BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24393_g1_i1 len=897 path=[875:0-234 1110:235-256 1132:257-312
1188:313-574 1450:575-598 1474:599-636 1512:637-649 1525:650-804
1680:805-896]

Length=897
                                                                      Score     E

ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...    345   1e-115   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    344   1e-115   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        342   9e-115   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...    342   1e-114   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    340   6e-114   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    340   9e-114   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    338   3e-113   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    338   7e-113   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    337   1e-112   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    337   1e-112   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    337   1e-112   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    337   2e-112   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                335   6e-112   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        335   7e-112   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        335   8e-112   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        334   1e-111   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        334   2e-111   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    334   2e-111   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        334   2e-111   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        333   3e-111   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    333   4e-111   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                333   4e-111   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                333   4e-111   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                332   9e-111   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    332   1e-110   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    332   2e-110   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        331   2e-110   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                331   3e-110   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    331   3e-110   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                331   4e-110   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                330   6e-110   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     330   1e-109   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                328   3e-109   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    327   1e-108   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                325   6e-108   
emb|CDP16790.1|  unnamed protein product                                324   1e-107   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    323   2e-107   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    323   2e-107   
emb|CDP16787.1|  unnamed protein product                                323   4e-107   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    323   4e-107   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                323   4e-107   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                322   7e-107   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    322   8e-107   
emb|CDP16788.1|  unnamed protein product                                321   2e-106   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                320   3e-106   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                320   4e-106   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                320   5e-106   
emb|CDP22064.1|  unnamed protein product                                320   8e-106   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             319   1e-105   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                318   4e-105   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                318   4e-105   
emb|CDP10701.1|  unnamed protein product                                317   5e-105   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    317   8e-105   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                317   1e-104   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             316   2e-104   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             315   3e-104   
emb|CDP10695.1|  unnamed protein product                                315   4e-104   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             315   5e-104   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             315   6e-104   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        314   1e-103   
emb|CDP16789.1|  unnamed protein product                                323   1e-103   
emb|CDP10694.1|  unnamed protein product                                313   2e-103   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    313   2e-103   
emb|CDP21353.1|  unnamed protein product                                321   2e-103   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             312   5e-103   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             312   6e-103   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    311   9e-103   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    311   1e-102   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    311   2e-102   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    310   3e-102   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    310   3e-102   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    310   4e-102   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        310   4e-102   
emb|CDP10693.1|  unnamed protein product                                309   7e-102   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 317   1e-101   
emb|CDP16791.1|  unnamed protein product                                309   1e-101   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        308   3e-101   
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg             307   6e-101   
emb|CDP16786.1|  unnamed protein product                                322   8e-101   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein               306   1e-100   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        305   3e-100   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        305   3e-100   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    303   2e-99    
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               302   5e-99    
ref|XP_003590904.1|  Germin-like protein subfamily 1 member             301   9e-99    
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...    301   1e-98    
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    301   2e-98    
emb|CAN80134.1|  hypothetical protein VITISV_012033                     301   2e-98    Vitis vinifera
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     301   2e-98    
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     300   2e-98    
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        300   3e-98    
emb|CBI33612.3|  unnamed protein product                                300   3e-98    
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           300   4e-98    Ricinus communis
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        299   7e-98    Vitis vinifera
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        299   8e-98    Vitis vinifera
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    299   1e-97    
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18          307   1e-97    
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               299   1e-97    
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    299   1e-97    
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    298   1e-97    
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    298   2e-97    
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        298   3e-97    
emb|CBI33610.3|  unnamed protein product                                301   3e-97    
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    298   3e-97    
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        297   3e-97    
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    297   4e-97    
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        297   5e-97    
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                     296   7e-97    
emb|CDP10698.1|  unnamed protein product                                296   7e-97    
emb|CAN72994.1|  hypothetical protein VITISV_000563                     296   9e-97    Vitis vinifera
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    296   1e-96    
emb|CBI33611.3|  unnamed protein product                                298   1e-96    
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...    296   1e-96    
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor     296   1e-96    
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    296   1e-96    
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        295   2e-96    Vitis vinifera
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        295   3e-96    Vitis vinifera
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...    295   3e-96    
emb|CAN66771.1|  hypothetical protein VITISV_022559                     294   3e-96    Vitis vinifera
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        295   4e-96    
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...    295   5e-96    
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...    294   5e-96    
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg             295   5e-96    
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        295   6e-96    Vitis vinifera
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18          295   7e-96    
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...    294   8e-96    
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          294   8e-96    
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    294   1e-95    
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    293   1e-95    
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...    293   2e-95    
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    293   2e-95    
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                     293   2e-95    
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...    293   2e-95    
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    301   3e-95    Vitis vinifera
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...    292   3e-95    
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg             293   3e-95    
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     292   5e-95    
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        291   5e-95    Vitis vinifera
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    291   7e-95    
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    291   9e-95    
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    291   1e-94    
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g             291   1e-94    
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    291   1e-94    
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480          291   1e-94    
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     291   1e-94    
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    298   2e-94    Vitis vinifera
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    290   2e-94    
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18          305   2e-94    
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    290   2e-94    
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    299   2e-94    Vitis vinifera
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...    290   3e-94    
ref|NP_001268128.1|  germin-like protein 5                              289   3e-94    
emb|CBI36791.3|  unnamed protein product                                290   4e-94    
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...    289   5e-94    
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    289   6e-94    
ref|XP_003618164.1|  Germin-like protein subfamily 1 member             289   7e-94    
ref|XP_007030272.1|  RmlC-like cupins superfamily protein               289   7e-94    
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    288   8e-94    
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        289   1e-93    Vitis vinifera
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...    289   1e-93    
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          288   1e-93    
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591    296   1e-93    
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    288   1e-93    
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...    288   1e-93    
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          288   1e-93    
ref|XP_003618167.1|  Germin-like protein                                288   2e-93    
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     288   2e-93    
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    288   2e-93    
ref|XP_003618165.1|  Germin-like protein subfamily 1 member             288   2e-93    
ref|NP_001268198.1|  germin-like protein 3 precursor                    288   2e-93    
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g             288   3e-93    
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               287   3e-93    
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    287   3e-93    
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...    287   4e-93    
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     287   5e-93    
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...    286   5e-93    
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        286   6e-93    
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     286   6e-93    
ref|XP_006375870.1|  germin-like protein 1                              286   7e-93    
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587    297   1e-92    
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    286   1e-92    
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    286   1e-92    
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g             286   1e-92    Populus trichocarpa [western balsam poplar]
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7                286   1e-92    
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    285   2e-92    
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                286   2e-92    
ref|XP_007201690.1|  hypothetical protein PRUPE_ppa016952mg             284   2e-92    
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g             285   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    293   2e-92    Vitis vinifera
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    285   2e-92    
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g             285   3e-92    
ref|XP_003618162.1|  Germin-like protein subfamily 1 member             285   3e-92    
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1        285   3e-92    
gb|AFK49577.1|  unknown                                                 285   4e-92    
emb|CAN70904.1|  hypothetical protein VITISV_032927                     283   4e-92    Vitis vinifera
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...    285   5e-92    
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          284   5e-92    
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    284   6e-92    
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    284   6e-92    
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...    284   6e-92    
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     284   6e-92    
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    283   9e-92    
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...    284   1e-91    
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    283   1e-91    
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18          286   1e-91    
gb|EPS67173.1|  hypothetical protein M569_07603                         283   1e-91    
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584    292   1e-91    
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...    283   1e-91    
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    283   1e-91    
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...    283   1e-91    
emb|CBI36790.3|  unnamed protein product                                282   1e-91    
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1        283   2e-91    
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...    283   2e-91    
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    291   2e-91    
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    290   2e-91    
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                     283   2e-91    
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1        283   2e-91    
emb|CBI36811.3|  unnamed protein product                                282   2e-91    
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                     282   2e-91    
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    282   3e-91    
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...    283   3e-91    
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    282   3e-91    
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    282   3e-91    
emb|CBI36815.3|  unnamed protein product                                282   4e-91    
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    282   4e-91    
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...    281   5e-91    
ref|NP_001267943.1|  germin-like protein 4 precursor                    281   5e-91    
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     281   6e-91    
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    281   6e-91    Vitis vinifera
emb|CBI36816.3|  unnamed protein product                                281   6e-91    
emb|CBI39477.3|  unnamed protein product                                281   8e-91    
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...    281   8e-91    
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g             281   9e-91    
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    281   1e-90    
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18          285   1e-90    
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...    281   1e-90    
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...    280   1e-90    Vitis vinifera
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     280   1e-90    
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...    280   2e-90    
ref|NP_001267940.1|  germin-like protein 1                              280   2e-90    
emb|CAN71140.1|  hypothetical protein VITISV_005471                     280   2e-90    Vitis vinifera
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...    280   2e-90    
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...    280   2e-90    
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             280   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010528770.1|  PREDICTED: germin-like protein subfamily 1 m...    281   3e-90    
gb|KDP23769.1|  hypothetical protein JCGZ_23602                         280   3e-90    
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...    279   4e-90    
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    290   5e-90    Vitis vinifera
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    279   5e-90    
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     279   5e-90    
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...    279   5e-90    
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     279   6e-90    
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1        279   6e-90    
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             278   1e-89    Populus trichocarpa [western balsam poplar]
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...    278   1e-89    
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    278   1e-89    
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     278   1e-89    
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...    278   2e-89    Vitis vinifera
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    279   2e-89    
emb|CAN80133.1|  hypothetical protein VITISV_012032                     278   2e-89    Vitis vinifera
emb|CBI39473.3|  unnamed protein product                                277   2e-89    
ref|XP_007030265.1|  Germin-like protein 2                              277   2e-89    
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...    278   3e-89    Vitis vinifera
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...    277   4e-89    
emb|CAN63889.1|  hypothetical protein VITISV_027218                     276   4e-89    Vitis vinifera
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...    276   4e-89    
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...    276   4e-89    
gb|ADD71877.1|  germin-like protein subfamily 1 member 1 precursor      276   5e-89    Arachis hypogaea [goober]
emb|CBI36810.3|  unnamed protein product                                279   7e-89    
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...    276   1e-88    
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         276   1e-88    
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...    275   1e-88    
ref|XP_006375874.1|  germin-like protein 1                              275   1e-88    
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...    275   2e-88    
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...    275   2e-88    
ref|XP_003604731.1|  Germin-like protein subfamily 1 member             275   2e-88    
emb|CAN63434.1|  hypothetical protein VITISV_033830                     274   3e-88    Vitis vinifera
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        275   3e-88    
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative           273   3e-88    Ricinus communis
ref|XP_003604729.1|  Germin-like protein subfamily 1 member             275   3e-88    
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                     274   3e-88    
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...    274   4e-88    
emb|CBI36812.3|  unnamed protein product                                282   4e-88    
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308    282   6e-88    
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g             273   8e-88    
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         273   1e-87    
ref|XP_008777419.1|  PREDICTED: uncharacterized protein LOC103697358    281   1e-87    
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18          276   1e-87    
ref|XP_003604730.1|  Germin-like protein subfamily 1 member             273   2e-87    
ref|XP_010689305.1|  PREDICTED: germin-like protein                     272   2e-87    
ref|XP_008381868.1|  PREDICTED: germin-like protein subfamily 1 m...    271   2e-87    
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg                273   3e-87    
gb|ACG69479.1|  germin-like protein 3                                   272   3e-87    
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...    271   4e-87    
ref|XP_003593910.1|  Germin-like protein subfamily 1 member             271   4e-87    
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g             272   4e-87    
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor     271   5e-87    
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative              271   6e-87    
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative           270   6e-87    
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...    271   6e-87    
emb|CBI36814.3|  unnamed protein product                                271   7e-87    
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1        271   8e-87    
gb|AFK48994.1|  unknown                                                 271   1e-86    
ref|XP_009402550.1|  PREDICTED: putative germin-like protein 2-1        270   1e-86    
emb|CBI36783.3|  unnamed protein product                                272   1e-86    
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...    275   3e-86    
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2                269   3e-86    
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...    270   3e-86    
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1        268   5e-86    
gb|AFK39387.1|  unknown                                                 269   6e-86    
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...    268   7e-86    
emb|CAN74480.1|  hypothetical protein VITISV_042844                     267   7e-86    
emb|CAB65370.1|  germin-like protein                                    267   8e-86    
sp|P92997.2|GL113_ARATH  RecName: Full=Germin-like protein subfam...    268   9e-86    
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1        268   9e-86    
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    269   1e-85    
ref|XP_009385876.1|  PREDICTED: germin-like protein 12-2                268   1e-85    
ref|XP_007140907.1|  hypothetical protein PHAVU_008G151200g             268   1e-85    
emb|CAN70189.1|  hypothetical protein VITISV_016562                     267   1e-85    
ref|XP_006405659.1|  hypothetical protein EUTSA_v10028158mg             268   1e-85    
ref|NP_001046874.1|  Os02g0491600                                       267   2e-85    
ref|XP_008243693.1|  PREDICTED: germin-like protein subfamily 1 m...    266   2e-85    
emb|CDY15957.1|  BnaA04g11540D                                          267   2e-85    
ref|XP_009129904.1|  PREDICTED: germin-like protein subfamily 1 m...    267   2e-85    
gb|ACG69478.1|  germin-like protein 2                                   267   3e-85    
ref|XP_006286150.1|  hypothetical protein CARUB_v10007709mg             267   3e-85    
ref|NP_198729.1|  germin-like protein subfamily 1 member 16             266   4e-85    
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807    274   4e-85    
gb|AAB51572.1|  germin-like protein                                     266   4e-85    
ref|NP_198732.2|  germin-like protein subfamily 1 member 18             266   5e-85    
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737    280   5e-85    
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...    266   5e-85    
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...    266   5e-85    
ref|NP_001238673.1|  uncharacterized protein LOC100527866 precursor     266   6e-85    
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1        266   6e-85    
ref|NP_198735.1|  germin-like protein 2a                                266   7e-85    
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160          265   7e-85    
gb|EMS56244.1|  Germin-like protein 8-5                                 266   7e-85    
ref|XP_010528696.1|  PREDICTED: germin-like protein subfamily 1 m...    266   7e-85    
gb|KFK33208.1|  hypothetical protein AALP_AA6G344800                    266   8e-85    
ref|XP_002868798.1|  predicted protein                                  266   8e-85    
gb|EMS56245.1|  Germin-like protein 8-5                                 266   8e-85    
gb|EMT02678.1|  Putative germin-like protein 2-1                        265   8e-85    
emb|CDX99669.1|  BnaC04g34260D                                          266   9e-85    
gb|ACT22756.1|  GER4a                                                   266   1e-84    
ref|XP_006285306.1|  hypothetical protein CARUB_v10006688mg             265   1e-84    
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...    265   1e-84    
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1        264   1e-84    
gb|KDP32127.1|  hypothetical protein JCGZ_12588                         265   1e-84    
emb|CAN73847.1|  hypothetical protein VITISV_021638                     265   1e-84    
ref|XP_006840197.1|  hypothetical protein AMTR_s00089p00120230          266   2e-84    
ref|XP_006405663.1|  hypothetical protein EUTSA_v10027916mg             265   2e-84    
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1        263   2e-84    
emb|CDY69099.1|  BnaA07g37570D                                          265   2e-84    
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg             265   3e-84    
emb|CDY11695.1|  BnaC06g13030D                                          264   3e-84    
ref|XP_010435818.1|  PREDICTED: germin-like protein subfamily 1 m...    264   3e-84    
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              264   4e-84    
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     264   4e-84    
ref|XP_006282503.1|  hypothetical protein CARUB_v10006909mg             264   4e-84    
gb|EMS48827.1|  Germin-like protein 8-5                                 264   4e-84    
gb|ACT22757.1|  GER4h                                                   264   4e-84    
gb|EYU20537.1|  hypothetical protein MIMGU_mgv1a013077mg                264   5e-84    
ref|XP_002868743.1|  predicted protein                                  263   6e-84    
ref|XP_002868742.1|  predicted protein                                  263   8e-84    
emb|CAN71631.1|  hypothetical protein VITISV_015711                     262   9e-84    
emb|CDY37880.1|  BnaC04g31260D                                          263   9e-84    
ref|XP_009140209.1|  PREDICTED: germin-like protein subfamily 1 m...    263   1e-83    
ref|NP_001241319.1|  germin-like protein subfamily 1 member 7-lik...    263   1e-83    
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    263   1e-83    
gb|EMT15740.1|  Germin-like protein 8-5                                 263   1e-83    
ref|XP_010441036.1|  PREDICTED: germin-like protein subfamily 1 m...    263   1e-83    
ref|XP_003553909.1|  PREDICTED: germin-like protein subfamily 1 m...    263   1e-83    
ref|XP_010450837.1|  PREDICTED: germin-like protein subfamily 1 m...    263   1e-83    
gb|KHN28990.1|  Germin-like protein subfamily 1 member 7                263   1e-83    
gb|AAG00425.1|AF250933_1  germin A                                      263   1e-83    
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...    263   1e-83    
ref|XP_009125150.1|  PREDICTED: germin-like protein subfamily 1 m...    262   2e-83    
emb|CAB65371.1|  germin-like protein                                    261   2e-83    
ref|XP_006284934.1|  hypothetical protein CARUB_v10006233mg             262   2e-83    
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...    262   2e-83    
emb|CAN74828.1|  hypothetical protein VITISV_002139                     261   2e-83    
emb|CAN61141.1|  hypothetical protein VITISV_024669                     261   2e-83    
gb|EYU38442.1|  hypothetical protein MIMGU_mgv1a013089mg                263   2e-83    
emb|CAB55559.1|  germin-like protein                                    262   2e-83    
ref|XP_002868738.1|  hypothetical protein ARALYDRAFT_494073             262   3e-83    
gb|EMT00501.1|  Germin-like protein 8-5                                 262   3e-83    
ref|XP_010435820.1|  PREDICTED: germin-like protein subfamily 1 m...    262   3e-83    
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...    261   4e-83    
gb|ACT22751.1|  GER4b                                                   261   5e-83    
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                   261   5e-83    
gb|EMS53399.1|  Putative germin-like protein 2-1                        261   5e-83    
gb|ABG46236.1|  germin-like protein 4d                                  261   6e-83    
ref|NP_198727.1|  germin-like protein subfamily 1 member 14             261   6e-83    
ref|XP_009139822.1|  PREDICTED: germin-like protein subfamily 1 m...    261   6e-83    
ref|XP_002523178.1|  Rhicadhesin receptor precursor, putative           260   7e-83    
ref|XP_002868741.1|  predicted protein                                  261   7e-83    
gb|AAM76226.1|  putative germin E protein precursor                     259   8e-83    
gb|ACG69489.1|  germin-like protein 13                                  261   8e-83    
gb|EMS53400.1|  Putative germin-like protein 2-1                        260   8e-83    
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892             261   8e-83    
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...    260   9e-83    
emb|CAA63659.1|  oxalate oxidase-like protein or germin-like protein    261   1e-82    
ref|XP_006414672.1|  hypothetical protein EUTSA_v10026186mg             260   1e-82    
ref|XP_006298965.1|  hypothetical protein CARUB_v10015090mg             260   1e-82    
ref|XP_006845853.1|  hypothetical protein AMTR_s00154p00039580          259   1e-82    
gb|EMT10776.1|  Putative germin-like protein 2-1                        260   1e-82    
gb|KFK33230.1|  hypothetical protein AALP_AA6G347300                    260   2e-82    
emb|CAB55558.1|  germin-like protein                                    260   2e-82    
ref|XP_006442442.1|  hypothetical protein CICLE_v10022152mg             259   3e-82    
gb|EYU20538.1|  hypothetical protein MIMGU_mgv1a012929mg                260   3e-82    
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    259   3e-82    
gb|EMT00456.1|  Germin-like protein 8-5                                 259   3e-82    
gb|EYU39944.1|  hypothetical protein MIMGU_mgv1a020036mg                259   4e-82    
dbj|BAJ98952.1|  predicted protein                                      259   4e-82    
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...    259   4e-82    
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg             259   4e-82    
ref|XP_008358299.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    257   4e-82    
gb|EYU38443.1|  hypothetical protein MIMGU_mgv1a013090mg                259   4e-82    
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    258   4e-82    
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...    259   4e-82    
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg             259   4e-82    
gb|EMT11294.1|  Putative germin-like protein 2-1                        258   5e-82    
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...    259   5e-82    
emb|CDY36875.1|  BnaC08g09720D                                          258   5e-82    
gb|ABG46235.1|  germin-like protein 4c                                  259   5e-82    
gb|AAM76225.1|  putative germin E protein precursor                     257   5e-82    
ref|XP_010662282.1|  PREDICTED: putative germin-like protein 2-1        258   5e-82    
emb|CAN74481.1|  hypothetical protein VITISV_042845                     257   5e-82    
gb|AAT67049.1|  germin-like protein 4                                   259   6e-82    
ref|NP_198728.1|  germin-like protein subfamily 1 member 15             258   6e-82    
ref|NP_198731.1|  germin-like protein subfamily 1 member 17             258   6e-82    
gb|EMT14183.1|  Putative germin-like protein 2-1                        258   6e-82    
ref|XP_009107789.1|  PREDICTED: germin-like protein subfamily 1 m...    258   6e-82    
gb|EYU42478.1|  hypothetical protein MIMGU_mgv1a022407mg                258   7e-82    
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...    258   7e-82    
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        258   7e-82    
ref|XP_007213316.1|  hypothetical protein PRUPE_ppb017655mg             258   7e-82    
gb|KFK24125.1|  hypothetical protein AALP_AAs58370U000100               258   8e-82    
gb|EYU40849.1|  hypothetical protein MIMGU_mgv1a021360mg                258   9e-82    
ref|NP_198734.1|  germin-like protein subfamily 1 member 19             258   9e-82    
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg             258   9e-82    
gb|EMS53398.1|  Putative germin-like protein 2-1                        258   1e-81    
ref|XP_008225644.1|  PREDICTED: putative germin-like protein 2-1        258   1e-81    
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg             258   1e-81    
ref|XP_009362202.1|  PREDICTED: putative germin-like protein 2-1        258   1e-81    
emb|CDP10932.1|  unnamed protein product                                258   1e-81    
gb|KCW61434.1|  hypothetical protein EUGRSUZ_H04164                     258   1e-81    
gb|KDP34916.1|  hypothetical protein JCGZ_09204                         258   1e-81    
ref|XP_006442438.1|  hypothetical protein CICLE_v10024000mg             258   1e-81    
ref|XP_003547666.1|  PREDICTED: germin-like protein subfamily 1 m...    258   1e-81    
gb|EMS61024.1|  Putative germin-like protein 2-1                        257   1e-81    
emb|CAA63023.1|  germin type2                                           258   1e-81    
ref|XP_010024910.1|  PREDICTED: germin-like protein subfamily 1 m...    258   1e-81    
gb|EMS64312.1|  Germin-like protein 8-5                                 258   1e-81    
ref|XP_010672478.1|  PREDICTED: germin-like protein subfamily 1 m...    257   2e-81    
ref|XP_008439537.1|  PREDICTED: putative germin-like protein 2-1        257   2e-81    
emb|CDP14601.1|  unnamed protein product                                257   2e-81    
emb|CDP10106.1|  unnamed protein product                                257   2e-81    
ref|XP_010907049.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    257   2e-81    
gb|AAM76227.1|  putative germin E protein precursor                     256   2e-81    
ref|XP_002443979.1|  hypothetical protein SORBIDRAFT_07g005310          257   2e-81    
emb|CAN72946.1|  hypothetical protein VITISV_034968                     271   2e-81    
ref|XP_002443981.1|  hypothetical protein SORBIDRAFT_07g005330          257   2e-81    
emb|CDP14600.1|  unnamed protein product                                257   2e-81    
ref|XP_008808107.1|  PREDICTED: putative germin-like protein 2-1 ...    256   2e-81    
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...    257   2e-81    
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg             257   2e-81    
ref|NP_001190438.1|  germin-like protein subfamily 1 member 18          257   2e-81    
emb|CDP10107.1|  unnamed protein product                                256   2e-81    
ref|XP_010234322.1|  PREDICTED: germin-like protein 8-8                 257   3e-81    
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          256   3e-81    
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg             257   3e-81    
ref|XP_002870812.1|  predicted protein                                  257   3e-81    
ref|XP_006442436.1|  hypothetical protein CICLE_v10024280mg             256   3e-81    
ref|XP_010450836.1|  PREDICTED: germin-like protein subfamily 1 m...    257   3e-81    
ref|XP_004952510.1|  PREDICTED: putative germin-like protein 2-2-...    256   3e-81    
ref|XP_004952511.1|  PREDICTED: putative germin-like protein 2-2-...    256   3e-81    
ref|XP_008678208.1|  PREDICTED: putative germin-like protein 12-4       256   4e-81    
ref|XP_006443311.1|  hypothetical protein CICLE_v10022142mg             256   4e-81    
gb|KFK23658.1|  germin-like protein                                     256   4e-81    
ref|XP_004134617.1|  PREDICTED: putative germin-like protein 2-1-...    256   4e-81    
ref|XP_008225643.1|  PREDICTED: putative germin-like protein 2-1        256   4e-81    
gb|EMT10792.1|  Putative germin-like protein 2-1                        256   4e-81    
gb|KDO42111.1|  hypothetical protein CISIN_1g027345mg                   256   5e-81    
gb|EMS52045.1|  Germin-like protein 12-2                                256   5e-81    
ref|XP_008383377.1|  PREDICTED: putative germin-like protein 2-1        256   5e-81    
ref|XP_006405675.1|  hypothetical protein EUTSA_v10027915mg             256   6e-81    
ref|XP_002523177.1|  Rhicadhesin receptor precursor, putative           256   6e-81    
ref|XP_007212425.1|  hypothetical protein PRUPE_ppa017161mg             256   6e-81    
gb|EMT01744.1|  Germin-like protein 8-5                                 256   6e-81    
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    255   6e-81    
ref|XP_009124949.1|  PREDICTED: germin-like protein subfamily 1 m...    256   7e-81    
ref|XP_009414514.1|  PREDICTED: putative germin-like protein 2-1        255   7e-81    
ref|XP_002870811.1|  manganese ion binding protein                      256   8e-81    
ref|XP_006477879.1|  PREDICTED: germin-like protein subfamily 1 m...    256   8e-81    
gb|EMT14063.1|  Putative germin-like protein 2-1                        255   8e-81    
ref|XP_006405681.1|  hypothetical protein EUTSA_v10027922mg             255   9e-81    
ref|XP_002452097.1|  hypothetical protein SORBIDRAFT_04g019640          255   1e-80    
ref|XP_002868739.1|  predicted protein                                  255   1e-80    



