   Brachypodium distachyon [annual false brome]
gb|EEE62901.1|  hypothetical protein OsJ_17706                        72.0    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961006.1|  PREDICTED: uncharacterized protein LOC101759...  69.3    3e-09   
ref|XP_001776937.1|  predicted protein                                68.6    9e-09   
ref|XP_004288940.1|  PREDICTED: uncharacterized protein LOC101298548  66.2    5e-08   
gb|EMS59833.1|  hypothetical protein TRIUR3_17784                     65.5    9e-08   
ref|XP_002441625.1|  hypothetical protein SORBIDRAFT_09g030625        62.8    3e-07   Sorghum bicolor [broomcorn]
ref|XP_009395791.1|  PREDICTED: uncharacterized protein LOC103980...  61.2    2e-06   
ref|XP_004488034.1|  PREDICTED: uncharacterized protein LOC101498...  60.1    2e-06   
ref|XP_010049552.1|  PREDICTED: uncharacterized protein LOC104438...  56.6    4e-06   
ref|XP_004488037.1|  PREDICTED: uncharacterized protein LOC101498...  57.0    2e-05   
ref|XP_004488036.1|  PREDICTED: uncharacterized protein LOC101498...  56.6    2e-05   
ref|XP_010545341.1|  PREDICTED: uncharacterized protein LOC104817...  56.6    3e-05   
ref|XP_004488033.1|  PREDICTED: uncharacterized protein LOC101498...  56.2    4e-05   
ref|XP_010451540.1|  PREDICTED: uncharacterized protein LOC104733...  53.9    2e-04   
gb|AAS98490.1|  unknown protein                                       53.1    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054981.1|  Os05g0232200                                     53.1    4e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG92602.1|  unnamed protein product                              52.8    5e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_008242337.1| PREDICTED: uncharacterized protein LOC103340678 isoform X1 [Prunus 
mume]
Length=557

 Score =   149 bits (376),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L SSS  SS+S+KVSMGK   QTWDKGDFTFPLTT RD+LVV+LQD
Sbjct  1     MPGTILVSVLEFMDLPSSSSSSSISIKVSMGKRECQTWDKGDFTFPLTTLRDNLVVLLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEI   GV+T  IVEKG WD  F L+G G VHMKL+F+L+E+ER RIR++RESA++K
Sbjct  61    AEGNEILDAGVETKSIVEKGLWDSFFPLKGGGLVHMKLKFVLNEEERIRIRSMRESALKK  120

Query  1222  K  1220
             K
Sbjct  121   K  121


 Score = 68.6 bits (166),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/347 (27%), Positives = 150/347 (43%), Gaps = 70/347 (20%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEE-PRYKHDRSSPAEKLETQSTPST-------ALVGPISEQNAQ  991
             +DR E TSS    H+  + P  +  +    E+ E Q  P+        A   P   +++Q
Sbjct  154   SDRNEETSSGITLHQRVDLPLTESCQGKLVEETEAQPLPANVPAKAKYASESPKLLRSSQ  213

Query  990   SKLGVLEI-NEKKDDNKSSNPEGQVSGKTSSSVRKMISAFETSLSQQERRPLVKTQASKS  814
             S +  + + N ++D   +   +G +  KT S+V+KMISAFE+  S ++ RP +K  + + 
Sbjct  214   SMVSAISLPNLQEDKPHNLEKQGPIH-KTPSNVKKMISAFESG-SAEDMRPCIKPPSKEV  271

Query  813   QPNIVGMGGSLK----------DPLVSKTWQE-------------TQTSTEKSGE-----  718
             Q N +  G  LK          D   +K+  E               TS +KSGE     
Sbjct  272   QSNSIKAGAPLKIHNLKEDKKVDTETAKSILEGVVKSFASGDLLLDPTSGDKSGEQINLL  331

Query  717   -------SSRSAL-----------NPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRES  592
                    SS   +             VGIK    +++   T+       S K     R  
Sbjct  332   GASDGTKSSHPTVIKNKVKLLHVHQEVGIKKKNFHKDFITTSRCETVQVSEKILSKHRHQ  391

Query  591   GTVSGRTNKDHSGIQTDSVAEKKGRELGS-DISRAIDFQRAASNEKL---------KSLA  442
              + +G   ++  GI    V E+   E+ S +IS+ ID Q A+++  +         + + 
Sbjct  392   PSNTGHGRRNSGGI---PVIEESLLEISSRNISQIIDIQEASTSANVCTSVVNCEDRQIP  448

Query  441   SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
              ESSGAWIFPD     CITT+GK++++ L     + N+ Q +  +SL
Sbjct  449   FESSGAWIFPDEAIRFCITTSGKKLMDLLGGCREKPNIQQGRMNVSL  495



>ref|XP_008242339.1| PREDICTED: uncharacterized protein LOC103340678 isoform X3 [Prunus 
mume]
Length=552

 Score =   149 bits (376),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L SSS  SS+S+KVSMGK   QTWDKGDFTFPLTT RD+LVV+LQD
Sbjct  1     MPGTILVSVLEFMDLPSSSSSSSISIKVSMGKRECQTWDKGDFTFPLTTLRDNLVVLLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEI   GV+T  IVEKG WD  F L+G G VHMKL+F+L+E+ER RIR++RESA++K
Sbjct  61    AEGNEILDAGVETKSIVEKGLWDSFFPLKGGGLVHMKLKFVLNEEERIRIRSMRESALKK  120

Query  1222  K  1220
             K
Sbjct  121   K  121


 Score = 68.6 bits (166),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/347 (27%), Positives = 150/347 (43%), Gaps = 70/347 (20%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEE-PRYKHDRSSPAEKLETQSTPST-------ALVGPISEQNAQ  991
             +DR E TSS    H+  + P  +  +    E+ E Q  P+        A   P   +++Q
Sbjct  154   SDRNEETSSGITLHQRVDLPLTESCQGKLVEETEAQPLPANVPAKAKYASESPKLLRSSQ  213

Query  990   SKLGVLEI-NEKKDDNKSSNPEGQVSGKTSSSVRKMISAFETSLSQQERRPLVKTQASKS  814
             S +  + + N ++D   +   +G +  KT S+V+KMISAFE+  S ++ RP +K  + + 
Sbjct  214   SMVSAISLPNLQEDKPHNLEKQGPIH-KTPSNVKKMISAFESG-SAEDMRPCIKPPSKEV  271

Query  813   QPNIVGMGGSLK----------DPLVSKTWQE-------------TQTSTEKSGE-----  718
             Q N +  G  LK          D   +K+  E               TS +KSGE     
Sbjct  272   QSNSIKAGAPLKIHNLKEDKKVDTETAKSILEGVVKSFASGDLLLDPTSGDKSGEQINLL  331

Query  717   -------SSRSAL-----------NPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRES  592
                    SS   +             VGIK    +++   T+       S K     R  
Sbjct  332   GASDGTKSSHPTVIKNKVKLLHVHQEVGIKKKNFHKDFITTSRCETVQVSEKILSKHRHQ  391

Query  591   GTVSGRTNKDHSGIQTDSVAEKKGRELGS-DISRAIDFQRAASNEKL---------KSLA  442
              + +G   ++  GI    V E+   E+ S +IS+ ID Q A+++  +         + + 
Sbjct  392   PSNTGHGRRNSGGI---PVIEESLLEISSRNISQIIDIQEASTSANVCTSVVNCEDRQIP  448

Query  441   SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
              ESSGAWIFPD     CITT+GK++++ L     + N+ Q +  +SL
Sbjct  449   FESSGAWIFPDEAIRFCITTSGKKLMDLLGGCREKPNIQQGRMNVSL  495



>ref|XP_008242338.1| PREDICTED: uncharacterized protein LOC103340678 isoform X2 [Prunus 
mume]
Length=556

 Score =   149 bits (376),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L SSS  SS+S+KVSMGK   QTWDKGDFTFPLTT RD+LVV+LQD
Sbjct  1     MPGTILVSVLEFMDLPSSSSSSSISIKVSMGKRECQTWDKGDFTFPLTTLRDNLVVLLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEI   GV+T  IVEKG WD  F L+G G VHMKL+F+L+E+ER RIR++RESA++K
Sbjct  61    AEGNEILDAGVETKSIVEKGLWDSFFPLKGGGLVHMKLKFVLNEEERIRIRSMRESALKK  120

Query  1222  K  1220
             K
Sbjct  121   K  121


 Score = 68.6 bits (166),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/347 (27%), Positives = 150/347 (43%), Gaps = 70/347 (20%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEE-PRYKHDRSSPAEKLETQSTPST-------ALVGPISEQNAQ  991
             +DR E TSS    H+  + P  +  +    E+ E Q  P+        A   P   +++Q
Sbjct  154   SDRNEETSSGITLHQRVDLPLTESCQGKLVEETEAQPLPANVPAKAKYASESPKLLRSSQ  213

Query  990   SKLGVLEI-NEKKDDNKSSNPEGQVSGKTSSSVRKMISAFETSLSQQERRPLVKTQASKS  814
             S +  + + N ++D   +   +G +  KT S+V+KMISAFE+  S ++ RP +K  + + 
Sbjct  214   SMVSAISLPNLQEDKPHNLEKQGPIH-KTPSNVKKMISAFESG-SAEDMRPCIKPPSKEV  271

Query  813   QPNIVGMGGSLK----------DPLVSKTWQE-------------TQTSTEKSGE-----  718
             Q N +  G  LK          D   +K+  E               TS +KSGE     
Sbjct  272   QSNSIKAGAPLKIHNLKEDKKVDTETAKSILEGVVKSFASGDLLLDPTSGDKSGEQINLL  331

Query  717   -------SSRSAL-----------NPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRES  592
                    SS   +             VGIK    +++   T+       S K     R  
Sbjct  332   GASDGTKSSHPTVIKNKVKLLHVHQEVGIKKKNFHKDFITTSRCETVQVSEKILSKHRHQ  391

Query  591   GTVSGRTNKDHSGIQTDSVAEKKGRELGS-DISRAIDFQRAASNEKL---------KSLA  442
              + +G   ++  GI    V E+   E+ S +IS+ ID Q A+++  +         + + 
Sbjct  392   PSNTGHGRRNSGGI---PVIEESLLEISSRNISQIIDIQEASTSANVCTSVVNCEDRQIP  448

Query  441   SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
              ESSGAWIFPD     CITT+GK++++ L     + N+ Q +  +SL
Sbjct  449   FESSGAWIFPDEAIRFCITTSGKKLMDLLGGCREKPNIQQGRMNVSL  495



>ref|XP_009604268.1| PREDICTED: uncharacterized protein LOC104099061 isoform X4 [Nicotiana 
tomentosiformis]
Length=708

 Score =   176 bits (447),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+FK +SS +PPSS+ L VSMGK  YQTWDKGDF+FPLTTFR++LVV LQD
Sbjct  1     MPGTIQVSVLDFKNISSPAPPSSICLWVSMGKRAYQTWDKGDFSFPLTTFRENLVVRLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS T V+T  IVEKG WDD F LEG  YVHMKLQFILSED+RNRIRNVRESA++K
Sbjct  61    AEGNEISRTEVQTLSIVEKGYWDDFFQLEGGDYVHMKLQFILSEDDRNRIRNVRESALKK  120

Query  1222  KQ  1217
             KQ
Sbjct  121   KQ  122


 Score = 36.6 bits (83),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPSTALVGPISEQNAQS--KLGVL  973
             +DR+E TSSSP++   +    + DR S A+K++T        V P++EQ+AQS  K+ V 
Sbjct  154   SDRSEATSSSPVKEGVQIQYSEPDRPS-AKKVQTPLIRDYISVKPVNEQDAQSMFKMDVA  212

Query  972   EINEKKDDNKSSNPEGQVSGKTSSSVRKMISAF-ETSLSQ  856
                E       ++P  +   +++ S+ KM+ A  E ++SQ
Sbjct  213   AKKEYVSQKTIADPYNKPEDQSAKSMLKMVVAVKEETVSQ  252


 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 99/343 (29%), Positives = 147/343 (43%), Gaps = 70/343 (20%)
 Frame = -3

Query  1044  QSTPSTALVGPISEQNAQSKLGVLEIN---------EKKDDNKSSNPEGQ-VSGKTSSSV  895
             +S  +  +V P S+   Q    VL +N         E K  +  + PE Q V  KT SSV
Sbjct  344   ESVSNKKIVDPSSKPEDQGAQYVLRVNVAAKKESVSETKIVDPPNKPEDQRVLEKTPSSV  403

Query  894   RKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD-------------------  775
             R MISAFET L+Q++ RR L + +ASKSQPN+VG+GGSLKD                   
Sbjct  404   RNMISAFETGLAQKKGRRSLTRNRASKSQPNLVGIGGSLKDLDPEDTAMPNKMSALRVER  463

Query  774   PLVSKTWQETQTSTEKSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRE  595
             PL +    E Q + +K GESS          P +            K   S  + +   E
Sbjct  464   PLNNANLPEPQRNIDKRGESS---------PPEHKIDGPGQPVFYEKLKQSSVHIVPFNE  514

Query  594   SGTVSGRTNKDHSGIQTDSVAEKKGRELGSDISRAIDFQRAASNEKLKSLASESSGAWIF  415
             +G+    T                 +E  S+ +  +D  R  S+ + + +    +G  +F
Sbjct  515   AGSSQRET-------------LTSAKESNSEATSPVDLVRRESSSREQDIV--GTGQPVF  559

Query  414   PDNMRHLCITT-------AGKEVLNFLEDSSTEVNVHQSKTRISLQ---GKQDSLQGTDP  265
              + ++   +         +G+  ++ LED   EV+ HQ   +   Q   GK+     +D 
Sbjct  560   HEQLKQSSVHIVPFNEAGSGESTMHLLEDYHAEVDDHQRNKKPPKQEITGKRGFFHKSDS  619

Query  264   TM-KGSEKLHKPY----EGSEKHGSSGPFGQVY-FVFIFSFGV  154
             T+ KG EK  KP     E S ++G SGP  QV     I  FG+
Sbjct  620   TIKKGGEKPQKPRKSQTESSGQNGPSGPVRQVIKIAVIVGFGI  662



>ref|XP_009604252.1| PREDICTED: uncharacterized protein LOC104099061 isoform X2 [Nicotiana 
tomentosiformis]
Length=829

 Score =   176 bits (447),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+FK +SS +PPSS+ L VSMGK  YQTWDKGDF+FPLTTFR++LVV LQD
Sbjct  1     MPGTIQVSVLDFKNISSPAPPSSICLWVSMGKRAYQTWDKGDFSFPLTTFRENLVVRLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS T V+T  IVEKG WDD F LEG  YVHMKLQFILSED+RNRIRNVRESA++K
Sbjct  61    AEGNEISRTEVQTLSIVEKGYWDDFFQLEGGDYVHMKLQFILSEDDRNRIRNVRESALKK  120

Query  1222  KQ  1217
             KQ
Sbjct  121   KQ  122


 Score = 36.2 bits (82),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPSTALVGPISEQNAQS--KLGVL  973
             +DR+E TSSSP++   +    + DR S A+K++T        V P++EQ+AQS  K+ V 
Sbjct  154   SDRSEATSSSPVKEGVQIQYSEPDRPS-AKKVQTPLIRDYISVKPVNEQDAQSMFKMDVA  212

Query  972   EINEKKDDNKSSNPEGQVSGKTSSSVRKMISAF-ETSLSQ  856
                E       ++P  +   +++ S+ KM+ A  E ++SQ
Sbjct  213   AKKEYVSQKTIADPYNKPEDQSAKSMLKMVVAVKEETVSQ  252


 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 91/182 (50%), Gaps = 31/182 (17%)
 Frame = -3

Query  609  LSIRESGTVSGRTNKDHS------GIQTD-------SVAEKKGRELGSDISRAIDFQRAA  469
            LS  E+ T S R N  HS       + TD       SVAE++ RE+ S+    +  +R  
Sbjct  603  LSNLETATSSQRINVAHSDMLNANNLATDQDRSSDPSVAEQRSREIRSEALLEVHIERVP  662

Query  468  SNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKT  313
             NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED   EV+ HQ   
Sbjct  663  -NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESTMHLLEDYHAEVDDHQRNK  721

Query  312  RISLQ---GKQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQVY-FVFIFSF  160
            +   Q   GK+     +D T+ KG EK  KP     E S ++G SGP  QV     I  F
Sbjct  722  KPPKQEITGKRGFFHKSDSTIKKGGEKPQKPRKSQTESSGQNGPSGPVRQVIKIAVIVGF  781

Query  159  GV  154
            G+
Sbjct  782  GI  783


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 72/140 (51%), Gaps = 29/140 (21%)
 Frame = -3

Query  1044  QSTPSTALVGPISEQNAQSKLGVLEIN---------EKKDDNKSSNPEGQ-VSGKTSSSV  895
             +S  +  +V P S+   Q    VL +N         E K  +  + PE Q V  KT SSV
Sbjct  344   ESVSNKKIVDPSSKPEDQGAQYVLRVNVAAKKESVSETKIVDPPNKPEDQRVLEKTPSSV  403

Query  894   RKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKD-------------------P  772
             R MISAFET L+Q+ RR L + +ASKSQPN+VG+GGSLKD                   P
Sbjct  404   RNMISAFETGLAQKGRRSLTRNRASKSQPNLVGIGGSLKDLDPEDTAMPNKMSALRVERP  463

Query  771   LVSKTWQETQTSTEKSGESS  712
             L +    E Q + +K GESS
Sbjct  464   LNNANLPEPQRNIDKRGESS  483



>ref|XP_007202845.1| hypothetical protein PRUPE_ppa014668mg [Prunus persica]
 gb|EMJ04044.1| hypothetical protein PRUPE_ppa014668mg [Prunus persica]
Length=507

 Score =   147 bits (372),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L SSS  SS+S+KVSMGK   QTWDKGDFTFPLTT RD+LVV+LQD
Sbjct  1     MPGTILVSVLEFMDLPSSSSSSSISIKVSMGKRECQTWDKGDFTFPLTTLRDNLVVLLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEI   GV+T  IVEKG WD  F L+G G VHMKLQF+L+E+ER RIR +RESA+++
Sbjct  61    AEGNEILDAGVETKSIVEKGLWDAFFSLKGGGLVHMKLQFVLNEEERIRIRLMRESALKR  120

Query  1222  K  1220
             K
Sbjct  121   K  121


 Score = 65.1 bits (157),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/350 (27%), Positives = 151/350 (43%), Gaps = 76/350 (22%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEE-PRYKHDRSSPAEKLETQSTPSTALVGPISEQNA--------  994
             +DR E TSS    H+  + P  +  +    E+ E Q  P+     P   + A        
Sbjct  154   SDRNEETSSGITLHQRVDLPLTESCQGKLVEETEAQPLPANV---PAKAKYASESSKLLR  210

Query  993   --QSKLGVLEI-NEKKDDNKSSNPEGQVSGKTSSSVRKMISAFETSLSQQERRPLVKTQA  823
               QS + V+ + N ++D   +   +G +  KT S+V+KMIS FE+  S ++ RP +K   
Sbjct  211   SPQSMVRVISLPNLQEDKPHNLEKQGPIQ-KTPSNVKKMISTFESG-SAEDMRPCIKPPP  268

Query  822   SKSQPNIVGMGGSLK----------DPLVSKTWQE-------------TQTSTEKSGES-  715
              + Q N +  G  LK          D   +K+  E               TS +KSGE  
Sbjct  269   KEVQSNSIKAGAPLKFHNLKEDKKVDTETAKSILEGVLKSFSSGDLLLDPTSGDKSGEQI  328

Query  714   --------SRSALNPVGIKPSY--------------SYRESTATTISSKGNSSMKNSLSI  601
                     ++S+ +P GIK                 ++ E   TT + +     +  LS 
Sbjct  329   NLLGASDGTKSS-HPTGIKNKVKQLHVHQEVGIKKNNFHEDFITTSTFETVQVSEKILSK  387

Query  600   RESGTVSGRTNKDHSGIQTDSVAEKKGRELGS-DISRAIDFQRAAS---------NEKLK  451
                   + R  + +SG  ++ V E+   E+ S +IS+ ID Q A++         N + +
Sbjct  388   HRHQPSNTRHGRRNSG--SNPVIEESRLEISSTNISQIIDIQEASTSADVCTSVVNCEDR  445

Query  450   SLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
              +  ESSGAWIFPD     CITT+GK+ ++ L     + N+ Q +  +SL
Sbjct  446   HIPYESSGAWIFPDEAIRFCITTSGKKFMDLLGGCREKPNIQQGRMNVSL  495



>ref|XP_009604238.1| PREDICTED: uncharacterized protein LOC104099061 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604244.1| PREDICTED: uncharacterized protein LOC104099061 isoform X1 [Nicotiana 
tomentosiformis]
Length=830

 Score =   176 bits (447),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+FK +SS +PPSS+ L VSMGK  YQTWDKGDF+FPLTTFR++LVV LQD
Sbjct  1     MPGTIQVSVLDFKNISSPAPPSSICLWVSMGKRAYQTWDKGDFSFPLTTFRENLVVRLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS T V+T  IVEKG WDD F LEG  YVHMKLQFILSED+RNRIRNVRESA++K
Sbjct  61    AEGNEISRTEVQTLSIVEKGYWDDFFQLEGGDYVHMKLQFILSEDDRNRIRNVRESALKK  120

Query  1222  KQ  1217
             KQ
Sbjct  121   KQ  122


 Score = 36.2 bits (82),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPSTALVGPISEQNAQS--KLGVL  973
             +DR+E TSSSP++   +    + DR S A+K++T        V P++EQ+AQS  K+ V 
Sbjct  154   SDRSEATSSSPVKEGVQIQYSEPDRPS-AKKVQTPLIRDYISVKPVNEQDAQSMFKMDVA  212

Query  972   EINEKKDDNKSSNPEGQVSGKTSSSVRKMISAF-ETSLSQ  856
                E       ++P  +   +++ S+ KM+ A  E ++SQ
Sbjct  213   AKKEYVSQKTIADPYNKPEDQSAKSMLKMVVAVKEETVSQ  252


 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 91/182 (50%), Gaps = 31/182 (17%)
 Frame = -3

Query  609  LSIRESGTVSGRTNKDHS------GIQTD-------SVAEKKGRELGSDISRAIDFQRAA  469
            LS  E+ T S R N  HS       + TD       SVAE++ RE+ S+    +  +R  
Sbjct  604  LSNLETATSSQRINVAHSDMLNANNLATDQDRSSDPSVAEQRSREIRSEALLEVHIERVP  663

Query  468  SNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKT  313
             NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED   EV+ HQ   
Sbjct  664  -NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESTMHLLEDYHAEVDDHQRNK  722

Query  312  RISLQ---GKQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQVY-FVFIFSF  160
            +   Q   GK+     +D T+ KG EK  KP     E S ++G SGP  QV     I  F
Sbjct  723  KPPKQEITGKRGFFHKSDSTIKKGGEKPQKPRKSQTESSGQNGPSGPVRQVIKIAVIVGF  782

Query  159  GV  154
            G+
Sbjct  783  GI  784


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 30/141 (21%)
 Frame = -3

Query  1044  QSTPSTALVGPISEQNAQSKLGVLEIN---------EKKDDNKSSNPEGQ-VSGKTSSSV  895
             +S  +  +V P S+   Q    VL +N         E K  +  + PE Q V  KT SSV
Sbjct  344   ESVSNKKIVDPSSKPEDQGAQYVLRVNVAAKKESVSETKIVDPPNKPEDQRVLEKTPSSV  403

Query  894   RKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD-------------------  775
             R MISAFET L+Q++ RR L + +ASKSQPN+VG+GGSLKD                   
Sbjct  404   RNMISAFETGLAQKKGRRSLTRNRASKSQPNLVGIGGSLKDLDPEDTAMPNKMSALRVER  463

