BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24394_g2_i1 len=456 path=[1677:0-356 8389:357-455]

Length=456
                                                                      Score     E

ref|XP_006346563.1|  PREDICTED: uncharacterized protein LOC102595100  65.5    2e-09   
ref|XP_009774392.1|  PREDICTED: uncharacterized protein LOC104224...  65.5    2e-09   
ref|XP_009774390.1|  PREDICTED: uncharacterized protein LOC104224...  65.5    2e-09   
ref|XP_009604268.1|  PREDICTED: uncharacterized protein LOC104099...  64.7    4e-09   
ref|XP_009604260.1|  PREDICTED: uncharacterized protein LOC104099...  64.7    4e-09   
ref|XP_009604238.1|  PREDICTED: uncharacterized protein LOC104099...  64.7    4e-09   
ref|XP_009604252.1|  PREDICTED: uncharacterized protein LOC104099...  64.7    4e-09   
ref|XP_009774393.1|  PREDICTED: uncharacterized protein LOC104224...  62.8    2e-08   
ref|XP_009604277.1|  PREDICTED: uncharacterized protein LOC104099...  61.6    3e-08   
ref|XP_004243957.2|  PREDICTED: uncharacterized protein LOC101245...  60.1    1e-07   
ref|XP_010324068.1|  PREDICTED: uncharacterized protein LOC101245...  60.1    1e-07   
ref|XP_010324069.1|  PREDICTED: uncharacterized protein LOC101245...  56.6    1e-06   



>ref|XP_006346563.1| PREDICTED: uncharacterized protein LOC102595100 [Solanum tuberosum]
Length=663

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+ IA ++GFGI VLL RQ+ETR ++ +SKD  F T+PD++D+L  SEEQW  L
Sbjct  608  QVMNIALVVGFGILVLLTRQRETRKNDRKSKDFYF-TSPDFMDQLASSEEQWSVL  661



>ref|XP_009774392.1| PREDICTED: uncharacterized protein LOC104224437 isoform X2 [Nicotiana 
sylvestris]
Length=798

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  740  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFIDQLASSEEKWSLL  793



>ref|XP_009774390.1| PREDICTED: uncharacterized protein LOC104224437 isoform X1 [Nicotiana 
sylvestris]
Length=799

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  741  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFIDQLASSEEKWSLL  794



>ref|XP_009604268.1| PREDICTED: uncharacterized protein LOC104099061 isoform X4 [Nicotiana 
tomentosiformis]
Length=708

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  650  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFMDQLASSEEKWSLL  703



>ref|XP_009604260.1| PREDICTED: uncharacterized protein LOC104099061 isoform X3 [Nicotiana 
tomentosiformis]
Length=801

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  743  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFMDQLASSEEKWSLL  796



>ref|XP_009604238.1| PREDICTED: uncharacterized protein LOC104099061 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604244.1| PREDICTED: uncharacterized protein LOC104099061 isoform X1 [Nicotiana 
tomentosiformis]
Length=830

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  772  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFMDQLASSEEKWSLL  825



>ref|XP_009604252.1| PREDICTED: uncharacterized protein LOC104099061 isoform X2 [Nicotiana 
tomentosiformis]
Length=829

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  771  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFMDQLASSEEKWSLL  824



>ref|XP_009774393.1| PREDICTED: uncharacterized protein LOC104224437 isoform X3 [Nicotiana 
sylvestris]
Length=674

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  616  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFIDQLASSEEKWSLL  669



>ref|XP_009604277.1| PREDICTED: uncharacterized protein LOC104099061 isoform X5 [Nicotiana 
tomentosiformis]
Length=705

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+KIA I+GFGI VLL RQKETR ++ +SK+  FA+ PD++D+L  SEE+W  L
Sbjct  647  QVIKIAVIVGFGILVLLTRQKETRRNDRKSKEFYFAS-PDFMDQLASSEEKWSLL  700



>ref|XP_004243957.2| PREDICTED: uncharacterized protein LOC101245860 isoform X3 [Solanum 
lycopersicum]
Length=624

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+ IA ++GFGI VLL RQ+ETR ++ +SK   F  +PD++D+L  SEEQW  L
Sbjct  569  QVMNIALVVGFGILVLLTRQRETRKNDRKSKVVYF-NSPDFMDQLASSEEQWSVL  622



>ref|XP_010324068.1| PREDICTED: uncharacterized protein LOC101245860 isoform X1 [Solanum 
lycopersicum]
Length=663

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+ IA ++GFGI VLL RQ+ETR ++ +SK   F  +PD++D+L  SEEQW  L
Sbjct  608  QVMNIALVVGFGILVLLTRQRETRKNDRKSKVVYF-NSPDFMDQLASSEEQWSVL  661



>ref|XP_010324069.1| PREDICTED: uncharacterized protein LOC101245860 isoform X2 [Solanum 
lycopersicum]
Length=659

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = -2

Query  362  KVLKIAAIIGFGIFVLLNRQKETRTSEARSKDRNFATAPDYVDRLTPSEEQWRTL  198
            +V+ IA ++GFGI VLL RQ+ETR S+       +  +PD++D+L  SEEQW  L
Sbjct  608  QVMNIALVVGFGILVLLTRQRETRKSKVV-----YFNSPDFMDQLASSEEQWSVL  657



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521224059158