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA++DSK+AVFVNGK CKNPM+V A+DF   GLN  GN SN LGSAV+AVN
Sbjct  24   DPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDFFRPGLNMAGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLGISLARIDFAPYGLNPPHTHPR TEVL + EGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVLALFEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ+E+KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQIENKVVDYLQSQFWWDNN  228



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDSK AVFVNGK CKNP++V+A+DF   GLN  GN SN LGSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSKNAVFVNGKFCKNPLDVNADDFFRPGLNLAGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLT+ EGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTLFEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++ KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQIDKKVVDYLQSQFWWDNN  228



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   342 bits (878),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS  AVFVNGK CKNPM+V+A+DF   GLN  GN SN LGSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVNADDFFRPGLNLAGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLT+ EGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTLFEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG ++A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPVGLIHFQFNVGKTDAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++ KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQIDKKVVDYLQSQFWWDNN  228



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   342 bits (878),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA++DSK+AVFVNGK CKNPM+V A+DF   GLN  GN SN LGSAV+AVN
Sbjct  24   DPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDFFRPGLNMAGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLGISLARIDFAPYGLNPPHTHPR TEVL + EGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVLALFEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVI IANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVIIIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ+E+KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQIENKVVDYLQSQFWWDNN  228



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score =   340 bits (873),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++DS AAVFVNGKICK+P +V ANDF   GLN PGN SN LGSAV+AVN
Sbjct  24   DPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISLARID+APYGLNPPHTHPR TE+L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  144  LFTKILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQ+QFW++NN
Sbjct  204  VLTKAFQVDKKVVDYLQSQFWWDNN  228



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   340 bits (871),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS  AVFVNGK CKNPM+V A+DF   GLN  GN SN LGSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVTADDFFRPGLNMAGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLGISLARIDFAPYGLNPPHTHPR TEVL + EGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVLALFEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI   
Sbjct  144  LFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPISDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++ KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQIDKKVVDYLQSQFWWDNN  228



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score =   338 bits (868),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++DS AAVFVNGKICK+P +V ANDF   GLN PGN SN LGS V+AVN
Sbjct  24   DPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGSVVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISLARID+APYGLNPPHTHPR TE+L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  144  LFTKILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQ+QFW++NN
Sbjct  204  VLTKAFQVDKKVVDYLQSQFWWDNN  228



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   338 bits (866),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++DS AAVFVNGKICK+P +V ANDF   GLN PGN SN LGSAV+AVN
Sbjct  24   DPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISLARID+APYGLNPPHTHPR TE+L VLEGTLYVGFVLSNP P +KNK
Sbjct  84   VGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNIKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  144  LFTKILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQVE KV++YLQ+QFW++NN
Sbjct  204  VLTKAFQVEKKVVDYLQSQFWWDNN  228



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++DS AAVFVNGKICK+P +V ANDF   GLN PGN SN LGSAV+AVN
Sbjct  24   DPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISLARID+APYGLNPPHTHPR TE+L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  144  LFTKILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ+++KV++YLQ+QFW++NN
Sbjct  204  VLTKAFQLDNKVVDYLQSQFWWDNN  228



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++DS AAVFVNGKICK+P +V ANDF   GLN PGN SN LGS V+AVN
Sbjct  24   DPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGSTVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISLARID+APYGLNPPHTHPR TE+L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  144  LFTKILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQVDNKVVDYLQSQFWWDNN  228



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   337 bits (863),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++DS AAVFVNGKICK+P +V ANDF   GLN PGN SN LGSAV+AVN
Sbjct  24   DPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISLARID+APYGLNPPHTHPR TE+L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  144  LFTKILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV++YLQ+QFW++NN
Sbjct  204  VLTKAFQLDKKVVDYLQSQFWWDNN  228



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   337 bits (863),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDSK+AVFVNGK CK+P +V A+DF   GLN PGN SN LGS V+AVN
Sbjct  24   DPSPLQDFCVAVNDSKSAVFVNGKFCKDPKDVTADDFFRPGLNVPGNTSNQLGSVVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARIDFAPYG NPPHTHPR TEVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLLGLNTLGISLARIDFAPYGFNPPHTHPRGTEVLAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVIT+ANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITVANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVVDYLQSQFWWDNN  228



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   335 bits (859),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK+CKNP  V A DFLF+GLNKPGN SNPLGS V+ VN
Sbjct  26   DPSPLQDFCVAVNDAKSAVFVNGKVCKNPNMVVAKDFLFRGLNKPGNTSNPLGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L V+EGTLYVGFV SNP  P +KN
Sbjct  86   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLYVGFVTSNPADPALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDP I+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  +I+YLQAQFW+N
Sbjct  206  AVLTKAFQVEKNIIDYLQAQFWWN  229



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score =   335 bits (859),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS+A+VFVNGKICK+P  V  +DF F GLNKPGN S+PLGS V+ V 
Sbjct  23   DPSPLQDFCVAVNDSRASVFVNGKICKDPNTVTPDDFFFSGLNKPGNTSSPLGSRVTPVT  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN LAGLNTLGISLARIDFAPYGLNPPHTHPRATE+L ++EG+LYVGFV SNP  P  KN
Sbjct  83   VNQLAGLNTLGISLARIDFAPYGLNPPHTHPRATEILVLVEGSLYVGFVTSNPANPNQKN  142

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTKTLYPGDVFVFP+GLIHFQ NVG++NA+AFAGLSSQNPGVITIANAVFGSDPPI  
Sbjct  143  KLFTKTLYPGDVFVFPEGLIHFQFNVGNTNAVAFAGLSSQNPGVITIANAVFGSDPPISS  202

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLT+AFQV+  VI+YLQ QFW++NN
Sbjct  203  DVLTRAFQVDKNVIKYLQGQFWWDNN  228



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   335 bits (858),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICK+P  V+A+DF   GLN PGN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINVD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVIDYLQSQFWWDNN  228



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   334 bits (857),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICK+P  V+A+DF   GLN PGN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILKPGDVFVFPIGLIHFQFNIGKNKAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVIDYLQSQFWWDNN  228



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICK+P  V+A+DF   GLN PGN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGSDP I+  
Sbjct  144  LFTKILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPSINAD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVIDYLQSQFWWDNN  228



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICKNP  V A DF F GLNKPGN SN +GS V+ VN
Sbjct  24   DPSPLQDFCVAVNDSVAAVFVNGKICKNPNMVVAEDFFFPGLNKPGNTSNQVGSMVTPVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGISLARIDFAPYG+NPPHTHPRA+E+L V+EGTLYVGFV SNP  P MKN
Sbjct  84   VNQLPGLNTLGISLARIDFAPYGINPPHTHPRASEILLVVEGTLYVGFVTSNPANPTMKN  143

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFPQGLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGS+PPI+P
Sbjct  144  KLFTKYLYPGDVFVFPQGLIHFQFNVGKTNALAFAGLSSQNPGVITIANAVFGSNPPINP  203

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQVE  VI+YLQAQFW+N N
Sbjct  204  DVLAKAFQVEKNVIDYLQAQFWWNIN  229



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICK+P  V+A+DF   GLN PGN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMAAVFVNGKICKDPNVVNADDFFKSGLNIPGNTSNQVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISL RID+APYGLNPPHTHPRA EVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VINLHGLNTLGISLVRIDYAPYGLNPPHTHPRAAEVLVVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANA+FGSDPPI+  
Sbjct  144  LFTKILKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAIFGSDPPINED  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KVI+YLQ+QFW++NN
Sbjct  204  VLTKAFQVDKKVIDYLQSQFWWDNN  228



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   333 bits (855),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICK+P  V+A+DF   GLN PGN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLAVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIAN VFGSDP I+  
Sbjct  144  LFTKILKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANTVFGSDPQINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VL KAFQV+ KVI+YLQ+QFW++NNN
Sbjct  204  VLAKAFQVDKKVIDYLQSQFWWDNNN  229



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   333 bits (854),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFVNGKICK+P  V+A+DF   GLN PGN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V NL GLNTLGISL RID+APYGLNPPHTHPRATE+L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVINYLQSQFWWDNN  228



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   333 bits (854),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+++AVFVNGK+CKNP  V A DFLF+GLNKPGN SNPLGS V+ VN
Sbjct  26   DPSPLQDFCVAVNDAQSAVFVNGKVCKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L V+EGTLYVGFV SNP  P +KN
Sbjct  86   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLYVGFVTSNPANPALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNP VITIANAVFGSDPPI+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPSVITIANAVFGSDPPINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQ QFW+N
Sbjct  206  AVLTKAFQVEKNVIDYLQKQFWWN  229



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   333 bits (854),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND++A VFVNGKICKNP  V A DFLF+GLNKPGN SNPLGS V+ V 
Sbjct  25   DPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVT  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L +L+GTLYVGFV SNP  P +KN
Sbjct  85   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK L+PGDVFVFPQGLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPIDP
Sbjct  145  KLFTKYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW+N
Sbjct  205  AVLTKAFQVEKDVIDYLQAQFWWN  228



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   332 bits (852),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+KA VFVNGKICKNP  V A DFLF+GLNKPGN SNPLGS V+ V 
Sbjct  25   DPSPLQDFCVAVNDTKAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVT  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L +L+GTLYVGFV SNP  P +KN
Sbjct  85   VNQLPGLNTLGISAVRIDYAPKGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLF   L+PGDVFVFPQGLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPIDP
Sbjct  145  KLFATYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VIEYLQAQFW+N
Sbjct  205  VVLTKAFQVEKDVIEYLQAQFWWN  228



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   332 bits (851),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDS   VFVNGK+CK+P  V A+DF   GLN  GN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAINDSMTTVFVNGKVCKDPKVVTADDFFKSGLNIAGNTSNNVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARID+APYGLNPPHTHPR TEVLTVLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDP I+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPSINND  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQVE KV+ YLQ+QFW++NN
Sbjct  204  VLAKAFQVEKKVVNYLQSQFWWDNN  228



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS   VFVNGK+CK+P  V A+DF   GLN  GN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTADDFFKSGLNVAGNTSNNVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISL RID+APYGLNPPHTHPR TEVLTVLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            +L KAFQV+ KV++YLQ+QFW++NN
Sbjct  204  ILAKAFQVDKKVVDYLQSQFWWDNN  228



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   331 bits (849),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS   VFVNGK+CK+P  V ANDF   GLN  GN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMTPVFVNGKVCKDPKVVSANDFFKSGLNVAGNTSNNVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISL RID+APYGLNPPHTHPR TEVLTVLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KV+ YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVVHYLQSQFWWDNN  228



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   331 bits (849),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGKICKNP  V A DF+++GLNKPGN SNP+GS V+ VN
Sbjct  25   DPSPLQDFCVAVKDADAAVFVNGKICKNPELVVAEDFIYRGLNKPGNTSNPIGSRVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP  P +KN
Sbjct  85   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLF K LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNPGVIT+ANAVFGSDPPI+P
Sbjct  145  KLFAKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPPINP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW+N
Sbjct  205  AVLTKAFQVEKNVIDYLQAQFWWN  228



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ DSK+AVFVNGK CK+P +V A+DF   GLN PGN SN LGS V AVN
Sbjct  24   DPSPLQDFCVAVEDSKSAVFVNGKFCKDPKDVTADDFFRPGLNVPGNTSNQLGSVVIAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARIDFAPYGLNPPHTHPR TEVL VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLPGLNTLGISLARIDFAPYGLNPPHTHPRGTEVLVVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNP VITIANA+FGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPVVITIANAIFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQVDKKVVDYLQSQFWWDNN  228



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   331 bits (848),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND++A VFVNGKICKNP  V A DFLF+GLNKPGN SNPLGS V+ V 
Sbjct  25   DPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVT  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L +L+GTLYVGFV SNP  P +KN
Sbjct  85   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLF   L+PGDVFVFPQGLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPIDP
Sbjct  145  KLFATYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VIEYLQAQFW+N
Sbjct  205  AVLTKAFQVEKDVIEYLQAQFWWN  228



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   330 bits (846),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGKICKNP  V A DF+++GLNKPGN SNP+GS V+ VN
Sbjct  25   DPSPLQDFCVAVKDADAAVFVNGKICKNPDLVVAEDFIYRGLNKPGNTSNPIGSRVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP  P +KN
Sbjct  85   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFA LSSQNPGVIT+ANAVFGSDPPI+P
Sbjct  145  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITVANAVFGSDPPINP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW+N
Sbjct  205  AVLTKAFQVEKNVIDYLQAQFWWN  228



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS   VFVNGK+CK+P  V A+DF   GLN  GN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTADDFFKSGLNVAGNTSNNVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLN LGISL RID+APYGLNPPHTHPR TEVLTVLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLPGLNALGISLVRIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            +L KAFQV+ KV++YLQ+QFW++NN
Sbjct  204  ILAKAFQVDKKVVDYLQSQFWWDNN  228



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND++A VFVNGKICKNP  V A DFLF+GLNKPGN SNPLGS V+ V 
Sbjct  25   DPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVT  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+AP GLNPPHTHPRATE+L +L+GTLYVGFV SNP  P +KN
Sbjct  85   VNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLF   L+PGDVFVFPQGLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPI+P
Sbjct  145  KLFATYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VIEYLQAQFW+N
Sbjct  205  AVLTKAFQVEKDVIEYLQAQFWWN  228



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   327 bits (838),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDSK  VFVNGK+CK+P  V A+DF   GLNKPGN SN LGS V+AVN
Sbjct  26   DPSPLQDFCVAVNDSKTTVFVNGKVCKDPKLVTADDFFRSGLNKPGNTSNQLGSIVTAVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARIDFA  GLNPPHTHPR TEVL VL+G LYVGFVLSNP P MKNK
Sbjct  86   VNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNK  145

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GLIHFQLNVG +NAIAFAGLSSQN GVIT+ANAVFGSDPPI+  
Sbjct  146  LFTKILNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDD  205

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ K I+ LQ QFW++NN
Sbjct  206  VLAKAFQVDKKAIDDLQEQFWWDNN  230



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   325 bits (833),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGK+CKNP  V A DF F GLNKPGN SNP+GS V+ VN
Sbjct  26   DPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFFPGLNKPGNTSNPVGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN + GLNTLGIS  RID+AP GLNPPHTHPRATE+L V+EGTLYVGFV SNP  P +KN
Sbjct  86   VNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPADPALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNPGVIT+ANAVFGSDP I+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPQINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW N
Sbjct  206  AVLTKAFQVEKNVIDYLQAQFWTN  229



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKIC++P  V   DF FQGLNKPG+ SNPLGS V+AVN
Sbjct  25   DPSPLQDFCVAVPDANAGVFVNGKICQDPKLVKPEDFFFQGLNKPGSTSNPLGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLAR+DFAPYGLNPPHTHPRATE+L VLEGTL VGFV SNP   MKNK
Sbjct  85   VNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNK  144

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GLIHFQ N GHSNA+AFA LSSQNPGVITIANAVFGS+PPI P 
Sbjct  145  LFTKVLNPGDVFVFPEGLIHFQFNQGHSNAVAFAALSSQNPGVITIANAVFGSNPPIYPD  204

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  VI+YLQ+QFW++N+
Sbjct  205  VLTKAFQVDKNVIKYLQSQFWWDNH  229



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA++D+K AVFVNGK CK+P  V A DF   GLN PGN SN +GSAV+ VN
Sbjct  24   DPSPLQDFCVAVDDTKNAVFVNGKFCKDPKLVVAEDFFKSGLNMPGNTSNNVGSAVTPVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARID+APYGLNPPHTHPR TE L VLEGTLYVGFVLSNP P MKNK
Sbjct  84   VNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEFLVVLEGTLYVGFVLSNPGPNMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ N G +  +AFAGLSSQNPGVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNPGKTKTVAFAGLSSQNPGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ+E+KV++YLQ+QFW++NN
Sbjct  204  VLAKAFQIENKVVDYLQSQFWWDNN  228



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS   VFVNGK+CK+P  V A+DF   GLN  GN SN +GSAV+AVN
Sbjct  24   DPSPLQDFCVAVNDSMTTVFVNGKVCKDPKIVTADDFFKSGLNVAGNTSNNVGSAVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARID+APYG+NPPHTHPR TEVLTVLEGTLYVGFVLSNP   MKNK
Sbjct  84   VNNLPGLNTLGISLARIDYAPYGVNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGANMKNK  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L+PGDVFVFP GLIHFQ NVG + A+AFAG +SQN GVITIANAVFGSDPPI+  
Sbjct  144  LFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGFNSQNQGVITIANAVFGSDPPINDD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            +L KAFQV+ KV++YLQ+QFW++NN
Sbjct  204  ILAKAFQVDKKVVDYLQSQFWWDNN  228



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V+A DF F GLN+PG+ SNPLGS V+ VN
Sbjct  23   DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAEDFFFPGLNEPGSTSNPLGSNVTTVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPHTHPRATE+L VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GLIHFQ N GHSNA+AFAGLSSQNPGVITIANAVFGS PPI   
Sbjct  143  LFTKVLNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V++YLQ+QFW++N+
Sbjct  203  VLTKAFQVDKNVVKYLQSQFWWDNH  227



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDSK  VFVNGK+CK P  V A+DF   GLNKPGN SN LGS V+AVN
Sbjct  26   DPSPLQDFCVAVNDSKTTVFVNGKVCKYPKLVTADDFFRSGLNKPGNTSNQLGSIVTAVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARIDFA  GLNPPHTHPR TEVL VL+G LYVGFVLSNP P MKNK
Sbjct  86   VNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNK  145

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQLNVG +NAIAFAGLSSQN GVIT+ANAVFGSDPPI+  
Sbjct  146  LFTKILNSGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDD  205

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ K I+ LQ QFW++NN
Sbjct  206  VLAKAFQVDKKAIDDLQEQFWWDNN  230



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK+CK+P  V A DF   GLNK GN SNPLGS V+ VN
Sbjct  26   DPSPLQDFCVAVNDAKSAVFVNGKVCKDPNMVVAEDFFLSGLNKLGNTSNPLGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN L GLNTLGIS  RID+A  GLNPPHTHPRATE+L VLEGTLYVGFV SNP  P +KN
Sbjct  86   VNQLPGLNTLGISAVRIDYALNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ N G +NA+AFAGLSSQNPGVITIANAVFGSDP I+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNAGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW+N
Sbjct  206  AVLTKAFQVEKNVIDYLQAQFWWN  229



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score =   322 bits (826),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGKICK+P  V A DF   GLNKPGN SNP+GS V+  N
Sbjct  25   DPSPLQDFCVAVKDADAAVFVNGKICKDPNMVVAEDFFLSGLNKPGNTSNPVGSRVTPAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN +AGLNTLGIS  RID+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP  P +KN
Sbjct  85   VNQIAGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG + A+AFA LSSQNPGVIT+ANAVFGSDPPI+ 
Sbjct  145  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTKAVAFAALSSQNPGVITVANAVFGSDPPINR  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW+N
Sbjct  205  AVLTKAFQVEKNVIDYLQAQFWWN  228