Query  774   PLVSKTWQETQTSTEKSGESS  712
             PL +    E Q + +K GESS
Sbjct  464   PLNNANLPEPQRNIDKRGESS  484



>ref|XP_009774392.1| PREDICTED: uncharacterized protein LOC104224437 isoform X2 [Nicotiana 
sylvestris]
Length=798

 Score =   175 bits (443),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+FK +SSS+  SS+ L VSMGK  YQTWDKGDF+FPLTTFR++LVV LQD
Sbjct  1     MPGTIQVSVLDFKNISSSAQSSSICLWVSMGKRAYQTWDKGDFSFPLTTFRENLVVRLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS   V+T  IVEKG WDD F LEG  YVHMKLQFILSEDERNRIRNVRESA++K
Sbjct  61    AEGNEISRAEVQTLSIVEKGYWDDFFQLEGGDYVHMKLQFILSEDERNRIRNVRESALKK  120

Query  1222  KQ  1217
             KQ
Sbjct  121   KQ  122


 Score = 35.0 bits (79),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPSTALVGPISEQNAQSKL  982
             +DR+E TSSSP++   +    + DR S A+KL+T        V P++EQ+AQS L
Sbjct  154   SDRSEATSSSPVKEMVQIQYSEPDRPS-AKKLQTPLIRDYISVKPVNEQDAQSML  207


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 119/252 (47%), Gaps = 29/252 (12%)
 Frame = -3

Query  840  LVKTQASKSQPNIVGMGGS-----LKDPLVSKT-WQETQTSTEKSGESSRSALNPVGIKP  679
            L++ ++S  + +IVG   S     LK+  V    + E  +S + +  S++   N V   P
Sbjct  507  LMRGESSSLEQDIVGTAQSVFHEQLKESSVHIVPFNEAGSSQQDTLRSAKKEPNAVATSP  566

Query  678  SYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDI  499
                R S   T +S    ++ +S  ++ +   +G+   +       SVAE++  E+ S+ 
Sbjct  567  MDLMRLSNLETATSSQRINVAHSDMLKANNLAAGQDCSNDP-----SVAEQRNTEIRSEA  621

Query  498  SRAIDFQRAASNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSS  343
               +  +R   NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED  
Sbjct  622  LLEVHIERVP-NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESAVHLLEDCH  680

Query  342  TEVNVHQSKTRISLQG---KQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQ  187
              V+ HQ   +   Q    K+     +D T+ KG EK  KP     E S ++G SGP  Q
Sbjct  681  IGVDDHQRNKKPPKQEITRKRGFFHRSDSTIKKGEEKPQKPRKSQSESSGQNGPSGPIRQ  740

Query  186  VY-FVFIFSFGV  154
            V     I  FG+
Sbjct  741  VIKIAVIVGFGI  752


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 12/101 (12%)
 Frame = -3

Query  1044  QSTPSTALVGPIS---EQNAQSKLGVLEINEKKDD-------NKSSNPEGQ-VSGKTSSS  898
             +S   T +V P +   +Q+AQS L  +++ EKK+        + S+ PE Q V  KT SS
Sbjct  312   ESISQTKIVDPSNKPQDQSAQSMLK-MDVAEKKESVSPKKIVDASNKPEDQGVLEKTPSS  370

Query  897   VRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKD  775
             VR MISAFE  L+Q+ RR L + +ASKSQPN+VG+GGS+KD
Sbjct  371   VRNMISAFEIGLAQKGRRSLTRNRASKSQPNLVGIGGSVKD  411



>ref|XP_009774390.1| PREDICTED: uncharacterized protein LOC104224437 isoform X1 [Nicotiana 
sylvestris]
Length=799

 Score =   175 bits (443),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+FK +SSS+  SS+ L VSMGK  YQTWDKGDF+FPLTTFR++LVV LQD
Sbjct  1     MPGTIQVSVLDFKNISSSAQSSSICLWVSMGKRAYQTWDKGDFSFPLTTFRENLVVRLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS   V+T  IVEKG WDD F LEG  YVHMKLQFILSEDERNRIRNVRESA++K
Sbjct  61    AEGNEISRAEVQTLSIVEKGYWDDFFQLEGGDYVHMKLQFILSEDERNRIRNVRESALKK  120

Query  1222  KQ  1217
             KQ
Sbjct  121   KQ  122


 Score = 35.0 bits (79),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPSTALVGPISEQNAQSKL  982
             +DR+E TSSSP++   +    + DR S A+KL+T        V P++EQ+AQS L
Sbjct  154   SDRSEATSSSPVKEMVQIQYSEPDRPS-AKKLQTPLIRDYISVKPVNEQDAQSML  207


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 119/252 (47%), Gaps = 29/252 (12%)
 Frame = -3

Query  840  LVKTQASKSQPNIVGMGGS-----LKDPLVSKT-WQETQTSTEKSGESSRSALNPVGIKP  679
            L++ ++S  + +IVG   S     LK+  V    + E  +S + +  S++   N V   P
Sbjct  508  LMRGESSSLEQDIVGTAQSVFHEQLKESSVHIVPFNEAGSSQQDTLRSAKKEPNAVATSP  567

Query  678  SYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDI  499
                R S   T +S    ++ +S  ++ +   +G+   +       SVAE++  E+ S+ 
Sbjct  568  MDLMRLSNLETATSSQRINVAHSDMLKANNLAAGQDCSNDP-----SVAEQRNTEIRSEA  622

Query  498  SRAIDFQRAASNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSS  343
               +  +R   NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED  
Sbjct  623  LLEVHIERVP-NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESAVHLLEDCH  681

Query  342  TEVNVHQSKTRISLQG---KQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQ  187
              V+ HQ   +   Q    K+     +D T+ KG EK  KP     E S ++G SGP  Q
Sbjct  682  IGVDDHQRNKKPPKQEITRKRGFFHRSDSTIKKGEEKPQKPRKSQSESSGQNGPSGPIRQ  741

Query  186  VY-FVFIFSFGV  154
            V     I  FG+
Sbjct  742  VIKIAVIVGFGI  753


 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (66%), Gaps = 13/102 (13%)
 Frame = -3

Query  1044  QSTPSTALVGPIS---EQNAQSKLGVLEINEKKDD-------NKSSNPEGQ-VSGKTSSS  898
             +S   T +V P +   +Q+AQS L  +++ EKK+        + S+ PE Q V  KT SS
Sbjct  312   ESISQTKIVDPSNKPQDQSAQSMLK-MDVAEKKESVSPKKIVDASNKPEDQGVLEKTPSS  370

Query  897   VRKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD  775
             VR MISAFE  L+Q++ RR L + +ASKSQPN+VG+GGS+KD
Sbjct  371   VRNMISAFEIGLAQKKGRRSLTRNRASKSQPNLVGIGGSVKD  412



>ref|XP_007012849.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY30468.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=575

 Score =   174 bits (441),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 110/137 (80%), Gaps = 4/137 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQV+VL+F  L SSS  S  S+KVSMGK  YQTWDKGDF+FPLTT RD+L++ LQD
Sbjct  1     MPGTIQVTVLDFNGLDSSSTASKTSIKVSMGKREYQTWDKGDFSFPLTTLRDNLIITLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISHTGV+T L+VEKG WDDIF LEG G+VHMKLQF+LSE+ER RIR +RESA++K
Sbjct  61    AEGNEISHTGVETRLVVEKGVWDDIFFLEGGGHVHMKLQFVLSEEERQRIRTMRESALKK  120

Query  1222  KQDRI----RGIPETAT  1184
             K D +     G P +A+
Sbjct  121   KHDELCNSGHGSPISAS  137


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 89/323 (28%), Positives = 128/323 (40%), Gaps = 75/323 (23%)
 Frame = -3

Query  918  SGKTSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQE---  748
            +GK  S+VRKMISAFE  L+Q + +  +K    K Q   +GM   L +  +++   E   
Sbjct  240  AGKAHSNVRKMISAFEDGLNQ-DMKSSIKPLPKKPQTRNIGMDSFLANSQLNEVETEKII  298

Query  747  ---------TQTSTEKSGESSRSALNPVG-IKPSYS---------YRESTATTISS-KGN  628
                          E++    R  +  +G +KP Y           +ES A  I + + N
Sbjct  299  PPKANLGRINTKEFEQTNIYFREKVQTIGCVKPIYEAASSKETQQLKESNAACIQTERKN  358

Query  627  SSMKNSLSI--------------------RESGTVSGRTNKDHS-GIQTDSVAEKK----  523
              +KN   +                     E    S R    HS G Q+ ++  KK    
Sbjct  359  LDLKNKFKVIQKESDEKEEKKYSEEFKRALEKAAFSRRMLDKHSKGNQSWNLFSKKQHSS  418

Query  522  ----GRELGSDISRAIDFQRAAS---NEKLKSLASES--------SGAWIFPDNMRHLCI  388
                 +E G +I   +   R A    NEKLKS+A  S        SG WIFP   + LCI
Sbjct  419  RNLVAKEGGDEI--FLKDPRGAEGNLNEKLKSVAIWSDDHCSIGSSGLWIFPGEAKCLCI  476

Query  387  TTAGKEVLNFLEDSSTEVNVHQSKTRI---SLQGKQDSLQGTDPTMKG-----SEKLHKP  232
            TT GK++++       E N HQ K         G+ ++  GT     G     S+KL   
Sbjct  477  TTGGKQIMDLTGGFWDETNTHQIKLSARDPKNTGEVNADAGTGNEANGDAKSSSQKLRPK  536

Query  231  YEGS-EKHGSSGPFGQVYFVFIF  166
             E S +   + GP GQV    I 
Sbjct  537  LENSRDPEHTIGPVGQVIRAIIM  559



>ref|XP_006346563.1| PREDICTED: uncharacterized protein LOC102595100 [Solanum tuberosum]
Length=663

 Score =   168 bits (425),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV +FK +SSSS    VS    MGK  YQTWDKGDF+FPLTTFRD+LVV L+D
Sbjct  1     MPGTIQVSVFDFKNISSSSICLWVS----MGKRAYQTWDKGDFSFPLTTFRDNLVVRLED  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS   V+T  IVEKG WDD+F LEG  YVHMKLQF LSEDERN IRNVRESA++K
Sbjct  57    VEGNEISRKEVETLSIVEKGCWDDVFQLEGGHYVHMKLQFSLSEDERNLIRNVRESALKK  116

Query  1222  KQDRI  1208
             KQD++
Sbjct  117   KQDKV  121


 Score = 35.4 bits (80),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 19/136 (14%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPS-TALVGPISEQNAQSKLGVLE  970
             +DR+E  SSSP++ E  E RY       AEKL+TQ   + +A V P+ +Q+ QS L +  
Sbjct  150   SDRSEVNSSSPVK-EGVEKRYSEPDRPSAEKLQTQLIQNDSAAVKPVYDQDVQSILKMDV  208

Query  969   INEKKDDNKS---SNPEGQVSGKTSSSVRKM-ISAFETSLSQ--------QERRPLVKT-  829
               +K+  ++    S+P  +   ++  S+ KM ++  + S+SQ        Q+ + ++K  
Sbjct  209   TGKKQSVSQQKILSDPSNKSEDQSGRSMLKMDVAVKKESISQKRNVDSEDQDTQSMLKMG  268

Query  828   ----QASKSQPNIVGM  793
                 + S SQ NIV +
Sbjct  269   VAAKKESVSQKNIVDL  284


 Score =   133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 126/372 (34%), Positives = 183/372 (49%), Gaps = 81/372 (22%)
 Frame = -3

Query  1050  ETQSTPSTALVGPISEQNAQSKLGVLEINEKKDDNKSSNPEGQVSGKTSSSVRKMISAFE  871
             E Q T S   +G  +++ + S+  +++++ + DD      +G V  KT SSVRKMISAFE
Sbjct  257   EDQDTQSMLKMGVAAKKESVSQKNIVDLSNEPDD------QG-VLEKTPSSVRKMISAFE  309

Query  870   TSLSQQER-RPLVKTQASKSQPNIVGMGGSLKD-------------------PLVSKTWQ  751
             T L+Q++  R L +T+ASKSQPN+VG+GGSLKD                   PL +    
Sbjct  310   TGLTQKKGGRSLTRTRASKSQPNLVGIGGSLKDLDSDNISRPNKMSALRLERPLNTVDLP  369

Query  750   ETQTSTEKSGESSRSALNPVGIKPSYSYRE-----------------STATTISSKGNSS  622
             E Q +  K G++S    + VG +    + E                    T +S+K  S+
Sbjct  370   EPQINIGKRGQNSSPEQDFVGTEQPVFHEELKQSSVHIVRFNEAGSSQQETFVSAKKESN  429

Query  621   MKNS-------LSIRESGTVSGRTNKDHSGIQTD-------------SVAEKKGRELGSD  502
                +       LS  E+ T S  T+  H  +                SVAEK+ RE+ S+
Sbjct  430   TVATSPVDLMRLSNLETATSSQTTSVAHPDVLKANNLAANRDSFNGPSVAEKQNREIRSE  489

Query  501   ISRAIDFQRAASNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDS  346
                 + F++A SN K K +A        SE+SGAWIFPDN + LC+T+AGK +++  ED 
Sbjct  490   TLPEVHFEKA-SNVKPKLIACREDELYDSENSGAWIFPDNKKRLCMTSAGKNIVHLSEDC  548

Query  345   STEVNVHQSKTRISLQ---GKQDSLQGTDP-TMKGSEKLHKPYEGSE---KHGSSGPFGQ  187
                V+ HQS  R S+Q   GK+     +D  T KG EK  KP   S+   ++GSSGP  Q
Sbjct  549   RIGVDDHQSNKRPSMQETTGKRSFFHRSDSMTKKGREKPQKPRNQSKSFGENGSSGPVRQ  608

Query  186   VY-FVFIFSFGV  154
             V     +  FG+
Sbjct  609   VMNIALVVGFGI  620



>ref|XP_007012851.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY30470.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=577

 Score =   169 bits (429),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 5/138 (4%)
 Frame = -2

Query  1582  MPGTIQV-SVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPGTIQV +VL+F  L SSS  S  S+KVSMGK  YQTWDKGDF+FPLTT RD+L++ LQ
Sbjct  1     MPGTIQVTAVLDFNGLDSSSTASKTSIKVSMGKREYQTWDKGDFSFPLTTLRDNLIITLQ  60

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             D EGNEISHTGV+T L+VEKG WDDIF LEG G+VHMKLQF+LSE+ER RIR +RESA++
Sbjct  61    DAEGNEISHTGVETRLVVEKGVWDDIFFLEGGGHVHMKLQFVLSEEERQRIRTMRESALK  120

Query  1225  KKQDRI----RGIPETAT  1184
             KK D +     G P +A+
Sbjct  121   KKHDELCNSGHGSPISAS  138


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 107/264 (41%), Gaps = 66/264 (25%)
 Frame = -3

Query  918  SGKTSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQE---  748
            +GK  S+VRKMISAFE  L+Q + +  +K    K Q   +GM   L +  +++   E   
Sbjct  241  AGKAHSNVRKMISAFEDGLNQ-DMKSSIKPLPKKPQTRNIGMDSFLANSQLNEVETEKII  299

Query  747  ---------TQTSTEKSGESSRSALNPVG-IKPSYS---------YRESTATTISS-KGN  628
                          E++    R  +  +G +KP Y           +ES A  I + + N
Sbjct  300  PPKANLGRINTKEFEQTNIYFREKVQTIGCVKPIYEAASSKETQQLKESNAACIQTERKN  359

Query  627  SSMKNSLSI--------------------RESGTVSGRTNKDHS-GIQTDSVAEKK----  523
              +KN   +                     E    S R    HS G Q+ ++  KK    
Sbjct  360  LDLKNKFKVIQKESDEKEEKKYSEEFKRALEKAAFSRRMLDKHSKGNQSWNLFSKKQHSS  419

Query  522  ----GRELGSDISRAIDFQRAAS---NEKLKSLASES--------SGAWIFPDNMRHLCI  388
                 +E G +I   +   R A    NEKLKS+A  S        SG WIFP   + LCI
Sbjct  420  RNLVAKEGGDEI--FLKDPRGAEGNLNEKLKSVAIWSDDHCSIGSSGLWIFPGEAKCLCI  477

Query  387  TTAGKEVLNFLEDSSTEVNVHQSK  316
            TT GK++++       E N HQ K
Sbjct  478  TTGGKQIMDLTGGFWDETNTHQIK  501



>ref|XP_007012850.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY30469.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=576

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 5/138 (4%)
 Frame = -2

Query  1582  MPGTIQV-SVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPGTIQV +VL+F  L SSS  S  S+KVSMGK  YQTWDKGDF+FPLTT RD+L++ LQ
Sbjct  1     MPGTIQVTAVLDFNGLDSSSTASKTSIKVSMGKREYQTWDKGDFSFPLTTLRDNLIITLQ  60

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             D EGNEISHTGV+T L+VEKG WDDIF LEG G+VHMKLQF+LSE+ER RIR +RESA++
Sbjct  61    DAEGNEISHTGVETRLVVEKGVWDDIFFLEGGGHVHMKLQFVLSEEERQRIRTMRESALK  120

Query  1225  KKQDRI----RGIPETAT  1184
             KK D +     G P +A+
Sbjct  121   KKHDELCNSGHGSPISAS  138


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 89/323 (28%), Positives = 128/323 (40%), Gaps = 75/323 (23%)
 Frame = -3

Query  918  SGKTSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQE---  748
            +GK  S+VRKMISAFE  L+Q + +  +K    K Q   +GM   L +  +++   E   
Sbjct  241  AGKAHSNVRKMISAFEDGLNQ-DMKSSIKPLPKKPQTRNIGMDSFLANSQLNEVETEKII  299

Query  747  ---------TQTSTEKSGESSRSALNPVG-IKPSYS---------YRESTATTISS-KGN  628
                          E++    R  +  +G +KP Y           +ES A  I + + N
Sbjct  300  PPKANLGRINTKEFEQTNIYFREKVQTIGCVKPIYEAASSKETQQLKESNAACIQTERKN  359

Query  627  SSMKNSLSI--------------------RESGTVSGRTNKDHS-GIQTDSVAEKK----  523
              +KN   +                     E    S R    HS G Q+ ++  KK    
Sbjct  360  LDLKNKFKVIQKESDEKEEKKYSEEFKRALEKAAFSRRMLDKHSKGNQSWNLFSKKQHSS  419

Query  522  ----GRELGSDISRAIDFQRAAS---NEKLKSLASES--------SGAWIFPDNMRHLCI  388
                 +E G +I   +   R A    NEKLKS+A  S        SG WIFP   + LCI
Sbjct  420  RNLVAKEGGDEI--FLKDPRGAEGNLNEKLKSVAIWSDDHCSIGSSGLWIFPGEAKCLCI  477

Query  387  TTAGKEVLNFLEDSSTEVNVHQSKTRI---SLQGKQDSLQGTDPTMKG-----SEKLHKP  232
            TT GK++++       E N HQ K         G+ ++  GT     G     S+KL   
Sbjct  478  TTGGKQIMDLTGGFWDETNTHQIKLSARDPKNTGEVNADAGTGNEANGDAKSSSQKLRPK  537

Query  231  YEGS-EKHGSSGPFGQVYFVFIF  166
             E S +   + GP GQV    I 
Sbjct  538  LENSRDPEHTIGPVGQVIRAIIM  560



>ref|XP_004243763.2| PREDICTED: uncharacterized protein LOC101245860 isoform X4 [Solanum 
lycopersicum]
Length=591

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV +FK +SSSS    VS    MGK  YQTWDKGDF+FPLTTFRD+LVV L+D
Sbjct  1     MPGTIQVSVFDFKNISSSSICLWVS----MGKRAYQTWDKGDFSFPLTTFRDNLVVRLED  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNE+S   V+T  IVEKG WDD+F  E   YVHMKLQFILSEDERN IRNVRESA++K
Sbjct  57    VEGNELSRKEVETLSIVEKGCWDDVFQFEEGHYVHMKLQFILSEDERNLIRNVRESALKK  116

Query  1222  KQDRI  1208
             KQD++
Sbjct  117   KQDKV  121


 Score =   121 bits (304),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 147/281 (52%), Gaps = 67/281 (24%)
 Frame = -3

Query  942  SSNPEGQ-VSGKTSSSVRKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD--  775
            S+ PE Q V  KT SSVRKMISAFET L+Q++ RR L +T+ASKSQPN+VG+GGSLKD  
Sbjct  285  SNEPEDQGVLEKTPSSVRKMISAFETGLTQKKGRRSLTRTRASKSQPNLVGIGGSLKDLD  344

Query  774  -----------------PLVSKTWQETQTSTEKSGESSRSALNPVGI-KPSY--SYREST  655
                             PL +    E Q +  K  ++S  A + VG  +P +   +++S+
Sbjct  345  SDKISRPNKISALRLERPLNTVDLPEPQINIGKRVQNSSPAQDFVGTEQPVFHEQFKQSS  404

Query  654  A--------------TTISSKGNSSMKNS-------LSIRESGTVSGRTNKDH------S  556
                           T +S+K +S+   +       LS  E+   S  T+  H      S
Sbjct  405  VHIVQFNEAGSSQQETFVSAKKDSNTVAASPVDLIRLSNLETAISSQTTSVAHPDMLKAS  464

Query  555  GIQTD-------SVAEKKGRELGSDISRAIDFQRAASNEKLKSLA--------SESSGAW  421
             +  D       +VAEK+ RE+ S+ S  + F++ ASN K K +A        SE+SGAW
Sbjct  465  NLAADQDFFNGPAVAEKRNREIRSETSPEVHFEK-ASNVKPKLIACRKDELFDSENSGAW  523

Query  420  IFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQ  298
            IFPDN R LC+T+AGK +++  ED    V+ HQ   R S+Q
Sbjct  524  IFPDNKRRLCMTSAGKNIVHLSEDCHIGVDDHQRNKRPSMQ  564



>ref|XP_009604260.1| PREDICTED: uncharacterized protein LOC104099061 isoform X3 [Nicotiana 
tomentosiformis]
Length=801

 Score =   159 bits (402),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  1495  MGKTVYQTWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             MGK  YQTWDKGDF+FPLTTFR++LVV LQD EGNEIS T V+T  IVEKG WDD F LE
Sbjct  1     MGKRAYQTWDKGDFSFPLTTFRENLVVRLQDAEGNEISRTEVQTLSIVEKGYWDDFFQLE  60

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKKQ  1217
             G  YVHMKLQFILSED+RNRIRNVRESA++KKQ
Sbjct  61    GGDYVHMKLQFILSEDDRNRIRNVRESALKKKQ  93


 Score = 36.2 bits (82),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = -3

Query  1146  TDRTEGTSSSPMRHEDEEPRYKHDRSSPAEKLETQSTPSTALVGPISEQNAQS--KLGVL  973
             +DR+E TSSSP++   +    + DR S A+K++T        V P++EQ+AQS  K+ V 
Sbjct  125   SDRSEATSSSPVKEGVQIQYSEPDRPS-AKKVQTPLIRDYISVKPVNEQDAQSMFKMDVA  183

Query  972   EINEKKDDNKSSNPEGQVSGKTSSSVRKMISAF-ETSLSQ  856
                E       ++P  +   +++ S+ KM+ A  E ++SQ
Sbjct  184   AKKEYVSQKTIADPYNKPEDQSAKSMLKMVVAVKEETVSQ  223


 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 91/182 (50%), Gaps = 31/182 (17%)
 Frame = -3

Query  609  LSIRESGTVSGRTNKDHS------GIQTD-------SVAEKKGRELGSDISRAIDFQRAA  469
            LS  E+ T S R N  HS       + TD       SVAE++ RE+ S+    +  +R  
Sbjct  575  LSNLETATSSQRINVAHSDMLNANNLATDQDRSSDPSVAEQRSREIRSEALLEVHIERVP  634

Query  468  SNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKT  313
             NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED   EV+ HQ   
Sbjct  635  -NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESTMHLLEDYHAEVDDHQRNK  693

Query  312  RISLQ---GKQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQVY-FVFIFSF  160
            +   Q   GK+     +D T+ KG EK  KP     E S ++G SGP  QV     I  F
Sbjct  694  KPPKQEITGKRGFFHKSDSTIKKGGEKPQKPRKSQTESSGQNGPSGPVRQVIKIAVIVGF  753

Query  159  GV  154
            G+
Sbjct  754  GI  755


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 30/141 (21%)
 Frame = -3

Query  1044  QSTPSTALVGPISEQNAQSKLGVLEIN---------EKKDDNKSSNPEGQ-VSGKTSSSV  895
             +S  +  +V P S+   Q    VL +N         E K  +  + PE Q V  KT SSV
Sbjct  315   ESVSNKKIVDPSSKPEDQGAQYVLRVNVAAKKESVSETKIVDPPNKPEDQRVLEKTPSSV  374

Query  894   RKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD-------------------  775
             R MISAFET L+Q++ RR L + +ASKSQPN+VG+GGSLKD                   
Sbjct  375   RNMISAFETGLAQKKGRRSLTRNRASKSQPNLVGIGGSLKDLDPEDTAMPNKMSALRVER  434

Query  774   PLVSKTWQETQTSTEKSGESS  712
             PL +    E Q + +K GESS
Sbjct  435   PLNNANLPEPQRNIDKRGESS  455



>ref|XP_010324069.1| PREDICTED: uncharacterized protein LOC101245860 isoform X2 [Solanum 
lycopersicum]
Length=659

 Score =   164 bits (416),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV +FK +SSSS    VS    MGK  YQTWDKGDF+FPLTTFRD+LVV L+D
Sbjct  1     MPGTIQVSVFDFKNISSSSICLWVS----MGKRAYQTWDKGDFSFPLTTFRDNLVVRLED  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNE+S   V+T  IVEKG WDD+F  E   YVHMKLQFILSEDERN IRNVRESA++K
Sbjct  57    VEGNELSRKEVETLSIVEKGCWDDVFQFEEGHYVHMKLQFILSEDERNLIRNVRESALKK  116

Query  1222  KQDRI  1208
             KQD++
Sbjct  117   KQDKV  121


 Score =   141 bits (355),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 176/337 (52%), Gaps = 75/337 (22%)
 Frame = -3

Query  942  SSNPEGQ-VSGKTSSSVRKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD--  775
            S+ PE Q V  KT SSVRKMISAFET L+Q++ RR L +T+ASKSQPN+VG+GGSLKD  
Sbjct  285  SNEPEDQGVLEKTPSSVRKMISAFETGLTQKKGRRSLTRTRASKSQPNLVGIGGSLKDLD  344

Query  774  -----------------PLVSKTWQETQTSTEKSGESSRSALNPVGI-KPSY--SYREST  655
                             PL +    E Q +  K  ++S  A + VG  +P +   +++S+
Sbjct  345  SDKISRPNKISALRLERPLNTVDLPEPQINIGKRVQNSSPAQDFVGTEQPVFHEQFKQSS  404

Query  654  A--------------TTISSKGNSSMKNS-------LSIRESGTVSGRTNKDH------S  556
                           T +S+K +S+   +       LS  E+   S  T+  H      S
Sbjct  405  VHIVQFNEAGSSQQETFVSAKKDSNTVAASPVDLIRLSNLETAISSQTTSVAHPDMLKAS  464

Query  555  GIQTD-------SVAEKKGRELGSDISRAIDFQRAASNEKLKSLA--------SESSGAW  421
             +  D       +VAEK+ RE+ S+ S  + F++ ASN K K +A        SE+SGAW
Sbjct  465  NLAADQDFFNGPAVAEKRNREIRSETSPEVHFEK-ASNVKPKLIACRKDELFDSENSGAW  523

Query  420  IFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQ---GKQDSLQGTD-PTMKG  253
            IFPDN R LC+T+AGK +++  ED    V+ HQ   R S+Q   GK+   + ++  TMKG
Sbjct  524  IFPDNKRRLCMTSAGKNIVHLSEDCHIGVDDHQRNKRPSMQETTGKRSFFRRSESTTMKG  583

Query  252  SEKLHKPYEGSE---KHGSSGPFGQVY-FVFIFSFGV  154
             EK  KP   SE   ++GSSGP  QV     +  FG+
Sbjct  584  REKPQKPRTQSESFGENGSSGPVRQVMNIALVVGFGI  620



>ref|XP_010324068.1| PREDICTED: uncharacterized protein LOC101245860 isoform X1 [Solanum 
lycopersicum]
Length=663

 Score =   164 bits (416),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV +FK +SSSS    VS    MGK  YQTWDKGDF+FPLTTFRD+LVV L+D
Sbjct  1     MPGTIQVSVFDFKNISSSSICLWVS----MGKRAYQTWDKGDFSFPLTTFRDNLVVRLED  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNE+S   V+T  IVEKG WDD+F  E   YVHMKLQFILSEDERN IRNVRESA++K
Sbjct  57    VEGNELSRKEVETLSIVEKGCWDDVFQFEEGHYVHMKLQFILSEDERNLIRNVRESALKK  116

Query  1222  KQDRI  1208
             KQD++
Sbjct  117   KQDKV  121


 Score =   141 bits (356),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 176/337 (52%), Gaps = 75/337 (22%)
 Frame = -3

Query  942  SSNPEGQ-VSGKTSSSVRKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD--  775
            S+ PE Q V  KT SSVRKMISAFET L+Q++ RR L +T+ASKSQPN+VG+GGSLKD  
Sbjct  285  SNEPEDQGVLEKTPSSVRKMISAFETGLTQKKGRRSLTRTRASKSQPNLVGIGGSLKDLD  344

Query  774  -----------------PLVSKTWQETQTSTEKSGESSRSALNPVGI-KPSY--SYREST  655
                             PL +    E Q +  K  ++S  A + VG  +P +   +++S+
Sbjct  345  SDKISRPNKISALRLERPLNTVDLPEPQINIGKRVQNSSPAQDFVGTEQPVFHEQFKQSS  404

Query  654  A--------------TTISSKGNSSMKNS-------LSIRESGTVSGRTNKDH------S  556
                           T +S+K +S+   +       LS  E+   S  T+  H      S
Sbjct  405  VHIVQFNEAGSSQQETFVSAKKDSNTVAASPVDLIRLSNLETAISSQTTSVAHPDMLKAS  464

Query  555  GIQTD-------SVAEKKGRELGSDISRAIDFQRAASNEKLKSLA--------SESSGAW  421
             +  D       +VAEK+ RE+ S+ S  + F++ ASN K K +A        SE+SGAW
Sbjct  465  NLAADQDFFNGPAVAEKRNREIRSETSPEVHFEK-ASNVKPKLIACRKDELFDSENSGAW  523

Query  420  IFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQ---GKQDSLQGTD-PTMKG  253
            IFPDN R LC+T+AGK +++  ED    V+ HQ   R S+Q   GK+   + ++  TMKG
Sbjct  524  IFPDNKRRLCMTSAGKNIVHLSEDCHIGVDDHQRNKRPSMQETTGKRSFFRRSESTTMKG  583

Query  252  SEKLHKPYEGSE---KHGSSGPFGQVY-FVFIFSFGV  154
             EK  KP   SE   ++GSSGP  QV     +  FG+
Sbjct  584  REKPQKPRTQSESFGENGSSGPVRQVMNIALVVGFGI  620



>gb|KDP33827.1| hypothetical protein JCGZ_07398 [Jatropha curcas]
Length=549

 Score =   160 bits (405),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVLEF  L SSS  S +S+K+SMGK  YQT+DKGDF+FPLTT RD+L+V LQD
Sbjct  1     MPGTIQVSVLEFMTLQSSSRLSQMSIKISMGKREYQTFDKGDFSFPLTTLRDNLIVTLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +G EISHT V+T  ++EKG WD++F  EG G+VHMKLQF+LSE++R+RIR +RESA+RK
Sbjct  61    SKGKEISHTVVETRFVIEKGIWDNVFPFEGGGHVHMKLQFVLSEEDRHRIRVMRESALRK  120

Query  1222  KQDR-IRGIPET---ATAVGDFKRGLSECNR  1142
             K +  + G P++   AT V +F + L + NR
Sbjct  121   KHEELLNGKPKSPARATTVSNFAQYL-QPNR  150


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 73/283 (26%), Positives = 120/283 (42%), Gaps = 48/283 (17%)
 Frame = -3

Query  942  SSNPEGQVS-GKTSSSVRKMISAFETSLSQQ---ERRPL-VKTQASKSQPNIV-------  799
            +++PE + S  KT S +R MISAFE+SL+Q    E RP  +K+Q+SK++  +        
Sbjct  274  ATDPEKRSSLKKTPSKIRNMISAFESSLNQDMKPEIRPAPIKSQSSKNRVEVASKSTHLT  333

Query  798  ----------GMGGSLKDPLVSKTWQETQTSTEKSGESSRSALNPVGIKPSYSYRESTA-  652
                       + G ++DP  S   Q+      K  E     +  V      S R S + 
Sbjct  334  EVKAENAEPANISGRVRDPSHSGDMQQAAAHIGKRKEQ----IGFVSQSEQLSERTSVSG  389

Query  651  TTISSKGNSSMKNSLS-IRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDISRAIDFQR  475
              +++KG   + N  + IR S                + + +K G+E+  +  +  +FQ 
Sbjct  390  RLLNAKGAHPLSNLFAWIRHS--------------TGNLLKQKNGKEIQLETLQEANFQG  435

Query  474  AASNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQG  295
            ++ +E        S+GAWI+PD  + LCIT+ GK++++      TE    Q +    +  
Sbjct  436  SSGDE-----PQSSNGAWIYPDGGKPLCITSGGKKIIDLKGSFHTEAKRQQLRANSHVTE  490

Query  294  KQDSLQGTDPTMKGSEKLHKPYEGSEKHGSSGPFGQVYFVFIF  166
                +Q  +             EGS K    GP  QV  V I 
Sbjct  491  NVKEIQAQEGIKAARRHSESNNEGS-KDAERGPAVQVMRVAIM  532



>ref|XP_006451456.1| hypothetical protein CICLE_v10010605mg, partial [Citrus clementina]
 gb|ESR64696.1| hypothetical protein CICLE_v10010605mg, partial [Citrus clementina]
Length=577

 Score =   160 bits (405),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = -2

Query  1618  LLLNVHCSVSSPMPGTIQVSVLEFKElssssppssvsl-kvSMGKTVYQTWDKGDFTFPL  1442
             L  +VH     PMPGTI VSVLEFK L SSS        KVSMGK  YQTW+K +F+FPL
Sbjct  12    LYASVHLRAWPPMPGTILVSVLEFKGLQSSSSMPQQMSIKVSMGKREYQTWEKTEFSFPL  71

Query  1441  TTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDER  1262
             TTFRD+L++ L D +GN+IS+TGV+T L+VEKG WDDIF LEG G+VH++LQFIL+EDER
Sbjct  72    TTFRDNLMIALYDAKGNKISYTGVETRLVVEKGLWDDIFSLEGGGHVHLRLQFILTEDER  131

Query  1261  NRIRNVRESAMRKKQDRIRGI-PETATAVG  1175
              RIR +RESA+RKK D +    P +  +VG
Sbjct  132   YRIRIMRESALRKKHDELSSSNPTSPESVG  161


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 67/272 (25%), Positives = 104/272 (38%), Gaps = 58/272 (21%)
 Frame = -3

Query  969  INEKKDDNKSSNPEGQVSG-KTSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVG-  796
            I  K ++  S N E Q    K  S+VR MI+AFE+SLSQ + RP +K   +KSQ   +  
Sbjct  233  IARKLEEAGSINREKQSPAEKIPSNVRNMINAFESSLSQ-DIRPYIKPAPAKSQLRKISS  291

Query  795  ----------------------MGGSLKDPLVSKTWQETQTSTEK-----------SGES  715
                                  M G +K P ++  +Q+    T              G +
Sbjct  292  EASLTSLSADEFKTEQIKPAALMSGRIKTPFLTGEFQQATMHTRAKEDQLGYVKAFDGYT  351

Query  714  SRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDH--------  559
            +       G+ P     E     +S K +S      S  ++ TVSGR   +H        
Sbjct  352  AHQGTRQFGLSPVDVRTEVKNPDMSDKNSSEGLMRESTGKAATVSGRMVDEHIRRQHPGK  411

Query  558  -----------SGIQTDSVAEKKGRELGSDISRAIDFQRAASNEKLKSL--ASESSGAWI  418
                       S I+      ++   L  D S+     +    E  K +  +S   G W+
Sbjct  412  LLLNEQQSGGKSSIKESMKGVRQEYSLEVD-SKGTSINKLKYKENWKDIHYSSNCPGTWM  470

Query  417  FPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQ  322
            FP   R+LCIT  GK +++ +     EV +H+
Sbjct  471  FPTGSRNLCITAGGKHLIDLMGICHAEVEIHR  502



>gb|KHG12429.1| Dystrophin-1 [Gossypium arboreum]
Length=627

 Score =   158 bits (400),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -2

Query  1582  MPGTIQVSVLEFK----ElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVV  1415
             MPGTIQVSVL+FK       SSS  S VS+KVS GK  YQTWDKG+F+FPLTT RD+L++
Sbjct  1     MPGTIQVSVLDFKGLHSSSLSSSSSSKVSIKVSKGKIEYQTWDKGEFSFPLTTLRDNLII  60

Query  1414  MLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRES  1235
              +QD EGNEISHTG++T L+VEKG WDDIF LEG G+ HMKLQF L+E+ER RIR +RES
Sbjct  61    TIQDAEGNEISHTGLETRLVVEKGVWDDIFPLEGGGHAHMKLQFFLNEEERQRIRIMRES  120

Query  1234  AMRKKQDRI----RGIPETAT  1184
             A++KK + +     G P+ A+
Sbjct  121   ALKKKHEELCNSGHGSPKNAS  141



>emb|CBI27917.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   158 bits (399),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 1/137 (1%)
 Frame = -2

Query  1612  LNVHCSVSSPMPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTF  1433
             +N++    SPMPGTIQVSVL+F     SS PSS+S+KVSMGK  YQTWDKGDF+FPLTT 
Sbjct  51    INIYFKALSPMPGTIQVSVLDFT-GLPSSSPSSISIKVSMGKREYQTWDKGDFSFPLTTL  109

Query  1432  RDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRI  1253
             R +L V LQD EGNEISH  + T L+V+KG  DD F L+G G+VHMKLQFILSE+ERNRI
Sbjct  110   RQNLTVTLQDAEGNEISHAEIDTMLVVQKGLLDDTFPLKGGGHVHMKLQFILSEEERNRI  169

Query  1252  RNVRESAMRKKQDRIRG  1202
             R +RESA++KK   + G
Sbjct  170   RIMRESALKKKHSGLSG  186


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 107/374 (29%), Positives = 157/374 (42%), Gaps = 86/374 (23%)
 Frame = -3

Query  1059  EKLETQSTPSTALVGPISEQNAQSKLGVLE--------INEKKDDNKSSNPEGQVS-GKT  907
             EK E QS  S   V PI      S  G LE         + + ++N + N E Q S  KT
Sbjct  276   EKFEAQSPFSDFPVKPIFSDGTSSMSGCLESVTTDSNSASPRLEENHADNTEKQSSLRKT  335

Query  906   SSSVRKMISAFETSLSQQERR----PLVKTQASKSQPNIVGMG-----------------  790
              S+VRKMISAFE SL+Q+       P+ K+Q++KS   ++  G                 
Sbjct  336   PSNVRKMISAFENSLTQEMGHRVAPPVTKSQSTKSWREVLLRGPQKLKETETWNPKVTQS  395

Query  789   --GSLKDPLVSKTWQETQTSTEKSGE--SSRSALNPVGIKPSYS--YRESTATTISSKGN  628
                  KD ++   +Q+T     K GE   S  A++     P Y+   +E +A  I SK  
Sbjct  396   TSEEAKDFVLKGEFQQTAAYIRKRGEQIDSDRAMDK-SKAPLYAGQSKELSAKHIQSKNE  454

Query  627   SSMKNSLSIR-----------------ESGTVSGRTNKDHSGIQ-----TD-------SV  535
             +    +  +                  E+ T SG        +Q     TD       SV
Sbjct  455   TPSDKNRQVHKKEERKSFENLIKKFPIETATASGGIFNRQGRLQPSNLVTDERDSGGTSV  514

Query  534   AEKKGRELGSDISRAIDFQRAASNE-------KLKSLASESSGAWIFPDNMRHLCITTAG  376
              EK G  + S  S  I  Q    N        K ++ + ES G+ IF D+ R LCITT+ 
Sbjct  515   IEKDGVGVQSRFSSEIISQGGTENTPKPVLYCKDENFSFESCGSCIFLDDTRRLCITTSD  574

Query  375   KEVLNFLEDSSTEVNVHQSKTRI----SLQGKQDSLQGTDPTMKGSEKLHKPYEGS-EKH  211
             K+V+N +  S TEV++HQ K ++     ++GKQ          K S ++ K  E S +  
Sbjct  575   KQVMNVMGGSPTEVDIHQRKLKVHGSSDIEGKQ--------AQKTSHRVKKRLESSADVE  626

Query  210   GSSGPFGQVYFVFI  169
              S GP  +V  + +
Sbjct  627   PSRGPVARVRALIL  640



>gb|ABK96358.1| unknown [Populus trichocarpa x Populus deltoides]
Length=162

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG I+VSVL+F  L SSSPPS +S+KVSMGK  Y+T DKGDF FPLTT R++L+V LQD
Sbjct  1     MPGAIEVSVLDFMGLQSSSPPSQMSIKVSMGKREYETRDKGDFIFPLTTLRENLIVTLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNEISHTGV+T L++EKG WDD F LEG G+V MK+QF+LSE +R+RIR +RE A++K
Sbjct  61    AKGNEISHTGVETRLVIEKGIWDDTFPLEGGGHVRMKVQFVLSEADRHRIRLMRELALKK  120

Query  1222  KQDRIRG----IPETATAV  1178
             K D +       PE A+AV
Sbjct  121   KHDELLSSDPRCPEYASAV  139



>ref|XP_006475430.1| PREDICTED: uncharacterized protein LOC102627547 isoform X1 [Citrus 
sinensis]
Length=583

 Score =   154 bits (390),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 106/138 (77%), Gaps = 2/138 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvsl-kvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPGTI VSVLEFK L SSS        KVSMGK  YQTW+K +F+FPLTTFRD+L++ L 
Sbjct  1     MPGTILVSVLEFKGLQSSSSMPQQMSIKVSMGKREYQTWEKTEFSFPLTTFRDNLMIALY  60

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             D +GN+IS+TGV+T L+VEKG WDDIF LEG G+VH++LQFIL+EDER RIR +RESA+R
Sbjct  61    DAKGNKISYTGVETRLVVEKGLWDDIFSLEGGGHVHLRLQFILTEDERYRIRIMRESALR  120

Query  1225  KKQDRIRGI-PETATAVG  1175
             KK D +    P +  +VG
Sbjct  121   KKHDELSSSNPTSPESVG  138


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 67/272 (25%), Positives = 104/272 (38%), Gaps = 58/272 (21%)
 Frame = -3

Query  969  INEKKDDNKSSNPEGQVSG-KTSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVG-  796
            I  K ++  S N E Q    K  S+VR MI+AFE+SLSQ + RP +K   +KSQ   +  
Sbjct  240  IARKLEEAGSINREKQSPAEKIPSNVRNMINAFESSLSQ-DIRPYIKPAPAKSQLRKISS  298

Query  795  ----------------------MGGSLKDPLVSKTWQETQTSTEK-----------SGES  715
                                  M G +K P ++  +Q+    T              G +
Sbjct  299  EASLTSLSADEFKTEQIKPAALMSGRIKTPFLTGEFQQATMHTRAKEDQLGYVKAFDGYT  358

Query  714  SRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDH--------  559
            +       G+ P     E     +S K +S      S  ++ TVSGR   +H        
Sbjct  359  AHQGTRQFGLSPVDVRTEVKNPDMSDKNSSEGLMRESTGKAATVSGRMVDEHIRRQHPGK  418

Query  558  -----------SGIQTDSVAEKKGRELGSDISRAIDFQRAASNEKLKSL--ASESSGAWI  418
                       S I+      ++   L  D S+     +    E  K +  +S   G W+
Sbjct  419  LLLNEQQSGGKSSIKESMKGVRQEYSLEVD-SKGTSINKLKYKENWKDIHYSSNCPGTWM  477

Query  417  FPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQ  322
            FP   R+LCIT  GK +++ +     EV +H+
Sbjct  478  FPTGSRNLCITAGGKHLIDLMGICHAEVEIHR  509



>ref|XP_010656201.1| PREDICTED: uncharacterized protein LOC100250764 isoform X1 [Vitis 
vinifera]
Length=608

 Score =   154 bits (389),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+F     SS PSS+S+KVSMGK  YQTWDKGDF+FPLTT R +L V LQD
Sbjct  1     MPGTIQVSVLDFT-GLPSSSPSSISIKVSMGKREYQTWDKGDFSFPLTTLRQNLTVTLQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH  + T L+V+KG  DD F L+G G+VHMKLQFILSE+ERNRIR +RESA++K
Sbjct  60    AEGNEISHAEIDTMLVVQKGLLDDTFPLKGGGHVHMKLQFILSEEERNRIRIMRESALKK  119

Query  1222  KQDRIRGIPETAT-----AVGDFKRGL  1157
             K   + G    ++      V D +RGL
Sbjct  120   KHSGLSGTASLSSLSINKKVSDSQRGL  146


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 159/379 (42%), Gaps = 87/379 (23%)
 Frame = -3

Query  1059  EKLETQSTPSTALVGPISEQNAQSKLGVLE--------INEKKDDNKSSNPEGQVS-GKT  907
             EK E QS  S   V PI      S  G LE         + + ++N + N E Q S  KT
Sbjct  227   EKFEAQSPFSDFPVKPIFSDGTSSMSGCLESVTTDSNSASPRLEENHADNTEKQSSLRKT  286

Query  906   SSSVRKMISAFETSLSQQERR----PLVKTQASKSQPNIVGMG-----------------  790
              S+VRKMISAFE SL+Q+       P+ K+Q++KS   ++  G                 
Sbjct  287   PSNVRKMISAFENSLTQEMGHRVAPPVTKSQSTKSWREVLLRGPQKLKETETWNPKVTQS  346

Query  789   --GSLKDPLVSKTWQETQTSTEKSGE--SSRSALNPVGIKPSYS--YRESTATTISSKGN  628
                  KD ++   +Q+T     K GE   S  A++     P Y+   +E +A  I SK  
Sbjct  347   TSEEAKDFVLKGEFQQTAAYIRKRGEQIDSDRAMDK-SKAPLYAGQSKELSAKHIQSKNE  405

Query  627   SSMKNSLSIR-----------------ESGTVSGRTNKDHSGIQ-----TD-------SV  535
             +    +  +                  E+ T SG        +Q     TD       SV
Sbjct  406   TPSDKNRQVHKKEERKSFENLIKKFPIETATASGGIFNRQGRLQPSNLVTDERDSGGTSV  465