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   322 bits (826),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+N+SK  VFVNGK+CK+P  V A+DF   GLNKPGN SN LGS V+AVN
Sbjct  26   DPSPLQDFCVAVNESKETVFVNGKVCKDPKLVTADDFFRPGLNKPGNTSNQLGSIVTAVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARIDFA  GLNPPHTHPR TEVL VL+G LYVGFVLSNP P MKNK
Sbjct  86   VNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNK  145

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GL+HFQLNVG +NAIAFAGLSSQN GVIT+ANAVFGSDPPI+  
Sbjct  146  LFTKILNPGDVFVFPEGLVHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDD  205

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+ LQ Q W++NN
Sbjct  206  VLAKAFQVDKKVIDNLQEQIWWDNN  230



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLNKPG+ +NPLGS V+AVN
Sbjct  23   DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANPLGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPH HPRATEVL VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N GHSNA+AFAGL SQNPGVITIANAVFGSDPPI P 
Sbjct  143  LFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV + VI+ LQ+QFW++NN
Sbjct  203  VLTKAFQVGNDVIKKLQSQFWWDNN  227



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGK+CKNP  V A DF   GLNKPGN SNP+GS V+  N
Sbjct  25   DPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFLSGLNKPGNTSNPVGSRVTPAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN + GLNTLGIS  RID+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP  P +KN
Sbjct  85   VNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPADPTLKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFA LSSQNPGVITIANAVFGSDP I+ 
Sbjct  145  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPTINT  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW+N
Sbjct  205  AVLTKAFQVEKNVIDYLQAQFWWN  228



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D  AAVFVNGK+CKNP  V A DF F GLNKPGN SN +GS V+ VN
Sbjct  26   DPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN + GLNTLGIS  RID+AP GLNPPHTHPRATE+L V+EGTLYVGFV SNP  P +KN
Sbjct  86   VNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPADPALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNPGVIT+ANAVFGSDP I+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQVE  VI+YLQAQFW + N
Sbjct  206  AVLTKAFQVEKNVIDYLQAQFWTDIN  231



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score =   320 bits (820),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGK+CKNP  V A +F F GLNK GN SNP+GS V+ VN
Sbjct  25   DPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAENFFFPGLNKSGNTSNPVGSRVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN + GLNTLGIS  RID+AP GLNPPHTHPRATE+L V+EGTLYVGFV SNP  P +KN
Sbjct  85   VNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPANPALKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFA LSSQNPGVITIAN VFGSDPPI+P
Sbjct  145  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANTVFGSDPPINP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQV+  VI+YLQAQFW+N
Sbjct  205  AVLTKAFQVKKNVIDYLQAQFWWN  228



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   320 bits (819),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V+A DF F GL +PG+ SNPLGS V+AVN
Sbjct  23   DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAKDFFFPGLKEPGSTSNPLGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPHTHPRATE+L VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GLIHFQ N GHS+A+AFAGLSSQNPGVITIANAVFGS PPI   
Sbjct  143  LFTKVLNPGDVFVFPEGLIHFQFNKGHSSAVAFAGLSSQNPGVITIANAVFGSKPPISRD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V++YLQ+QFW +N+
Sbjct  203  VLTKAFQVDKNVVKYLQSQFWRDNH  227



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 176/205 (86%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK CK+P  V+ANDF F GL  P N  NP+GS V+AVN
Sbjct  25   DPSPLQDFCVALNDTKSAVFVNGKFCKDPKLVNANDFFFSGLQNPRNTQNPVGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NLAGLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  142  LFTKVLNEGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++ +++YLQ QFWY+NN
Sbjct  202  VLAKAFQVDNNLVDYLQKQFWYDNN  226



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   318 bits (815),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ AAVFVNGK+CKNP  V A DF F GLNKPGN SN +GS V+ VN
Sbjct  26   DPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN + GLNTLGIS  RID+AP G NPPHTHPRATE+L V+EGTLYVGFV SNP  P +KN
Sbjct  86   VNQIPGLNTLGISAVRIDYAPNGSNPPHTHPRATEILVVMEGTLYVGFVTSNPANPALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNPGVIT+ANAVFGSDP I+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQVE  VI+YLQAQFW + N
Sbjct  206  AVLTKAFQVEKNVIDYLQAQFWTDIN  231



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score =   318 bits (815),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D  AAVFVNGK+CKNP  V A DF F GLNKPGN SN +GS V+ VN
Sbjct  26   DPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVGSRVTPVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPP-GMKN  404
            VN + GLNTLGIS  RID+AP GLNPPHTHPRATE+L V+EGTLYVGFV SNP    +KN
Sbjct  86   VNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILFVMEGTLYVGFVTSNPADLALKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFG DPPI+P
Sbjct  146  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGLDPPINP  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTKAFQVE  VI+YLQAQFW N
Sbjct  206  AVLTKAFQVEKNVIDYLQAQFWTN  229



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K AVFVNGKICK+P  V ANDF FQGLNKP N +N  GS V+AVN
Sbjct  23   DPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFFFQGLNKPRNTANRQGSTVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLG+SLAR+DFAP+GLNPPHTHPRATEVL VLEGTL+VGFV SNPP  MKN+
Sbjct  83   VNNLAGLNTLGVSLARLDFAPHGLNPPHTHPRATEVLFVLEGTLHVGFVTSNPPNNMKNQ  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTKTL PGDVFVFP+GLIHFQ N G + A+AFAG  SQNPGVITIANAVFGSDP I P 
Sbjct  143  LFTKTLNPGDVFVFPEGLIHFQFNFGKTKAVAFAGFGSQNPGVITIANAVFGSDPLISPA  202

Query  220  VLTKAFQVEDKVIEYLQAQFW  158
            VL KAFQV+ KVI+ L+ QF 
Sbjct  203  VLAKAFQVDKKVIDLLEGQFL  223



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score =   317 bits (813),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 3/208 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPL+ FCVA+NDSK  VFVNGK+CK+P  V A+DF   GLNKPGN SN LGS V+AVN
Sbjct  26   DPSPLKIFCVAVNDSKTTVFVNGKVCKDPKLVTADDFFRSGLNKPGNTSNQLGSIVTAVN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNTLGISLARIDFA +GLNPPHTHPR TEVL VL+G LYVGFVLSNP P MKNK
Sbjct  86   VNNLPGLNTLGISLARIDFARHGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNK  145

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSD---PPI  230
            LFTK L PGDVFVFP+GLIHFQLNVG +NAIAFAGLSSQN GVIT+ANAVFGSD   PPI
Sbjct  146  LFTKILNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPHPPI  205

Query  229  DPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            +  VL+KAFQV+ KVI+ LQ +FW++NN
Sbjct  206  NDNVLSKAFQVDKKVIDDLQEEFWWDNN  233



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ ++ AAVFVNGKICK+P  V A DF   GLNKPGN  NP+GS V+  N
Sbjct  25   DPSPLQDFCVAVKEADAAVFVNGKICKDPNMVVAEDFFLSGLNKPGNTLNPVGSRVTPAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            VN + GLNTLGIS  RID+AP GLNPPHTHPRATE+L V EGTLYVGFV SNP  P +KN
Sbjct  85   VNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVSEGTLYVGFVTSNPANPAIKN  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP+GLIHFQ NVG +NA+AFA LSSQNPGVITIANAVFGSDPPI+P
Sbjct  145  KLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPPINP  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYN  152
             VLTK FQVE  VI+YLQAQFW+N
Sbjct  205  AVLTKGFQVEKNVIDYLQAQFWWN  228



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 173/205 (84%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D K  VFVNGK CK+P   +ANDF F GL  P N  NP+GS V+AVN
Sbjct  25   DPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPVGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NLAGLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  142  LFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++KV++YLQ QFWY+NN
Sbjct  202  VLTKAFQVDNKVVDYLQKQFWYDNN  226



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 173/205 (84%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D K+ VFVNGK CK+P   +ANDF F GL  P N  NP+GS V+AVN
Sbjct  25   DPSPLQDFCVAVKDIKSGVFVNGKFCKDPKLANANDFFFSGLQNPRNTKNPVGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NL GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDNLEGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  142  LFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++KV++YLQ QFWY+NN
Sbjct  202  VLTKAFQVDNKVVDYLQKQFWYDNN  226



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   315 bits (807),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K AVFVNGKICK+P  V ANDFLFQGLNKP N +N  GS V+AVN
Sbjct  23   DPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFLFQGLNKPRNTANRQGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLG+SLAR+DFAP+GLNPPHTHPRATEVL VLEGTL+VGFV SNPP  MKN+
Sbjct  83   VNNLAGLNTLGVSLARLDFAPFGLNPPHTHPRATEVLFVLEGTLHVGFVTSNPPNNMKNQ  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTKTL PGDVFVFP+GLIHFQ N G +NA+AF+   SQNPGVITIANAVFGSDP I   
Sbjct  143  LFTKTLNPGDVFVFPEGLIHFQFNFGKTNAVAFSAFGSQNPGVITIANAVFGSDPLISAD  202

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VL KAFQV+ KVI  L+AQF
Sbjct  203  VLAKAFQVDKKVIYLLEAQF  222



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 172/205 (84%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK CK+P   +ANDF F GL  P N  NPLGS V+AVN
Sbjct  25   DPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPLGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NL GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIA AVFGS PPI+P 
Sbjct  142  LFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIAKAVFGSQPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+D V++ LQ QFWY+NN
Sbjct  202  VLAKAFQVDDNVVDNLQKQFWYDNN  226



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   315 bits (806),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 172/205 (84%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK CK+P   +ANDF F GL  P N  NPLGS V+AVN
Sbjct  25   DPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPLGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NL GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIA AVFGS PPI+P 
Sbjct  142  LFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIAKAVFGSQPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+D V++ LQ QFWY+NN
Sbjct  202  VLAKAFQVDDNVVDNLQKQFWYDNN  226



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D++  VFVNGK CKNP    A+DF F GL+KPGN SNP+GS V+ VN
Sbjct  22   DPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  L GLNTLG+SL RID+APYGLNPPHTHPRATEVL VLEGTLYVGFV SNP    +N+
Sbjct  82   VMQLPGLNTLGVSLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP----ENR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ NVGH+NA+AFAGLSSQNPG ITIANAVFGS PPI   
Sbjct  138  LFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQAQFW +NN
Sbjct  198  VLAKAFQVDKKVIDYLQAQFWMDNN  222



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLNKPG+ +NPLGS V+AVN
Sbjct  23   DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANPLGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLAR+DFAPYGLNPPHTHPRATE+L VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N GHSNA+AFAGL SQNPGVITIANAVFGS+PPI P 
Sbjct  143  LFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSNPPISPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFW  158
            VLTKAFQV+ KVI+YLQ+QFW
Sbjct  203  VLTKAFQVDKKVIKYLQSQFW  223


 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLN PG+ +NPLGS V+AVN
Sbjct  281  DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNMPGSTANPLGSNVTAVN  340

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLAR+DFAPYGLNPPHTHPRATE+L VLEGTL VGFV SNP   MKNK
Sbjct  341  VNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNK  400

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GLIHFQ N G +NA+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  401  LFTKVLNPGDVFVFPEGLIHFQFNQGQTNAVAFAALSSQNPGVITIANAVFGSKPPISRD  460

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  VI+YLQ+QFW++N+
Sbjct  461  VLTKAFQVDKNVIKYLQSQFWWDNH  485



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K AVFVNGKICK+P  V+ANDF FQGLN P + +N  GS V+AVN
Sbjct  23   DPSPLQDFCVAINDPKTAVFVNGKICKDPKVVNANDFFFQGLNIPRSTANRQGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNLAGLNTLG+SLAR+DFAPYGLNPPHTHPRATEVL VLEG L VGFV SNPP  MKN+
Sbjct  83   VNNLAGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGVLNVGFVTSNPPNNMKNQ  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTKTL PGDVFVFP+GLIHFQ NVG +NA+AFAG  SQNPGVITIANAVFGSDP I   
Sbjct  143  LFTKTLNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISAD  202

Query  220  VLTKAFQVEDKVIEYLQAQFW  158
            VL KAFQV+ KVI+ L+AQF 
Sbjct  203  VLAKAFQVDKKVIDLLEAQFL  223



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+++ VFVNGK CKNP    A+DF F GL+KPGN SNP+GS V+ VN
Sbjct  22   DPSPLQDFCVAINDTESPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  L GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEG LYVGFV SNP     N+
Sbjct  82   VMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ NVGH+NA+AFAGLSSQNPG ITIANAVFGS PPI   
Sbjct  138  LFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQAQFW +NN
Sbjct  198  VLAKAFQVDKKVIDYLQAQFWMDNN  222



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLNKPG+ +NPLGS V+AVN
Sbjct  23   DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANPLGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPH HPRATEVL VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N GHSNA+AFAGL SQNPGVITIANAVFGSDPPI P 
Sbjct  143  LFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV + VI+ LQ+QFW++NN
Sbjct  203  VLTKAFQVGNDVIKKLQSQFWWDNN  227


 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLN+PG+ SNPLGS V+AVN
Sbjct  252  DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNEPGSTSNPLGSNVTAVN  311

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPHTHPRATE+L VLEGTL VGFV SNP   MKNK
Sbjct  312  VNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNK  371

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFP+GLIHFQ N GHSNA+AFAGLSSQNPGVITIANAVFGS PPI   
Sbjct  372  LFTKVLNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRD  431

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V++YLQ+QFW++N+
Sbjct  432  VLTKAFQVDKNVVKYLQSQFWWDNH  456



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score =   312 bits (800),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 171/205 (83%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIN++++AVFVNGK CK+P  V ANDF F GL  PGN SNP+GS V+  N
Sbjct  26   DPSPLQDFCVAINNTESAVFVNGKFCKDPKFVTANDFFFSGLRIPGNTSNPVGSFVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGISLARIDFAP GLNPPHTHPR TE L VLEGTLYVGFV SN   G  N+
Sbjct  86   VEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLIVLEGTLYVGFVTSN---GDNNR  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  143  LFTKVLNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSSQNPGVITIANAVFGSNPPINPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++DK +EYLQ QFWYNNN
Sbjct  203  VLAKAFQIDDKEVEYLQKQFWYNNN  227



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 171/205 (83%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK CK+P  V+ANDF F GL  P N  NPLGS V+ VN
Sbjct  25   DPSPLQDFCVALNDNKSAVFVNGKFCKDPKLVNANDFFFSGLQNPRNTQNPLGSNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ +AGLNTLGISL RIDFAP GLNPPHTHPRA+E L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDQIAGLNTLGISLTRIDFAPNGLNPPHTHPRASEFLVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  142  LFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+D V++YLQ Q WY+NN
Sbjct  202  VLAKAFQVDDNVVDYLQKQLWYDNN  226



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   311 bits (798),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D++  VFVNGK CKNP    A+DF F GL+KPGN SNP+GS V+ VN
Sbjct  22   DPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  L GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEG LYVGFV SNP     N+
Sbjct  82   VMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ NVGH+NA+AFAGLSSQNPG ITIANAVFGS PPI   
Sbjct  138  LFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQAQFW +NN
Sbjct  198  VLAKAFQVDKKVIDYLQAQFWMDNN  222



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 171/205 (83%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIN++++AVFVNGK CK+P  V ANDF F GL  PGN SNP+GS V+  N
Sbjct  26   DPSPLQDFCVAINNTESAVFVNGKFCKDPKLVTANDFFFSGLRIPGNTSNPVGSFVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGISLARIDFAP GLNPPHTHPR TE L VLEGTLYVGFV SN   G  N+
Sbjct  86   VEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLIVLEGTLYVGFVSSN---GDNNR  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  143  LFTKVLNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSSQNPGVITIANAVFGSNPPINPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++DK +EYLQ QFWYNNN
Sbjct  203  VLAKAFQIDDKEVEYLQKQFWYNNN  227



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 173/207 (84%), Gaps = 5/207 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA--VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSA  587
            DPSPLQDFCVA+ND+K+A  VFVNGK CK+P   +ANDF F GL  P N  NPLGS V+A
Sbjct  25   DPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPLGSNVTA  84

Query  586  VNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMK  407
            VNV+NL GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  
Sbjct  85   VNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDG  141

Query  406  NKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPID  227
            N+LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS P I+
Sbjct  142  NRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLIN  201

Query  226  PKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            P VL KAFQV+DKV++ LQ QFWY+NN
Sbjct  202  PDVLAKAFQVDDKVVDNLQKQFWYDNN  228



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 173/208 (83%), Gaps = 6/208 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAV---FVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVS  590
            DPSPLQDFCVA+ND+K+AV   FVNGK CK+P   +ANDF F GL  P N  NPLGS V+
Sbjct  25   DPSPLQDFCVALNDTKSAVEAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPLGSNVT  84

Query  589  AVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGM  410
            AVNV+NL GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G 
Sbjct  85   AVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GD  141

Query  409  KNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPI  230
             N+LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS P I
Sbjct  142  GNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLI  201

Query  229  DPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            +P VL KAFQV+DKV++ LQ QFWY+NN
Sbjct  202  NPDVLAKAFQVDDKVVDNLQKQFWYDNN  229



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 176/213 (83%), Gaps = 11/213 (5%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA--------VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPL  605
            DPSPLQDFCVA+ND+K+A        VFVNGK CK+P  V+ANDF F GL  P N  NP+
Sbjct  25   DPSPLQDFCVALNDTKSAGGYFGAGAVFVNGKFCKDPKLVNANDFFFSGLQNPRNTQNPV  84

Query  604  GSAVSAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSN  425
            GS V+AVNV+NLAGLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN
Sbjct  85   GSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN  144

Query  424  PPPGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFG  245
               G  N+LFTK L  GDVFVFP GLIHFQLNVG+ NA+AFAGLSSQNPGVITIANAVFG
Sbjct  145  ---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGYVNAVAFAGLSSQNPGVITIANAVFG  201

Query  244  SDPPIDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            S PPI+P VL KAFQV++ V++YLQ QFWY+NN
Sbjct  202  SKPPINPDVLAKAFQVDNNVVDYLQKQFWYDNN  234



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 173/207 (84%), Gaps = 5/207 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA--VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSA  587
            DPSPLQDFCVA+ND+K+A  VFVNGK CK+P   +ANDF F GL  P N  NPLGS V+A
Sbjct  25   DPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPLGSNVTA  84

Query  586  VNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMK  407
            VNV+NL GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  
Sbjct  85   VNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDG  141

Query  406  NKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPID  227
            N+LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS P I+
Sbjct  142  NRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLIN  201

Query  226  PKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            P VL KAFQV++ V++YLQ QFWY+NN
Sbjct  202  PDVLAKAFQVDNNVVDYLQKQFWYDNN  228



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP+PLQDFCVAI D++  VFVNGK CKNP    A+DF F GL+KPGN SNP+GS V+ VN
Sbjct  22   DPNPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  L GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEGTLYVGFV SNP    +N+
Sbjct  82   VMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP----ENR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TKTL  GDVFVFP GLIHFQ NVGH+NA+AFAGLSSQNPG ITIANAVFGS PPI   
Sbjct  138  LITKTLNKGDVFVFPVGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSXPPIKDD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQAQFW +NN
Sbjct  198  VLAKAFQVDKKVIDYLQAQFWMDNN  222



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   309 bits (792),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 172/207 (83%), Gaps = 6/207 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA------VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGS  599
            DPSPLQDFCVAIND K A      VFVNGKICK+P  V+ANDF FQGLN P + +N  GS
Sbjct  12   DPSPLQDFCVAINDPKTAASFFNAVFVNGKICKDPKVVNANDFFFQGLNIPRSTANRQGS  71

Query  598  AVSAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP  419
             V+AVNVNNLAGLNTLG+SLAR+DFAPYGLNPPHTHPRATEVL VLEGTL VGFV SNPP
Sbjct  72   NVTAVNVNNLAGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLNVGFVTSNPP  131

Query  418  PGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSD  239
              MKN+LFTKTL PGDVFVFP+GLIHFQ NVG +NA+AFAG  SQNPGVITIANAVFGSD
Sbjct  132  NNMKNQLFTKTLNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSD  191

Query  238  PPIDPKVLTKAFQVEDKVIEYLQAQFW  158
            P I   VL KAFQV+ KVI+ L+AQF 
Sbjct  192  PLISADVLAKAFQVDKKVIDLLEAQFL  218



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 173/205 (84%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D K  VFVNGK CK+P   +ANDF F GL  P N  NP+GS V+AVN
Sbjct  255  DPSPLQDFCVAIKDIKDGVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPVGSNVTAVN  314

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NLAGLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  315  VDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  371

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  372  LFTKELNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPD  431

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++KV++YLQ QFWY+NN
Sbjct  432  VLTKAFQVDNKVVDYLQKQFWYDNN  456


 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 172/204 (84%), Gaps = 3/204 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D K  VFVNGK CK+P   +ANDF F GL  P N  NP+GS V+AVN
Sbjct  25   DPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPVGSNVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+NLAGLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SN   G  N+
Sbjct  85   VDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  142  LFTKELNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNN  149
            VLTKAFQV++KV++YLQ QFWY+N
Sbjct  202  VLTKAFQVDNKVVDYLQKQFWYDN  225



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLNKPG+ +NPLGS V+ VN
Sbjct  23   DPSPLQDFCVAVPDANATVFVNGKICKDPKLVKPKDFFFPGLNKPGSTANPLGSNVTQVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLAR+DFAPYGLNPPHTHPRATEVL VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLLVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N G ++A+AFAG  SQNPGVITIANAV GSDPPI P 
Sbjct  143  LFTKVLNPGDVFVFPQGLIHFQFNQGKTDAVAFAGFGSQNPGVITIANAVVGSDPPISPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV +  I+ LQ+QFW++NN
Sbjct  203  VLTKAFQVGNDAIKKLQSQFWWDNN  227



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D+   VFVNGK CKNP    A+DF F GL+KPGN SNP+GS V+ VN
Sbjct  22   DPSPLQDFCVAIKDTDYPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  L GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEG LYVGFV SNP     N+
Sbjct  82   VMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ NVGH+NA+AFAGLSSQNPG ITIANAVFG+ PPI   
Sbjct  138  LFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGAKPPIKDD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KVI+YLQAQFW +NN
Sbjct  198  VLAKAFQVDKKVIDYLQAQFWMDNN  222



>ref|XP_007201563.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
 gb|EMJ02762.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
Length=227