Query  534   AEKKGRELGSDISRAIDFQRAASNE-------KLKSLASESSGAWIFPDNMRHLCITTAG  376
              EK G  + S  S  I  Q    N        K ++ + ES G+ IF D+ R LCITT+ 
Sbjct  466   IEKDGVGVQSRFSSEIISQGGTENTPKPVLYCKDENFSFESCGSCIFLDDTRRLCITTSD  525

Query  375   KEVLNFLEDSSTEVNVHQSKTRI----SLQGKQDSLQGTDPTMKGSEKLHKPYEGS-EKH  211
             K+V+N +  S TEV++HQ K ++     ++GKQ          K S ++ K  E S +  
Sbjct  526   KQVMNVMGGSPTEVDIHQRKLKVHGSSDIEGKQ--------AQKTSHRVKKRLESSADVE  577

Query  210   GSSGPFGQVYFVFIFS-FG  157
              S GP  +   V I + FG
Sbjct  578   PSRGPVARAIKVAIMAGFG  596



>ref|XP_002514104.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48058.1| conserved hypothetical protein [Ricinus communis]
Length=556

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 106/142 (75%), Gaps = 5/142 (4%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG IQVSVLEF  L SS P S +S+KVSMGK  YQT DKG+F+FPLTT RD L+V LQD
Sbjct  1     MPGIIQVSVLEFMALPSSPPLSQMSIKVSMGKRYYQTRDKGEFSFPLTTLRDKLIVTLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +G E+S+T ++T L++EKG WDDIF LEG G+VH+KLQF+LSE++R RIR +RESA+RK
Sbjct  61    AQGKEVSYTVIETRLVIEKGIWDDIFQLEGGGHVHLKLQFVLSEEDRQRIRIMRESALRK  120

Query  1222  KQD-----RIRGIPETATAVGD  1172
             K D      +R  P  ++   D
Sbjct  121   KHDELLKSELRSSPRASSVRSD  142


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 98/227 (43%), Gaps = 49/227 (22%)
 Frame = -3

Query  912  KTSSSVRKMISAFETSLSQ-QERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTS  736
            KT S +R MISAFE++++Q Q+ +P ++  + KS+ +     GS      S+   E +  
Sbjct  259  KTPSKIRNMISAFESNVNQKQDMKPKIRPTSIKSESDKTRAEGS-----SSRHLNEVKVE  313

Query  735  TEKSGESSRSALNPVG-----IKPSYSYRESTATTISSKGNS-------SMKNSLSIRES  592
              +  + S S  N +      + PS          I +KG +        +K  ++I+E 
Sbjct  314  NAELAQLSDSVRNAIHTRDLELTPSLIREREEQIGIRTKGTTQNLKDKTKVKQKVNIQEE  373

Query  591  GT---------------VSGRTNKD-----------HSGIQTDSVAEKKGRE--LGSDIS  496
             T               VSGR   +              +  D + E+K  +     D+ 
Sbjct  374  KTSYEGFARVSTSGRASVSGRMLNEKGRHPLRNLIGRRRLSGDKIVEQKSVKGIQPKDMQ  433

Query  495  RAIDFQRAASNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFL  355
               +  RA+SN+      SE +GAWIFPD  + +CITT  K+++N +
Sbjct  434  HLNNQDRASSND---PCPSECNGAWIFPDGGKRMCITTNAKQMMNLM  477



>ref|XP_011077975.1| PREDICTED: uncharacterized protein LOC105161846 isoform X2 [Sesamum 
indicum]
Length=608

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQV+VLEFK +SSSS PS+ SLKVSMGK  YQTWDKG+F+FP+T  R++LVV + D
Sbjct  1     MPGTIQVTVLEFKGVSSSSKPSAKSLKVSMGKRHYQTWDKGEFSFPITKLRENLVVAILD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEI+H  ++T  I+EKGSWD++F + G G+VHMKLQFILSE+ER RIR+VRESA++K
Sbjct  61    AGGNEIAHADIRTMQIIEKGSWDEVFSINGGGHVHMKLQFILSEEERKRIRSVRESAVKK  120

Query  1222  K  1220
             K
Sbjct  121   K  121


 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 123/399 (31%), Positives = 179/399 (45%), Gaps = 85/399 (21%)
 Frame = -3

Query  1176  GILRGGFQNATDRTEGTSSSPMRHE---DEEPRYK---------HDRSSPAEKLETQSTP  1033
             GI++  F + TD+++G  SSP  HE   DE+ + +         H  +S +E LE+  + 
Sbjct  195   GIIKPAFPDTTDQSQGAPSSPQLHEQVPDEKSKMRPLADIRSDVHQWAS-SELLESAISG  253

Query  1032  STALV------GPISEQNAQ-------SKLGVLEINEK-KDDNKSSNPEGQVSGKTSSSV  895
                LV       PI E   Q       S +  + +  K KDD+       + S KT S+V
Sbjct  254   KRNLVVSKLQDDPIQESRNQEPVEKTPSIVRKISVASKFKDDSVQKTGNQEPSVKTPSNV  313

Query  894   RKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTSTEKSGES  715
             RKMISAFE     QER+ + K+ +  S+ N     G              Q    +S E 
Sbjct  314   RKMISAFENG-QLQERKSMRKSLSLPSELNRFRKAG--------------QVDNRESKEL  358

Query  714   SRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDHSGI-----  550
             + S + P+      + RE T   +       M+ S S  ++ T SGR  ++ S +     
Sbjct  359   T-STVTPIPSGSGAASREPTVKELEISVVDLMRQSTS--KAATSSGRMPEEQSQVTQSSN  415

Query  549   ----QTDSVAEKKGRELGSDI--SRAIDFQRAASNEKLKSL--------ASESSGAWIFP  412
                    SVAE  GR  G+ +  S+ ID  + ASN KLKSL        +++SSG WIFP
Sbjct  416   LLKSSQSSVAEGSGRGRGTGLKSSKIIDI-KVASNPKLKSLEYYNDECYSTQSSGMWIFP  474

Query  411   DNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQGKQDSLQGTDPTM-----KGSE  247
             DN R LCITTAGK+V+  +    +E     +KTR + +G   +L+  D        + +E
Sbjct  475   DNARRLCITTAGKQVIKIVGHQHSE-----AKTREASKG-SSALEMPDKNQIHGKGRKNE  528

Query  246   KLHKPYEGSEKHG--------SSGPFGQVYFV-FIFSFG  157
             K  K Y      G        S+G  GQV  V  I +FG
Sbjct  529   KNQKKYAKHPARGRGSSPDDSSNGLVGQVIKVAVILAFG  567



>ref|XP_011077974.1| PREDICTED: uncharacterized protein LOC105161846 isoform X1 [Sesamum 
indicum]
Length=609

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQV+VLEFK +SSSS PS+ SLKVSMGK  YQTWDKG+F+FP+T  R++LVV + D
Sbjct  1     MPGTIQVTVLEFKGVSSSSKPSAKSLKVSMGKRHYQTWDKGEFSFPITKLRENLVVAILD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEI+H  ++T  I+EKGSWD++F + G G+VHMKLQFILSE+ER RIR+VRESA++K
Sbjct  61    AGGNEIAHADIRTMQIIEKGSWDEVFSINGGGHVHMKLQFILSEEERKRIRSVRESAVKK  120

Query  1222  K  1220
             K
Sbjct  121   K  121


 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 180/399 (45%), Gaps = 84/399 (21%)
 Frame = -3

Query  1176  GILRGGFQNATDRTEGTSSSPMRHE---DEEPRYK---------HDRSSPAEKLETQSTP  1033
             GI++  F + TD+++G  SSP  HE   DE+ + +         H  +S +E LE+  + 
Sbjct  195   GIIKPAFPDTTDQSQGAPSSPQLHEQVPDEKSKMRPLADIRSDVHQWAS-SELLESAISG  253

Query  1032  STALV------GPISEQNAQ-------SKLGVLEINEK-KDDNKSSNPEGQVSGKTSSSV  895
                LV       PI E   Q       S +  + +  K KDD+       + S KT S+V
Sbjct  254   KRNLVVSKLQDDPIQESRNQEPVEKTPSIVRKISVASKFKDDSVQKTGNQEPSVKTPSNV  313

Query  894   RKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTSTEKSGES  715
             RKMISAFE    QQER+ + K+ +  S+ N     G              Q    +S E 
Sbjct  314   RKMISAFENGQLQQERKSMRKSLSLPSELNRFRKAG--------------QVDNRESKEL  359

Query  714   SRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDHSGI-----  550
             + S + P+      + RE T   +       M+ S S  ++ T SGR  ++ S +     
Sbjct  360   T-STVTPIPSGSGAASREPTVKELEISVVDLMRQSTS--KAATSSGRMPEEQSQVTQSSN  416

Query  549   ----QTDSVAEKKGRELGSDI--SRAIDFQRAASNEKLKSL--------ASESSGAWIFP  412
                    SVAE  GR  G+ +  S+ ID  + ASN KLKSL        +++SSG WIFP
Sbjct  417   LLKSSQSSVAEGSGRGRGTGLKSSKIIDI-KVASNPKLKSLEYYNDECYSTQSSGMWIFP  475

Query  411   DNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQGKQDSLQGTDPTM-----KGSE  247
             DN R LCITTAGK+V+  +    +E     +KTR + +G   +L+  D        + +E
Sbjct  476   DNARRLCITTAGKQVIKIVGHQHSE-----AKTREASKG-SSALEMPDKNQIHGKGRKNE  529

Query  246   KLHKPYEGSEKHG--------SSGPFGQVYFV-FIFSFG  157
             K  K Y      G        S+G  GQV  V  I +FG
Sbjct  530   KNQKKYAKHPARGRGSSPDDSSNGLVGQVIKVAVILAFG  568



>ref|XP_008337704.1| PREDICTED: uncharacterized protein LOC103400809 [Malus domestica]
Length=481

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI+VSVLEF +L SSS    VS    MGK   Q WDKGDFTF LT+ RD+LVV+LQD
Sbjct  1     MPGTIKVSVLEFIDLPSSSISIKVS----MGKRECQAWDKGDFTFVLTSLRDNLVVLLQD  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH GV+   IVEKG WDD+F L G G+V MKLQF+L+E+ERNRIR +RESA++K
Sbjct  57    SEGNEISHAGVEVKSIVEKGIWDDLFPLSGGGFVRMKLQFVLNEEERNRIRMMRESALKK  116

Query  1222  KQ  1217
             KQ
Sbjct  117   KQ  118



>ref|XP_011048528.1| PREDICTED: uncharacterized protein LOC105142547 isoform X1 [Populus 
euphratica]
 ref|XP_011048529.1| PREDICTED: uncharacterized protein LOC105142547 isoform X1 [Populus 
euphratica]
Length=488

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG I+VSVL+F  L SSSPPS +S+KVSMGK  Y+T DKGDF FPLTT R++L+V LQD
Sbjct  1     MPGAIEVSVLDFMGLQSSSPPSQMSIKVSMGKREYETRDKGDFIFPLTTLRENLIVTLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNEISHTGV+T L++EKG WDD F LEG G+V MKLQF+LSE +R+RIR +RE A++K
Sbjct  61    AKGNEISHTGVETRLVIEKGIWDDTFPLEGGGHVRMKLQFVLSEADRHRIRLMRELALKK  120

Query  1222  KQDRIRG----IPETATAV  1178
             K D +       PE ATAV
Sbjct  121   KHDELLSSEPRCPEYATAV  139



>ref|XP_011048530.1| PREDICTED: uncharacterized protein LOC105142547 isoform X2 [Populus 
euphratica]
Length=474

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG I+VSVL+F  L SSSPPS +S+KVSMGK  Y+T DKGDF FPLTT R++L+V LQD
Sbjct  1     MPGAIEVSVLDFMGLQSSSPPSQMSIKVSMGKREYETRDKGDFIFPLTTLRENLIVTLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNEISHTGV+T L++EKG WDD F LEG G+V MKLQF+LSE +R+RIR +RE A++K
Sbjct  61    AKGNEISHTGVETRLVIEKGIWDDTFPLEGGGHVRMKLQFVLSEADRHRIRLMRELALKK  120

Query  1222  KQDRIRG----IPETATAV  1178
             K D +       PE ATAV
Sbjct  121   KHDELLSSEPRCPEYATAV  139



>ref|XP_002279676.2| PREDICTED: uncharacterized protein LOC100250764 isoform X2 [Vitis 
vinifera]
Length=597

 Score =   151 bits (381),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL+F     SS PSS+S+KVSMGK  YQTWDKGDF+FPLTT R +L V LQD
Sbjct  1     MPGTIQVSVLDFT-GLPSSSPSSISIKVSMGKREYQTWDKGDFSFPLTTLRQNLTVTLQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH  + T L+V+KG  DD F L+G G+VHMKLQFILSE+ERNRIR +RESA++K
Sbjct  60    AEGNEISHAEIDTMLVVQKGLLDDTFPLKGGGHVHMKLQFILSEEERNRIRIMRESALKK  119

Query  1222  KQDRIRG  1202
             K   + G
Sbjct  120   KHSGLSG  126


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 159/379 (42%), Gaps = 87/379 (23%)
 Frame = -3

Query  1059  EKLETQSTPSTALVGPISEQNAQSKLGVLE--------INEKKDDNKSSNPEGQVS-GKT  907
             EK E QS  S   V PI      S  G LE         + + ++N + N E Q S  KT
Sbjct  216   EKFEAQSPFSDFPVKPIFSDGTSSMSGCLESVTTDSNSASPRLEENHADNTEKQSSLRKT  275

Query  906   SSSVRKMISAFETSLSQQERR----PLVKTQASKSQPNIVGMG-----------------  790
              S+VRKMISAFE SL+Q+       P+ K+Q++KS   ++  G                 
Sbjct  276   PSNVRKMISAFENSLTQEMGHRVAPPVTKSQSTKSWREVLLRGPQKLKETETWNPKVTQS  335

Query  789   --GSLKDPLVSKTWQETQTSTEKSGE--SSRSALNPVGIKPSYS--YRESTATTISSKGN  628
                  KD ++   +Q+T     K GE   S  A++     P Y+   +E +A  I SK  
Sbjct  336   TSEEAKDFVLKGEFQQTAAYIRKRGEQIDSDRAMDK-SKAPLYAGQSKELSAKHIQSKNE  394

Query  627   SSMKNSLSIR-----------------ESGTVSGRTNKDHSGIQ-----TD-------SV  535
             +    +  +                  E+ T SG        +Q     TD       SV
Sbjct  395   TPSDKNRQVHKKEERKSFENLIKKFPIETATASGGIFNRQGRLQPSNLVTDERDSGGTSV  454

Query  534   AEKKGRELGSDISRAIDFQRAASNE-------KLKSLASESSGAWIFPDNMRHLCITTAG  376
              EK G  + S  S  I  Q    N        K ++ + ES G+ IF D+ R LCITT+ 
Sbjct  455   IEKDGVGVQSRFSSEIISQGGTENTPKPVLYCKDENFSFESCGSCIFLDDTRRLCITTSD  514

Query  375   KEVLNFLEDSSTEVNVHQSKTRI----SLQGKQDSLQGTDPTMKGSEKLHKPYEGS-EKH  211
             K+V+N +  S TEV++HQ K ++     ++GKQ          K S ++ K  E S +  
Sbjct  515   KQVMNVMGGSPTEVDIHQRKLKVHGSSDIEGKQ--------AQKTSHRVKKRLESSADVE  566

Query  210   GSSGPFGQVYFVFIFS-FG  157
              S GP  +   V I + FG
Sbjct  567   PSRGPVARAIKVAIMAGFG  585



>gb|EPS63424.1| hypothetical protein M569_11360, partial [Genlisea aurea]
Length=136

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  1585  PMPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQ  1406
             PMPG +QV VLEFK +SSSS P++ SLKVSMGK  YQTWD+G+F FP++  R+DLV+ L 
Sbjct  1     PMPGVVQVVVLEFKGVSSSSKPTAKSLKVSMGKRQYQTWDRGEFFFPVSKLREDLVISLL  60

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             D  GNEI+H+ ++T  I+EK  WD++F +   G+VH+KL FILSE+ERNRIR +RESA+R
Sbjct  61    DASGNEIAHSDIRTAEIIEKRFWDEVFSVSESGHVHLKLSFILSEEERNRIRVMRESAVR  120

Query  1225  KK  1220
             KK
Sbjct  121   KK  122



>ref|XP_010656203.1| PREDICTED: uncharacterized protein LOC100250764 isoform X3 [Vitis 
vinifera]
Length=590

 Score =   149 bits (376),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 95/147 (65%), Gaps = 24/147 (16%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV                   SMGK  YQTWDKGDF+FPLTT R +L V LQD
Sbjct  1     MPGTIQVSV-------------------SMGKREYQTWDKGDFSFPLTTLRQNLTVTLQD  41

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH  + T L+V+KG  DD F L+G G+VHMKLQFILSE+ERNRIR +RESA++K
Sbjct  42    AEGNEISHAEIDTMLVVQKGLLDDTFPLKGGGHVHMKLQFILSEEERNRIRIMRESALKK  101

Query  1222  KQDRIRGIPETAT-----AVGDFKRGL  1157
             K   + G    ++      V D +RGL
Sbjct  102   KHSGLSGTASLSSLSINKKVSDSQRGL  128


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 159/379 (42%), Gaps = 87/379 (23%)
 Frame = -3

Query  1059  EKLETQSTPSTALVGPISEQNAQSKLGVLE--------INEKKDDNKSSNPEGQVS-GKT  907
             EK E QS  S   V PI      S  G LE         + + ++N + N E Q S  KT
Sbjct  209   EKFEAQSPFSDFPVKPIFSDGTSSMSGCLESVTTDSNSASPRLEENHADNTEKQSSLRKT  268

Query  906   SSSVRKMISAFETSLSQQERR----PLVKTQASKSQPNIVGMG-----------------  790
              S+VRKMISAFE SL+Q+       P+ K+Q++KS   ++  G                 
Sbjct  269   PSNVRKMISAFENSLTQEMGHRVAPPVTKSQSTKSWREVLLRGPQKLKETETWNPKVTQS  328

Query  789   --GSLKDPLVSKTWQETQTSTEKSGE--SSRSALNPVGIKPSYS--YRESTATTISSKGN  628
                  KD ++   +Q+T     K GE   S  A++     P Y+   +E +A  I SK  
Sbjct  329   TSEEAKDFVLKGEFQQTAAYIRKRGEQIDSDRAMDK-SKAPLYAGQSKELSAKHIQSKNE  387

Query  627   SSMKNSLSIR-----------------ESGTVSGRTNKDHSGIQ-----TD-------SV  535
             +    +  +                  E+ T SG        +Q     TD       SV
Sbjct  388   TPSDKNRQVHKKEERKSFENLIKKFPIETATASGGIFNRQGRLQPSNLVTDERDSGGTSV  447

Query  534   AEKKGRELGSDISRAIDFQRAASNE-------KLKSLASESSGAWIFPDNMRHLCITTAG  376
              EK G  + S  S  I  Q    N        K ++ + ES G+ IF D+ R LCITT+ 
Sbjct  448   IEKDGVGVQSRFSSEIISQGGTENTPKPVLYCKDENFSFESCGSCIFLDDTRRLCITTSD  507

Query  375   KEVLNFLEDSSTEVNVHQSKTRI----SLQGKQDSLQGTDPTMKGSEKLHKPYEGS-EKH  211
             K+V+N +  S TEV++HQ K ++     ++GKQ          K S ++ K  E S +  
Sbjct  508   KQVMNVMGGSPTEVDIHQRKLKVHGSSDIEGKQ--------AQKTSHRVKKRLESSADVE  559

Query  210   GSSGPFGQVYFVFIFS-FG  157
              S GP  +   V I + FG
Sbjct  560   PSRGPVARAIKVAIMAGFG  578



>ref|XP_006381679.1| hypothetical protein POPTR_0006s15560g [Populus trichocarpa]
 gb|ERP59476.1| hypothetical protein POPTR_0006s15560g [Populus trichocarpa]
Length=565

 Score =   149 bits (375),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG I+VSVL+F  L SSSPPS +S+KVSMGK  Y+T DKGDF FPLTT R++L+V LQD
Sbjct  1     MPGAIEVSVLDFMGLQSSSPPSQMSIKVSMGKREYETRDKGDFIFPLTTLRENLIVTLQD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNEISHTGV+T L++EKG WDD F LEG G+V MK+QF+LSE +R+RIR +RE A++K
Sbjct  61    AKGNEISHTGVETRLVIEKGIWDDTFPLEGGGHVRMKVQFVLSEADRHRIRLMRELALKK  120

Query  1222  KQDRIRG----IPETATAV  1178
             K D +       PE ATAV
Sbjct  121   KHDELLSSEPRCPEYATAV  139



>ref|XP_004157921.1| PREDICTED: uncharacterized protein LOC101223934 [Cucumis sativus]
Length=161

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI++SVLEF +L    P         MGK  Y+T DKGDF+FPLTT RDD+++++QD
Sbjct  1     MPGTIRLSVLEFIDLPELLPSQISIKVS-MGKRHYETSDKGDFSFPLTTLRDDVILIVQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEIS  GV+   IVEKG WDD+F LEG G+VH++ QF LSED+R+RIR +RE+A+R+
Sbjct  60    AGGNEISRAGVQAKSIVEKGYWDDLFPLEGGGHVHLQFQFALSEDDRSRIRMMRETALRR  119

Query  1222  KQ  1217
             KQ
Sbjct  120   KQ  121



>ref|XP_004141055.1| PREDICTED: uncharacterized protein LOC101205190 [Cucumis sativus]
Length=164

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI++SVLEF +L    P         MGK  Y+T DKGDF+FPLTT RDD+++++QD
Sbjct  1     MPGTIRLSVLEFIDLPELLPSQISIKVS-MGKRHYETSDKGDFSFPLTTLRDDVILIVQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEIS  GV+   IVEKG WDD+F LEG G+VH++ QF LSED+R+RIR +RE+A+R+
Sbjct  60    AGGNEISRAGVQAKSIVEKGYWDDLFPLEGGGHVHLQFQFALSEDDRSRIRMMRETALRR  119

Query  1222  KQ  1217
             KQ
Sbjct  120   KQ  121



>ref|XP_009361719.1| PREDICTED: uncharacterized protein LOC103951948 [Pyrus x bretschneideri]
Length=574

 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI +SVL+F +L S            MGK   Q WDKGDFTF LTT RD+LV++LQD
Sbjct  1     MPGTINISVLQFMDLPSPPSSPISIKVS-MGKRECQAWDKGDFTFALTTLRDNLVLLLQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH GV+   IVEKG WDD+F L+G G+V MKLQF+L+E+ERN+IR +RESA++K
Sbjct  60    SEGNEISHAGVEVKSIVEKGLWDDLFPLKGGGFVRMKLQFVLNEEERNKIRMMRESAVKK  119

Query  1222  KQ  1217
             KQ
Sbjct  120   KQ  121



>ref|XP_009352649.1| PREDICTED: uncharacterized protein LOC103943989 isoform X2 [Pyrus 
x bretschneideri]
Length=573

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI+VSVLEF +L SSS    VS    MGK   Q WDKGDFTF LT+ RD+LVV+LQD
Sbjct  1     MPGTIKVSVLEFIDLPSSSISIKVS----MGKRECQAWDKGDFTFILTSLRDNLVVLLQD  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH GV+   IVEKG W+D+F L   G+V MKLQF+L+E+ERNRIR +RESA++K
Sbjct  57    SEGNEISHAGVEVKSIVEKGLWEDLFPLNEGGFVRMKLQFVLNEEERNRIRMMRESALKK  116

Query  1222  KQ  1217
             KQ
Sbjct  117   KQ  118


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 3/108 (3%)
 Frame = -3

Query  474  AASNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQG  295
            + +N + + +  ESSGAWIFPD     C+TT GK++++         N+HQ +T  SL  
Sbjct  455  SVANCEDRHIPFESSGAWIFPDEAIRFCVTTTGKKMIDSRGRCRENPNIHQRETNFSLPE  514

Query  294  KQDSLQGTDPTMKGSEKLHKPYEGSEKHGS-SGPFGQ-VYFVFIFSFG  157
              +     D   +   +  K    SE+ G+  GPFGQ +    +  FG
Sbjct  515  NVEE-HNVDKNEENQRRRSKVENSSEEAGTFGGPFGQAIKVAIMIGFG  561



>ref|XP_009352648.1| PREDICTED: uncharacterized protein LOC103943989 isoform X1 [Pyrus 
x bretschneideri]
Length=574

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI+VSVLEF +L SSS    VS    MGK   Q WDKGDFTF LT+ RD+LVV+LQD
Sbjct  1     MPGTIKVSVLEFIDLPSSSISIKVS----MGKRECQAWDKGDFTFILTSLRDNLVVLLQD  56

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH GV+   IVEKG W+D+F L   G+V MKLQF+L+E+ERNRIR +RESA++K
Sbjct  57    SEGNEISHAGVEVKSIVEKGLWEDLFPLNEGGFVRMKLQFVLNEEERNRIRMMRESALKK  116

Query  1222  KQ  1217
             KQ
Sbjct  117   KQ  118


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 3/108 (3%)
 Frame = -3

Query  474  AASNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQG  295
            + +N + + +  ESSGAWIFPD     C+TT GK++++         N+HQ +T  SL  
Sbjct  456  SVANCEDRHIPFESSGAWIFPDEAIRFCVTTTGKKMIDSRGRCRENPNIHQRETNFSLPE  515

Query  294  KQDSLQGTDPTMKGSEKLHKPYEGSEKHGS-SGPFGQ-VYFVFIFSFG  157
              +     D   +   +  K    SE+ G+  GPFGQ +    +  FG
Sbjct  516  NVEE-HNVDKNEENQRRRSKVENSSEEAGTFGGPFGQAIKVAIMIGFG  562



>gb|KDO57758.1| hypothetical protein CISIN_1g048506mg [Citrus sinensis]
Length=398

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = -2

Query  1495  MGKTVYQTWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             MGK  YQTW+K +F+FPLTTFRD+L++ L D +GN+IS+TGV+T L+VEKG WDDIF LE
Sbjct  11    MGKREYQTWEKTEFSFPLTTFRDNLMIALYDAKGNKISYTGVETRLVVEKGLWDDIFSLE  70

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRGI-PETATAVG  1175
             G G+VH++LQFIL+EDER RIR +RESA+RKK D +    P +  +VG
Sbjct  71    GGGHVHLRLQFILTEDERYRIRIMRESALRKKHDELSSSNPTSPESVG  118



>ref|XP_004243957.2| PREDICTED: uncharacterized protein LOC101245860 isoform X3 [Solanum 
lycopersicum]
Length=624

 Score =   142 bits (358),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 176/337 (52%), Gaps = 75/337 (22%)
 Frame = -3

Query  942  SSNPEGQ-VSGKTSSSVRKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD--  775
            S+ PE Q V  KT SSVRKMISAFET L+Q++ RR L +T+ASKSQPN+VG+GGSLKD  
Sbjct  246  SNEPEDQGVLEKTPSSVRKMISAFETGLTQKKGRRSLTRTRASKSQPNLVGIGGSLKDLD  305

Query  774  -----------------PLVSKTWQETQTSTEKSGESSRSALNPVGI-KPSY--SYREST  655
                             PL +    E Q +  K  ++S  A + VG  +P +   +++S+
Sbjct  306  SDKISRPNKISALRLERPLNTVDLPEPQINIGKRVQNSSPAQDFVGTEQPVFHEQFKQSS  365

Query  654  A--------------TTISSKGNSSMKNS-------LSIRESGTVSGRTNKDH------S  556
                           T +S+K +S+   +       LS  E+   S  T+  H      S
Sbjct  366  VHIVQFNEAGSSQQETFVSAKKDSNTVAASPVDLIRLSNLETAISSQTTSVAHPDMLKAS  425

Query  555  GIQTD-------SVAEKKGRELGSDISRAIDFQRAASNEKLKSLA--------SESSGAW  421
             +  D       +VAEK+ RE+ S+ S  + F++ ASN K K +A        SE+SGAW
Sbjct  426  NLAADQDFFNGPAVAEKRNREIRSETSPEVHFEK-ASNVKPKLIACRKDELFDSENSGAW  484

Query  420  IFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQ---GKQDSLQGTD-PTMKG  253
            IFPDN R LC+T+AGK +++  ED    V+ HQ   R S+Q   GK+   + ++  TMKG
Sbjct  485  IFPDNKRRLCMTSAGKNIVHLSEDCHIGVDDHQRNKRPSMQETTGKRSFFRRSESTTMKG  544

Query  252  SEKLHKPYEGSE---KHGSSGPFGQVY-FVFIFSFGV  154
             EK  KP   SE   ++GSSGP  QV     +  FG+
Sbjct  545  REKPQKPRTQSESFGENGSSGPVRQVMNIALVVGFGI  581


 Score =   121 bits (303),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  1447  PLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSED  1268
             PLTTFRD+LVV L+D EGNE+S   V+T  IVEKG WDD+F  E   YVHMKLQFILSED
Sbjct  3     PLTTFRDNLVVRLEDVEGNELSRKEVETLSIVEKGCWDDVFQFEEGHYVHMKLQFILSED  62

Query  1267  ERNRIRNVRESAMRKKQDRI  1208
             ERN IRNVRESA++KKQD++
Sbjct  63    ERNLIRNVRESALKKKQDKV  82



>gb|KGN60539.1| hypothetical protein Csa_2G000470 [Cucumis sativus]
Length=538

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI++SVLEF +L    P         MGK  Y+T DKGDF+FPLTT RDD+++++QD
Sbjct  1     MPGTIRLSVLEFIDLPELLPSQISIKVS-MGKRHYETSDKGDFSFPLTTLRDDVILIVQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEIS  GV+   IVEKG WDD+F LEG G+VH++ QF LSED+R+RIR +RE+A+R+
Sbjct  60    AGGNEISRAGVQAKSIVEKGYWDDLFPLEGGGHVHLQFQFALSEDDRSRIRMMRETALRR  119

Query  1222  KQ  1217
             KQ
Sbjct  120   KQ  121



>emb|CDP03167.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 99/140 (71%), Gaps = 10/140 (7%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGT+QVSV+EFK         S  LK+S+GK  Y T D GDF FPLTT  D+LVV L D
Sbjct  1     MPGTVQVSVMEFK------GLPSTCLKLSLGKREYLTSDTGDFLFPLTTLHDNLVVRLLD  54

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEI+ TG++T  IVEK SWD+ F L+G G+VH+KLQF+L+++ERNRIR  RE+A++K
Sbjct  55    AEGNEIALTGIQTMSIVEKVSWDEKFPLDGGGHVHLKLQFVLNQEERNRIRLKREAAVKK  114

Query  1222  KQDRIRGI----PETATAVG  1175
             KQ+    I    PE AT+ G
Sbjct  115   KQESFSYISNENPEIATSFG  134



>ref|XP_008459327.1| PREDICTED: uncharacterized protein LOC103498484 isoform X2 [Cucumis 
melo]
Length=538

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI++SVLEF +L    P         MGK  Y+T DKGDF+FPLTT RDD+++++QD
Sbjct  1     MPGTIKLSVLEFIDLPELLPSQISIKVS-MGKRHYETSDKGDFSFPLTTLRDDVILIVQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEIS  GV+   IVEKG WDD+F LEG G VH++ QF LSED+R+RIR +RE+A+R+
Sbjct  60    GGGNEISRAGVQAKSIVEKGYWDDLFPLEGGGRVHLQFQFSLSEDDRSRIRIMRETALRR  119

Query  1222  KQ  1217
             KQ
Sbjct  120   KQ  121



>ref|XP_008459318.1| PREDICTED: uncharacterized protein LOC103498484 isoform X1 [Cucumis 
melo]
Length=557

 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI++SVLEF +L    P         MGK  Y+T DKGDF+FPLTT RDD+++++QD
Sbjct  1     MPGTIKLSVLEFIDLPELLPSQISIKVS-MGKRHYETSDKGDFSFPLTTLRDDVILIVQD  59

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GNEIS  GV+   IVEKG WDD+F LEG G VH++ QF LSED+R+RIR +RE+A+R+
Sbjct  60    GGGNEISRAGVQAKSIVEKGYWDDLFPLEGGGRVHLQFQFSLSEDDRSRIRIMRETALRR  119

Query  1222  KQ  1217
             KQ
Sbjct  120   KQ  121



>gb|ACU23282.1| unknown [Glycine max]
Length=127

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L  SS     +    +GK  YQ  DKG+ +FPLT+ RDDL+  + D
Sbjct  1     MPGTIMVSVLEFMDLPLSSSTFIRAS---LGKIEYQVNDKGNLSFPLTSLRDDLIFQILD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISHTGV+  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    SEGNEISHTGVQIKLILEKGVLEDNFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQDRI  1208
             K D +
Sbjct  117   KHDEL  121



>ref|XP_010049551.1| PREDICTED: uncharacterized protein LOC104438166 [Eucalyptus grandis]
Length=212

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S SPPSS+S++V+MGK  +Q  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSPSPPSSMSIQVTMGKREFQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139



>gb|EYU28413.1| hypothetical protein MIMGU_mgv11b019606mg, partial [Erythranthe 
guttata]
Length=342

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -2

Query  1495  MGKTVYQTWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             MGK  YQTWDKGDF+FP+T  R+DLVV L D  GNEI+   ++T  ++EKGSWD++F ++
Sbjct  2     MGKRQYQTWDKGDFSFPITKLREDLVVALLDAGGNEIARADIRTMQVMEKGSWDEVFPID  61

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKK  1220
             G G VHMKLQFILS++ERNRIR VRESA++KK
Sbjct  62    GGGNVHMKLQFILSDEERNRIRIVRESAVKKK  93



>ref|XP_010049736.1| PREDICTED: uncharacterized protein LOC104438315 isoform X5 [Eucalyptus 
grandis]
Length=374

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139



>ref|XP_010049738.1| PREDICTED: uncharacterized protein LOC104438315 isoform X7 [Eucalyptus 
grandis]
Length=360

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139



>ref|XP_010049737.1| PREDICTED: uncharacterized protein LOC104438315 isoform X6 [Eucalyptus 
grandis]
Length=363

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139



>ref|XP_010049735.1| PREDICTED: uncharacterized protein LOC104438315 isoform X4 [Eucalyptus 
grandis]
Length=377

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139



>ref|XP_010262149.1| PREDICTED: uncharacterized protein LOC104600734 [Nelumbo nucifera]
Length=634

 Score =   135 bits (341),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKE--lssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVML  1409
             MPG IQVSVL+  +   S+SS  SSVSLKVSMG+  YQTWDKG+FTFPL T RD+L++ L
Sbjct  1     MPGNIQVSVLDIVDFPSSTSSSSSSVSLKVSMGRREYQTWDKGEFTFPLLTLRDNLIITL  60

Query  1408  QDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAM  1229
              D EG ++S TG++T  IV+KG WDD+F LEG G +HMKL+ ILSE+ER RI  VRESA+
Sbjct  61    LDAEGKQLSRTGIETMSIVQKGFWDDLFPLEGGGKLHMKLKLILSEEERKRIHQVRESAV  120

Query  1228  RKKQDRIRGIP  1196
             +KK    R +P
Sbjct  121   KKKHAGSRLVP  131



>gb|KEH37469.1| hypothetical protein MTR_2g038710 [Medicago truncatula]
Length=625

 Score =   134 bits (337),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L  SS  S  +    MGK  Y+  DKG+F+FP+T+ RDDL+  +QD
Sbjct  1     MPGTIMVSVLEFMDLPFSSSTSIRAS---MGKMEYEINDKGNFSFPITSLRDDLIFKIQD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISH GV   LI++KG W+D+F L G G +H+KLQ ILS++ER+RIR +R+SA++K
Sbjct  58    SEGNEISHAGVHLRLILQKGVWEDMFPL-GEGQLHLKLQVILSDEERDRIRMMRQSALKK  116

Query  1222  KQDRI  1208
             KQD +
Sbjct  117   KQDEL  121



>ref|XP_010049733.1| PREDICTED: uncharacterized protein LOC104438315 isoform X2 [Eucalyptus 
grandis]
Length=573

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/273 (29%), Positives = 133/273 (49%), Gaps = 29/273 (11%)
 Frame = -3

Query  909  TSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTSTE  730
            T S+VRK+IS FE+SL Q + +P  K   +K++P++     S  + + +  +++ +    
Sbjct  296  TPSNVRKVISVFESSLVQ-DMQPHTKAPPAKTEPSM-----SRTEDIANHQFKKIKIEIS  349

Query  729  KSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKD----  562
            K  E     +    +K      +S    + ++   S+K+S    +S   +  + +D    
Sbjct  350  KGAELIPRKVQSPFLKEESQRAQSATGVVPTRTLHSIKSSRDTGQSYLTASESQQDSLHD  409

Query  561  HSGIQTDS---VAEKKGRELGSDISRAIDFQRAASNEKLKSLAS--------ESSGAWIF  415
             +  Q DS   V E+ G+ +GS  S+ I FQRA SN+K+KS++         E SG WIF
Sbjct  410  WASEQHDSSGNVVERSGKAIGSIESQKIKFQRA-SNDKVKSMSCYQGEHDVFERSGVWIF  468

Query  414  PDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQGKQDSLQGTDPTMKGSEKLH-  238
            PD  R+LCITT GK+ ++ +   S E +  + K +IS+      ++     MK  ++   
Sbjct  469  PDESRNLCITTGGKQAMHLMGCCSIETSKWKGKIKISMPENAREVKRNGNEMKKDQRTSY  528

Query  237  -----KPYEGSEKHGSSGPFGQVYFVFIF-SFG  157
                 K    ++ + S GP GQV  V I   FG
Sbjct  529  TKTRPKTDSSTDANPSGGPIGQVMKVAIMVGFG  561



>ref|XP_010049734.1| PREDICTED: uncharacterized protein LOC104438315 isoform X3 [Eucalyptus 
grandis]
Length=562

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (60%), Gaps = 12/99 (12%)
 Frame = -3

Query  564  DHSGIQTDS---VAEKKGRELGSDISRAIDFQRAASNEKLKSLAS--------ESSGAWI  418
            D +  Q DS   V E+ G+ +GS  S+ I FQRA SN+K+KS++         E SG WI
Sbjct  395  DWASEQHDSSGNVVERSGKAIGSIESQKIKFQRA-SNDKVKSMSCYQGEHDVFERSGVWI  453

Query  417  FPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
            FPD  R+LCITT GK+ ++ +   S E +  + K +IS+
Sbjct  454  FPDESRNLCITTGGKQAMHLMGCCSIETSKWKGKIKISM  492



>ref|XP_010049732.1| PREDICTED: uncharacterized protein LOC104438315 isoform X1 [Eucalyptus 
grandis]
Length=576

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139


 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 113/218 (52%), Gaps = 22/218 (10%)
 Frame = -3

Query  909  TSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTSTE  730
            T S+VRK+IS FE+SL Q + +P  K   +K++P++     S  + + +  +++ +    
Sbjct  296  TPSNVRKVISVFESSLVQ-DMQPHTKAPPAKTEPSM-----SRTEDIANHQFKKIKIEIS  349

Query  729  KSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKD----  562
            K  E     +    +K      +S    + ++   S+K+S    +S   +  + +D    
Sbjct  350  KGAELIPRKVQSPFLKEESQRAQSATGVVPTRTLHSIKSSRDTGQSYLTASESQQDSLHD  409

Query  561  HSGIQTDS---VAEKKGRELGSDISRAIDFQRAASNEKLKSLAS--------ESSGAWIF  415
             +  Q DS   V E+ G+ +GS  S+ I FQRA SN+K+KS++         E SG WIF
Sbjct  410  WASEQHDSSGNVVERSGKAIGSIESQKIKFQRA-SNDKVKSMSCYQGEHDVFERSGVWIF  468

Query  414  PDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
            PD  R+LCITT GK+ ++ +   S E +  + K +IS+
Sbjct  469  PDESRNLCITTGGKQAMHLMGCCSIETSKWKGKIKISM  506



>gb|KCW82501.1| hypothetical protein EUGRSUZ_C03893 [Eucalyptus grandis]
Length=651

 Score =   132 bits (332),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 113/218 (52%), Gaps = 22/218 (10%)
 Frame = -3

Query  909  TSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTSTE  730
            T S+VRK+IS FE+SL Q + +P  K   +K++P++     S  + + +  +++ +    
Sbjct  296  TPSNVRKVISVFESSLVQ-DMQPHTKAPPAKTEPSM-----SRTEDIANHQFKKIKIEIS  349

Query  729  KSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKD----  562
            K  E     +    +K      +S    + ++   S+K+S    +S   +  + +D    
Sbjct  350  KGAELIPRKVQSPFLKEESQRAQSATGVVPTRTLHSIKSSRDTGQSYLTASESQQDSLHD  409

Query  561  HSGIQTDS---VAEKKGRELGSDISRAIDFQRAASNEKLKSLAS--------ESSGAWIF  415
             +  Q DS   V E+ G+ +GS  S+ I FQRA SN+K+KS++         E SG WIF
Sbjct  410  WASEQHDSSGNVVERSGKAIGSIESQKIKFQRA-SNDKVKSMSCYQGEHDVFERSGVWIF  468

Query  414  PDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
            PD  R+LCITT GK+ ++ +   S E +  + K +IS+
Sbjct  469  PDESRNLCITTGGKQAMHLMGCCSIETSKWKGKIKISM  506



>gb|KCW82500.1| hypothetical protein EUGRSUZ_C03893 [Eucalyptus grandis]
Length=637

 Score =   132 bits (332),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S+SPPSS+S++V+MGK  YQ  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSTSPPSSMSIQVTMGKREYQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 9/88 (10%)
 Frame = -3

Query  540  SVAEKKGRELGSDISRAIDFQRAASNEKLKSLAS--------ESSGAWIFPDNMRHLCIT  385
            +V E+ G+ +GS  S+ I FQRA SN+K+KS++         E SG WIFPD  R+LCIT
Sbjct  406  NVVERSGKAIGSIESQKIKFQRA-SNDKVKSMSCYQGEHDVFERSGVWIFPDESRNLCIT  464

Query  384  TAGKEVLNFLEDSSTEVNVHQSKTRISL  301
            T GK+ ++ +   S E +  + K +IS+
Sbjct  465  TGGKQAMHLMGCCSIETSKWKGKIKISM  492



>gb|KCW82231.1| hypothetical protein EUGRSUZ_C03649 [Eucalyptus grandis]
Length=576

 Score =   130 bits (328),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+IQ+SVL+   L S SPPSS+S++V+MGK  +Q  D GDF+ PLTT R++LVV L D
Sbjct  1     MPGSIQISVLDIVNLPSPSPPSSMSIQVTMGKREFQIGDDGDFSIPLTTLRENLVVKLLD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              +GNE+S TGV+T L+VEKG WDD F  EG G VH+K++F LSE+E+NRIR +R SA++K
Sbjct  61    PDGNEMSRTGVETKLVVEKGLWDDFFPFEGGGEVHLKIRFTLSEEEQNRIRMMRLSALKK  120

Query  1222  KQDRI----RGIPETATAV  1178
             K   +      + E+A+AV
Sbjct  121   KHGELLNPTSKVTESASAV  139


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 112/218 (51%), Gaps = 22/218 (10%)
 Frame = -3

Query  909  TSSSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVGMGGSLKDPLVSKTWQETQTSTE  730
            T S+VRK+ISAFE+SL Q + +P  K   +K++P++     S  + + +  +++ +    
Sbjct  296  TPSNVRKVISAFESSLVQ-DMQPHTKAPPAKTEPSM-----SRTEDIANHQFKKIKIEIS  349

Query  729  KSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDHS--  556
            K  E          +K      +S    + ++   S+K+S    +S   +  + +D S  
Sbjct  350  KGAELIPRKFQSPFLKEESQRAQSETGVVLTRTLHSIKSSRDTGQSYLTASESQQDSSHD  409

Query  555  --GIQTDS---VAEKKGRELGSDISRAIDFQRAASNEKLKSLAS--------ESSGAWIF  415
                Q DS   V E+ G+ + S  S+ I FQRA SN+K+KS++         E SG WIF
Sbjct  410  WASEQHDSSGNVVERSGKAINSIESQKIKFQRA-SNDKVKSMSCCQGEHDVYERSGVWIF  468

Query  414  PDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISL  301
            PD  R+LCITT GK+ ++ +   S E +  + K RIS+
Sbjct  469  PDESRNLCITTGGKQAMHLMGCCSIETSKWKGKIRISM  506



>ref|XP_003534912.1| PREDICTED: transcriptional regulator ATRX homolog isoform X1 
[Glycine max]
Length=429

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L  SS     +    +GK  YQ  DKG+ +FPLT+ RDDL+  + D
Sbjct  1     MPGTIMVSVLEFMDLPLSSSTFIRAS---LGKIEYQVNDKGNLSFPLTSLRDDLIFQILD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISHTGV+  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    SEGNEISHTGVQIKLILEKGVLEDNFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQDRI  1208
             K D +
Sbjct  117   KHDEL  121



>ref|XP_006587006.1| PREDICTED: transcriptional regulator ATRX homolog isoform X2 
[Glycine max]
 gb|KHN35840.1| hypothetical protein glysoja_013265 [Glycine soja]
Length=439

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L  SS     +    +GK  YQ  DKG+ +FPLT+ RDDL+  + D
Sbjct  1     MPGTIMVSVLEFMDLPLSSSTFIRAS---LGKIEYQVNDKGNLSFPLTSLRDDLIFQILD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEISHTGV+  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    SEGNEISHTGVQIKLILEKGVLEDNFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQDRI  1208
             K D +
Sbjct  117   KHDEL  121



>ref|XP_006597814.1| PREDICTED: uncharacterized protein LOC100780338 isoform X3 [Glycine 
max]
Length=424

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+I VSVLEF         SS S++ S+GK  YQ  DKG+ +FPLT+ RDDL+  +QD
Sbjct  1     MPGSIMVSVLEF---IDLPLSSSTSIRASLGKIEYQVNDKGNLSFPLTSLRDDLIFKIQD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS TGV+  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    AEGNEISRTGVQIKLILEKGVLEDNFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQD  1214
             K +
Sbjct  117   KHE  119



>ref|XP_006597812.1| PREDICTED: uncharacterized protein LOC100780338 isoform X1 [Glycine 
max]
Length=435

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+I VSVLEF         SS S++ S+GK  YQ  DKG+ +FPLT+ RDDL+  +QD
Sbjct  1     MPGSIMVSVLEF---IDLPLSSSTSIRASLGKIEYQVNDKGNLSFPLTSLRDDLIFKIQD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS TGV+  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    AEGNEISRTGVQIKLILEKGVLEDNFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQD  1214
             K +
Sbjct  117   KHE  119



>ref|XP_006597813.1| PREDICTED: uncharacterized protein LOC100780338 isoform X2 [Glycine 
max]
 gb|KHN24613.1| hypothetical protein glysoja_032257 [Glycine soja]
Length=434