 Score =   307 bits (787),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 171/206 (83%), Gaps = 3/206 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K+AVFVNGK CK+P   +ANDF F GL    +  NPLGS V+AVN
Sbjct  25   DPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFFSGLQIARSTQNPLGSTVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ +AGLNTLGISLARIDFA  GLNPPHTHPRATE+L VLEGTLYVGFV SN      N+
Sbjct  85   VDQIAGLNTLGISLARIDFARNGLNPPHTHPRATEILLVLEGTLYVGFVTSNAD---NNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVG  +A+A A LSSQNPGVITIANAVFGSDPPI+P+
Sbjct  142  LFTKVLNKGDVFVFPIGLIHFQLNVGEGDAVAQAALSSQNPGVITIANAVFGSDPPINPE  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VL KAFQV++K +EYLQ QFWY+NNN
Sbjct  202  VLAKAFQVDNKAVEYLQKQFWYDNNN  227



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   322 bits (824),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLNKPG+ +NPLGS V+AVN
Sbjct  484  DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANPLGSNVTAVN  543

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPH HPRATEVL VLEGTL VGFV SNP   MKNK
Sbjct  544  VNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNK  603

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N GHSNA+AFAGL SQNPGVITIANAVFGSDPPI P 
Sbjct  604  LFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPD  663

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV + VI+ LQ+QFW++NN
Sbjct  664  VLTKAFQVGNDVIKKLQSQFWWDNN  688


 Score =   309 bits (791),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V A DF FQGLNKPG+ +NPLGS V+ VN
Sbjct  23   DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKAEDFFFQGLNKPGSTANPLGSNVTQVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLAR+DFAPYGLNPPHTHPRATEVL VLEGTL VGFV SNP   MKNK
Sbjct  83   VNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLLVGFVTSNPGMNMKNK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N G ++A+AFAGL SQNPGVITIANAVFGSDPPI P 
Sbjct  143  LFTKVLNPGDVFVFPQGLIHFQFNQGETDAVAFAGLGSQNPGVITIANAVFGSDPPISPD  202

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV + VI+ LQ Q  ++ +
Sbjct  203  VLTKAFQVGNDVIKKLQVQLIFDTS  227


 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 167/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ D+ A VFVNGKICK+P  V   DF F GLNKPG+ +NPLGS V+AVN
Sbjct  254  DPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANPLGSNVTAVN  313

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLG+SLARIDFAPYGLNPPH HPRATEVL VLEGTL VGFV SNP   MKNK
Sbjct  314  VNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNK  373

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGLIHFQ N GHSNA+AFAGL SQNPGVITIANAVFGSDPPI P 
Sbjct  374  LFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPD  433

Query  220  VLTKAFQVEDKVI-EYLQAQF  161
            VLTKAFQV + V+ +  + QF
Sbjct  434  VLTKAFQVGNDVLPKKFEIQF  454



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K AVFVNGK CK+PM   A DF F GLN PGN SN LGS V+ VN
Sbjct  24   DPSPLQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLG+SLAR+DFAPYG LNPPHTHPRATE+L VLEGTLYVGFV SNP     N
Sbjct  84   VEQIPGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFA   SQNPGVITIA AVFGS+PPI+P
Sbjct  140  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINP  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQ++  V++YLQ+QFW++NN
Sbjct  200  DVLTKAFQLDKNVVKYLQSQFWWDNN  225



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKA-AVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAV  584
            DPSPLQDFCVAI D+++ AVFVNGK CKNP    A+DF F GL+KPGN SNP+GS V+ V
Sbjct  22   DPSPLQDFCVAIKDTESPAVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPV  81

Query  583  NVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            NV  L GLNTLGISL RID+APYGLNPPHTHPRATEVL VLEG LYVGFV SNP     N
Sbjct  82   NVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DN  137

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +LFTK L  GDVFVFPQGL HFQ NVGH+NA+AFAGLSSQNPG ITIANAVFG  PPI  
Sbjct  138  RLFTKVLNKGDVFVFPQGLTHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGPKPPIKD  197

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQV+ KVI+YLQAQ+W +NN
Sbjct  198  DVLAKAFQVDKKVIDYLQAQYWMDNN  223



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D KAAV VNGK CKNP    A DF F GL+KPGN SNP+GS V+AVN
Sbjct  24   DPSPLQDFCVAIKDPKAAVLVNGKFCKNPKLAKAKDFFFSGLHKPGNTSNPVGSKVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLARIDFAPYGLNPPHTHPRATE+L VLEGTLYVGF  SNP     N+
Sbjct  84   VEQIPGLNTLGISLARIDFAPYGLNPPHTHPRATEILVVLEGTLYVGFATSNP----DNR  139

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TKTL  GDVFVFP GLIHFQ N G +NA+A AGLSSQNPGVITIANAVFGS PPI   
Sbjct  140  LITKTLNKGDVFVFPVGLIHFQFNTGETNAVALAGLSSQNPGVITIANAVFGSKPPIRDD  199

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL +AF+V+ K+I+ LQAQFW +NN
Sbjct  200  VLARAFRVDTKLIDNLQAQFWMDNN  224



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIN++  AVFVNGK CKNP    ANDF    L  PGN SNP+GS V+A N
Sbjct  25   DPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+++ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L VLEG+LYVGFV SN   G  N+
Sbjct  85   VDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---GDGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  142  LFTKVLYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++K ++YLQ QFWYNN+
Sbjct  202  VLAKAFQVDEKEVDYLQKQFWYNNH  226



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK C++P    A DF + GLN P N SNPLGS V+ VN
Sbjct  25   DPSPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRNTSNPLGSTVTQVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISLARID+APYG LNPPHTHPRA+E+L VLEGTLYVGFV SNP    +N
Sbjct  85   VAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGFVTSNP----EN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFAGLSSQNPGVITIA AVFGS+PPI+P
Sbjct  141  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQ++  ++  LQ++FW++NN
Sbjct  201  DVLTKAFQLDKNIVTSLQSRFWWDNN  226



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score =   301 bits (771),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P   +A+DF FQGL  PGN SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKTGVFVNGKFCKDPKLANADDFFFQGLG-PGNTSNPLGSKVTPVT  80

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLGISLAR+DFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN      N+
Sbjct  81   VNEILGLNTLGISLARVDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVSSNQD---NNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVG+  AIA AGLSSQNPGVITIANAVFGS PPI  +
Sbjct  138  LFTKVLNKGDVFVFPIGLIHFQLNVGYGEAIAIAGLSSQNPGVITIANAVFGSKPPISLE  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  VI+YLQ QFWYNN+
Sbjct  198  VLTKAFQVDKNVIDYLQKQFWYNNS  222



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK CK+     ANDF F GL  P +  NPLGS V+  N
Sbjct  25   DPSPLQDFCVALNDTKLGVFVNGKFCKDSRLASANDFFFSGLQIPRSTQNPLGSTVTPAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ +AGLNTLGISLARIDFAP GLNPPHTHPR TE+L + EGTLYVGFV SNP     N+
Sbjct  85   VDQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEILFLQEGTLYVGFVTSNP----NNR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH++A+A AGLSSQNPGVITIANAVFG++PPI+P 
Sbjct  141  LFTKVLNKGDVFVFPVGLIHFQLNVGHTSAVAIAGLSSQNPGVITIANAVFGANPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+DK++ YLQ QFWY+NN
Sbjct  201  VLAKAFQVDDKLVSYLQKQFWYDNN  225



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++ +AVFVNGK CK+P    ANDF    L  PGN  NP+GS V+A N
Sbjct  27   DPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPGNTLNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+N+ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L V+EG+LYVGFV SN   G  N+
Sbjct  87   VDNIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNR  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  144  LFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+D V++YLQ QFWYNN+
Sbjct  204  VLAKAFQVDDNVVDYLQKQFWYNNS  228



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 4/204 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA++D KAAVFVNGK CK+P    A+DF F GL+ PGN SNP+GSAV+ VN
Sbjct  25   DPSPLQDTCVAVDDPKAAVFVNGKFCKDPKLAMADDFFFSGLHIPGNTSNPVGSAVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGISLAR+D+APYGLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  85   VAQIAGLNTLGISLARVDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----ENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ NVGH+N +A A LSSQNPGVITIANAVFGSDPPI   
Sbjct  141  LISKVLNKGDVFVFPIGLIHFQFNVGHTNTVAIAALSSQNPGVITIANAVFGSDPPISID  200

Query  220  VLTKAFQVEDKVIEYLQAQFWYNN  149
            VLTKAFQ++  V+ YLQ+ FW++N
Sbjct  201  VLTKAFQLDKDVVNYLQSSFWWDN  224



>ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
Length=226

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIND+K  VFVNGK CK+P    A DF + GLN P N SNP+GS V+ VN
Sbjct  25   DPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNPVGSTVTQVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISLARID+APYG LNPPHTHPRA+E+L VLEGTLYVGFV SNP    +N
Sbjct  85   VAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGFVTSNP----EN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFAGLSSQNPGVITIA AVFGS+PPI+P
Sbjct  141  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQ++  ++  LQ++FW++NN
Sbjct  201  DVLTKAFQLDKNIVTSLQSRFWWDNN  226



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIND+K  VFVNGK CK+P    A DF + GLN P N SNP+GS V+ VN
Sbjct  25   DPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNPVGSTVTQVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISLARID+APYG LNPPHTHPRA+E+L VLEGTLYVGFV SNP    +N
Sbjct  85   VAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGFVTSNP----EN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFAGLSSQNPGVITIA AVFGS+PPI+P
Sbjct  141  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQ++  ++  LQ++FW++NN
Sbjct  201  DVLTKAFQLDKNIVTSLQSRFWWDNN  226



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  202  VLTKAFQVDKKVVDYLQSQF  221



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  202  VLTKAFQVDKKVVDYLQSQF  221



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA +D K AVFVNGK+CK+P    ANDF F GLN P + SNP+GS V+ +N
Sbjct  24   DPSPLQDFCVATDDPKDAVFVNGKLCKDPKLATANDFSFSGLNVPRDTSNPVGSNVTLLN  83

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
             + + GLNTLGISLARID+APYGLNPPHTHPRATE+L VLEGTLYVGFV SNP     N+
Sbjct  84   ADRIPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP-----NR  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TKTL PGDVFVFP G+IHFQ N G++NA+AFAGLSSQNPG ITIANAVFGS+PPI+  
Sbjct  139  LITKTLKPGDVFVFPIGMIHFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V++YLQ QFW NN+
Sbjct  199  VLTKAFQVDKNVVKYLQKQFWTNNH  223



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   299 bits (766),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN +GS V+  N
Sbjct  26   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  202  VLTKAFQVDKKVVDYLQSQF  221



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   299 bits (766),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+  +VFVNGK CK+P     NDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  VI YLQ+QFW +N+
Sbjct  202  VLTKAFQVDKNVINYLQSQFWTDNH  226



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++ +AVFVNGK CK+P    ANDF    L  PGN SNP+GS V+A N
Sbjct  27   DPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPGNTSNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGIS AR+DFAP GLNPPHTHPRATE+L V+EG+LYVGFV SN   G  N+
Sbjct  87   VDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNR  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  144  LFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+D V++YLQ QFWYNN+
Sbjct  204  VLAKAFQVDDNVVDYLQKQFWYNNS  228



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K AVFVNGK CK+PM   A DF F GLN PGN SN LGS V+ VN
Sbjct  275  DPSPLQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVN  334

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLG+SLAR+DFAPYG LNPPHTHPRATE+L VLEGTLYVGFV SNP     N
Sbjct  335  VEQIPGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DN  390

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFA   SQNPGVITIA AVFGS+PPI+P
Sbjct  391  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINP  450

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQ++  V++YLQ+QFW++NN
Sbjct  451  DVLTKAFQLDKNVVKYLQSQFWWDNN  476


 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 164/201 (82%), Gaps = 5/201 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIND+K  VFVNGK C++P    A DF + GLN P N SNP+GS V+ VN
Sbjct  25   DPDPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRNTSNPVGSTVTQVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISLARID+APYG LNPPHTHPRA+E+L VLEGTLYVGFV SNP    +N
Sbjct  85   VAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGFVTSNP----EN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFAGLSSQNPGVITIA AVFGS+PPI+P
Sbjct  141  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQF  161
             VLTKAFQ++  ++  LQ++ 
Sbjct  201  DVLTKAFQLDKNIVTSLQSRL  221



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 168/202 (83%), Gaps = 5/202 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    A+DF + GLN PGN SNP+GS V+ VN
Sbjct  25   DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNPVGSNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V+ + GLNTLGISL RID+APYG LNPPHTHPR TE+L V+EGTLYVGFV SNP    +N
Sbjct  85   VDQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEILVVVEGTLYVGFVTSNP----EN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +LFTK LYPGDVFVFP GLIHFQ N+G + A+AFAGLSSQN GVITIANAVFGSDPPI+P
Sbjct  141  RLFTKVLYPGDVFVFPIGLIHFQFNIGKTEAVAFAGLSSQNAGVITIANAVFGSDPPINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQFW  158
             VLTKAFQ++  ++ YLQ++FW
Sbjct  201  DVLTKAFQLDKNMVAYLQSRFW  222



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++ +AVFVNGK CK+P    ANDF    L  P N SNP+GS V+A N
Sbjct  27   DPXPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPRNTSNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+++ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L V+EG+LYVGFV SN   G  N+
Sbjct  87   VDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNR  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  144  LFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++ V++YLQ QFWYNN+
Sbjct  204  VLAKAFQVDBNVVDYLQKQFWYNNS  228



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++ +AVFVNGK CK+P    ANDF    L  P N SNP+GS V+A N
Sbjct  27   DPGPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPXNTSNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+++ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L V EG+LYVGFV SN   G  N+
Sbjct  87   VDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVXEGSLYVGFVTSN---GDGNR  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  144  LFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+D V++YLQ QFWYNN+
Sbjct  204  VLAKAFQVDDNVVDYLQKQFWYNNS  228



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++ +AVFVNGK CK+P    AN+F    L  P N SNP+GS V+A N
Sbjct  27   DPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANBFFSDKLRYPRNTSNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+++ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L V+EG+LYVGFV SN   G  N+
Sbjct  87   VDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNR  143

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  144  LFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  203

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++ V++YLQ QFWYNN+
Sbjct  204  VLAKAFQVDBNVVDYLQKQFWYNNS  228



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN +GS V+  N
Sbjct  31   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPAN  90

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  91   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  146

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L  K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  147  LICKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  206

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  207  VLTKAFQVDKKVVDYLQSQF  226



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN +GS V+  N
Sbjct  120  DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPAN  179

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  180  VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  235

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  236  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  295

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  296  VLTKAFQVDKKVVDYLQSQF  315



>ref|XP_008237525.1| PREDICTED: germin-like protein subfamily 1 member 18 [Prunus 
mume]
Length=234

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 170/213 (80%), Gaps = 11/213 (5%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA--------VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPL  605
            DPSPLQDFCVA++D+K+A        VFVNGK CK+P  V+ANDF F GL  P N  NPL
Sbjct  25   DPSPLQDFCVALDDTKSAGGYFGAGAVFVNGKFCKDPKLVNANDFFFSGLQNPRNTQNPL  84

Query  604  GSAVSAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSN  425
            GS V+ VNV+ +AGLNTLGISL RIDFAP GLNPPHTHPRA+E L VLEG+LYVGFV SN
Sbjct  85   GSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPHTHPRASEFLVVLEGSLYVGFVTSN  144

Query  424  PPPGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFG  245
               G  N+LFTK L  GDVFVFP GLIHFQ NVGH NA+AFAGLSSQNPGVITIANAVFG
Sbjct  145  ---GDGNRLFTKVLNKGDVFVFPIGLIHFQFNVGHVNAVAFAGLSSQNPGVITIANAVFG  201

Query  244  SDPPIDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            S P I+P VL KAFQV++ V++YLQ QFWY+NN
Sbjct  202  SKPLINPDVLAKAFQVDNNVVDYLQKQFWYDNN  234



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D+ + VFVNGK CKNP    A+DF F GL+KPGN SN +GS V+ VN
Sbjct  22   DPSPLQDFCVAIKDTDSRVFVNGKFCKNPYYTTADDFFFSGLDKPGNTSNSVGSKVTPVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  L GLNTLGIS+ARID+APYGLNP H HPRAT+VL VLEGTLYV FV SN    + N+
Sbjct  82   VMQLPGLNTLGISMARIDYAPYGLNPLHMHPRATKVLVVLEGTLYVSFVTSN----LDNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ NVGH+NA+AFAGLSSQNPG ITIANAVF + PPI   
Sbjct  138  LFTKVLNKGDVFVFPKGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFEAKPPIKND  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KV++YLQAQFW +NN
Sbjct  198  VLAKAFQVDKKVVDYLQAQFWMDNN  222



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIN++  AVFVNGK CKNP    ANDF    L  PGN SNP+GS V+A N
Sbjct  25   DPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+++ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L VLEG+LYVGFV SN      N+
Sbjct  85   VDDIPGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A AGLSSQNPGVITIANAVFGS+P I+P 
Sbjct  142  LFTKVLYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPHINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++K ++YLQ QFWYNN+
Sbjct  202  VLAKAFQVDEKEVDYLQKQFWYNNH  226



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   297 bits (760),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 161/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L  K LY GDVFVFP+GLIHF LNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LIAKVLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  202  VLTKAFQVDKKVVDYLQSQF  221



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score =   296 bits (759),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G+ KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
             LTKAFQV+ K I+YLQAQFWY+NN
Sbjct  199  ALTKAFQVDKKTIDYLQAQFWYDNN  223



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   296 bits (759),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDSKAAVFVNGKICK+P  V+ANDF FQG N PGN +NP+GS V+ V 
Sbjct  23   DPSPLQDFCVAINDSKAAVFVNGKICKDPKVVNANDFFFQGFNIPGNTNNPVGSNVTRVL  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VNNL GLNT GISLARIDFAPYG+N PHTHPRATEV+  +EGTL   FV SNPP  MKN+
Sbjct  83   VNNLPGLNTFGISLARIDFAPYGVNTPHTHPRATEVIFAVEGTLAASFVTSNPPNNMKNR  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L PGDVFVFPQGL+HF  N+G + A+AF+G SSQNPGV TIAN VFG++PPI   
Sbjct  143  LFTKVLNPGDVFVFPQGLVHFIQNLGKTKALAFSGFSSQNPGVNTIANVVFGTEPPISLG  202

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KVI+ L+AQF
Sbjct  203  VLTKAFQVDKKVIDALEAQF  222



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   296 bits (757),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 161/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN LGS V+  N
Sbjct  10   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPAN  69

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  70   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  125

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L  K LY GDVFVFP+GLIHF LNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  126  LIAKVLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  185

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  186  VLTKAFQVDKKVVDYLQSQF  205



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDNN  223



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 162/199 (81%), Gaps = 4/199 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN +GS V+  N
Sbjct  84   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPAN  143

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  144  VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  199

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  200  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  259

Query  220  VLTKAFQVEDKVIEYLQAQ  164
            VLTKAFQV+ KV++YLQ+Q
Sbjct  260  VLTKAFQVDKKVVDYLQSQ  278



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDNN  223



>ref|NP_001237300.1| uncharacterized protein LOC100527781 precursor [Glycine max]
 gb|ACG69488.1| germin-like protein 12 [Glycine max]
 gb|ACU16953.1| unknown [Glycine max]
 gb|KHN04964.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=222

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    A DF F GL  PGN SNPLGS V+AV 
Sbjct  22   DPSPLQDFCVAINDTKTGVFVNGKFCKDPKLAKAEDFFFPGLG-PGNTSNPLGSKVTAVT  80

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN      N+
Sbjct  81   VNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQ---NDNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQ N+G+ NA+A AGLSSQNPGVITIANAVFGS PPI  +
Sbjct  138  LFTKVLNKGDVFVFPIGLIHFQQNIGYGNALAIAGLSSQNPGVITIANAVFGSKPPISDE  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV   VI+YLQ QFWYNN+
Sbjct  198  VLAKAFQVGKNVIDYLQKQFWYNNS  222



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIN++  AVFVNGK CKNP    ANDF    L  PGN SNP+GS V+A N
Sbjct  25   DPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAAN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+++ GLNTLGIS AR+DFAP GLNPPHTHPRATE+L VLEG+LYVGFV SN      N+
Sbjct  85   VDDIPGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A  GLSSQNPGVITIANAVFGS+P I+P 
Sbjct  142  LFTKVLYKGDVFVFPVGLIHFQLNVGKTNALAIGGLSSQNPGVITIANAVFGSNPHINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++K ++YLQ QFWYNN+
Sbjct  202  VLAKAFQVDEKEVDYLQKQFWYNNH  226



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P     NDF F GL  PGN SN +GS V+  N
Sbjct  26   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATPNDFFFSGLRVPGNTSNKVGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  202  VLTKAFQVDKKVVDYLQSQF  221



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+  +VFVNGK CK+P     NDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPH+HPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGVSLARVDYAPYGLNPPHSHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L+ GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLHKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V+ YLQ+QFW +N+
Sbjct  202  VLTKAFQVDKNVVNYLQSQFWTDNH  226



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VMEFPGLNTLGISMARIDFAPDGLNPPHTHPRGTEVLVVVEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFA LSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K +EYLQAQFWY+NN
Sbjct  199  VLTKAFQVDEKTVEYLQAQFWYDNN  223



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P     NDF F GL  PGN SN +GS V+  N
Sbjct  10   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATPNDFFFSGLRVPGNTSNKVGSMVTPAN  69

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  70   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  125

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  126  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  185

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  186  VLTKAFQVDKKVVDYLQSQF  205



>ref|XP_008778966.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=221

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 165/206 (80%), Gaps = 6/206 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA  D  + VFVNG +CKNP +V A+DF F GL++PG+ +N LGS V+ VN
Sbjct  22   DPSPLQDFCVA--DKTSHVFVNGLVCKNPNDVKADDFFFSGLDRPGDAANKLGSNVTLVN  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGISLARIDFAPYGLNPPH HPRATE+LTVLEG+LYVGFV SNP     N+
Sbjct  80   VEKIAGLNTLGISLARIDFAPYGLNPPHIHPRATEILTVLEGSLYVGFVTSNP----DNR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF K +  GDVFVFPQGLIHFQ N G  NA+A A LSSQNPGVIT+ANAVFGS PPI   
Sbjct  136  LFAKVINKGDVFVFPQGLIHFQFNYGTKNAVAIAALSSQNPGVITVANAVFGSKPPISRD  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VL KAFQV+ K I++LQAQFW +NNN
Sbjct  196  VLAKAFQVDKKTIDWLQAQFWMDNNN  221



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P +  A+DF F G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL ++EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVIIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDNN  223



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score =   294 bits (753),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P +  A+DF F G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS+AR+DFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGARPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K+++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKIVDYLQAQFWYDNN  223