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPG+I VSVLEF         SS S++ S+GK  YQ  DKG+ +FPLT+ RDDL+  +QD
Sbjct  1     MPGSIMVSVLEF---IDLPLSSSTSIRASLGKIEYQVNDKGNLSFPLTSLRDDLIFKIQD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS TGV+  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    AEGNEISRTGVQIKLILEKGVLEDNFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQD  1214
             K +
Sbjct  117   KHE  119



>ref|XP_007138733.1| hypothetical protein PHAVU_009G232800g [Phaseolus vulgaris]
 gb|ESW10727.1| hypothetical protein PHAVU_009G232800g [Phaseolus vulgaris]
Length=433

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 9/140 (6%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLEF +L  SS  S  +    +G+  YQ  DK + +FPLT+ RDDL+  +QD
Sbjct  1     MPGTIMVSVLEFMDLPLSSTTSIRAS---LGRIEYQVNDKENLSFPLTSIRDDLIFKIQD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEIS TG++  LI+EKG  +D F L G G++ +KLQFILS++ER+RIR++R+SA++K
Sbjct  58    AEGNEISRTGIQIKLILEKGVLEDKFPL-GGGHLRLKLQFILSDEERDRIRSLRQSALKK  116

Query  1222  KQDRI-----RGIPETATAV  1178
             K D +     RG    + AV
Sbjct  117   KHDELLSSGRRGAESNSRAV  136



>ref|XP_010090038.1| hypothetical protein L484_027269 [Morus notabilis]
 gb|EXB38835.1| hypothetical protein L484_027269 [Morus notabilis]
Length=608

 Score =   125 bits (315),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = -2

Query  1447  PLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSED  1268
             PLTT RD+LVV++QD EGNEISH GV+T LIVEKG WDDIF LEG G+V MKLQF+L+ED
Sbjct  160   PLTTLRDNLVVVIQDSEGNEISHAGVETKLIVEKGIWDDIFPLEGGGHVQMKLQFVLNED  219

Query  1267  ERNRIRNVRESAMRKKQDRIRGIPETATAVG---DFKRGLSECNR*N*RN  1127
             ERNRIR +RESAM+KK   +     ++  V    D K   S C+  + RN
Sbjct  220   ERNRIRLMRESAMKKKHGELLDCRTSSVEVSPNDDTKVASSSCHENSDRN  269


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 122/265 (46%), Gaps = 41/265 (15%)
 Frame = -3

Query  903  SSVRKMISAFETSLSQQERRPLVKTQASKSQPNIVG-------------MGGSLKDPLVS  763
            SSVR MISAFE++LSQ  +  +  +  +K Q N +G             M GS++     
Sbjct  343  SSVRNMISAFESNLSQDTKSHIKPSPPTKVQSNKIGSQSKEAKTENTETMRGSVQ-----  397

Query  762  KTWQETQTSTEKSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKNSLSIRESGTV  583
                E  ++T+  G+ + +      +K  ++++E       S G+S+   +  I  S  V
Sbjct  398  ---LEELSTTKVRGKGTNNTSTKSKLK--FTHKELATEEEKSHGDST--RTPMITTSSAV  450

Query  582  SGRTNKDHSG-----IQTDSVAEKKGRELGSDISRAIDFQRAASNEKLKSLASESSGAWI  418
               +++ HS      I +++      RE+ +   R ++      +      + +S  AWI
Sbjct  451  DNVSDRQHSSKSQTKISSETSPSFTMREITTHNLRPVEHYEDMHD------SFDSFSAWI  504

Query  417  FPDNMRHLCITTAGKEVLNFLED-SSTEVNVHQSKTRISLQGKQDSLQGTDPTMKGSEKL  241
            FPD MR  C+TT GK++++F+    S +  V Q K  IS+  K +   GT   +K S+K 
Sbjct  505  FPDQMRRFCVTTGGKKLMDFVGGYGSIKSEVRQGKVNISIPEKSNDNGGTRNEIKRSKKT  564

Query  240  HKPY----EGSEKHGSSGPFGQVYF  178
            HK      E  +   S+GP GQ+  
Sbjct  565  HKARKSKPESEDVESSTGPVGQIKL  589



>ref|XP_004488038.1| PREDICTED: uncharacterized protein LOC101498984 isoform X6 [Cicer 
arietinum]
Length=329

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLE  +L  SS  S  +    MGK  YQ  DKG+F+FPLT+ RDDL+  + D
Sbjct  1     MPGTIMVSVLELMDLPLSSSTSIRAS---MGKIEYQISDKGNFSFPLTSLRDDLIFKIHD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              + NEIS  G+   LI+EKG W+D+F + G G +H+KLQ ILS++ER RIR +R+SA++K
Sbjct  58    SQENEISSAGIHIRLILEKGVWEDMFPI-GGGKLHLKLQVILSDEERERIRMMRQSALKK  116

Query  1222  KQDRI  1208
             K D +
Sbjct  117   KHDEL  121



>ref|XP_004488035.1| PREDICTED: uncharacterized protein LOC101498984 isoform X3 [Cicer 
arietinum]
Length=346

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLE  +L  SS  S  +    MGK  YQ  DKG+F+FPLT+ RDDL+  + D
Sbjct  1     MPGTIMVSVLELMDLPLSSSTSIRAS---MGKIEYQISDKGNFSFPLTSLRDDLIFKIHD  57

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              + NEIS  G+   LI+EKG W+D+F + G G +H+KLQ ILS++ER RIR +R+SA++K
Sbjct  58    SQENEISSAGIHIRLILEKGVWEDMFPI-GGGKLHLKLQVILSDEERERIRMMRQSALKK  116

Query  1222  KQDRI  1208
             K D +
Sbjct  117   KHDEL  121



>ref|XP_010941459.1| PREDICTED: uncharacterized protein LOC105059534 isoform X3 [Elaeis 
guineensis]
Length=514

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 95/149 (64%), Gaps = 12/149 (8%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvS-------MGKTVYQTWDKGDFTFPLTTFRDD  1424
             MPGTIQVSVLE  +L     P  +    S       MGK  YQ+   GDF+FP+T+  ++
Sbjct  1     MPGTIQVSVLELMDLPPPLAPCQLEDNSSFVYLKVVMGKKEYQSVGGGDFSFPVTSLHEN  60

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             L++ML D EGN IS T  KT  +VEKG  DD+F LEG G VHMKLQF+LSE+ER RIR +
Sbjct  61    LILMLHDMEGNLISRTEFKTRSVVEKGISDDVFPLEGGGSVHMKLQFVLSEEERQRIREM  120

Query  1243  RESAM-RKKQDRIRGIPETA----TAVGD  1172
             R SA+ RK+ + ++G  E+     TA GD
Sbjct  121   RYSALKRKRMELLKGGCESHVSELTAEGD  149



>ref|XP_010941198.1| PREDICTED: uncharacterized protein LOC105059534 isoform X1 [Elaeis 
guineensis]
 ref|XP_010941320.1| PREDICTED: uncharacterized protein LOC105059534 isoform X1 [Elaeis 
guineensis]
Length=837

 Score =   123 bits (308),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = -2

Query  1600  CSVSSPMPGTIQVSVLEFKElssssppssvslkvS-------MGKTVYQTWDKGDFTFPL  1442
             C     MPGTIQVSVLE  +L     P  +    S       MGK  YQ+   GDF+FP+
Sbjct  76    CPRHQTMPGTIQVSVLELMDLPPPLAPCQLEDNSSFVYLKVVMGKKEYQSVGGGDFSFPV  135

Query  1441  TTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDER  1262
             T+  ++L++ML D EGN IS T  KT  +VEKG  DD+F LEG G VHMKLQF+LSE+ER
Sbjct  136   TSLHENLILMLHDMEGNLISRTEFKTRSVVEKGISDDVFPLEGGGSVHMKLQFVLSEEER  195

Query  1261  NRIRNVRESAM-RKKQDRIRGIPETA----TAVGD  1172
              RIR +R SA+ RK+ + ++G  E+     TA GD
Sbjct  196   QRIREMRYSALKRKRMELLKGGCESHVSELTAEGD  230



>ref|XP_008797707.1| PREDICTED: uncharacterized protein LOC103712837 isoform X3 [Phoenix 
dactylifera]
Length=759

 Score =   120 bits (302),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvS-------MGKTVYQTWDKGDFTFPLTTFRDD  1424
             MPGTIQVSVLE  +L     P       S       MGK  YQ+  +G F FP+T+ R++
Sbjct  91    MPGTIQVSVLELVDLPPPPAPCPSEANSSFVSLKVVMGKREYQSVGRGHFLFPVTSLREN  150

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             L++ML D  GN +S T  K  L+VEKG WDD+F LEG G VHMKLQF+LSE+ER RI  +
Sbjct  151   LILMLHDMAGNLLSRTEFKIRLVVEKGIWDDVFPLEGGGSVHMKLQFVLSEEERQRIHEM  210

Query  1243  RESAMRKK  1220
             R SA+++K
Sbjct  211   RYSALKRK  218



>ref|XP_008797706.1| PREDICTED: uncharacterized protein LOC103712837 isoform X2 [Phoenix 
dactylifera]
Length=799

 Score =   120 bits (302),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvS-------MGKTVYQTWDKGDFTFPLTTFRDD  1424
             MPGTIQVSVLE  +L     P       S       MGK  YQ+  +G F FP+T+ R++
Sbjct  91    MPGTIQVSVLELVDLPPPPAPCPSEANSSFVSLKVVMGKREYQSVGRGHFLFPVTSLREN  150

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             L++ML D  GN +S T  K  L+VEKG WDD+F LEG G VHMKLQF+LSE+ER RI  +
Sbjct  151   LILMLHDMAGNLLSRTEFKIRLVVEKGIWDDVFPLEGGGSVHMKLQFVLSEEERQRIHEM  210

Query  1243  RESAMRKK  1220
             R SA+++K
Sbjct  211   RYSALKRK  218



>ref|XP_010545340.1| PREDICTED: uncharacterized protein LOC104817752 isoform X4 [Tarenaya 
hassleriana]
Length=413

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV    ++ +SS  S  S+KVSMGKT YQT D GD++FP+TT RD L V L D
Sbjct  1     MPGTIQVSVSGLSDVQTSSGSSDTSIKVSMGKTEYQTSDSGDYSFPVTTLRDKLTVTLVD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN++S   ++  LI+E+G  ++   +EG G V +KLQF+LSE++R+RIR +R+SA+RK
Sbjct  61    ANGNDVSRREIENRLIIERGFLEEKLQIEGRGNVLLKLQFVLSEEDRDRIRFLRQSALRK  120

Query  1222  KQDRI  1208
             K + +
Sbjct  121   KHEEL  125



>ref|XP_008797705.1| PREDICTED: uncharacterized protein LOC103712837 isoform X1 [Phoenix 
dactylifera]
Length=818

 Score =   120 bits (301),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 83/129 (64%), Gaps = 7/129 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvS-------MGKTVYQTWDKGDFTFPLTTFRDD  1424
             MPGTIQVSVLE  +L     P       S       MGK  YQ+  +G F FP+T+ R++
Sbjct  91    MPGTIQVSVLELVDLPPPPAPCPSEANSSFVSLKVVMGKREYQSVGRGHFLFPVTSLREN  150

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             L++ML D  GN +S T  K  L+VEKG WDD+F LEG G VHMKLQF+LSE+ER RI  +
Sbjct  151   LILMLHDMAGNLLSRTEFKIRLVVEKGIWDDVFPLEGGGSVHMKLQFVLSEEERQRIHEM  210

Query  1243  RESAMRKKQ  1217
             R SA+++K 
Sbjct  211   RYSALKRKH  219



>ref|XP_010545339.1| PREDICTED: uncharacterized protein LOC104817752 isoform X3 [Tarenaya 
hassleriana]
Length=438

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV    ++ +SS  S  S+KVSMGKT YQT D GD++FP+TT RD L V L D
Sbjct  1     MPGTIQVSVSGLSDVQTSSGSSDTSIKVSMGKTEYQTSDSGDYSFPVTTLRDKLTVTLVD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN++S   ++  LI+E+G  ++   +EG G V +KLQF+LSE++R+RIR +R+SA+RK
Sbjct  61    ANGNDVSRREIENRLIIERGFLEEKLQIEGRGNVLLKLQFVLSEEDRDRIRFLRQSALRK  120

Query  1222  KQDRI  1208
             K + +
Sbjct  121   KHEEL  125



>ref|XP_010545337.1| PREDICTED: uncharacterized protein LOC104817752 isoform X1 [Tarenaya 
hassleriana]
Length=442

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV    ++ +SS  S  S+KVSMGKT YQT D GD++FP+TT RD L V L D
Sbjct  1     MPGTIQVSVSGLSDVQTSSGSSDTSIKVSMGKTEYQTSDSGDYSFPVTTLRDKLTVTLVD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN++S   ++  LI+E+G  ++   +EG G V +KLQF+LSE++R+RIR +R+SA+RK
Sbjct  61    ANGNDVSRREIENRLIIERGFLEEKLQIEGRGNVLLKLQFVLSEEDRDRIRFLRQSALRK  120

Query  1222  KQDRI  1208
             K + +
Sbjct  121   KHEEL  125



>ref|XP_010667283.1| PREDICTED: uncharacterized protein LOC104884344 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=814

 Score =   118 bits (295),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 0/158 (0%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI VSVLE   L S    SS+ +KVSMGK  ++  DK + + PL + RD L V + D
Sbjct  1     MPGTIHVSVLELVGLPSPPQSSSMGVKVSMGKKAHEMRDKEETSLPLASLRDILNVSVHD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
              EGNEI+HT V+T  IVEK  WDD+F L+G G + ++L F+L+EDE+NRIR +RESA R+
Sbjct  61    FEGNEIAHTDVETRSIVEKVIWDDLFPLKGGGNIRLRLHFLLTEDEQNRIRIMRESAARR  120

Query  1222  KQDRIRGIPETATAVGDFKRGLSECNR*N*RNFIFSHE  1109
             KQ+ +     +++A+     G S   + + R+ I + E
Sbjct  121   KQEDLLKRRHSSSALAHASVGSSASPQDSIRSQIAAQE  158



>ref|XP_006597815.1| PREDICTED: uncharacterized protein LOC100780338 isoform X4 [Glycine 
max]
Length=414

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  1495  MGKTVYQTWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             +GK  YQ  DKG+ +FPLT+ RDDL+  +QD EGNEIS TGV+  LI+EKG  +D F L 
Sbjct  6     LGKIEYQVNDKGNLSFPLTSLRDDLIFKIQDAEGNEISRTGVQIKLILEKGVLEDNFPL-  64

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKKQD  1214
             G G++ +KLQFILS++ER+RIR++R+SA++KK +
Sbjct  65    GGGHLRLKLQFILSDEERDRIRSLRQSALKKKHE  98



>ref|XP_010545338.1| PREDICTED: uncharacterized protein LOC104817752 isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSV    ++ +SS  S  S+KVSMGKT YQT D GD++FP+TT RD L V L D
Sbjct  1     MPGTIQVSVSGLSDVQTSSGSSDTSIKVSMGKTEYQTSDSGDYSFPVTTLRDKLTVTLVD  60

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN++S    +  LI+E+G  ++   +EG G V +KLQF+LSE++R+RIR +R+SA+RK
Sbjct  61    ANGNDVSRR--ENRLIIERGFLEEKLQIEGRGNVLLKLQFVLSEEDRDRIRFLRQSALRK  118

Query  1222  KQDRI  1208
             K + +
Sbjct  119   KHEEL  123



>ref|XP_010941402.1| PREDICTED: uncharacterized protein LOC105059534 isoform X2 [Elaeis 
guineensis]
Length=717

 Score =   112 bits (281),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvS-------MGKTVYQTWDKGDFTFPLTTFRDD  1424
             MPGTIQVSVLE  +L     P  +    S       MGK  YQ+   GDF+FP+T+  ++
Sbjct  1     MPGTIQVSVLELMDLPPPLAPCQLEDNSSFVYLKVVMGKKEYQSVGGGDFSFPVTSLHEN  60

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIR  1250
             L++ML D EGN IS T  KT  +VEKG  DD+F LEG G VHMKLQF+LSE+ER RIR
Sbjct  61    LILMLHDMEGNLISRTEFKTRSVVEKGISDDVFPLEGGGSVHMKLQFVLSEEERQRIR  118



>ref|XP_008797708.1| PREDICTED: uncharacterized protein LOC103712837 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -2

Query  1495  MGKTVYQTWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             MGK  YQ+  +G F FP+T+ R++L++ML D  GN +S T  K  L+VEKG WDD+F LE
Sbjct  1     MGKREYQSVGRGHFLFPVTSLRENLILMLHDMAGNLLSRTEFKIRLVVEKGIWDDVFPLE  60

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKKQ  1217
             G G VHMKLQF+LSE+ER RI  +R SA+++K 
Sbjct  61    GGGSVHMKLQFVLSEEERQRIHEMRYSALKRKH  93



>ref|XP_010483168.1| PREDICTED: uncharacterized protein LOC104761749 isoform X2 [Camelina 
sativa]
Length=485

 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  1582  MPGTIQVSVL---EFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVM  1412
             MPGTIQVSVL   +  + SS    S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V 
Sbjct  1     MPGTIQVSVLGLIDDVQTSSPPGSSNTSIKVAMGKLEYRTLDSGDYIFPVTRLRENLIVS  60

Query  1411  LQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESA  1232
             L D  GN I H  ++T +I+E G  ++     G+G VH+K+QFIL+E++RNRIR +R+SA
Sbjct  61    LLDVNGNIILHKEIETRMIIESGFLEEKLSFNGYGNVHLKMQFILTEEDRNRIRFLRQSA  120

Query  1231  MRKKQDRI  1208
             +RKK + +
Sbjct  121   LRKKHEEL  128



>ref|XP_010483170.1| PREDICTED: uncharacterized protein LOC104761749 isoform X4 [Camelina 
sativa]
Length=462

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 88/128 (69%), Gaps = 3/128 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssp---pssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVM  1412
             MPGTIQVSVL   +   +S     S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V 
Sbjct  1     MPGTIQVSVLGLIDDVQTSSPPGSSNTSIKVAMGKLEYRTLDSGDYIFPVTRLRENLIVS  60

Query  1411  LQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESA  1232
             L D  GN I H  ++T +I+E G  ++     G+G VH+K+QFIL+E++RNRIR +R+SA
Sbjct  61    LLDVNGNIILHKEIETRMIIESGFLEEKLSFNGYGNVHLKMQFILTEEDRNRIRFLRQSA  120

Query  1231  MRKKQDRI  1208
             +RKK + +
Sbjct  121   LRKKHEEL  128



>ref|XP_010483169.1| PREDICTED: uncharacterized protein LOC104761749 isoform X3 [Camelina 
sativa]
Length=477

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  1582  MPGTIQVSVL---EFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVM  1412
             MPGTIQVSVL   +  + SS    S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V 
Sbjct  1     MPGTIQVSVLGLIDDVQTSSPPGSSNTSIKVAMGKLEYRTLDSGDYIFPVTRLRENLIVS  60

Query  1411  LQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESA  1232
             L D  GN I H  ++T +I+E G  ++     G+G VH+K+QFIL+E++RNRIR +R+SA
Sbjct  61    LLDVNGNIILHKEIETRMIIESGFLEEKLSFNGYGNVHLKMQFILTEEDRNRIRFLRQSA  120

Query  1231  MRKKQDRI  1208
             +RKK + +
Sbjct  121   LRKKHEEL  128



>ref|XP_010483166.1| PREDICTED: uncharacterized protein LOC104761749 isoform X1 [Camelina 
sativa]
 ref|XP_010483167.1| PREDICTED: uncharacterized protein LOC104761749 isoform X1 [Camelina 
sativa]
Length=497

 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 88/128 (69%), Gaps = 3/128 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssp---pssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVM  1412
             MPGTIQVSVL   +   +S     S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V 
Sbjct  1     MPGTIQVSVLGLIDDVQTSSPPGSSNTSIKVAMGKLEYRTLDSGDYIFPVTRLRENLIVS  60

Query  1411  LQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESA  1232
             L D  GN I H  ++T +I+E G  ++     G+G VH+K+QFIL+E++RNRIR +R+SA
Sbjct  61    LLDVNGNIILHKEIETRMIIESGFLEEKLSFNGYGNVHLKMQFILTEEDRNRIRFLRQSA  120

Query  1231  MRKKQDRI  1208
             +RKK + +
Sbjct  121   LRKKHEEL  128



>ref|NP_200496.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED96813.1| uncharacterized protein AT5G56850 [Arabidopsis thaliana]
Length=551

 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssp-pssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPGTIQVSVL   ++ +SSP  S+ S+KV+MGK  YQT D GD+ FP+T  R++L+V L 
Sbjct  1     MPGTIQVSVLGLIDVQTSSPGSSNTSIKVAMGKLEYQTSDSGDYIFPVTRLRENLIVTLL  60

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             D  GN+I    ++T +I+E G  ++     G+G V +K+QF+LSE++RNRIR +R+SA+R
Sbjct  61    DVNGNQILQKEIETRMIIESGFLEEKLSFNGYGNVQLKMQFVLSEEDRNRIRFLRQSALR  120

Query  1225  KKQDRI  1208
             KK + +
Sbjct  121   KKHEEL  126



>ref|XP_009132172.1| PREDICTED: uncharacterized protein LOC103856793 isoform X3 [Brassica 
rapa]
Length=417

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL    +   +  S+ S+KV+MGK  Y+T D GD+ FP+T  +++L+V L D
Sbjct  1     MPGTIQVSVLGL--VDVQTASSTTSIKVAMGKIEYRTSDSGDYIFPVTRLQENLIVTLLD  58

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN I H  ++T +I+E G  ++     G+G V +K+QF+LSE++RNRIR +R+SA+RK
Sbjct  59    VNGNGILHKEIETRMIIESGFLEEKVLFNGYGNVQLKMQFVLSEEDRNRIRFLRQSALRK  118

Query  1222  KQDRIRG---IPETATAVGDFKRGLS  1154
             K   + G     ++ +   D  R LS
Sbjct  119   KHKELVGGSSFTKSKSIASDVMRDLS  144



>ref|XP_009132169.1| PREDICTED: uncharacterized protein LOC103856793 isoform X1 [Brassica 
rapa]
 ref|XP_009132170.1| PREDICTED: uncharacterized protein LOC103856793 isoform X1 [Brassica 
rapa]
Length=473

 Score =   106 bits (264),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL    +   +  S+ S+KV+MGK  Y+T D GD+ FP+T  +++L+V L D
Sbjct  1     MPGTIQVSVLGL--VDVQTASSTTSIKVAMGKIEYRTSDSGDYIFPVTRLQENLIVTLLD  58

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN I H  ++T +I+E G  ++     G+G V +K+QF+LSE++RNRIR +R+SA+RK
Sbjct  59    VNGNGILHKEIETRMIIESGFLEEKVLFNGYGNVQLKMQFVLSEEDRNRIRFLRQSALRK  118

Query  1222  KQDRIRG---IPETATAVGDFKRGLS  1154
             K   + G     ++ +   D  R LS
Sbjct  119   KHKELVGGSSFTKSKSIASDVMRDLS  144



>emb|CDY65438.1| BnaCnng47150D [Brassica napus]
Length=469

 Score =   105 bits (263),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL    +   +  S+ S+KV+MGK  Y+T D GD+ FP+T  +++L+V L D
Sbjct  1     MPGTIQVSVLGL--VDVQTASSTTSIKVAMGKIEYRTSDSGDYIFPVTRLQENLIVTLLD  58

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN + H  ++T +I+E G  ++     G+G V +K+QF+LSE++RNRIR +R+SA+RK
Sbjct  59    VNGNGLLHKEIETRMIIESGFLEEKLSFNGYGNVQLKMQFVLSEEDRNRIRFLRQSALRK  118

Query  1222  KQDRIRG  1202
             K   + G
Sbjct  119   KHKELVG  125



>ref|XP_009132171.1| PREDICTED: uncharacterized protein LOC103856793 isoform X2 [Brassica 
rapa]
Length=469

 Score =   105 bits (262),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL    +   +  S+ S+KV+MGK  Y+T D GD+ FP+T  +++L+V L D
Sbjct  1     MPGTIQVSVLGL--VDVQTASSTTSIKVAMGKIEYRTSDSGDYIFPVTRLQENLIVTLLD  58

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN I H  ++T +I+E G  ++     G+G V +K+QF+LSE++RNRIR +R+SA+RK
Sbjct  59    VNGNGILHKEIETRMIIESGFLEEKVLFNGYGNVQLKMQFVLSEEDRNRIRFLRQSALRK  118

Query  1222  KQDRIRG  1202
             K   + G
Sbjct  119   KHKELVG  125



>emb|CDX88592.1| BnaA03g10570D [Brassica napus]
Length=479

 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL    +   +  S+ S+KV+MGK  Y+T D GD+ FP+T  +++L+V L D
Sbjct  1     MPGTIQVSVLGL--VDVQTASSTTSIKVAMGKIEYRTSDSGDYIFPVTRLQENLIVTLLD  58

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN I H  ++T +I+E G  ++     G+G V +K+QF+LSE++RNRIR +R+SA+RK
Sbjct  59    VNGNGILHKEIETRMIIESGFLEEKVLFNGYGNVQLKMQFVLSEEDRNRIRFLRQSALRK  118

Query  1222  KQDRIRG  1202
             K   + G
Sbjct  119   KHKELVG  125



>ref|XP_006401278.1| hypothetical protein EUTSA_v10013398mg [Eutrema salsugineum]
 gb|ESQ42731.1| hypothetical protein EUTSA_v10013398mg [Eutrema salsugineum]
Length=484

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvsl--kvSMGKTVYQTWDKGDFTFPLTTFRDDLVVML  1409
             MPGTIQVSVL  +++ +SS P S     KV+MGK  Y+T D GD+ FP+T  R++L+V L
Sbjct  1     MPGTIQVSVLGLRDVQTSSSPGSSDTSIKVAMGKLEYRTSDSGDYIFPVTRLRENLIVSL  60

Query  1408  QDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAM  1229
              D  GN I H  ++T +I+E G  ++     G+G V +++QF LSE++RNRIR +R+SA+
Sbjct  61    LDVNGNGILHREIETRMIIESGLLEEKLSFNGYGDVELRMQFFLSEEDRNRIRFLRQSAL  120

Query  1228  RKKQDRI  1208
             RKK + +
Sbjct  121   RKKHEEL  127



>ref|XP_002866168.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42427.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=552

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTIQVSVL    +   +  S+ S+KVSMGK  Y+T D GD+ FP+T  R++L+V L D
Sbjct  1     MPGTIQVSVLGL--IDVHTASSNTSIKVSMGKLEYRTSDSGDYIFPVTRLRENLIVTLLD  58

Query  1402  DEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRK  1223
               GN+I    ++T +I+E G  ++     G+G V +K++F+LSE++RNRIR +R+SA+RK
Sbjct  59    VNGNQILQKEIETRMIIENGFLEEKLSFNGYGNVQLKMEFVLSEEDRNRIRFLRQSALRK  118

Query  1222  KQDRI  1208
             K + +
Sbjct  119   KHEEL  123



>ref|XP_006401277.1| hypothetical protein EUTSA_v10013398mg [Eutrema salsugineum]
 gb|ESQ42730.1| hypothetical protein EUTSA_v10013398mg [Eutrema salsugineum]
Length=469

 Score =   103 bits (258),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvsl--kvSMGKTVYQTWDKGDFTFPLTTFRDDLVVML  1409
             MPGTIQVSVL  +++ +SS P S     KV+MGK  Y+T D GD+ FP+T  R++L+V L
Sbjct  1     MPGTIQVSVLGLRDVQTSSSPGSSDTSIKVAMGKLEYRTSDSGDYIFPVTRLRENLIVSL  60

Query  1408  QDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAM  1229
              D  GN I H  ++T +I+E G  ++     G+G V +++QF LSE++RNRIR +R+SA+
Sbjct  61    LDVNGNGILHREIETRMIIESGLLEEKLSFNGYGDVELRMQFFLSEEDRNRIRFLRQSAL  120

Query  1228  RKKQDRI  1208
             RKK + +
Sbjct  121   RKKHEEL  127



>ref|XP_010451535.1| PREDICTED: uncharacterized protein LOC104733665 isoform X2 [Camelina 
sativa]
Length=484

 Score =   102 bits (255),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 87/128 (68%), Gaps = 3/128 (2%)
 Frame = -2

Query  1582  MPGTIQVSVL---EFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVM  1412
             MPGTIQVSVL   +  + SS    S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V 
Sbjct  1     MPGTIQVSVLGLIDDVQTSSPPGSSNTSIKVAMGKLEYRTSDSGDYIFPVTRLRENLIVS  60

Query  1411  LQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESA  1232
             L D  GN I H  ++  +I+E G  ++     G+G V +K+QF+L+E++RNRIR +R+SA
Sbjct  61    LLDVNGNGILHREIEARMIIESGFLEEKLSFNGYGNVQLKMQFVLTEEDRNRIRFLRQSA  120

Query  1231  MRKKQDRI  1208
             +RKK + +
Sbjct  121   LRKKHEEL  128



>ref|XP_010451532.1| PREDICTED: uncharacterized protein LOC104733665 isoform X1 [Camelina 
sativa]
Length=485

 Score =   102 bits (255),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 87/128 (68%), Gaps = 3/128 (2%)
 Frame = -2

Query  1582  MPGTIQVSVL---EFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVM  1412
             MPGTIQVSVL   +  + SS    S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V 
Sbjct  1     MPGTIQVSVLGLIDDVQTSSPPGSSNTSIKVAMGKLEYRTSDSGDYIFPVTRLRENLIVS  60

Query  1411  LQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESA  1232
             L D  GN I H  ++  +I+E G  ++     G+G V +K+QF+L+E++RNRIR +R+SA
Sbjct  61    LLDVNGNGILHREIEARMIIESGFLEEKLSFNGYGNVQLKMQFVLTEEDRNRIRFLRQSA  120

Query  1231  MRKKQDRI  1208
             +RKK + +
Sbjct  121   LRKKHEEL  128



>ref|XP_006280323.1| hypothetical protein CARUB_v10026246mg [Capsella rubella]
 gb|EOA13221.1| hypothetical protein CARUB_v10026246mg [Capsella rubella]
Length=511

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssp--pssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVML  1409
             MPGTIQ+SVL   +   +S    S+ S+KV+MGK  Y+T D GD+ FP+T  R++L+V L
Sbjct  1     MPGTIQLSVLALIDDVQTSSPGSSNASIKVAMGKLEYRTSDSGDYIFPVTRLRENLIVTL  60

Query  1408  QDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAM  1229
              D  GN I    ++T +I+E G  ++    +G+G V +K+QF+L++++R RIR +R+SA+
Sbjct  61    LDVNGNRILDREIETRMIIESGFLEEKLSFKGYGNVQLKMQFVLTDEDRTRIRFLRQSAL  120

Query  1228  RKKQDRI  1208
             RKK + +
Sbjct  121   RKKHEEL  127



>ref|XP_009395790.1| PREDICTED: uncharacterized protein LOC103980967 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=671

 Score = 98.6 bits (244),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkv-------SMGKTVYQTWDKGDFTFPLTTFRDD  1424
             MPGTIQVSVLE  E   S+ P+    K        + GK  Y+T  K + TFP+ + R++
Sbjct  1     MPGTIQVSVLELMEPPPSASPALTDAKTRSLSLKVTAGKREYETVGKMEITFPVVSLREN  60

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             LVVML   +GN +S    KT  +VE+G  DD F LEG G V ++LQF+LSE+ER RI  +
Sbjct  61    LVVMLYSLDGNLLSRIEFKTLSVVERGMLDDTFPLEGGGTVRVRLQFLLSEEERLRIHEL  120

Query  1243  RESAMRKK  1220
             R S +R+K
Sbjct  121   RNSTLRRK  128



>ref|XP_010443341.1| PREDICTED: uncharacterized protein LOC104726229 isoform X1 [Camelina 
sativa]
Length=499

 Score = 97.4 bits (241),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  1495  MGKTVYQTWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             MGK  Y+T D GD+ FP+T  R++L+V L D  GN I H  ++T +I+E G  ++     
Sbjct  27    MGKLEYRTSDSGDYIFPVTRLRENLIVSLLDVNGNRILHREIETRIIIENGFLEEKLSFN  86

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRI  1208
             G+G V +K+QF+L+E++RNRIR +R+SA+RKK + +
Sbjct  87    GYGNVQLKMQFVLTEEDRNRIRFLRQSALRKKHEEL  122



>ref|XP_009604277.1| PREDICTED: uncharacterized protein LOC104099061 isoform X5 [Nicotiana 
tomentosiformis]
Length=705

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 91/182 (50%), Gaps = 31/182 (17%)
 Frame = -3

Query  609  LSIRESGTVSGRTNKDHS------GIQTD-------SVAEKKGRELGSDISRAIDFQRAA  469
            LS  E+ T S R N  HS       + TD       SVAE++ RE+ S+    +  +R  
Sbjct  479  LSNLETATSSQRINVAHSDMLNANNLATDQDRSSDPSVAEQRSREIRSEALLEVHIERVP  538

Query  468  SNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKT  313
             NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED   EV+ HQ   
Sbjct  539  -NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESTMHLLEDYHAEVDDHQRNK  597

Query  312  RISLQ---GKQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQVY-FVFIFSF  160
            +   Q   GK+     +D T+ KG EK  KP     E S ++G SGP  QV     I  F
Sbjct  598  KPPKQEITGKRGFFHKSDSTIKKGGEKPQKPRKSQTESSGQNGPSGPVRQVIKIAVIVGF  657

Query  159  GV  154
            G+
Sbjct  658  GI  659


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 30/141 (21%)
 Frame = -3

Query  1044  QSTPSTALVGPISEQNAQSKLGVLEIN---------EKKDDNKSSNPEGQ-VSGKTSSSV  895
             +S  +  +V P S+   Q    VL +N         E K  +  + PE Q V  KT SSV
Sbjct  219   ESVSNKKIVDPSSKPEDQGAQYVLRVNVAAKKESVSETKIVDPPNKPEDQRVLEKTPSSV  278

Query  894   RKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD-------------------  775
             R MISAFET L+Q++ RR L + +ASKSQPN+VG+GGSLKD                   
Sbjct  279   RNMISAFETGLAQKKGRRSLTRNRASKSQPNLVGIGGSLKDLDPEDTAMPNKMSALRVER  338

Query  774   PLVSKTWQETQTSTEKSGESS  712
             PL +    E Q + +K GESS
Sbjct  339   PLNNANLPEPQRNIDKRGESS  359



>ref|XP_006854956.1| hypothetical protein AMTR_s00052p00157970, partial [Amborella 
trichopoda]
 gb|ERN16423.1| hypothetical protein AMTR_s00052p00157970, partial [Amborella 
trichopoda]
Length=783

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 72/117 (62%), Gaps = 8/117 (7%)
 Frame = -2

Query  1486  TVYQTWDKGDF---TFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLE  1316
             T  + W  G+     FP+   RD LV+   D E  EI+ T + T  IVE+G+W+D+F L 
Sbjct  73    TFMEVWKLGEAWVSVFPVLNLRDSLVIKFIDRE-KEITQTEIGTLSIVERGNWEDLFELM  131

Query  1315  GWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRGIPETATAVGDFKRGLSECN  1145
             G G +H+KLQFILS++E  R++ +RE+A+RK++D I  +  T     +F+R  + CN
Sbjct  132   GGGRIHLKLQFILSDEEIQRVKAMREAALRKREDEISKMGVTI----EFRRSTNTCN  184



>gb|EMS59832.1| hypothetical protein TRIUR3_17783 [Triticum urartu]
Length=547

 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = -2

Query  1495  MGKTVYQTWDKGD-FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y  +   D F+FP+T+ RD +V+ L D +   +S T +KT  IVE+GS D +F L
Sbjct  164   LGKKDYSGYIGQDGFSFPVTSLRDSMVLSLYDADKELVSKTELKTRSIVEQGSTDVVFSL  223

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRG  1202
             +  G + ++LQF+LS+++R RI+ +R SAM++KQ  + G
Sbjct  224   DSGGQIVLQLQFLLSDEDRKRIQEMRNSAMKRKQQELFG  262



>ref|XP_008797709.1| PREDICTED: uncharacterized protein LOC103712837 isoform X5 [Phoenix 
dactylifera]
 ref|XP_008797710.1| PREDICTED: uncharacterized protein LOC103712837 isoform X5 [Phoenix 
dactylifera]
Length=665

 Score = 82.0 bits (201),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  1414  MLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRES  1235
             ML D  GN +S T  K  L+VEKG WDD+F LEG G VHMKLQF+LSE+ER RI  +R S
Sbjct  1     MLHDMAGNLLSRTEFKIRLVVEKGIWDDVFPLEGGGSVHMKLQFVLSEEERQRIHEMRYS  60

Query  1234  AMRKKQ  1217
             A+++K 
Sbjct  61    ALKRKH  66



>ref|XP_006654168.1| PREDICTED: vitellogenin-1-like [Oryza brachyantha]
Length=420

 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 83/126 (66%), Gaps = 6/126 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPG+I VS  +      S+  + + L+V++GK  Y  +  +G+F+FP+T+ R+ +V++L 
Sbjct  1     MPGSIHVSAAQ-----PSAGTAPLFLQVALGKREYSGSIGQGEFSFPVTSLRESMVMLLY  55

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             + + + IS   +KT  +VE G+ D +F L+  G + ++LQF+LS+++R R++ +R SA++
Sbjct  56    NTDKSLISQAELKTKAVVESGTMDVVFSLDNGGSIILRLQFLLSDEDRKRVQEMRNSAVK  115

Query  1225  KKQDRI  1208
             +KQ  +
Sbjct  116   RKQQEL  121



>gb|EMT31459.1| hypothetical protein F775_06131 [Aegilops tauschii]
Length=1111

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = -2

Query  1495  MGKTVYQTWDKGD-FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y  +   D F+FP+T+ RD +V+ L D +   +S T VKT  IVE GS D +F L
Sbjct  736   LGKKEYSGYIGQDGFSFPVTSLRDSMVLSLYDADKELVSKTEVKTRSIVELGSTDVVFTL  795

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRG  1202
             +  G + ++LQF+LS+++R RI+ +R SAM++KQ  + G
Sbjct  796   DSGGEIILQLQFLLSDEDRKRIQEMRNSAMKRKQQELFG  834


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  1447  PLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSED  1268
             P+T+ RD +V+ L + +   +S T VKT LIVE G+ D IF L+  G + ++LQF LS++
Sbjct  175   PVTSIRDSMVMTLYNADKELVSKTEVKTKLIVELGTMDVIFTLDSGGTIILQLQFFLSDE  234

Query  1267  ERNRIRNVRESAMRKKQDRIRG  1202
             +R RI+ +R S M++KQ  + G
Sbjct  235   DRKRIQEMRNSVMKRKQQELLG  256



>ref|XP_009774393.1| PREDICTED: uncharacterized protein LOC104224437 isoform X3 [Nicotiana 
sylvestris]
Length=674

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 119/252 (47%), Gaps = 29/252 (12%)
 Frame = -3

Query  840  LVKTQASKSQPNIVGMGGS-----LKDPLVSKT-WQETQTSTEKSGESSRSALNPVGIKP  679
            L++ ++S  + +IVG   S     LK+  V    + E  +S + +  S++   N V   P
Sbjct  383  LMRGESSSLEQDIVGTAQSVFHEQLKESSVHIVPFNEAGSSQQDTLRSAKKEPNAVATSP  442

Query  678  SYSYRESTATTISSKGNSSMKNSLSIRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDI  499
                R S   T +S    ++ +S  ++ +   +G+   +       SVAE++  E+ S+ 
Sbjct  443  MDLMRLSNLETATSSQRINVAHSDMLKANNLAAGQDCSNDP-----SVAEQRNTEIRSEA  497

Query  498  SRAIDFQRAASNEKLKSLA--------SESSGAWIFPDNMRHLCITTAGKEVLNFLEDSS  343
               +  +R   NEK K +A        SE+SG WIFPDN   +CITTAG+  ++ LED  
Sbjct  498  LLEVHIERVP-NEKPKLIAYCENEHYDSENSGVWIFPDNKNRVCITTAGESAVHLLEDCH  556

Query  342  TEVNVHQSKTRISLQG---KQDSLQGTDPTM-KGSEKLHKPY----EGSEKHGSSGPFGQ  187
              V+ HQ   +   Q    K+     +D T+ KG EK  KP     E S ++G SGP  Q
Sbjct  557  IGVDDHQRNKKPPKQEITRKRGFFHRSDSTIKKGEEKPQKPRKSQSESSGQNGPSGPIRQ  616

Query  186  VY-FVFIFSFGV  154
            V     I  FG+
Sbjct  617  VIKIAVIVGFGI  628


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (66%), Gaps = 13/102 (13%)
 Frame = -3

Query  1044  QSTPSTALVGPIS---EQNAQSKLGVLEINEKKDD-------NKSSNPEGQ-VSGKTSSS  898
             +S   T +V P +   +Q+AQS L  +++ EKK+        + S+ PE Q V  KT SS
Sbjct  187   ESISQTKIVDPSNKPQDQSAQSMLK-MDVAEKKESVSPKKIVDASNKPEDQGVLEKTPSS  245

Query  897   VRKMISAFETSLSQQE-RRPLVKTQASKSQPNIVGMGGSLKD  775
             VR MISAFE  L+Q++ RR L + +ASKSQPN+VG+GGS+KD
Sbjct  246   VRNMISAFEIGLAQKKGRRSLTRNRASKSQPNLVGIGGSVKD  287



>gb|ACT34065.3| predicted protein [Aegilops tauschii]
Length=419

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -2

Query  1495  MGKTVYQTWDKGD-FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y  +   D F+FP+T+ RD +V+ L D +   +S T VKT  IVE GS D +F L
Sbjct  45    LGKKEYSGYIGQDGFSFPVTSLRDSMVLSLYDADKELVSKT-VKTRSIVELGSTDVVFTL  103

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRG  1202
             +  G + ++LQF+LS+++R RI+ +R SAM++KQ  + G
Sbjct  104   DSGGEIILQLQFLLSDEDRKRIQEMRNSAMKRKQQELFG  142



>ref|XP_010230952.1| PREDICTED: uncharacterized protein LOC100841025 isoform X2 [Brachypodium 
distachyon]
Length=452

 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (58%), Gaps = 20/128 (16%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPG+I +SV+                   +GK  Y+ +  +  F+FP+T+ RD  V+ML+
Sbjct  1     MPGSIHISVV-------------------VGKREYRGSIGQDGFSFPVTSLRDSTVMMLR  41

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             + +   IS T VKT  IVE G+ D +F L+  G + ++LQF+LS ++R R++ +R  AM+
Sbjct  42    NADEELISKTEVKTKEIVELGTMDVVFTLDSGGKIIIQLQFLLSAEDRKRVQEMRNFAMK  101

Query  1225  KKQDRIRG  1202
             +KQ  + G
Sbjct  102   RKQQELLG  109



>ref|XP_010656204.1| PREDICTED: uncharacterized protein LOC100250764 isoform X4 [Vitis 
vinifera]
Length=536

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 159/379 (42%), Gaps = 87/379 (23%)
 Frame = -3

Query  1059  EKLETQSTPSTALVGPISEQNAQSKLGVLE--------INEKKDDNKSSNPEGQVS-GKT  907
             EK E QS  S   V PI      S  G LE         + + ++N + N E Q S  KT
Sbjct  155   EKFEAQSPFSDFPVKPIFSDGTSSMSGCLESVTTDSNSASPRLEENHADNTEKQSSLRKT  214

Query  906   SSSVRKMISAFETSLSQQERR----PLVKTQASKSQPNIVGMG-----------------  790
              S+VRKMISAFE SL+Q+       P+ K+Q++KS   ++  G                 
Sbjct  215   PSNVRKMISAFENSLTQEMGHRVAPPVTKSQSTKSWREVLLRGPQKLKETETWNPKVTQS  274

Query  789   --GSLKDPLVSKTWQETQTSTEKSGE--SSRSALNPVGIKPSYS--YRESTATTISSKGN  628
                  KD ++   +Q+T     K GE   S  A++     P Y+   +E +A  I SK  
Sbjct  275   TSEEAKDFVLKGEFQQTAAYIRKRGEQIDSDRAMDK-SKAPLYAGQSKELSAKHIQSKNE  333

Query  627   SSMKNSLSIR-----------------ESGTVSGRTNKDHSGIQ-----TD-------SV  535
             +    +  +                  E+ T SG        +Q     TD       SV
Sbjct  334   TPSDKNRQVHKKEERKSFENLIKKFPIETATASGGIFNRQGRLQPSNLVTDERDSGGTSV  393

Query  534   AEKKGRELGSDISRAIDFQRAASNE-------KLKSLASESSGAWIFPDNMRHLCITTAG  376
              EK G  + S  S  I  Q    N        K ++ + ES G+ IF D+ R LCITT+ 
Sbjct  394   IEKDGVGVQSRFSSEIISQGGTENTPKPVLYCKDENFSFESCGSCIFLDDTRRLCITTSD  453

Query  375   KEVLNFLEDSSTEVNVHQSKTRI----SLQGKQDSLQGTDPTMKGSEKLHKPYEGS-EKH  211
             K+V+N +  S TEV++HQ K ++     ++GKQ          K S ++ K  E S +  
Sbjct  454   KQVMNVMGGSPTEVDIHQRKLKVHGSSDIEGKQ--------AQKTSHRVKKRLESSADVE  505

Query  210   GSSGPFGQVYFVFIFS-FG  157
              S GP  +   V I + FG
Sbjct  506   PSRGPVARAIKVAIMAGFG  524


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 5/73 (7%)
 Frame = -2

Query  1360  LIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRGIPETAT-  1184
             L+V+KG  DD F L+G G+VHMKLQFILSE+ERNRIR +RESA++KK   + G    ++ 
Sbjct  2     LVVQKGLLDDTFPLKGGGHVHMKLQFILSEEERNRIRIMRESALKKKHSGLSGTASLSSL  61

Query  1183  ----AVGDFKRGL  1157
                  V D +RGL
Sbjct  62    SINKKVSDSQRGL  74



>gb|AFW81319.1| hypothetical protein ZEAMMB73_351941 [Zea mays]
Length=329

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -2

Query  1456  FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFIL  1277
              +FP+T+ R+ +V+ML   +G  IS + +KT  IVE G+ D +F L+  G + +++QF+L
Sbjct  38    LSFPVTSLRESMVIMLYSADGALISKSELKTKEIVESGTMDTVFALDSGGEIVLQIQFLL  97

Query  1276  SEDERNRIRNVRESAMRKKQDRIRG  1202
             ++D+R RI+ +R SAM+ KQ  + G
Sbjct  98    NDDDRKRIQEMRNSAMKMKQQGLLG  122



>ref|XP_003567786.1| PREDICTED: uncharacterized protein LOC100841025 isoform X1 [Brachypodium 
distachyon]
Length=465

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPG+I +S ++          + + L+V +GK  Y+ +  +  F+FP+T+ RD  V+ML+
Sbjct  1     MPGSIHISAIK------PPVTAPLFLQVVVGKREYRGSIGQDGFSFPVTSLRDSTVMMLR  54