>ref|XP_007199406.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
 gb|EMJ00605.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
Length=226

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIN   +AVFVNGK CK+P  V ANDF F GL    + +NP+GS V+AVN
Sbjct  25   DPSPLQDFCVAINKPPSAVFVNGKFCKDPKFVTANDFFFSGLQIAKSTANPVGSTVTAVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ +AGLNTLGISLARIDFAP GLNPPHTHPR +E+L VLEGTLYVGFV SN      N+
Sbjct  85   VDQIAGLNTLGISLARIDFAPNGLNPPHTHPRGSEILVVLEGTLYVGFVTSNAD---NNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQLN+G+ NA+A AGLSSQNPGVITIANAVFGS PPI+P 
Sbjct  142  LISKVLNKGDVFVFPIGLIHFQLNLGYGNAVALAGLSSQNPGVITIANAVFGSKPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++K+++YLQ QFWY NN
Sbjct  202  VLAKAFQVDNKLVDYLQKQFWYENN  226



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+   VFVNGK C++P     NDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRVPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+   + YLQ+QFW +N+
Sbjct  202  VLTKAFQVDKNEVNYLQSQFWTDNH  226



>ref|XP_007030263.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10765.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=252

 Score =   295 bits (755),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND+K  +FVNGK CK+P    A DF F GLN P N +NP+GS V+ VN
Sbjct  51   DPSPLQDICVAINDTKTGIFVNGKFCKDPKLATAEDFFFSGLNVPRNTTNPVGSVVTPVN  110

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V+ + GLNTLGISL RID+APYG  NPPH HPR TE+L VLEGTLYVGFV SNP     N
Sbjct  111  VDQILGLNTLGISLVRIDYAPYGGQNPPHIHPRGTEILVVLEGTLYVGFVTSNP----DN  166

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L +K LYPGDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGS+PPI+P
Sbjct  167  RLISKVLYPGDVFVFPIGLIHFQQNVGKTNAVAFAGLSSQNPGVITIANAVFGSNPPINP  226

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNN  149
             VLT+AFQ+++KV++YLQ++FW+ N
Sbjct  227  DVLTRAFQLDNKVVKYLQSRFWWKN  251



>ref|XP_008237387.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=233

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 166/212 (78%), Gaps = 10/212 (5%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKA-------AVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLG  602
            DPSPLQDFCVAIND+K+       AVFVNGK CK+P   +ANDF   G   P +  NP+G
Sbjct  25   DPSPLQDFCVAINDTKSPVILNGIAVFVNGKFCKDPKLANANDFFLSGFQIPRSTQNPVG  84

Query  601  SAVSAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNP  422
            S V+  NV+ +AGLNTLGISLARIDF P GLNPPHTHPR TE+L VLEGTLYVGFV SN 
Sbjct  85   STVTPANVDQIAGLNTLGISLARIDFGPNGLNPPHTHPRGTEILVVLEGTLYVGFVTSN-  143

Query  421  PPGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGS  242
              G  N+LFTK L  GDVFVFP GLIHFQLNVGH NA+A A LSSQNPGVITIANAVFGS
Sbjct  144  --GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVALAALSSQNPGVITIANAVFGS  201

Query  241  DPPIDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
             PPI+P VL KAFQV++KV+ YLQ QFWYNN+
Sbjct  202  KPPINPDVLAKAFQVDNKVVNYLQKQFWYNNS  233



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score =   294 bits (752),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 166/205 (81%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA N SK  VFVNGK+CK+PM   ANDF + GLNKPGN SNPLGS V+ VN
Sbjct  21   DPSPLQDFCVADNYSK--VFVNGKVCKDPMLATANDFFYDGLNKPGNTSNPLGSMVTPVN  78

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLARIDFAP G NPPHTHPR TE+LTVLEGTLYVGFV SNP    +N+
Sbjct  79   VMQIPGLNTLGISLARIDFAPGGQNPPHTHPRGTEILTVLEGTLYVGFVTSNP----ENR  134

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +KTL  GDVFVFP+GLIHFQ NVG+ N +A AGLSSQNPGVITIANAVFG+DPPI   
Sbjct  135  LISKTLKKGDVFVFPEGLIHFQQNVGYGNTVAIAGLSSQNPGVITIANAVFGADPPISDV  194

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++ K+++ LQA FW + N
Sbjct  195  VLAKAFQIDKKLVDKLQASFWMDTN  219



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSP QDFCVA+ND+K  VFVNGK CK+P    AN F F GL  P +  NPLGS V+ VN
Sbjct  25   DPSPXQDFCVALNDTKLGVFVNGKFCKDPKLASANYFFFSGLQIPRSTQNPLGSTVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTL ISL RIDFAP GLNPPHTHPR TE+L + EGTLYVGFV SNP     N+
Sbjct  85   VDQIPGLNTLSISLVRIDFAPNGLNPPHTHPRGTEILFLQEGTLYVGFVTSNP----DNR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVGH+NA+A +GLSSQNPGVITIANAVFG++PPI+P 
Sbjct  141  LFTKVLNKGDVFVFPVGLIHFQLNVGHTNAVAISGLSSQNPGVITIANAVFGANPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQVE+K++ YLQ QFWY+NN
Sbjct  201  VLAKAFQVEBKLVTYLQKQFWYDNN  225



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++  AVFVNGK CK+P    ANDF    L  PGN SNP+GS V+A N
Sbjct  27   DPGPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFTDKLRYPGNTSNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGIS AR+DFAP GLNPPHTHPRATE+  VLEG+LYVGFV SN   G  N+
Sbjct  87   VDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEIFIVLEGSLYVGFVTSN-IEGDGNR  145

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLNVG +NA+A A  SSQNPGVIT+ANAVFGS PPI+P 
Sbjct  146  LFTKVLYKGDVFVFPFGLIHFQLNVGKTNAVAIAAFSSQNPGVITVANAVFGSKPPINPD  205

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++ V++YLQ QFWYNN+
Sbjct  206  VLTKAFQVDNNVVDYLQKQFWYNNS  230



>ref|XP_011034308.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 171/207 (83%), Gaps = 3/207 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ ++   VFVNGK CK+P +V   DF F GLN P + S P+GS V+AVN
Sbjct  24   DPSPLQDFCVAMKETDG-VFVNGKFCKDPEQVTEKDFFFSGLNVPRDTSGPVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  +AGLNTLGISLARID+AP+G L PPHTHPRATE+L V+EGTLYVGFV SN P G  N
Sbjct  83   VAQIAGLNTLGISLARIDYAPHGGLTPPHTHPRATEILVVVEGTLYVGFVTSNLPNG-DN  141

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GL+HFQLNVG +NA+AFA LSSQNPGVITIANAVFG+DPPI+P
Sbjct  142  RLITKVLNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINP  201

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNNN  143
             VLTKAFQV+ K+++YLQ QFW +NNN
Sbjct  202  NVLTKAFQVDKKLVDYLQKQFWTDNNN  228



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+  AGLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFAGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPG+ITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>gb|KCW61456.1| hypothetical protein EUGRSUZ_H04192 [Eucalyptus grandis]
Length=223

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YL AQFWY+NN
Sbjct  199  VLTKAFQVDKKTVDYLLAQFWYDNN  223



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P +  A+DF F G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFA LSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFASLSSQNPGVITIANSVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDNN  223



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN LGS V+  N
Sbjct  283  DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPAN  342

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  343  VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  398

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  399  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  458

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  459  VLTKAFQVDKKVVDYLQSQF  478


 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 160/209 (77%), Gaps = 4/209 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQ+FCVA+ND+K  VFVNGK+CK+     AND  F  L   G+ SN L S V+  N
Sbjct  10   DPSPLQEFCVAVNDTKTTVFVNGKVCKDLKVATANDLFFSRLQVLGHTSNKLESMVTQAN  69

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +  LNTLGISLAR+D+APYGLNPPHT+PRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  70   VAQIPELNTLGISLARVDYAPYGLNPPHTYPRATEILTVLEGTLYVGFVTSNP----DNR  125

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVF+F +GLIHFQLNV  + A+A A LSSQN GVITIANAVFGS P I   
Sbjct  126  LISKVLYKGDVFIFLEGLIHFQLNVRKTKAVAIAALSSQNLGVITIANAVFGSKPAISAD  185

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN*TI  134
            VLTKAFQV+ KV++YLQ+QFW +N+  +I
Sbjct  186  VLTKAFQVDKKVVDYLQSQFWTDNHTNSI  214



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPH HPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VMEFPGLNTLGISMARIDFAPSGLNPPHIHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFA LSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K I+YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKTIDYLQAQFWYDNN  223



>ref|XP_007201630.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
 gb|EMJ02829.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
Length=233

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 167/212 (79%), Gaps = 10/212 (5%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKA-------AVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLG  602
            DPSPLQDFCVAIND+K+       AVFVNGK CK+P   +ANDF   G   P +  NP+G
Sbjct  25   DPSPLQDFCVAINDTKSPVILNGIAVFVNGKFCKDPKLANANDFFLSGFQIPRSTQNPVG  84

Query  601  SAVSAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNP  422
            S V+  +V+ +AGLNTLGISLARIDF P GLNPPHTHPR TE+L V+EGTLYVGFV SN 
Sbjct  85   STVTPASVDQIAGLNTLGISLARIDFGPNGLNPPHTHPRGTEILVVVEGTLYVGFVTSN-  143

Query  421  PPGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGS  242
              G  N+LFTK L  GDVFVFP GLIHFQLNVGH NA+A A LSSQNPGVITIANAVFGS
Sbjct  144  --GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVALAALSSQNPGVITIANAVFGS  201

Query  241  DPPIDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
             PPI+P VL KAFQV++KV++YLQ QFWYNN+
Sbjct  202  KPPINPDVLAKAFQVDNKVVDYLQKQFWYNNS  233



>gb|KCW76697.1| hypothetical protein EUGRSUZ_D01057 [Eucalyptus grandis]
Length=221

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 165/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND +  VFVNGK CK+P ++ A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPE--VFVNGKFCKDPKQITADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+   VFVNGK C++P     NDF F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRLPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPH HPRATE+LTVLEGTLYVGFV SNP    +N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHIHPRATEILTVLEGTLYVGFVTSNP----ENR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIA AVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIAKAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQVE  V+EYLQ+QF
Sbjct  202  VLTKAFQVEKNVVEYLQSQF  221



>ref|XP_010041605.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_010024923.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61463.1| hypothetical protein EUGRSUZ_H04199 [Eucalyptus grandis]
Length=223

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF G   PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLSSGVFVNGKFCKDPNQASADDFLFTGFRNPGNTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+AR+DFAP GLNPPHTHPR TEVL V+EGTL VGFV S+    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AFAGLSSQNPG+ITIANAVFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_010024911.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61444.1| hypothetical protein EUGRSUZ_H04175 [Eucalyptus grandis]
Length=221

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+  +V A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDQKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P   +A+DF F+GL   G+ +NP+GS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKTGVFVNGKFCKDPKFANADDFFFRGLGA-GDTANPVGSKVTPVA  80

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN      N+
Sbjct  81   VNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQN---DNR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQ NVG+ NA+A AGLSSQNPGVITIANAVFGS PPI  +
Sbjct  138  LFTKVLNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQNPGVITIANAVFGSKPPISDE  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            +L KAFQV+   I+YLQ QFWYNNN
Sbjct  198  ILAKAFQVDKNTIDYLQKQFWYNNN  222



>ref|XP_010024926.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61466.1| hypothetical protein EUGRSUZ_H04202 [Eucalyptus grandis]
Length=223

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF G   PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPNQASADDFLFTGFRNPGNTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+AR+DFAP GLNPPHTHPR TEVL V+EGTL VGFV S+    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AFAGLSSQNPG+ITIANAVFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_006840196.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
 gb|ERN01871.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
Length=219

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 167/205 (81%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA N SK  VFVNGK+CK+PM V A DF + GL+KPGN SNPLGS V+ VN
Sbjct  21   DPSPLQDFCVADNYSK--VFVNGKVCKDPMLVTAKDFFYDGLDKPGNTSNPLGSMVTQVN  78

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISL RIDFAP G NPPHTHPRATE+LTVLEGTLYVGFV SNP    +N+
Sbjct  79   VMQILGLNTLGISLVRIDFAPGGQNPPHTHPRATEILTVLEGTLYVGFVTSNP----ENR  134

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +KTL  GDVFVFPQGLIHFQ NVG+ N++A AGLSSQNPGVITIA AVFG++PPI   
Sbjct  135  LISKTLNKGDVFVFPQGLIHFQQNVGYGNSVAIAGLSSQNPGVITIAKAVFGANPPISDV  194

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++ ++++ LQA FW +NN
Sbjct  195  VLAKAFQIDKQLVDKLQASFWMDNN  219



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGIS+ARIDFAP GLNPPHTHPR +E+L V EGTL VGFV SN    + N 
Sbjct  80   VDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIAN+VFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN +GS V+  N
Sbjct  255  DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPAN  314

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  315  VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  370

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  371  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  430

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  431  VLTKAFQVDKKVVDYLQSQF  450


 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 142/187 (76%), Gaps = 4/187 (2%)
 Frame = -3

Query  706  VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVNVNNLAGLNTLGISLARID  527
            VFVNGK+CK+P    ANDF F GL  PGN SN LGS V+  NV  +  L TLGISLAR+D
Sbjct  7    VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPANVAQIPDLKTLGISLARVD  66

Query  526  FAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNKLFTKTLYPGDVFVFPQGL  347
            +APYGLNPPHTHPR TE+LT LEGTLYVGFV SNP     N+L +K LY GDVFVFP+ L
Sbjct  67   YAPYGLNPPHTHPRDTEILTFLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEDL  122

Query  346  IHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPKVLTKAFQVEDKVIEYLQA  167
            IHFQLNV  + A+A A LSSQNPGVITIANAVFGS P I   VLTKAFQV+ KV++YLQ+
Sbjct  123  IHFQLNVEKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQS  182

Query  166  QFWYNNN  146
            QF  N  
Sbjct  183  QFSINRQ  189



>ref|XP_010024924.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61464.1| hypothetical protein EUGRSUZ_H04200 [Eucalyptus grandis]
Length=223

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF G   PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPNQASADDFLFTGFRNPGNTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+AR+DFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEILVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AFAGLSSQNPG+ITIANAVFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_007030274.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10776.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=675

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    A DF + GLN P N SNP+GS V+ VN
Sbjct  474  DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNPVGSTVTPVN  533

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISLARID+APYG LNPPHTHPRATE+L VLEGTLYVGFV SNP    +N
Sbjct  534  VAQILGLNTLGISLARIDYAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----EN  589

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQLN+G +NA+AFAGLSSQNPGVITIANAVFGS PPI+P
Sbjct  590  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIANAVFGSKPPINP  649

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQ++  ++  LQ++FW++NN
Sbjct  650  DVLTKAFQLDKNIVTSLQSRFWWDNN  675


 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 158/196 (81%), Gaps = 5/196 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    A+DF + GLN PGN SNP+GS V+ VN
Sbjct  252  DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNPVGSNVTTVN  311

Query  580  VNNLAGLNTLGISLARIDFAPY-GLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V+ + GLNTLGISL RID+APY GLNPPHTHPR TE+L V+EGTLYVGFV SNP    +N
Sbjct  312  VDQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEILVVVEGTLYVGFVTSNP----EN  367

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +LFTK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQN GVITIA AVFGS+PPI P
Sbjct  368  RLFTKVLNPGDVFVFPIGLIHFQFNIGKTAAVAFAGLSSQNAGVITIAKAVFGSNPPIKP  427

Query  223  KVLTKAFQVEDKVIEY  176
             VLTKAFQ++  V  +
Sbjct  428  DVLTKAFQLDKNVDRF  443


 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = -3

Query  490  PRATEVLTVLEGTLYVGFVLSNPPPGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNA  311
            P+  ++L ++EGTLYVG V SNP    +N   TK L PGD F+FP GLIHFQ NVG +NA
Sbjct  52   PKHGKILVIMEGTLYVGLVTSNP----ENHPITKVLNPGDGFLFPVGLIHFQFNVGKTNA  107

Query  310  IAFAGLSSQNPGVITIANAVFGSDPPIDPKVLTKAFQVEDKVIE  179
            +AFA LSSQNP VITI NAVFGS+P I+P VL K FQ++  +I 
Sbjct  108  VAFAALSSQNPDVITIVNAVFGSNPAINPDVLVKDFQLDINMIS  151



>ref|XP_010050166.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89288.1| hypothetical protein EUGRSUZ_A01578 [Eucalyptus grandis]
Length=223

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPKQATADDFLFMGFRNPGNTTNPLGSKVTPAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+AR+DFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AFAGLSSQ+PGVITIANAVFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQSPGVITIANAVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PGN SN +GS V+  N
Sbjct  26   DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQ+QF
Sbjct  202  VLTKAFQVDKKVVDYLQSQF  221


 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 161/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K  VFVNGK+CK+P    A+DF F GL  PGN SN +GS V+  N
Sbjct  295  DPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATADDFFFSGLRVPGNTSNKVGSMVTPAN  354

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  355  VAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  410

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L  K LY GDVF+FP+GLIHFQLNVG + A+A A LSSQNPGVITIANAVFGS P I   
Sbjct  411  LICKVLYKGDVFIFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISAD  470

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+  V++YLQ+QF
Sbjct  471  VLTKAFQVDKNVVDYLQSQF  490



>ref|XP_011038438.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 162/206 (79%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    ANDF F GLN   + SNP+GS V+  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS+ RID+APYG LNPPHTHPRATEV+TVLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQ NVG + A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRS  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQV+ K+++YLQ QFWY+NN
Sbjct  200  DVLAKAFQVDKKIVDYLQKQFWYDNN  225



>ref|NP_001268128.1| germin-like protein 5 [Vitis vinifera]
 gb|ABL60874.1| germin-like protein 5 [Vitis vinifera]
 emb|CBI39475.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI+D KAAVFVNGK CKNP    A DF FQGLN PGN  NPLG  V+ VN
Sbjct  12   DPSPLQDTCVAIDDPKAAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTENPLGFNVTTVN  71

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGISL RID+APYG NPPHTHPR TE++TVLEGTLYVGFV SNP    +N+
Sbjct  72   VDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRGTEIITVLEGTLYVGFVTSNP----ENR  127

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDV+VFP GLIHFQ NVGH+NA+A A LSSQNPGVITIANAVFGS+PPI+P 
Sbjct  128  LISKLLNKGDVYVFPIGLIHFQFNVGHANAVAIAALSSQNPGVITIANAVFGSNPPINPD  187

Query  220  VLTKAFQVEDKVIEYLQAQF  161
             L KAFQ++ KV+EYLQA F
Sbjct  188  FLAKAFQLDKKVVEYLQAHF  207



>emb|CBI36791.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI+D K  VFVNGK CK+     A+DF + GL+ PGN++NP+GS V+ VN
Sbjct  25   DPSPLQDICVAISDLKDGVFVNGKFCKDLKLASADDFFYYGLHIPGNITNPVGSMVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+APYG NPPHTHPRATE+L VLEGTL VGFV SN     +N+
Sbjct  85   VEQIPGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP GLIHFQ NVG +NA+AFAGLSSQNPGVITIANAVFGSDPPIDP 
Sbjct  141  LISKVLYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPD  200

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLT+AFQ+++ V++ LQ++FW++NN
Sbjct  201  VLTRAFQLDEDVVKDLQSRFWWDNN  225



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   289 bits (740),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 162/206 (79%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    ANDF F GLN   + SNP+GS V+  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS+ RID+APYG LNPPHTHPRATEV+TVLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQ NVG + A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRS  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQ++ K+++YLQ QFWY+NN
Sbjct  200  DVLAKAFQLDKKIVDYLQKQFWYDNN  225



>ref|XP_010024913.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61440.1| hypothetical protein EUGRSUZ_H04170 [Eucalyptus grandis]
Length=221

 Score =   289 bits (740),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+  +V A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDQKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V EG L VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGALLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDRKVVDYLQAQFWYDNN  221



>ref|XP_003618164.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74382.1| germin family protein [Medicago truncatula]
Length=220

 Score =   289 bits (739),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 164/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CKNP     NDF F    K GN SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKTGVFVNGKFCKNPKLATPNDFFFSV--KEGNTSNPLGSKVTPVT  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN++ GLNTLGISLARIDFA  GLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----ENR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ NA+A AGLSSQNPGVITIANAVFGS+P I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANAVFGSNPKISSE  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++ +++ LQ QFW +NN
Sbjct  196  VLTKAFQVDNNIVDNLQKQFWVDNN  220



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   289 bits (739),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD+CVAIND+K  VFVNGK CK+P    A DF F GLN P N SNP+GS V+ VN
Sbjct  24   DPSPLQDYCVAINDAKDGVFVNGKFCKDPKLAKAEDFFFSGLNIPRNKSNPVGSTVTPVN  83

Query  580  VNNLAGLNTLGISLARIDFAPY-GLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISL RID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISLVRIDYAPNDGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQ NVG +NA+AFA LSSQNPGVITIANAVFG++PPI+P
Sbjct  140  RLITKILYPGDVFVFPIGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGANPPINP  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQ++  V++ LQ++FW+ NN
Sbjct  200  DVLVKAFQLDKNVVKNLQSKFWWANN  225



>ref|XP_010066338.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Eucalyptus grandis]
 ref|XP_010066339.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Eucalyptus grandis]
 ref|XP_010066340.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Eucalyptus grandis]
 ref|XP_010066341.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066345.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066346.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=220

 Score =   288 bits (738),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 162/204 (79%), Gaps = 5/204 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   G+NTLGIS+ARIDFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGINTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNN  149
            VLTKAFQV+ KV++YLQAQFWY+N
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDN  220



>ref|XP_002277055.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
 emb|CBI38542.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+ AAVFVNGK C++P     NDF F GL  PGN SN LGS V+  +
Sbjct  26   DPSPLQDFCVAVNDTNAAVFVNGKFCQDPKLATPNDFSFSGLRLPGNTSNQLGSMVTPAS  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPHTHPRATE+LTVLEGTLYVGFV SNP     N+
Sbjct  86   VAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIA AVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIARAVFGSKPAISVD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++  V+  LQ++FW +N+
Sbjct  202  VLTKAFQLDKDVVANLQSKFWTDNH  226



>ref|XP_011034305.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 169/207 (82%), Gaps = 3/207 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ ++   VFVNGK CK+P +V   DF F GLN P + S P+GS V+AVN
Sbjct  24   DPSPLQDFCVAMKETDG-VFVNGKFCKDPEQVTEKDFFFSGLNVPRDTSGPVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTL ISL RID+AP+G LNPPHTHPRATE+L V+EGTLYVGFV SN P G  N
Sbjct  83   VAQIPGLNTLSISLVRIDYAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLPNG-DN  141