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             + +   IS T VKT  IVE G+ D +F L+  G + ++LQF+LS ++R R++ +R  AM+
Sbjct  55    NADEELISKTEVKTKEIVELGTMDVVFTLDSGGKIIIQLQFLLSAEDRKRVQEMRNFAMK  114

Query  1225  KKQDRIRG  1202
             +KQ  + G
Sbjct  115   RKQQELLG  122



>ref|XP_008387889.1| PREDICTED: uncharacterized protein LOC103450333 isoform X1 [Malus 
domestica]
Length=429

 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTFPLTTFRDDLVVMLQD  1403
             MPGTI +SVLEF +L SS           MGK   Q WDKGDFTF LTT R +LV++LQD
Sbjct  1     MPGTINISVLEFMDLPSSPSSPISIKVS-MGKRECQAWDKGDFTFALTTLRGNLVLLLQD  59

Query  1402  DEGNEISHT  1376
              EGNEISH 
Sbjct  60    SEGNEISHA  68



>gb|ACT34066.1| predicted protein [Aegilops tauschii]
Length=371

 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  1456  FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFIL  1277
             F+ P+T+ RD +V+ L + +   +S T VKT LIVE G+ D IF L+  G + ++LQF L
Sbjct  16    FSLPVTSIRDSMVMTLYNADKELVSKTEVKTKLIVELGTMDVIFTLDSGGTIILQLQFFL  75

Query  1276  SEDERNRIRNVRESAMRKKQDRIRG  1202
             S+++R RI+ +R S M++KQ  + G
Sbjct  76    SDEDRKRIQEMRNSVMKRKQQELLG  100



>ref|XP_008654691.1| PREDICTED: uncharacterized protein LOC100275805 isoform X1 [Zea 
mays]
Length=491

 Score = 74.7 bits (182),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -2

Query  1456  FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFIL  1277
              +FP+T+ R+ +V+ML   +G  IS + +KT  IVE G+ D +F L+  G + +++QF+L
Sbjct  38    LSFPVTSLRESMVIMLYSADGALISKSELKTKEIVESGTMDTVFALDSGGEIVLQIQFLL  97

Query  1276  SEDERNRIRNVRESAMRKKQDRIRG  1202
             ++D+R RI+ +R SAM+ KQ  + G
Sbjct  98    NDDDRKRIQEMRNSAMKMKQQGLLG  122



>ref|NP_001143274.1| uncharacterized protein LOC100275805 [Zea mays]
 gb|ACG30274.1| hypothetical protein [Zea mays]
Length=495

 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  1456  FTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFIL  1277
              +FP+T+ R+ +V+ML   +G  IS + +KT  IVE G+ D +F L+  G + +++QF+L
Sbjct  38    LSFPVTSLRESMVIMLYSADGALISKSELKTKEIVESGTMDTVFALDSGGEIVLQIQFLL  97

Query  1276  SEDERNRIRNVRESAMRKKQDRIRG  1202
             ++D+R RI+ +R S M+ KQ  + G
Sbjct  98    NDDDRKRIQEMRNSVMKMKQQELLG  122



>emb|CDP03168.1| unnamed protein product [Coffea canephora]
Length=200

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 71/143 (50%), Gaps = 20/143 (14%)
 Frame = -3

Query  540  SVAEKKGRELGSDISRAIDFQRAASNEKLKSLA--------SESSGAWIFPDNMRHLCIT  385
            S AE KGR   +D S   DF   AS +K KS+         SE+SG WIFP++ +HLCIT
Sbjct  25   SYAEGKGR---TD-STKTDFL-VASIKKSKSVKYCEEENFNSENSGMWIFPNDTKHLCIT  79

Query  384  TAGKEVLNFLEDSSTEVNVHQSKTRISLQGKQDSLQGTDPTMKGSEKLHKP-----YEGS  220
            TAGK V+N L   +TE  +HQ K   S  G      G+D  MK  EK  +       E S
Sbjct  80   TAGKRVMNLLGTGATEAKLHQKKNSSSSSGDTRK-HGSDYEMKKREKESQSPRISRSESS  138

Query  219  EKHGSSGPFGQVY-FVFIFSFGV  154
                S G  GQV     I  FG+
Sbjct  139  SNDASGGLVGQVIKIAIIVGFGI  161



>ref|XP_004961007.1| PREDICTED: uncharacterized protein LOC101759692 isoform X2 [Setaria 
italica]
Length=479

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQ  1406
             MPG+IQ+S  +          + + L+V++GK  Y    ++   + P+T+ R+ +V+ML 
Sbjct  1     MPGSIQISATQ------PPAITPLFLQVAVGKREYSGNIEQDGLSIPVTSLRESMVIMLY  54

Query  1405  DDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMR  1226
             + +   IS + +KT  IVE G+ + +F L   G + +++QF+L++D+R RI+ +R SAM+
Sbjct  55    NADRELISKSELKTKTIVESGTMNAVFTLASGGEIILQVQFLLNDDDRKRIQEMRNSAMK  114

Query  1225  KKQDRIRG  1202
             +KQ  + G
Sbjct  115   RKQQELLG  122



>ref|XP_008459332.1| PREDICTED: uncharacterized protein LOC103498484 isoform X3 [Cucumis 
melo]
Length=496

 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  1372  VKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQ  1217
             V+   IVEKG WDD+F LEG G VH++ QF LSED+R+RIR +RE+A+R+KQ
Sbjct  9     VQAKSIVEKGYWDDLFPLEGGGRVHLQFQFSLSEDDRSRIRIMRETALRRKQ  60



>gb|EEC78803.1| hypothetical protein OsI_19064 [Oryza sativa Indica Group]
Length=542

 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -2

Query  1495  MGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y  +  +G+F+FP+T+ R+ +V++L + + + IS   +K   +VE G+ D  F L
Sbjct  134   LGKREYNGSIGQGEFSFPVTSLRESMVMLLYNADRSLISQAELKMKAVVESGTMDVDFSL  193

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRI  1208
             +  G + ++LQF+LS+++R R++ +R SA+++KQ  +
Sbjct  194   DNGGSIILRLQFLLSDEDRRRVQEMRNSAVKRKQQEL  230



>gb|ACU01767.2| predicted protein [Brachypodium distachyon]
Length=449

 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -2

Query  1495  MGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y+ +  +  F+FP+T+ RD  V+ML++ +   IS T VKT  IVE G+ D +F L
Sbjct  38    VGKREYRGSIGQDGFSFPVTSLRDSTVMMLRNADEELISKT-VKTKEIVELGTMDVVFTL  96

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRG  1202
             +  G + ++LQF+LS ++R R++ +R  AM++KQ  + G
Sbjct  97    DSGGKIIIQLQFLLSAEDRKRVQEMRNFAMKRKQQELLG  135



>gb|EEE62901.1| hypothetical protein OsJ_17706 [Oryza sativa Japonica Group]
Length=541

 Score = 72.0 bits (175),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -2

Query  1495  MGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y  +  +G+F+FP+T+ R+ +V++L + + + IS   +K   +VE G+ D  F L
Sbjct  134   LGKREYNGSIGQGEFSFPVTSLRESMVMLLYNADRSLISQAELKMKAVVESGTMDVDFSL  193

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRI  1208
             +  G + ++LQF+LS+++R R++ +R SA+++KQ  +
Sbjct  194   DNGGSIILRLQFLLSDEDRRRVQEMRNSAVKRKQQEL  230



>ref|XP_004961006.1| PREDICTED: uncharacterized protein LOC101759692 isoform X1 [Setaria 
italica]
Length=491

 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = -2

Query  1495  MGKTVYQ-TWDKGDFTFPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHL  1319
             +GK  Y    ++   + P+T+ R+ +V+ML + +   IS + +KT  IVE G+ + +F L
Sbjct  36    VGKREYSGNIEQDGLSIPVTSLRESMVIMLYNADRELISKSELKTKTIVESGTMNAVFTL  95

Query  1318  EGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRG  1202
                G + +++QF+L++D+R RI+ +R SAM++KQ  + G
Sbjct  96    ASGGEIILQVQFLLNDDDRKRIQEMRNSAMKRKQQELLG  134



>ref|XP_001776937.1| predicted protein [Physcomitrella patens]
 gb|EDQ58186.1| predicted protein [Physcomitrella patens]
Length=610

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 68/126 (54%), Gaps = 17/126 (13%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssp----pssvslkvSMGKTVYQT------------WDKGDFT  1451
             MPGTI+VSVLE  EL           +++ KV++G T+ +T            W+  DF 
Sbjct  1     MPGTIRVSVLEAVELPKGLTDGEIGDNITAKVTLGPTLCKTPPLKIAGGEIQPWNS-DFA  59

Query  1450  FPLTTFRDDLVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSE  1271
             FP+   RD L + + D E   +S T ++   I++KGS D+   L   G +H+++ F LS+
Sbjct  60    FPVMNLRDKLGISICDGEDRSVSQTAIEIPSIIQKGSRDEFVELGEGGRIHLRMSFTLSD  119

Query  1270  DERNRI  1253
             DER +I
Sbjct  120   DERKKI  125



>ref|XP_004288940.1| PREDICTED: uncharacterized protein LOC101298548 [Fragaria vesca 
subsp. vesca]
Length=558

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 75/127 (59%), Gaps = 31/127 (24%)
 Frame = -2

Query  1582  MPGTIQVSVLEFKElssssppssvslkvSMGKTVYQTWDKGDFTF---PLTTFRDDLVVM  1412
             MPGTI VSVL+F +L SSS  SS S+             KG+  F   PLTT RD+++V+
Sbjct  1     MPGTILVSVLKFMDLPSSSSSSSTSI-------------KGEKLFHLNPLTTLRDNMLVI  47

Query  1411  LQDDEGNEISHTG---VKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVR  1241
             LQD EGN+IS TG   ++T  IVEKG WDD F L+G          + ++   N ++  R
Sbjct  48    LQDSEGNQISETGNAAIETRSIVEKGLWDDFFPLKG----------VCTQVSDNFLQ--R  95

Query  1240  ESAMRKK  1220
             ESA++KK
Sbjct  96    ESAVKKK  102



>gb|EMS59833.1| hypothetical protein TRIUR3_17784 [Triticum urartu]
Length=805

 Score = 65.5 bits (158),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 31/116 (27%)
 Frame = -2

Query  1456  FTFPLTTFRDDLVVMLQDDEGNEISHTG-------------------------------V  1370
             F+ P+T+ RD +V+ML + +   +S TG                               V
Sbjct  206   FSLPVTSIRDSMVMMLYNADKELVSKTGLFTVGSLSLSSVYHLHTCQLTCVAIFCKPSEV  265

Query  1369  KTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRIRG  1202
             KT LIVE G+ D +F L+  G + ++LQF LS+++R RI+ +R S M++KQ  + G
Sbjct  266   KTKLIVELGTMDAVFTLDSGGTIILQLQFFLSDEDRKRIQEMRNSVMKRKQQELLG  321



>ref|XP_002441625.1| hypothetical protein SORBIDRAFT_09g030625 [Sorghum bicolor]
 gb|EES20055.1| hypothetical protein SORBIDRAFT_09g030625 [Sorghum bicolor]
Length=382

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -2

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             +V+M+ + +   IS + +KT +IVE G+ D +F L+  G + +++QF+L++D+R RI+ +
Sbjct  1     MVIMMYNADKELISKSELKTKVIVESGTMDAVFTLDSGGKIILQVQFLLNDDDRKRIQEM  60

Query  1243  RESAMRKKQDRIRG  1202
             R SAM++KQ  + G
Sbjct  61    RNSAMKRKQQELLG  74



>ref|XP_009395791.1| PREDICTED: uncharacterized protein LOC103980967 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=612

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  1414  MLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRES  1235
             ML   +GN +S    KT  +VE+G  DD F LEG G V ++LQF+LSE+ER RI  +R S
Sbjct  1     MLYSLDGNLLSRIEFKTLSVVERGMLDDTFPLEGGGTVRVRLQFLLSEEERLRIHELRNS  60

Query  1234  AMRKK  1220
              +R+K
Sbjct  61    TLRRK  65



>ref|XP_004488034.1| PREDICTED: uncharacterized protein LOC101498984 isoform X2 [Cicer 
arietinum]
Length=346

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 84/324 (26%), Positives = 136/324 (42%), Gaps = 63/324 (19%)
 Frame = -3

Query  984  LGVLEINEKKDDNKSSNPEGQVSGKTSSSVRKMISAFETSLSQQERR----PLVKTQAS-  820
            L ++++  ++DD    + +     +T S+V+KMI+AFE+ L +  R     P  K Q S 
Sbjct  5    LNLIQLQHREDDGLQYSEKKAPPKRTPSNVKKMITAFESGLPKDMRSHIKPPPTKYQVSP  64

Query  819  -----KSQPNIVGMGGSL-KDP--LVSKTWQETQTSTEKSGESSRSALNPVGIKPSYSYR  664
                  S+   +    SL K+P   + +  +     T++        LN    K +    
Sbjct  65   IEKEDSSEAQHLEQDKSLNKEPSGFLQERVKSASLVTKEESIGQIKLLNYAQPKNTMQLE  124

Query  663  ESTATTISSKGNSSMKN-------------------SLSIRESGTVSGRTNKDHSGIQTD  541
             ST  T++ + +S+ +N                   + SI E+ TVSG+           
Sbjct  125  LSTTNTLNKQTDSNARNKDQVEETNNNEAYSKHHMMTTSIFETVTVSGKM----------  174

Query  540  SVAEKKGRELGSDISRAIDFQRAASNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLN  361
             + E+K R    ++S     +R   N   K  + ESS AWIFP   R +C+TT+GK V++
Sbjct  175  PLKEEKRRGKAPEVSYETCTERDLDN---KYYSFESSEAWIFPHESRRICVTTSGKSVMD  231

Query  360  FLEDSSTEVNVHQSKTR------ISLQGKQDSLQGTDPTMKGSEKLHKPYE-----GSEK  214
             LE+  T+   H S+ R      +  + K  +  GT       EK+    E      S  
Sbjct  232  ILENEDTK---HLSQQRSFDFPKVENKEKNATYIGTGTEGSKYEKVQDILESKTTTASNN  288

Query  213  HG---SSGPFGQVY-FVFIFSFGV  154
            +G   S GPF QV     I  FG+
Sbjct  289  NGDENSGGPFDQVIKAAIIIGFGL  312



>ref|XP_010049552.1| PREDICTED: uncharacterized protein LOC104438167 isoform X1 [Eucalyptus 
grandis]
Length=124

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 50/101 (50%), Gaps = 7/101 (7%)
 Frame = -3

Query  438  ESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTRISLQGKQDSLQGTDPTM  259
            E SG WIFPD  R+LCITT GK+ ++ +   S E +  + K RIS+      ++     M
Sbjct  12   ERSGVWIFPDESRNLCITTGGKQAMHLMGCCSIETSKWKGKIRISMPENAREVKRNGNEM  71

Query  258  KGSEKLH------KPYEGSEKHGSSGPFGQVYFVFIF-SFG  157
            K  ++        K    ++ + S GP GQV  V I   FG
Sbjct  72   KKDQRTSYTKTRPKTDSSTDANPSGGPIGQVMKVAIMVGFG  112



>ref|XP_004488037.1| PREDICTED: uncharacterized protein LOC101498984 isoform X5 [Cicer 
arietinum]
Length=337

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 125/300 (42%), Gaps = 63/300 (21%)
 Frame = -3

Query  912  KTSSSVRKMISAFETSLSQQERR----PLVKTQAS------KSQPNIVGMGGSL-KDP--  772
            +T S+V+KMI+AFE+ L +  R     P  K Q S       S+   +    SL K+P  
Sbjct  38   RTPSNVKKMITAFESGLPKDMRSHIKPPPTKYQVSPIEKEDSSEAQHLEQDKSLNKEPSG  97

Query  771  LVSKTWQETQTSTEKSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKN-------  613
             + +  +     T++        LN    K +     ST  T++ + +S+ +N       
Sbjct  98   FLQERVKSASLVTKEESIGQIKLLNYAQPKNTMQLELSTTNTLNKQTDSNARNKDQVEET  157

Query  612  ------------SLSIRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDISRAIDFQRAA  469
                        + SI E+ TVSG+            + E+K R    ++S     +R  
Sbjct  158  NNNEAYSKHHMMTTSIFETVTVSGKM----------PLKEEKRRGKAPEVSYETCTERDL  207

Query  468  SNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTR------I  307
             N   K  + ESS AWIFP   R +C+TT+GK V++ LE+  T+   H S+ R      +
Sbjct  208  DN---KYYSFESSEAWIFPHESRRICVTTSGKSVMDILENEDTK---HLSQQRSFDFPKV  261

Query  306  SLQGKQDSLQGTDPTMKGSEKLHKPYE-----GSEKHG---SSGPFGQVY-FVFIFSFGV  154
              + K  +  GT       EK+    E      S  +G   S GPF QV     I  FG+
Sbjct  262  ENKEKNATYIGTGTEGSKYEKVQDILESKTTTASNNNGDENSGGPFDQVIKAAIIIGFGL  321



>ref|XP_004488036.1| PREDICTED: uncharacterized protein LOC101498984 isoform X4 [Cicer 
arietinum]
Length=338

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 125/300 (42%), Gaps = 63/300 (21%)
 Frame = -3

Query  912  KTSSSVRKMISAFETSLSQQERR----PLVKTQAS------KSQPNIVGMGGSL-KDP--  772
            +T S+V+KMI+AFE+ L +  R     P  K Q S       S+   +    SL K+P  
Sbjct  38   RTPSNVKKMITAFESGLPKDMRSHIKPPPTKYQVSPIEKEDSSEAQHLEQDKSLNKEPSG  97

Query  771  LVSKTWQETQTSTEKSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKN-------  613
             + +  +     T++        LN    K +     ST  T++ + +S+ +N       
Sbjct  98   FLQERVKSASLVTKEESIGQIKLLNYAQPKNTMQLELSTTNTLNKQTDSNARNKDQVEET  157

Query  612  ------------SLSIRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDISRAIDFQRAA  469
                        + SI E+ TVSG+            + E+K R    ++S     +R  
Sbjct  158  NNNEAYSKHHMMTTSIFETVTVSGKM----------PLKEEKRRGKAPEVSYETCTERDL  207

Query  468  SNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTR------I  307
             N   K  + ESS AWIFP   R +C+TT+GK V++ LE+  T+   H S+ R      +
Sbjct  208  DN---KYYSFESSEAWIFPHESRRICVTTSGKSVMDILENEDTK---HLSQQRSFDFPKV  261

Query  306  SLQGKQDSLQGTDPTMKGSEKLHKPYE-----GSEKHG---SSGPFGQVY-FVFIFSFGV  154
              + K  +  GT       EK+    E      S  +G   S GPF QV     I  FG+
Sbjct  262  ENKEKNATYIGTGTEGSKYEKVQDILESKTTTASNNNGDENSGGPFDQVIKAAIIIGFGL  321



>ref|XP_010545341.1| PREDICTED: uncharacterized protein LOC104817752 isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010545342.1| PREDICTED: uncharacterized protein LOC104817752 isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010545344.1| PREDICTED: uncharacterized protein LOC104817752 isoform X5 [Tarenaya 
hassleriana]
Length=384

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  1372  VKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRI  1208
             ++  LI+E+G  ++   +EG G V +KLQF+LSE++R+RIR +R+SA+RKK + +
Sbjct  13    IENRLIIERGFLEEKLQIEGRGNVLLKLQFVLSEEDRDRIRFLRQSALRKKHEEL  67



>ref|XP_004488033.1| PREDICTED: uncharacterized protein LOC101498984 isoform X1 [Cicer 
arietinum]
Length=355

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 125/300 (42%), Gaps = 63/300 (21%)
 Frame = -3

Query  912  KTSSSVRKMISAFETSLSQQERR----PLVKTQAS------KSQPNIVGMGGSL-KDP--  772
            +T S+V+KMI+AFE+ L +  R     P  K Q S       S+   +    SL K+P  
Sbjct  38   RTPSNVKKMITAFESGLPKDMRSHIKPPPTKYQVSPIEKEDSSEAQHLEQDKSLNKEPSG  97

Query  771  LVSKTWQETQTSTEKSGESSRSALNPVGIKPSYSYRESTATTISSKGNSSMKN-------  613
             + +  +     T++        LN    K +     ST  T++ + +S+ +N       
Sbjct  98   FLQERVKSASLVTKEESIGQIKLLNYAQPKNTMQLELSTTNTLNKQTDSNARNKDQVEET  157

Query  612  ------------SLSIRESGTVSGRTNKDHSGIQTDSVAEKKGRELGSDISRAIDFQRAA  469
                        + SI E+ TVSG+            + E+K R    ++S     +R  
Sbjct  158  NNNEAYSKHHMMTTSIFETVTVSGKM----------PLKEEKRRGKAPEVSYETCTERDL  207

Query  468  SNEKLKSLASESSGAWIFPDNMRHLCITTAGKEVLNFLEDSSTEVNVHQSKTR------I  307
             N   K  + ESS AWIFP   R +C+TT+GK V++ LE+  T+   H S+ R      +
Sbjct  208  DN---KYYSFESSEAWIFPHESRRICVTTSGKSVMDILENEDTK---HLSQQRSFDFPKV  261

Query  306  SLQGKQDSLQGTDPTMKGSEKLHKPYE-----GSEKHG---SSGPFGQVY-FVFIFSFGV  154
              + K  +  GT       EK+    E      S  +G   S GPF QV     I  FG+
Sbjct  262  ENKEKNATYIGTGTEGSKYEKVQDILESKTTTASNNNGDENSGGPFDQVIKAAIIIGFGL  321



>ref|XP_010451540.1| PREDICTED: uncharacterized protein LOC104733665 isoform X3 [Camelina 
sativa]
Length=408

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  1360  LIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNVRESAMRKKQDRI  1208
             +I+E G  ++     G+G V +K+QF+L+E++RNRIR +R+SA+RKK + +
Sbjct  1     MIIESGFLEEKLSFNGYGNVQLKMQFVLTEEDRNRIRFLRQSALRKKHEEL  51



>gb|AAS98490.1| unknown protein [Oryza sativa Japonica Group]
Length=352

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             +V++L + + + IS   +K   +VE G+ D  F L+  G + ++LQF+LS+++R R++ +
Sbjct  1     MVMLLYNADRSLISQAELKMKAVVESGTMDVDFSLDNGGSIILRLQFLLSDEDRRRVQEM  60

Query  1243  RESAMRKKQ  1217
             R SA+++KQ
Sbjct  61    RNSAVKRKQ  69



>ref|NP_001054981.1| Os05g0232200 [Oryza sativa Japonica Group]
 gb|AAT73657.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16895.1| Os05g0232200 [Oryza sativa Japonica Group]
Length=383

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             +V++L + + + IS   +K   +VE G+ D  F L+  G + ++LQF+LS+++R R++ +
Sbjct  1     MVMLLYNADRSLISQAELKMKAVVESGTMDVDFSLDNGGSIILRLQFLLSDEDRRRVQEM  60

Query  1243  RESAMRKKQ  1217
             R SA+++KQ
Sbjct  61    RNSAVKRKQ  69



>dbj|BAG92602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=383

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  1423  LVVMLQDDEGNEISHTGVKTTLIVEKGSWDDIFHLEGWGYVHMKLQFILSEDERNRIRNV  1244
             +V++L + + + IS   +K   +VE G+ D  F L+  G + ++LQF+LS+++R R++ +
Sbjct  1     MVMLLYNADRSLISQAELKMKAVVESGTMDVDFSLDNGGSIILRLQFLLSDEDRRRVQEM  60

Query  1243  RESAMRKKQ  1217
             R SA+++KQ
Sbjct  61    RNSAVKRKQ  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4803422651472