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GL+HFQLNVG +NA+AFA LSSQNPGVITIANAVFG+DPPI+P
Sbjct  142  RLITKVLNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINP  201

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNNN  143
             VLTKAFQV+ K+++YLQ QFW +NNN
Sbjct  202  NVLTKAFQVDKKLVDYLQKQFWTDNNN  228



>ref|XP_006840195.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
 gb|ERN01870.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
Length=219

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 167/205 (81%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA N SK  VFVNGK+CK+P    ANDF F GL+KPGN SNP+GS V+ VN
Sbjct  21   DPSPLQDFCVADNYSK--VFVNGKVCKDPKLATANDFFFAGLDKPGNTSNPVGSKVTPVN  78

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGISLARIDFAP G NPPHTHPRATE+LTVLEGTLYVGFV SNP    +N+
Sbjct  79   VMQIAGLNTLGISLARIDFAPGGQNPPHTHPRATEILTVLEGTLYVGFVTSNP----ENR  134

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ NVG+SNA+A A LSSQNPGVITIANAVFG++PPI   
Sbjct  135  LISKILNKGDVFVFPVGLIHFQQNVGYSNAVAIAALSSQNPGVITIANAVFGANPPISDV  194

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQ++ ++++ LQA FW +NN
Sbjct  195  VLAKAFQIDKQLVDKLQASFWMDNN  219



>ref|XP_010027143.1| PREDICTED: uncharacterized protein LOC104417591 [Eucalyptus grandis]
Length=451

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  250  DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  309

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  310  VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  366

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  367  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISAD  426

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YLQAQFWY+NN
Sbjct  427  VLTKAFQVDKKTVDYLQAQFWYDNN  451


 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G  KPGN +NPLGS V+   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNN  149
            VLTKAFQV+ K ++YL AQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLLAQFWYDN  222



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF GL  PGN +NPLGS V+   
Sbjct  22   DPSPLQDICVATNDPNSGVFVNGKFCKDPKQASADDFLFMGLRNPGNTANPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+AR+DFAP GLNPPHTHPR TEVL V+EG L VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGMLLVGFVTSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G++NA+AFAGLSSQNPGVITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGNTNALAFAGLSSQNPGVITIANAVFGAKLPISTD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ K ++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKEVDYLQAQFWYDNN  223



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 161/206 (78%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P    ANDF F GLN   + SNP+GS V+  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS+ RID+APYG LNPPHTHPRATEV+TVLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQ NVG + A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRS  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQV+ K+++YLQ Q WY+NN
Sbjct  200  DVLAKAFQVDKKIVDYLQKQLWYDNN  225



>ref|XP_006857270.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
 gb|ERN18737.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
Length=218

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA N S+  +FVNGK+CK+P    ANDF F GL+KPGN +N LGS V+ VN
Sbjct  20   DPSPLQDFCVADNASQ--LFVNGKVCKDPQLAQANDFFFAGLDKPGNTANALGSRVTQVN  77

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGIS+ RID+AP G NPPHTHPRATE+LTVLEG+LYVGFV SNP     N+
Sbjct  78   VAQIAGLNTLGISMVRIDYAPGGQNPPHTHPRATEILTVLEGSLYVGFVTSNP----DNR  133

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TKTL  GDVFVFP+GLIHFQ NVG+ NA+A A LSSQNPGVITIANAVFGS P I+  
Sbjct  134  LITKTLQKGDVFVFPEGLIHFQQNVGYKNAVAIAALSSQNPGVITIANAVFGSKPAINSN  193

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV++KV+  LQ+QFW +NN
Sbjct  194  VLAKAFQVDNKVVNQLQSQFWMDNN  218



>ref|XP_003618167.1| Germin-like protein [Medicago truncatula]
 gb|AES74385.1| germin family protein [Medicago truncatula]
Length=220

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK+CK+P     NDF F    K GN SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKNGVFVNGKVCKDPKLATPNDFFFSV--KEGNTSNPLGSKVTPVT  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN++ GLNTLGISLARIDFA  GLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----ENR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ NA+A AGLSSQNPGVITIANAVFGS+P I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANAVFGSNPKISSE  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++ +++ LQ QFW +NN
Sbjct  196  VLTKAFQVDNNIVDNLQKQFWVDNN  220



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGIS+ARIDFAP GLNPPHTHPR +E+L V EGTL VGFV  N    + N 
Sbjct  80   VDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTFN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIAN+VFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_010024917.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61455.1| hypothetical protein EUGRSUZ_H04191 [Eucalyptus grandis]
Length=221

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND +  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPE--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G +  +AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPTLAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_003618165.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74383.1| germin family protein [Medicago truncatula]
 gb|AFK46512.1| unknown [Medicago truncatula]
Length=220

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P     NDF F    K GN+SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLATPNDFFFSV--KEGNISNPLGSKVTPVT  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN++ GLNTLGISLARIDFA  GLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----ENR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ NA+A AGLSSQNPGVITIANAVFGS+P I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANAVFGSNPKISSE  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++ +++ LQ QFW +NN
Sbjct  196  VLTKAFQVDNNIVDNLQKQFWVDNN  220



>ref|NP_001268198.1| germin-like protein 3 precursor [Vitis vinifera]
 gb|AAQ63185.2| germin-like protein 3 [Vitis vinifera]
Length=225

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI+D K  VFVNGK CK+     A+DF + GL+ PGN++NP+GS V+ VN
Sbjct  25   DPSPLQDICVAISDPKDGVFVNGKFCKDLKLASADDFFYYGLHIPGNITNPVGSMVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+APYG NPPHTHPRATE+L VLEGTL VGFV SN     +N+
Sbjct  85   VEQIPGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPIDP 
Sbjct  141  LISKVLYKGDVFVFPIGLIHFQFNVGKAKAVAFAGLSSQNPGVITIANAVFGSDPPIDPD  200

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLT+AFQ+++ V++ LQ++FW++NN
Sbjct  201  VLTRAFQLDEDVVKDLQSRFWWDNN  225



>ref|XP_006387364.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
 gb|ERP46278.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
Length=228

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 168/207 (81%), Gaps = 3/207 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAI ++   VFVNGK CK+P +V ANDF F GLN P + S+ +GS V+AVN
Sbjct  24   DPGPLQDFCVAIKETDG-VFVNGKFCKDPEQVTANDFFFPGLNVPRDTSSAVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS ARIDFAP+G LNPPHTHPRATE+L V+EGTLYVGFV SN   G  N
Sbjct  83   VAQIPGLNTLGISFARIDFAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLANG-DN  141

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQLNVG +NA+AFA LSSQNPGVITIA AVFG+DPPI+P
Sbjct  142  RLITKVLNPGDVFVFPVGLIHFQLNVGRTNAVAFASLSSQNPGVITIAKAVFGADPPINP  201

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNNN  143
             VLTKAFQV+ KV++YLQ Q W +NNN
Sbjct  202  NVLTKAFQVDKKVVDYLQKQLWTDNNN  228



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score =   287 bits (735),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 165/201 (82%), Gaps = 5/201 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPS LQDFCVA+ND+K A+FVNGK CK+P    A+DF F GL+K GN SN +GS V+ VN
Sbjct  25   DPSSLQDFCVALNDTKHAIFVNGKFCKDPKLATADDFFFSGLDKAGNTSNAVGSRVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V+ + GLNTLGISLARID+APYG LNPPHTHPRATE+L V +GTLYVGFV SNP     N
Sbjct  85   VDQIPGLNTLGISLARIDYAPYGGLNPPHTHPRATEILAVKKGTLYVGFVTSNP----DN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            K FTK L  GDVFVFP GLIHFQ N+G +NAIAFAGLSSQNPGVITIANAVFGS+PPI+P
Sbjct  141  KFFTKILKTGDVFVFPVGLIHFQFNIGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQF  161
             VL KAF+++ KV+E+LQ QF
Sbjct  201  DVLAKAFKLDKKVVEFLQTQF  221



>ref|XP_010050157.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW89287.1| hypothetical protein EUGRSUZ_A01577 [Eucalyptus grandis]
Length=223

 Score =   287 bits (735),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPKQATADDFLFMGFRNPGNTTNPLGSKVTPAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+AR+DFAP GLNPPHTHPR TEVL V+EGTL VGF+ SN    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFITSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G++ A+AFAGLSSQNPGVITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNCGNTYALAFAGLSSQNPGVITIANAVFGAKSPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YL+AQFWY+NN
Sbjct  199  VLTKAFQVDKKVVDYLEAQFWYDNN  223



>ref|XP_011034443.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   287 bits (735),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 161/206 (78%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNG+ CK+P    ANDF F GLN   + SNP+GS V+  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGRFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS+ RID+APYG LNPPHTHPRATEV+TVLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQ NVG + A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRS  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQV+ K+++YLQ Q WY+NN
Sbjct  200  DVLAKAFQVDKKIVDYLQKQLWYDNN  225



>gb|KCW80407.1| hypothetical protein EUGRSUZ_C01764 [Eucalyptus grandis]
Length=221

 Score =   287 bits (734),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND +  VFVNGK CK+P +V A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPE--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFA  GLNPPHTHPR TEVL V EGTL V FV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNN  221



>ref|XP_004489240.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Cicer 
arietinum]
Length=220

 Score =   286 bits (733),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 163/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAI D K  VFVNGK CK+P     NDF F    K GN SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAIKDIKNGVFVNGKFCKDPKLATPNDFFFSV--KEGNTSNPLGSKVTPVT  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VNEILGLNTLGISLARIDFAPKGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----QNR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ NAIA AGLSSQNPGV+TIANAVFGS+P I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYENAIAVAGLSSQNPGVVTIANAVFGSNPKISSE  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++ +I+ LQ QFW++NN
Sbjct  196  VLTKAFQVDNNIIDNLQKQFWWDNN  220



>ref|XP_010911724.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 165/206 (80%), Gaps = 6/206 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPS LQDFCVA  D  + VFVNG +CK+P    A DF F GL+KPG+  N LGS V+ V+
Sbjct  22   DPSQLQDFCVA--DLHSDVFVNGFVCKDPKMAKAEDFFFSGLDKPGDTGNKLGSNVTLVD  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN LAGLNTLGISLAR+DFAPYGLNPPHTHPR TE+L VLEGTLYVGFV SNP     N+
Sbjct  80   VNKLAGLNTLGISLARLDFAPYGLNPPHTHPRGTEILVVLEGTLYVGFVTSNP----NNQ  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF+K L+ GDVFVFPQGLIHFQ N G ++A+A AGLSSQNPGVITIANAVFG+ PPI  +
Sbjct  136  LFSKVLHEGDVFVFPQGLIHFQFNNGKTSAVALAGLSSQNPGVITIANAVFGAKPPISDE  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VL KAFQ++ K +++LQAQFW +NNN
Sbjct  196  VLAKAFQLDKKTVDWLQAQFWTDNNN  221



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGIS+ARIDFAP GLNPPHTHPR +E+L V EGTL VGFV SN    + N 
Sbjct  80   VDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIAN+VF S PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQ QFWY+NN
Sbjct  197  VLTKAFQVDKKVVDYLQVQFWYDNN  221



>ref|XP_006375870.1| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53667.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score =   286 bits (733),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 160/206 (78%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P     NDF F GLN   N SNP+GS V+  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPAN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISL RID+APYG LNPPHTHPRATE+LTVLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L+PGDVFVFP GLIHFQ NVG + A A   LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRS  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQV+  ++++LQ QFWY+NN
Sbjct  200  DVLAKAFQVDKNIVDFLQKQFWYDNN  225



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAIND K+AVFVNG+ CK+P + +A+DF F G+ KPGN +NPLGS V+   
Sbjct  348  DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKPGNTANPLGSKVTPAT  407

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN   GLNTLGIS ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  408  VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  464

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN G + A+AFAGLSSQNPGVITIAN+VFG+ PPI   
Sbjct  465  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  524

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
             LTKAFQV+ K I+YLQAQFWY+NN
Sbjct  525  ALTKAFQVDKKTIDYLQAQFWYDNN  549


 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDS +AV VNGK CK+P    A+DF F     PGN SNPLGS V+   
Sbjct  22   DPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI++AR+DFAPYGLNPPH HPR TE+L V+EGTLYVGFV SN    + N 
Sbjct  82   VDQFPGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSN---QLNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN+VFGS P I+  
Sbjct  139  LFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W++N+
Sbjct  199  VLTKAFQVDNKLINYLQAQNWFDNH  223


 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +3

Query  204  KALVRTLGSIGGSEPNTALAMVMTPGFWLLKPAKAMAFECPTLSWK*MRPCGNTKTSPGY  383
             ALVRT   +GG +PNTALAMV+TPGFWLL+ AKA A   P  SWK MRP GNT TSP Y
Sbjct  223  HALVRTSAEMGGFDPNTALAMVITPGFWLLRAAKASAGVFPMFSWKWMRPIGNTNTSPLY  282

Query  384  NVLVKSLFFIPGGGLERTNPT*RVPSKTVRTSVALGW  494
            N LVK + F     L+ T PT  VPS T RTSV  G+
Sbjct  283  NTLVKRVLF---NWLDVTKPTSSVPSVTTRTSVPRGF  316



>ref|XP_010027145.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61467.1| hypothetical protein EUGRSUZ_H04203 [Eucalyptus grandis]
Length=223

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND  + VFVNGK CK+P +  A+DFLF+G   P N SN LGS V+   
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPNQATADDFLFKGFRIPRNTSNLLGSKVTPAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V+EGTL VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AFAGLSSQNPG+ITIANAVFG+ PPI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|NP_001240963.1| germin-like protein subfamily 1 member 7-like precursor [Glycine 
max]
 gb|ACG69487.1| germin-like protein 11 [Glycine max]
Length=232

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 163/208 (78%), Gaps = 8/208 (4%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA----VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAV  593
            DPSPLQDFCVAIND+K      VFVNGK CK+P    A+DF F GL  PGN +NP GS V
Sbjct  22   DPSPLQDFCVAINDTKTGGLYGVFVNGKFCKDPKFAYADDFFFGGLG-PGNTANPQGSKV  80

Query  592  SAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPG  413
            +AV VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN    
Sbjct  81   TAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQN--  138

Query  412  MKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPP  233
              N+LFTK LY GDVFVFP GL+HFQ N+G+ NA+A AGLSSQNPGVITIANAVFGS PP
Sbjct  139  -DNRLFTKVLYKGDVFVFPIGLVHFQQNIGYGNAVAIAGLSSQNPGVITIANAVFGSKPP  197

Query  232  IDPKVLTKAFQVEDKVIEYLQAQFWYNN  149
            I  +VL KAFQV+  VI+YLQ QF YNN
Sbjct  198  ISDEVLAKAFQVDKNVIDYLQKQFGYNN  225



>ref|XP_002319674.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
 gb|EEE95597.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
Length=225

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 159/206 (77%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P     NDF F GLN   N SNP+GS V+  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPAN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISL RID+APYG LNPPHTHPRATE+LTVLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DN  139

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQ NVG + A A   LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLNPGDVFVFPIGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRS  199

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQVE  ++++LQ QFWY+NN
Sbjct  200  DVLAKAFQVEKNIVDFLQKQFWYDNN  225



>gb|KHN14792.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 163/208 (78%), Gaps = 8/208 (4%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA----VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAV  593
            DPSPLQDFCVAIND+KA     VFVNGK CK+P    A+DF F GL  PGN +NP GS V
Sbjct  22   DPSPLQDFCVAINDTKAGGLYGVFVNGKFCKDPKFAYADDFFFGGLG-PGNTANPQGSKV  80

Query  592  SAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPG  413
            +AV VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN    
Sbjct  81   TAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQN--  138

Query  412  MKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPP  233
              N+LFTK LY GDVFVFP GLIHFQ NVG+ NA+A A LSSQNPGVITIANAVFGS PP
Sbjct  139  -DNRLFTKVLYKGDVFVFPIGLIHFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSKPP  197

Query  232  IDPKVLTKAFQVEDKVIEYLQAQFWYNN  149
            I  +VL KAFQV+  +++YLQ QF YNN
Sbjct  198  ISDEVLAKAFQVDKNIVDYLQKQFGYNN  225



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 160/200 (80%), Gaps = 5/200 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA ++  +AVFVNGK CKNP  V A DFLF+GLN  GN  N  GS V+ VN
Sbjct  28   DPSPLQDFCVAADEPNSAVFVNGKFCKNPKLVRAEDFLFRGLNIAGNTMNKQGSNVTLVN  87

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGISLARID+APYGLNPPHTHPRATE+L V+EGTL VGFV SNP     NK
Sbjct  88   VDRLPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVVEGTLLVGFVTSNP-----NK  142

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQ NVGHS A+AFAGLSSQNPGVITIANAVFGSDPPI   
Sbjct  143  LFTKVLNKGDVFVFPIGLIHFQFNVGHSPALAFAGLSSQNPGVITIANAVFGSDPPISID  202

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV++ VI  L  QF
Sbjct  203  VLTKAFQVDNNVIHALMKQF  222



>gb|KHN04965.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 163/208 (78%), Gaps = 8/208 (4%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA----VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAV  593
            DPSPLQDFCVAIND+K      VFVNGK CK+P    A+DF F GL  PGN +NP GS V
Sbjct  22   DPSPLQDFCVAINDTKTGGLYGVFVNGKFCKDPKFAYADDFFFGGLG-PGNTANPQGSKV  80

Query  592  SAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPG  413
            +AV VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN    
Sbjct  81   TAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQN--  138

Query  412  MKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPP  233
              N+LFTK LY GDVFVFP GL+HFQ N+G+ NA+A AGLSSQNPGVITIANAVFGS PP
Sbjct  139  -DNRLFTKVLYKGDVFVFPIGLVHFQQNIGYGNALAIAGLSSQNPGVITIANAVFGSKPP  197

Query  232  IDPKVLTKAFQVEDKVIEYLQAQFWYNN  149
            I  +VL KAFQV+  VI+YLQ QF YNN
Sbjct  198  ISDEVLAKAFQVDKNVIDYLQKQFGYNN  225



>ref|XP_007201690.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
 gb|EMJ02889.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
Length=183

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 158/186 (85%), Gaps = 3/186 (2%)
 Frame = -3

Query  703  FVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVNVNNLAGLNTLGISLARIDF  524
            FVNGK CK+P   +ANDF F GL  P N  NP+GS V+AVNV+NLAGLNTLGISLAR+DF
Sbjct  1    FVNGKFCKDPKLANANDFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARLDF  60

Query  523  APYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNKLFTKTLYPGDVFVFPQGLI  344
            AP GLNPPHTHPRA+E+L VLEGTLYVGFV SN   G  N+LFTK L  GDVFVFP GLI
Sbjct  61   APNGLNPPHTHPRASEILAVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLI  117

Query  343  HFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPKVLTKAFQVEDKVIEYLQAQ  164
            HFQLNVGH NA+AFAGLSSQNPGVITIANAVFGS PPI+P VLTKAFQV++KV++YLQ Q
Sbjct  118  HFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQ  177

Query  163  FWYNNN  146
            FWY+NN
Sbjct  178  FWYDNN  183



>ref|XP_002319184.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 ref|XP_002319673.2| germin-like protein 1 [Populus trichocarpa]
 ref|XP_006375916.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 ref|XP_002319185.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
 gb|EEE95107.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 gb|EEE95596.2| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53713.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 gb|EEE95108.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
Length=228

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 167/207 (81%), Gaps = 3/207 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAI ++   VFVNGK CK+P +V A DF F GLN P + S+ +GS V+AVN
Sbjct  24   DPGPLQDFCVAIKETDG-VFVNGKFCKDPEQVTAKDFFFPGLNVPRDTSSAVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS ARIDFAP+G LNPPHTHPRATE+L V+EGTLYVGFV SN   G  N
Sbjct  83   VAQIPGLNTLGISFARIDFAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLANG-DN  141

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQLNVG +NA+AFA LSSQNPGVITIA AVFG+DPPI+P
Sbjct  142  RLITKVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIAKAVFGADPPINP  201

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNNN  143
             VLTKAFQV+ KV++YLQ Q W +NNN
Sbjct  202  NVLTKAFQVDKKVVDYLQKQLWTDNNN  228



>ref|XP_002276926.2| PREDICTED: uncharacterized protein LOC100251187, partial [Vitis 
vinifera]
Length=447

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+NDS AAVFV GK C++P     NDF F GL  PGN SN LGS V+  N
Sbjct  245  DPSPLQDFCVAVNDSNAAVFVKGKFCRDPKLATPNDFFFSGLRLPGNTSNKLGSMVTPAN  304

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPH HPRATE+LTVLEGTLYV FV SNP     N 
Sbjct  305  VAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGTLYVAFVTSNP----DNH  360

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIANAVFGS P I   
Sbjct  361  LISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISAD  420

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V+E LQ+QFW +N+
Sbjct  421  VLTKAFQVDKNVVECLQSQFWTDNH  445


 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 155/195 (79%), Gaps = 4/195 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+K AVFVNGK CK+P     NDF F GL  PGN SN LGS V+  N
Sbjct  19   DPSPLQDFCVAVNDTKDAVFVNGKFCKDPKLATPNDFFFSGLRLPGNTSNKLGSMVTPAN  78

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPH HPRATE+LTVLEG LYVGFV SNP     N+
Sbjct  79   VAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGALYVGFVTSNP----DNR  134

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIANAVFGS P I   
Sbjct  135  LISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISAD  194

Query  220  VLTKAFQVEDKVIEY  176
            VLTKAFQV+  V+E+
Sbjct  195  VLTKAFQVDKNVVEF  209



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 163/200 (82%), Gaps = 2/200 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA++++   VFVNGK CK+P +V A DF   GLN PG+ S  +GS V+AVN
Sbjct  24   DPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTAKDFFSSGLNIPGDTSGRVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLARIDFAPYGLNPPHTHPRATE++ V+EGTLYVGFV SN   G  N+
Sbjct  83   VEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANG-DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  142  LITKALKPGDVFVFPIGLIHFQFNMGQTKALAFAGLSSQNPGVITIANAVFGSDPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VL KAFQ++ KV+EYLQ  F
Sbjct  202  VLAKAFQLDKKVVEYLQKSF  221



>ref|XP_007143990.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15984.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=228

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 164/209 (78%), Gaps = 8/209 (4%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA----VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAV  593
            DPSPLQDFCVAIND+K      VFVNGK CK+P   +A+DF F+GL   G+ +NP+GS V
Sbjct  22   DPSPLQDFCVAINDTKTGGIYGVFVNGKFCKDPKFANADDFFFRGLG-AGDTANPVGSKV  80

Query  592  SAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPG  413
            + V VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN    
Sbjct  81   TPVAVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQN--  138

Query  412  MKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPP  233
              N+LFTK L  GDVFVFP GLIHFQ NVG+ NA+A AGLSSQNPGVITIANAVFGS PP
Sbjct  139  -DNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQNPGVITIANAVFGSKPP  197

Query  232  IDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            I  ++L KAFQV+   I+YLQ QFWYNNN
Sbjct  198  ISDEILAKAFQVDKNTIDYLQKQFWYNNN  226



>ref|XP_003618162.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74380.1| germin family protein [Medicago truncatula]
 gb|AFK39197.1| unknown [Medicago truncatula]
Length=220

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 163/204 (80%), Gaps = 6/204 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P     NDF F    K GN SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLATPNDFFFSV--KEGNTSNPLGSKVTPVT  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN++ GLNTLGISLARIDFA  GLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----ENR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ NA+A AGLSSQNPGVITIANAVFGS+P I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANAVFGSNPKISSE  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNN  149
            VLTKAFQV++ +++ LQ QFW +N
Sbjct  196  VLTKAFQVDNNIVDNLQKQFWVDN  219



>ref|XP_009385875.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 157/206 (76%), Gaps = 4/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA  DSK  V VNG +CK+P  V A DF F GL+K GN  N LGS V+AVN
Sbjct  22   DPSPLQDFCVADKDSK--VLVNGFVCKDPKHVTAEDFFFMGLDKAGNTVNKLGSMVTAVN  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN L GLNTLGIS+ RID+ P GLNPPHTHPRATE+LTV+EG L VGFV SN   G  N+
Sbjct  80   VNKLVGLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQLLVGFVTSNTDDG--NR  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ N GH+  IA   LSSQNPG ITIANAVFGS PPI   
Sbjct  138  LFTKMLKKGDVFVFPEGLIHFQFNPGHTKTIAIGALSSQNPGTITIANAVFGSKPPISDD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VL KAFQV+ K I++LQAQFW +NNN
Sbjct  198  VLAKAFQVDKKTIDWLQAQFWTDNNN  223



>gb|AFK49577.1| unknown [Lotus japonicus]
Length=220

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 160/205 (78%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDSK+ VFVNG  CK+P     NDF F    K GN SNPLGS V+ V 
Sbjct  22   DPSPLQDFCVAINDSKSGVFVNGMFCKDPTRATPNDFFFS--VKEGNTSNPLGSKVTPVA  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLARIDFA  GLNPPH+HPR TE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VTEIPGLNTLGISLARIDFARKGLNPPHSHPRGTEILIVLEGTLYVGFVTSNP----ENR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ NA A AGLSSQNPGV TIANAVFGSDP I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNAAAIAGLSSQNPGVTTIANAVFGSDPSISSQ  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  V++YLQ QFW++NN
Sbjct  196  VLTKAFQVDKNVVDYLQKQFWWDNN  220



>emb|CAN70904.1| hypothetical protein VITISV_032927 [Vitis vinifera]
Length=196

 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 156/197 (79%), Gaps = 4/197 (2%)
 Frame = -3

Query  751  PLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVNVNN  572
            PLQDFCVA+ND+K  VFVNGK+CK+P    ANDF F GL  PG  SN LGS V+  NV  
Sbjct  4    PLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGYTSNKLGSMVTPANVAQ  63

Query  571  LAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNKLFT  392
            + GLNTLGISLAR+D+APYGLNPPHTH RATE+LTVLEGTLYVGFV SNP     N+L  
Sbjct  64   IPGLNTLGISLARVDYAPYGLNPPHTHLRATEILTVLEGTLYVGFVTSNP----DNRLIA  119

Query  391  KTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPKVLT  212
            K LY GDVFVFP+GLIHF LNVG + A+A A LSSQNPGVITIANAVFGS P I   VLT
Sbjct  120  KVLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLT  179

Query  211  KAFQVEDKVIEYLQAQF  161
            KAFQV+ KV++YLQ+QF
Sbjct  180  KAFQVDKKVVDYLQSQF  196



>ref|XP_011034307.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=229

 Score =   285 bits (728),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 169/207 (82%), Gaps = 3/207 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ ++   VFVNGK CK+P +V   DF F GLN P ++S+P+GS V+AVN
Sbjct  25   DPSPLQDFCVAMKETDG-VFVNGKFCKDPEQVTEKDFFFAGLNVPRDISSPVGSNVTAVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISL RID+AP+G LNPPHTHPRATE+L V+EGTLYVGF+ SN   G  N
Sbjct  84   VAQIPGLNTLGISLVRIDYAPHGGLNPPHTHPRATEILLVVEGTLYVGFLTSNLAKG-GN  142

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQLNVG +NA+AFA LSSQNPGVITIANAVFG+DPP++P
Sbjct  143  RLITKVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNP  202

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNNN  143
             VLTKAF ++ K++EYLQ Q W +NNN
Sbjct  203  NVLTKAFHLDKKLVEYLQKQIWTDNNN  229



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score =   284 bits (726),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 161/205 (79%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA N SK  VFVNGK+CK+P    ANDF F GLNKPGN +NPLGS V+ VN
Sbjct  22   DPSPLQDFCVADNASK--VFVNGKVCKDPKLAQANDFFFCGLNKPGNTANPLGSRVTPVN  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISL RID+A  G NPPHTHPRATE+LTVLEG+LYVGFV SNP     N+
Sbjct  80   VAQIPGLNTLGISLVRIDYARGGQNPPHTHPRATEILTVLEGSLYVGFVTSNP----DNR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TKT+  GDVFVFP+GLIHFQ NVG  NA+A A LSSQNPGVITIANAVFGS P I   
Sbjct  136  LITKTIQKGDVFVFPEGLIHFQQNVGSKNAVAIAALSSQNPGVITIANAVFGSKPAISND  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV+ KV+  LQ+QFW +NN
Sbjct  196  VLAKAFQVDKKVVNRLQSQFWMDNN  220



>ref|XP_010049995.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010042080.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82840.1| hypothetical protein EUGRSUZ_C04211 [Eucalyptus grandis]
Length=223

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEAQFWYDNN  223



>ref|XP_010049993.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82839.1| hypothetical protein EUGRSUZ_C04210 [Eucalyptus grandis]
Length=223

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEAQFWYDNN  223



>ref|XP_011013026.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 169/207 (82%), Gaps = 3/207 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ ++   VFVNGK CK+P +V   DF F GLN P ++S+P+GS V+AVN
Sbjct  24   DPSPLQDFCVAMKETDG-VFVNGKFCKDPEQVTEKDFFFAGLNVPRDISSPVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISL RID+AP+G LNPPHTHPRATE+L V+EGTLYVGF+ SN   G  N
Sbjct  83   VAQIPGLNTLGISLVRIDYAPHGGLNPPHTHPRATEILLVVEGTLYVGFLTSNLAKG-GN  141

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L PGDVFVFP GLIHFQLNVG +NA+AFA LSSQNPGVITIANAVFG+DPP++P
Sbjct  142  RLITKVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNP  201

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNNN  143
             VLTKAF ++ K++EYLQ Q W +NNN
Sbjct  202  NVLTKAFHLDKKLVEYLQKQIWTDNNN  228



>gb|KCW82834.1| hypothetical protein EUGRSUZ_C04205 [Eucalyptus grandis]
Length=223

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPRQATADDFVFMGLRNPGNTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+  SSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+EYL+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVEYLEAQFWYDNN  223



>ref|XP_010049996.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82841.1| hypothetical protein EUGRSUZ_C04212 [Eucalyptus grandis]
Length=223

 Score =   283 bits (725),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEAQFWYDNN  223



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVA+NDSKAAVFVNGKICK+P  V ++DF   GLNKPGN SNP GS V+   
Sbjct  26   DPDPLQDFCVAVNDSKAAVFVNGKICKDPKTVTSDDFFISGLNKPGNTSNPFGSRVTHAF  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPP-PGMKN  404
            V++L GLNTLGIS+ RIDFAP G+NPPH HPRA+E+L VL+G LY GF+ +NPP P  KN
Sbjct  86   VDDLPGLNTLGISIVRIDFAPNGVNPPHEHPRASEILVVLKGKLYAGFITTNPPNPNHKN  145

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLF K L PGD FVFP+GLIHFQ NVG ++A+A A L+SQNPG++TI  AVFGS+PP+  
Sbjct  146  KLFAKILKPGDAFVFPKGLIHFQYNVGKTSAVAIASLNSQNPGIMTIPKAVFGSEPPVRA  205

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL K+FQV +K++EYLQ+  W  NN
Sbjct  206  DVLVKSFQVREKLVEYLQSLPWTGNN  231



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 160/200 (80%), Gaps = 5/200 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+++ K+AVFVNGK CKNP  V A DFLF+GLN  GN  N  GS V+ VN
Sbjct  27   DPSPLQDFCVAVDEPKSAVFVNGKFCKNPKFVRAEDFLFRGLNIAGNTMNKQGSNVTLVN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGISLARID+AP GLNPPHTHPRATE+L V+EGTL VGFV SNP     NK
Sbjct  87   VDRLPGLNTLGISLARIDYAPNGLNPPHTHPRATEILVVVEGTLLVGFVTSNP-----NK  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQ NVGH  A+AFAGLSSQNPGVITIANAVFGSDPPI   
Sbjct  142  LFTKVLNKGDVFVFPVGLIHFQFNVGHYPALAFAGLSSQNPGVITIANAVFGSDPPISID  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV++ VI  L  QF
Sbjct  202  VLTKAFQVDNNVIHALMKQF  221



>ref|XP_007030267.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10769.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=298

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 5/201 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P  V+A DF F GLNK GN SN LGS V+ VN
Sbjct  25   DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLVNAEDFFFSGLNKQGNTSNQLGSKVTLVN  84

Query  580  VNNLAGLNTLGISLARIDFAPY-GLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  ++GLNTLGISLAR+D+APY GLNPPHTHPRATE+L V+EGTLYVGFV SNP     N
Sbjct  85   VGQISGLNTLGISLARVDYAPYGGLNPPHTHPRATEILVVVEGTLYVGFVTSNP----DN  140

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQ N+G++NA+AF+GLSSQNPG+ TIA AVFGS+P I+P
Sbjct  141  RLITKVLYPGDVFVFPVGLIHFQFNIGNTNAVAFSGLSSQNPGINTIAKAVFGSNPAINP  200

Query  223  KVLTKAFQVEDKVIEYLQAQF  161
            +VL KAFQ++  ++  LQ++ 
Sbjct  201  EVLAKAFQLDKNIVNQLQSRL  221



>gb|EPS67173.1| hypothetical protein M569_07603 [Genlisea aurea]
Length=220

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP+ LQDFCVA+ DS   VFVNGK CKNP  V A+DF+F GLN PGN +N  GSAV+ V 
Sbjct  25   DPTQLQDFCVAVPDSANPVFVNGKFCKNPATVVADDFVFHGLNVPGNTTNKEGSAVTPVF  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLG+++ARIDFAP+GLNPPH HPRA+E L VLEG LYVGFV SNP     NK
Sbjct  85   VSQLPGLNTLGVAMARIDFAPHGLNPPHVHPRASEALLVLEGNLYVGFVTSNP----DNK  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF KTL PGDVFVFPQGLIHFQLNVG +NA+A A L SQNPGVIT+ANAVFGS PPI+P 
Sbjct  141  LFAKTLCPGDVFVFPQGLIHFQLNVGSTNAVAIATLGSQNPGVITVANAVFGSQPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VL KAFQV+  VI YLQAQF
Sbjct  201  VLVKAFQVDKSVISYLQAQF  220



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN +NPLGS V+   
Sbjct  293  DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  350

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+  AGLNTLGIS+AR DFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  351  VDQFAGLNTLGISMARTDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSNQ---LNNT  407

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPG+ITIANAVFGS PPI   
Sbjct  408  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAG  467

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  468  VLTKAFQVDKKVVDYLQAQFWYDNN  492


 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 159/201 (79%), Gaps = 5/201 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGIS+ARIDFAP GLNPPHTHPR +E+L V EGTL VGFV  N    + N 
Sbjct  80   VDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTFNQ---LNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIAN+VFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFW  158
            VLTKAFQV+ KV++YLQAQFW
Sbjct  197  VLTKAFQVDKKVVDYLQAQFW  217



>ref|XP_004489241.1| PREDICTED: putative germin-like protein 2-1-like [Cicer arietinum]
Length=220

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 161/205 (79%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P     NDF F    K G+ SN LGS V+ V 
Sbjct  22   DPSPLQDFCVAINDTKTGVFVNGKFCKDPKLATPNDFFFS--IKEGDTSNSLGSKVTPVT  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN + GLNTLGISLARIDFAP GLNPPHTHPRATE+L VLEGTLYVGFV SNP    +N+
Sbjct  80   VNEILGLNTLGISLARIDFAPKGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----ENR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L  GDVFVFP GLIHFQLNVG+ N +A AGLSSQNPGVITIANAVFGS+P I  +
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNVVAIAGLSSQNPGVITIANAVFGSNPKISSQ  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+  +++ LQ QFW +NN
Sbjct  196  VLTKAFQVDKNIVDNLQKQFWLDNN  220



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 163/200 (82%), Gaps = 2/200 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA++++   VFVNGK CK+P +V A DF   GLN PG+ S  +GS V+AVN
Sbjct  24   DPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTAKDFFSSGLNIPGDTSGRVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGISLARIDFAPYGLNPPHTHPRATE++ V+EGTLYVGFV SN   G  N+
Sbjct  83   VEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANG-DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L PGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  142  LITKALKPGDVFVFPIGLIHFQFNMGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VL KAFQ++ KV++YLQ  F
Sbjct  202  VLAKAFQLDKKVVDYLQKSF  221



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CK+P   +A DF F GL+KPGN SNP+ S V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTEAEDFFFSGLDKPGNTSNPVASNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+ PYG NPPHTHPRATE+LTVLEGTLYVGFV SN     +++
Sbjct  85   VEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTVLEGTLYVGFVTSN----TEDR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
              +K L  GDVFVFP GLIHFQ NVG + A+A A LSSQNPGVITIANAVFGSDPPI+P 
Sbjct  141  FISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAALSSQNPGVITIANAVFGSDPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLT+AFQ++ KV+ YLQ++F
Sbjct  201  VLTRAFQLDKKVVSYLQSRF  220



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 164/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CKNP    A DF  +GLN PGN SN +GS+V+ VN
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  71

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGISL RID+APYG NPPHTHPRATE+LTVLEGTL VGFV SNP    +N+
Sbjct  72   VDVIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNR  127

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF+K L  GDVFVFP GLIHFQ N+GH NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  128  LFSKVLNKGDVFVFPIGLIHFQFNIGHMNAVAIAGLSSQNPGVITIANAVFGSNPPINPD  187

Query  220  VLTKAFQVEDKVIEYLQAQF  161
             L KAFQ++ KV+E+LQA+F
Sbjct  188  FLAKAFQLDKKVVEFLQARF  207



>ref|XP_010024915.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
Length=223

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDS +AV VNGK CK+P    A+DF F     PGN SNPLGS V+   
Sbjct  22   DPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI++AR+DFAPYGLNPPH HPR TE+L V+EGTLYVGFV SN    + N 
Sbjct  82   VDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN+VFGS P I+  
Sbjct  139  LFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W++N+
Sbjct  199  VLTKAFQVDNKLINYLQAQNWFDNH  223



>ref|XP_011038439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=236

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 162/217 (75%), Gaps = 16/217 (7%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLN-----------KPGNVS  614
            DPSPLQDFCVAIND+K  VFVNGK CK+P    ANDF F GLN              N S
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVARNTS  83

Query  613  NPLGSAVSAVNVNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGF  437
            NP+GS V+  NV  + GLNTLGISL RID+APYG LNPPHTHPRATEV+TVLEGTLYVGF
Sbjct  84   NPVGSVVTPANVAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGF  143

Query  436  VLSNPPPGMKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIAN  257
            V SNP     N+L TK L PGDVFVFP GLIHFQ NVG + A A + LSSQNPGVITIAN
Sbjct  144  VTSNP----DNRLITKVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIAN  199

Query  256  AVFGSDPPIDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            AVFGS PPI   VL KAFQV+ K+++YLQ QFWY+NN
Sbjct  200  AVFGSTPPIRSDVLAKAFQVDKKIVDYLQKQFWYDNN  236



>ref|XP_010054506.1| PREDICTED: uncharacterized protein LOC104442816 [Eucalyptus grandis]
Length=448

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND +  VFVNGK CK+P ++ A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPE--VFVNGKFCKDPKQITADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TEVL V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VLTKAFQV+ KV++YLQAQFWY+N  
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNKT  222


 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  249  DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  306

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGIS+ARIDFAP GLNPPHTHPR +E+L V EGTL VGFV SN    + N 
Sbjct  307  VDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSN---QLNNT  363

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIAN+VF S PPI   
Sbjct  364  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISAD  423

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQ QFWY+NN
Sbjct  424  VLTKAFQVDKKVVDYLQVQFWYDNN  448



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  249  DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  306

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGIS+ARIDFAP GLNPPHTHPR +E+L V EGTL VGFV SN    + N 
Sbjct  307  VDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSN---QLNNT  363

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIAN+VFGS PPI   
Sbjct  364  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISAD  423

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV+ KV++YLQAQFWY+NN
Sbjct  424  VLTKAFQVDKKVVDYLQAQFWYDNN  448


 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 162/206 (79%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND +  VFVNGK CK+P +V A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPE--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFA  GLNPPHTHPR TEVL V EGTL V FV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VLTKAFQV+ KV++YLQAQFWY+N  
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNKT  222



>gb|KCW61443.1| hypothetical protein EUGRSUZ_H04174 [Eucalyptus grandis]
Length=222

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDS +AV VNGK CK+P    A+DF F     PGN SNPLGS V+   
Sbjct  21   DPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNPLGSKVTTAF  80

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI++AR+DFAPYGLNPPH HPR TE+L V+EGTLYVGFV SN    + N 
Sbjct  81   VDQFPGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQ---LNNT  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN+VFGS P I+  
Sbjct  138  LFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W++N+
Sbjct  198  VLTKAFQVDNKLINYLQAQNWFDNH  222



>ref|XP_008775104.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=222

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPS LQDFCVA  D K+ + VNG +CK PM V A+DF F GL+ PGN SN LGS V+ VN
Sbjct  22   DPSQLQDFCVA--DLKSPILVNGFVCKPPMHVTADDFFFSGLDMPGNTSNQLGSKVTQVN  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN +AGLNTLGISLARID+ PYGLNPPHTHPRATEVLTVLEGTLY+GFV SN   G  N 
Sbjct  80   VNQIAGLNTLGISLARIDYEPYGLNPPHTHPRATEVLTVLEGTLYLGFVTSNTNNG--NL  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQ N G + A+A + LSSQNPGVITIANAVFGS+PPI   
Sbjct  138  LFTKMLKKGDVFVFPQGLIHFQFNYGPTPAVALSALSSQNPGVITIANAVFGSNPPISDA  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV    I+YLQAQFW +NN
Sbjct  198  VLAKAFQVGKDTIKYLQAQFWVDNN  222



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CK+P    A DF F GL+KPGN SN   S V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAEDFFFSGLDKPGNTSNAAASNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGIS+ RID+ PYG NPPHTHPRATE+LTVLEGTLYVGFV SN     +N+
Sbjct  85   VDKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTVLEGTLYVGFVTSN----TENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ NVG + A+A AGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  141  LISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLT+AFQ++ KV+ YLQ++F
Sbjct  201  VLTRAFQLDKKVVSYLQSRF  220



>gb|KCW61437.1| hypothetical protein EUGRSUZ_H04167 [Eucalyptus grandis]
Length=222

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAINDS +AV VNGK CK+P    A+DF F     PGN SNPLGS V+   
Sbjct  21   DPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNPLGSKVTTAF  80

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI++AR+DFAPYGLNPPH HPR TE+L V+EGTLYVGFV SN    + N 
Sbjct  81   VDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQ---LNNT  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN+VFGS P I+  
Sbjct  138  LFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W++N+
Sbjct  198  VLTKAFQVDNKLINYLQAQNWFDNH  222



>ref|XP_010051710.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82838.1| hypothetical protein EUGRSUZ_C04209 [Eucalyptus grandis]
Length=223

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  PGN S+PLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSSPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEAQFWYDNN  223



>ref|XP_003536153.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Glycine 
max]
 gb|ACG69482.1| germin-like protein 6 [Glycine max]
Length=232

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 162/208 (78%), Gaps = 8/208 (4%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA----VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAV  593
            DPSPLQDFCVAIND+KA     VFVNGK CK+P    A+DF F GL  PG+ +N  GS V
Sbjct  22   DPSPLQDFCVAINDTKAGGLYGVFVNGKFCKDPKFAYADDFFFGGLG-PGDTANAQGSKV  80

Query  592  SAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPG  413
            +AV VN + GLNTLGISLARIDFAP GLNPPHTHPR TE+L VLEGTLYVGFV SN    
Sbjct  81   TAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQN--  138

Query  412  MKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPP  233
              N+LFTK LY GDVFVFP GLIHFQ NVG+ NA+A A LSSQNPGVITIANAVFGS PP
Sbjct  139  -DNRLFTKVLYKGDVFVFPIGLIHFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSKPP  197

Query  232  IDPKVLTKAFQVEDKVIEYLQAQFWYNN  149
            I  +VL KAFQV+  +++YLQ QF YNN
Sbjct  198  ISDEVLAKAFQVDKNIVDYLQKQFGYNN  225



>ref|XP_010049991.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82836.1| hypothetical protein EUGRSUZ_C04207 [Eucalyptus grandis]
Length=223

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+ QFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEVQFWYDNN  223



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DP PLQDFCVAIN++  AVFVNGK CK+P    ANDF    L   GN SNP+GS V+A N
Sbjct  27   DPDPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFSDKLRYAGNTSNPVGSIVTAAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGIS AR+DFAP G+NPPHTHPRATE+  VLEG+LYVGFV SN   G  N+
Sbjct  87   VDVIPGLNTLGISFARVDFAPNGVNPPHTHPRATEIFIVLEGSLYVGFVTSN-INGDGNR  145

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP GLIHFQLNVG +NA+A A   SQNPGVITIANAVFGS PPI+P 
Sbjct  146  LFTKVLNKGDVFVFPIGLIHFQLNVGKTNALAIAAFGSQNPGVITIANAVFGSKPPINPD  205

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ+++ V++YLQ QFWYNN+
Sbjct  206  VLTKAFQLDNNVVDYLQKQFWYNNS  230



>emb|CBI36815.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CK+P    A DF F GL+KPGN SN + S V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNAVASNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+ PYG NPPHTHPRATE+LTVLEGTLYVGFV SN     +N+
Sbjct  85   VEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTVLEGTLYVGFVTSN----TENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ N+GH+NA+A AGLSSQNPGVITIANAVFGSDP I+P 
Sbjct  141  LISKVLNKGDVFVFPMGLIHFQFNIGHTNAVAIAGLSSQNPGVITIANAVFGSDPSINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
             LT+AFQ++  V+ YLQ++F
Sbjct  201  FLTRAFQLDKNVVNYLQSRF  220



>ref|XP_010049992.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82837.1| hypothetical protein EUGRSUZ_C04208 [Eucalyptus grandis]
Length=223

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ VFVNGK CK+P +  A+DF+F GL  P N SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPANTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEAQFWYDNN  223



>ref|XP_008776811.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Phoenix 
dactylifera]
Length=206

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 160/205 (78%), Gaps = 2/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPS LQDFCVA   S  AV VNG +CK PM V A+DF F GL+ P N SN LGS V+ VN
Sbjct  4    DPSQLQDFCVADLKSPNAVLVNGFVCKPPMHVTADDFFFSGLDMPDNTSNQLGSKVTLVN  63

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN +AGLNTLGISLARID+APYGLNPPHTHP+ATE+LTVLEGTLYVGFV SN   G  N 
Sbjct  64   VNQIAGLNTLGISLARIDYAPYGLNPPHTHPQATEILTVLEGTLYVGFVTSNTNNG--NL  121

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ N G ++A+A A LSSQNPGVITIANAVFGS+PPI   
Sbjct  122  LFTKMLKKGDVFVFPEGLIHFQFNYGPTHAVAVAALSSQNPGVITIANAVFGSNPPISDA  181

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VL KAFQV    I+YLQAQFW  NN
Sbjct  182  VLAKAFQVGKDTIKYLQAQFWVANN  206



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score =   281 bits (720),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 159/199 (80%), Gaps = 4/199 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CK+P    A DF F GL+KPGN SN + S V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNAVASNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+ PYG NPPHTHPRATE+LTVLEGTLYVGFV SN     +N+
Sbjct  85   VEKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTVLEGTLYVGFVTSN----TENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ NVG + A+A AGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  141  LISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQ  164
            VLT+AFQ++ KV+ YLQ++
Sbjct  201  VLTRAFQLDKKVVSYLQSR  219



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score =   281 bits (719),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 159/200 (80%), Gaps = 5/200 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN  NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+  AGLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFAGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPG+ITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQAQF
Sbjct  197  VLTKAFQVDKKVVDYLQAQF  216



>ref|XP_002284624.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36787.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 164/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI + + AVFVNGK CKNP    A DF FQGLN PGN +N +GS V+ VN
Sbjct  25   DPSPLQDTCVAIPEPENAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTANRVGSNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGISL RID+APYG NPPHTHPRATE+LTVLEGTL VGFV SNP    +N+
Sbjct  85   VDAIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF+K L  GDVFVFP GLIHFQ N+GH+NA+A AGL+SQNPGVITIA+AVFGS+PPI+P 
Sbjct  141  LFSKVLNKGDVFVFPIGLIHFQFNIGHTNAVAIAGLNSQNPGVITIADAVFGSNPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
             L +AFQ++ KV+EYLQA+F
Sbjct  201  FLARAFQLDKKVVEYLQARF  220



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   281 bits (719),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CK+P    A DF F GL+KPGN SN + S V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNAVASNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+ PYG NPPHTHPRATE+LTVLEGTLYVGFV SN     +N+
Sbjct  85   VEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTVLEGTLYVGFVTSN----TENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ N+G +NA+A A LSSQNPGVITIANAVFGSDPPI+P 
Sbjct  141  LISKVLNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSSQNPGVITIANAVFGSDPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLT+AFQ++  V++YLQ++F
Sbjct  201  VLTRAFQLDKSVVKYLQSRF  220



>emb|CBI39477.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI+D KAAVFVNGK CK+P      DF F GL+ P N SNP+GS V+ VN
Sbjct  25   DPSPLQDTCVAIDDPKAAVFVNGKFCKDPKLATPEDFFFSGLHIPRNTSNPVGSTVTPVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  +AGLNTLGIS+AR+D+APYGLNPPHTHPRATE+L VL+GTLYVGFV SNP     N+
Sbjct  85   VAQIAGLNTLGISMARVDYAPYGLNPPHTHPRATEILVVLKGTLYVGFVTSNP----DNR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP  LIHFQLNVGH+NA+A A L SQNPGVITIANAVFGS+PPI   
Sbjct  141  LISKVLNKGDVFVFPISLIHFQLNVGHTNAVAIAALGSQNPGVITIANAVFGSNPPISAD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQ++  V++YLQ+ F
Sbjct  201  VLTKAFQLDKNVVDYLQSSF  220



>ref|XP_004291649.1| PREDICTED: germin-like protein subfamily 1 member 11-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   281 bits (720),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 165/209 (79%), Gaps = 8/209 (4%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAA---VFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVS  590
            DPSPLQDFCVAIN ++     VFVNGK CK+P    ANDF F GL  P   +N +GS V+
Sbjct  26   DPSPLQDFCVAINSAQFPQFPVFVNGKFCKDPKMATANDFFFAGLQIPKPTANAVGSTVT  85

Query  589  AVNVNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPG  413
            A NV  + GLNTLGISLARID+AP G LNPPHTHPRA+EVL VLEGTLYVGFV SNP   
Sbjct  86   AANVEQIPGLNTLGISLARIDYAPNGGLNPPHTHPRASEVLVVLEGTLYVGFVTSNP---  142

Query  412  MKNKLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPP  233
              NKL +K L  GDVFVFP GLIHFQLN+G  NA+A A LSSQNPGVITIANAVFG++PP
Sbjct  143  -DNKLISKVLNKGDVFVFPVGLIHFQLNIGPVNAVALAALSSQNPGVITIANAVFGANPP  201

Query  232  IDPKVLTKAFQVEDKVIEYLQAQFWYNNN  146
            I+P VL+KAFQV++K++EYLQ QFWYNNN
Sbjct  202  INPDVLSKAFQVDEKLVEYLQKQFWYNNN  230



>ref|XP_006375871.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
 gb|ERP53668.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
Length=221

 Score =   281 bits (718),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 159/206 (77%), Gaps = 6/206 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P     NDF F GLN   N SNP+GS V+  N
Sbjct  21   DPSPLQDFCVAINDTKD-VFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPAN  79

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGISL RID+APYG LNPPHTHPRATE+LTVLEGTLYVGFV SNP     N
Sbjct  80   VAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DN  135

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK L+PGDVFVFP GLIHFQ NVG + A A   LSSQNPGVITI NAVFGS PPI  
Sbjct  136  RLITKVLHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRS  195

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VL KAFQV+  +++YLQ QFWY+NN
Sbjct  196  DVLAKAFQVDKNLVDYLQKQFWYDNN  221



>ref|XP_010051709.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82835.1| hypothetical protein EUGRSUZ_C04206 [Eucalyptus grandis]
Length=223

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVA ND ++ V VNGK CK+P +  A+DF+F GL  PGN SNPLGS V+   
Sbjct  22   DPSPLQDICVATNDLESGVSVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V    GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V+EGTL VGFV S+    + N 
Sbjct  82   VQQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK LY GDVFVFP GLIHFQLN+G++ A+AF+GLSSQNPG+ITIANAVFG+  PI   
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISAD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQ++ KV+++L+AQFWY+NN
Sbjct  199  VLTKAFQLDKKVVDHLEAQFWYDNN  223



>ref|XP_007030270.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10772.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=329

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 163/198 (82%), Gaps = 6/198 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+K  VFVNGK CK+P   +A+DF F GLNK GN SN LGS V+ VN
Sbjct  101  DPSPLQDFCVAINDAKNGVFVNGKFCKDPKLANADDFFFSGLNKQGNTSNQLGSKVTPVN  160

Query  580  VNNLAGLNTLGISLARIDFAPY-GLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  + GLNTLGIS AR+D+APY GLNPPHTHPRATE+L V+EGTLYVGFV SNP     N
Sbjct  161  VEQIPGLNTLGISFARVDYAPYGGLNPPHTHPRATEILVVVEGTLYVGFVTSNP----DN  216

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +L TK LYPGDVFVFP GLIHFQ N G++NA+AFAGLSSQNPGVITIANAVFGS+P I+P
Sbjct  217  RLITKVLYPGDVFVFPVGLIHFQFNKGNTNAVAFAGLSSQNPGVITIANAVFGSNPAINP  276

Query  223  KVLTKAFQVEDKVIEYLQ  170
            +VL KAFQ+E K IE ++
Sbjct  277  EVLAKAFQLE-KNIERMK  293



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND  +AVFVNGK CK+P  V A+DF F     PG+ SNPLGS V+   
Sbjct  22   DPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI+ AR+DFAPYGLNPPH HPR TE+L V+EGTL+VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN VFGS PPI+  
Sbjct  139  LFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W+ N+
Sbjct  199  VLTKAFQVDNKLINYLQAQSWFENH  223



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CK+P    A DF F GL+KPGN SN + S V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNAVASNVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLGIS+ RID+ PYG NPPHTHPRATE+LTVL GTLYVGFV SNP    +N+
Sbjct  85   VEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTVLGGTLYVGFVTSNP----ENR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K L  GDVFVFP GLIHFQ NVG + A+A A LSSQNPGVITIANAVFGSDPPI+P 
Sbjct  141  LISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAALSSQNPGVITIANAVFGSDPPINPD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLT+AFQ++ KV+ YLQ++F
Sbjct  201  VLTRAFQLDKKVVSYLQSRF  220



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 159/200 (80%), Gaps = 5/200 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A+DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+  AGLNTLGIS+AR DFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFAGLNTLGISMARTDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSNQ---LNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPG+ITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAG  196

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQAQF
Sbjct  197  VLTKAFQVDKKVVDYLQAQF  216



>ref|XP_009402547.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402548.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402549.1| PREDICTED: putative germin-like protein 2-1 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=221

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA  DSK  V VNG +CK+P  V A DF F GL+K GN  N LGS V+AVN
Sbjct  22   DPSPLQDFCVADKDSK--VLVNGFVCKDPKHVTAEDFFFMGLDKAGNTVNKLGSMVTAVN  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            VN L GLNTLGIS+ RID+ P GLNPPHTHPRATE+LTV+EG L VGFV SN      N+
Sbjct  80   VNKLIGLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQLLVGFVTSNT----DNR  135

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFP+GLIHFQ N G+ N IA   LSSQNPG ITIANAVFGS PPI   
Sbjct  136  LFTKMLKKGDVFVFPEGLIHFQFNPGNCNTIAIGALSSQNPGTITIANAVFGSKPPISDD  195

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VL KAFQV+ K I++LQAQFW +NNN
Sbjct  196  VLAKAFQVDKKTIDWLQAQFWMDNNN  221



>ref|NP_001267940.1| germin-like protein 1 [Vitis vinifera]
 gb|ABL60872.1| germin-like protein 1 [Vitis vinifera]
Length=207

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CKNP    A DF  +GLN PGN SN +GS+V+ VN
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  71

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGISL RID+APYG NPPHTHPRATE+LTVLEGTL VGFV SNP    +N+
Sbjct  72   VDVIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNR  127

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF+K L  GDVFVFP GLIHFQ N+GH NA+A AGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  128  LFSKVLNKGDVFVFPIGLIHFQFNIGHMNAVAIAGLSSQNPGVITIANAVFGSNPPINPD  187

Query  220  VLTKAFQVEDKVIEYLQAQF  161
             L KAFQ++ KV E+LQA+F
Sbjct  188  FLAKAFQLDKKVGEFLQARF  207



>emb|CAN71140.1| hypothetical protein VITISV_005471 [Vitis vinifera]
Length=220

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQD CVAI++ K AVFVNGK CKNP    A DF  +GLN PGN SN +GS+V+ VN
Sbjct  25   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  84

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLGISL RID+APYG NPPHTHPRATE+LTVLEGTL VGFV SNP    +N+
Sbjct  85   VDVIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNR  140

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF+K L  GDVFVFP GLIHFQ N+GH NA+A AGLSSQNPGVITIANAVFGS+PPI+  
Sbjct  141  LFSKVLNKGDVFVFPIGLIHFQFNIGHFNAVAIAGLSSQNPGVITIANAVFGSNPPINSD  200

Query  220  VLTKAFQVEDKVIEYLQAQF  161
             L KAFQ++ KV+E+LQA+F
Sbjct  201  FLAKAFQLDKKVVEFLQARF  220



>ref|XP_004142551.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cucumis 
sativus]
 gb|KGN66717.1| hypothetical protein Csa_1G662810 [Cucumis sativus]
Length=223

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND+++ VF+NGK CK+P     NDFLFQGLN PGN  NP GS V+ VN
Sbjct  22   DPSPLQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFLFQGLNIPGNTENPNGSNVTLVN  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ L GLNTLGISLARID+APYGLNPPHTHPRATE+L V+EG+L VGFV SNP     NK
Sbjct  82   VDKLPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVMEGSLLVGFVTSNP----DNK  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LF+K LY GDVFVFP GLIHFQ NVG + A+AFAGL SQNPGVITIANAVFGS P I   
Sbjct  138  LFSKVLYKGDVFVFPVGLIHFQFNVGRTPALAFAGLGSQNPGVITIANAVFGSKPLIPVD  197

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VL KAFQ++  ++ YLQ +F
Sbjct  198  VLEKAFQLDANIVAYLQRRF  217



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND  +AVFVNGK CK+P  V A+DF F     PG+ SNPLGS V+   
Sbjct  22   DPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNPLGSKVTTAF  81

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI+ AR+DFAPYGLNPPH HPR TE+L V+EGTL+VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQ---LNNT  138

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN VFGS PPI+  
Sbjct  139  LFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVD  198

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W+ N+
Sbjct  199  VLTKAFQVDNKLINYLQAQNWFENH  223



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 161/200 (81%), Gaps = 2/200 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA++++   VFVNGK CK+P +V   DF   GLN PG+ S  +GS V+AVN
Sbjct  24   DPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTEKDFFSSGLNIPGDTSGRVGSNVTAVN  82

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            +  + GLNTLGIS ARIDFAPYGLNPPHTHPRATE++ V+EGTLYVGFV SN   G  N+
Sbjct  83   IEKIPGLNTLGISFARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANG-DNR  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L TK L PGDVFVFP GLIHFQ NVG + A+AFAGLSSQNPGVITIANAVFGSDPPI+P 
Sbjct  142  LITKALKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPD  201

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VL KAFQ++ KV++YLQ  F
Sbjct  202  VLAKAFQLDKKVVDYLQKAF  221



>ref|XP_010528770.1| PREDICTED: germin-like protein subfamily 1 member 18 [Tarenaya 
hassleriana]
Length=252

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K+ VFVNG+ CK+P   +ANDF F GLNKPGN +N +GS V+ VN
Sbjct  54   DPSPLQDFCVAINDLKSGVFVNGRFCKDPQLANANDFFFSGLNKPGNTNNQVGSNVTTVN  113

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+ + GLNTLG+SL RID+APYG NPPHTHPRA+E+L V+EGTL VGFV SN      N+
Sbjct  114  VDQIPGLNTLGVSLVRIDYAPYGQNPPHTHPRASEILVVIEGTLLVGFVSSNQD---NNR  170

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             F+K LYPGDVFVFP G+IHFQ N+G   A+AFAGL SQNPGVITIANAVFGS+PPI+P+
Sbjct  171  FFSKVLYPGDVFVFPIGMIHFQANIGKVPAVAFAGLGSQNPGVITIANAVFGSNPPINPE  230

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            +L +AFQ++ K+++ L+A+F
Sbjct  231  ILARAFQLDVKIVKELEAKF  250



>gb|KDP23769.1| hypothetical protein JCGZ_23602 [Jatropha curcas]
Length=223

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ + K A+FVNGK CK+P    ANDF F GLN PGN +N +GS V+ VN
Sbjct  24   DPSPLQDFCVAVEEPKNAIFVNGKFCKDPNLAKANDFSFSGLNIPGNTNNGVGSNVTLVN  83

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V+ L GLNTLGISLAR+D+APYG LNPPH HPRATE+L VL+GTLYVGFV SNP     +
Sbjct  84   VDLLPGLNTLGISLARLDYAPYGGLNPPHIHPRATEILVVLKGTLYVGFVTSNP-----S  138

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            +LF K LYPGDVFVFP GLIHFQLNV  + A+AFAGLSSQNPGVITIANA FGSDPPI+P
Sbjct  139  RLFAKVLYPGDVFVFPIGLIHFQLNVAKTEAVAFAGLSSQNPGVITIANATFGSDPPINP  198

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNN  149
             VL KAFQ+++ V+ YLQ  F  +N
Sbjct  199  DVLAKAFQLDEDVVAYLQKLFGGSN  223



>ref|XP_010066343.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066344.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066348.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 gb|KCW64220.1| hypothetical protein EUGRSUZ_G01870 [Eucalyptus grandis]
 gb|KCW64221.1| hypothetical protein EUGRSUZ_G01871 [Eucalyptus grandis]
 gb|KCW64224.1| hypothetical protein EUGRSUZ_G01874 [Eucalyptus grandis]
Length=222

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND  +AVFVNGK CK+P  V A+DF F     PG+ SNPLGS V+   
Sbjct  21   DPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNPLGSKVTTAF  80

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGI+ AR+DFAPYGLNPPH HPR TE+L V+EGTL+VGFV SN    + N 
Sbjct  81   VDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQ---LNNT  137

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            LFTK L  GDVFVFPQGLIHFQLN+G +NA+AFA LSSQNPG+ITIAN VFGS PPI+  
Sbjct  138  LFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVD  197

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNN  146
            VLTKAFQV++K+I YLQAQ W+ N+
Sbjct  198  VLTKAFQVDNKLINYLQAQNWFENH  222



>ref|XP_002276445.2| PREDICTED: uncharacterized protein LOC100254460 [Vitis vinifera]
Length=546

 Score =   290 bits (741),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+   VFVNGK C++P     NDF F GL  PGN SN LGS V+  N
Sbjct  351  DPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRLPGNTSNKLGSMVTPAN  410

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+APYGLNPPH HPRATE+LTVLEGTLYVGFV SNP    +N+
Sbjct  411  VAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGTLYVGFVTSNP----ENR  466

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A LSSQNPGVITIA AVFGS+P I   
Sbjct  467  LISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIAKAVFGSNPAISAD  526

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+  V+EYLQ+QF
Sbjct  527  VLTKAFQVDKNVVEYLQSQF  546


 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 159/206 (77%), Gaps = 4/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVA+ND+  +VFV+GK CK+P     N+F F GL  PGN SN LGS V+  N
Sbjct  26   DPSPLQDFCVAVNDTNDSVFVSGKFCKDPKLATPNNFFFSGLRLPGNTSNKLGSMVTPAN  85

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V  + GLNTLG+SLAR+D+A YGLNPPH HPRATE+LTVLEGTLYVGFV SNP     N 
Sbjct  86   VEQIPGLNTLGVSLARVDYAAYGLNPPHIHPRATEILTVLEGTLYVGFVTSNP----DNS  141

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
            L +K LY GDVFVFPQGLIHFQLNVG +NA+A A L SQN GVITIANAVFGS P I   
Sbjct  142  LISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLGSQNLGVITIANAVFGSKPAISVD  201

Query  220  VLTKAFQVEDKVIEYLQAQFWYNNNN  143
            VLTKAFQV+  VI  LQ+QFW +N+N
Sbjct  202  VLTKAFQVDKNVINNLQSQFWTDNHN  227


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +2

Query  323  SNVELEMNETLWEHENISGI*CFSEELVFHSWWWIRKNESNVEGALQDREDFGSSRVGVR  502
            S++ELE+NE LWE EN+S +    +E V      IR  +++++   QD ED   SRV V 
Sbjct  234  SHIELEVNENLWEDENVSLVKDPGDEAVLR----IRGEKAHIKCPFQDNEDLCGSRVDVG  289

Query  503  RVETIRCKINTS*RNTKSIQSS*VIH  580
            RV+TI   IN S  N K ++S  + H
Sbjct  290  RVKTIWRIINLSQGNAKGVESRYLCH  315



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 161/206 (78%), Gaps = 5/206 (2%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPS LQDFCVA+ ++   VFVNGK CK+P  V  +DF F GL  PGN SN +GS V+  N
Sbjct  29   DPSSLQDFCVALKNTD--VFVNGKFCKDPKLVTEDDFFFSGLRMPGNTSNAVGSKVTPAN  86

Query  580  VNNLAGLNTLGISLARIDFAPYG-LNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKN  404
            V  +AGLNTLGISLARID+AP G LNPPHTHPRA+E L V+EGTLYVGFV SN   G  N
Sbjct  87   VEQIAGLNTLGISLARIDYAPNGGLNPPHTHPRASEFLVVMEGTLYVGFVTSNTDNG--N  144

Query  403  KLFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDP  224
            KLFTK LYPGDVFVFP GLIHFQ N+G   A+A AGLSSQNPG ITIANAVFGS PPI  
Sbjct  145  KLFTKVLYPGDVFVFPVGLIHFQFNIGKVKAVAIAGLSSQNPGAITIANAVFGSKPPIKF  204

Query  223  KVLTKAFQVEDKVIEYLQAQFWYNNN  146
             VLTKAFQV++ V++YLQ QFWY+NN
Sbjct  205  DVLTKAFQVDNNVVQYLQNQFWYDNN  230



>gb|KCW44233.1| hypothetical protein EUGRSUZ_L02343 [Eucalyptus grandis]
Length=231

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -3

Query  760  DPSPLQDFCVAINDSKAAVFVNGKICKNPMEVDANDFLFQGLNKPGNVSNPLGSAVSAVN  581
            DPSPLQDFCVAIND K  VFVNGK CK+P +V A DFLF+G   PGN +NPLGS V+   
Sbjct  22   DPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  580  VNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVLTVLEGTLYVGFVLSNPPPGMKNK  401
            V+   GLNTLGIS+ARIDFAP GLNPPHTHPR TE+L V EGTL VGFV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNT  136

Query  400  LFTKTLYPGDVFVFPQGLIHFQLNVGHSNAIAFAGLSSQNPGVITIANAVFGSDPPIDPK  221
             FTK LY GDVFVFP GLIHFQLN+G + A+AFA LSSQNPGVITIANAVFGS PPI   
Sbjct  137  FFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  220  VLTKAFQVEDKVIEYLQAQF  161
            VLTKAFQV+ KV++YLQAQF
Sbjct  197  VLTKAFQVDKKVVDYLQAQF  216



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1838885864684