BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24390_g2_i7 len=2606 path=[15019:0-35 @3434@!:36-813 15245:814-824
4426:825-975 12086:976-1148 4577:1149-1242 4671:1243-2605]

Length=2606
                                                                      Score     E

ref|XP_011090295.1|  PREDICTED: scarecrow-like protein 6                427   1e-132   
ref|XP_009762628.1|  PREDICTED: scarecrow-like protein 22               419   1e-129   
emb|CDP09504.1|  unnamed protein product                                419   6e-129   
ref|XP_011093313.1|  PREDICTED: scarecrow-like protein 27               417   7e-129   
ref|XP_006347894.1|  PREDICTED: scarecrow-like protein 22-like          415   3e-128   
ref|XP_010325595.1|  PREDICTED: scarecrow-like protein 22               415   4e-128   
ref|XP_009591500.1|  PREDICTED: scarecrow-like protein 22               406   6e-125   
emb|CBI38908.3|  unnamed protein product                                393   6e-122   
ref|XP_010661679.1|  PREDICTED: scarecrow-like protein 27               393   5e-120   
ref|XP_009374164.1|  PREDICTED: scarecrow-like protein 27               390   5e-119   
ref|XP_007052139.1|  GRAS family transcription factor                   389   8e-119   
gb|KDP28794.1|  hypothetical protein JCGZ_14565                         387   1e-118   
gb|EPS74456.1|  hypothetical protein M569_00292                         373   2e-117   
ref|XP_009375779.1|  PREDICTED: scarecrow-like protein 22               382   2e-116   
ref|XP_008371269.1|  PREDICTED: scarecrow-like protein 6                382   6e-116   
ref|XP_008341645.1|  PREDICTED: scarecrow-like protein 22               382   7e-116   
ref|XP_009349895.1|  PREDICTED: scarecrow-like protein 6                379   1e-115   
gb|AEL95438.1|  GRAS transcription factor                               368   4e-115   
ref|XP_006375288.1|  hypothetical protein POPTR_0014s05940g             377   5e-115   
ref|XP_009342426.1|  PREDICTED: scarecrow-like protein 6                379   1e-114   
ref|XP_009611444.1|  PREDICTED: uncharacterized protein LOC104104...    393   3e-114   
ref|XP_009802870.1|  PREDICTED: uncharacterized protein LOC104248329    393   5e-114   
ref|XP_002511661.1|  hypothetical protein RCOM_1610560                  377   5e-114   Ricinus communis
ref|XP_008232583.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    377   9e-114   
ref|XP_004306953.1|  PREDICTED: scarecrow-like protein 6-like           376   1e-113   
ref|XP_006375286.1|  hypothetical protein POPTR_0014s05910g             375   2e-113   
ref|XP_006347902.1|  PREDICTED: uncharacterized protein LOC102580...    390   2e-113   
ref|XP_006347906.1|  PREDICTED: uncharacterized protein LOC102580...    390   2e-113   
ref|XP_010325553.1|  PREDICTED: uncharacterized protein LOC101252...    389   1e-112   
ref|XP_010325546.1|  PREDICTED: uncharacterized protein LOC101252...    389   1e-112   
ref|XP_007220242.1|  hypothetical protein PRUPE_ppa001781mg             374   2e-112   
ref|XP_002302518.1|  scarecrow transcription factor family protein      368   4e-112   Populus trichocarpa [western balsam poplar]
ref|XP_006445315.1|  hypothetical protein CICLE_v10019094mg             370   5e-112   
gb|ACV95482.1|  SCL6                                                    370   1e-111   Citrus trifoliata [hardy orange]
ref|XP_002301269.1|  hypothetical protein POPTR_0002s14550g             370   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011033505.1|  PREDICTED: scarecrow-like protein 22 isoform X2    368   3e-111   
ref|XP_011033489.1|  PREDICTED: scarecrow-like protein 22 isoform X1    368   4e-111   
gb|KGN55872.1|  hypothetical protein Csa_3G020600                       370   6e-111   
ref|XP_004147202.1|  PREDICTED: scarecrow-like protein 27-like          370   6e-111   
ref|XP_004169643.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    370   6e-111   
ref|XP_010088896.1|  hypothetical protein L484_020885                   367   6e-110   
emb|CDP09497.1|  unnamed protein product                                377   2e-109   
ref|XP_004515466.1|  PREDICTED: scarecrow-like protein 27-like is...    364   3e-109   
ref|XP_004515465.1|  PREDICTED: scarecrow-like protein 27-like is...    364   3e-109   
ref|XP_010056372.1|  PREDICTED: scarecrow-like protein 22               364   3e-109   
ref|XP_008448862.1|  PREDICTED: scarecrow-like protein 6                365   5e-109   
ref|XP_006440333.1|  hypothetical protein CICLE_v10018916mg             364   2e-108   
ref|XP_002511652.1|  nucleotidyltransferase, putative                   375   2e-108   Ricinus communis
gb|KDO61473.1|  hypothetical protein CISIN_1g042460mg                   362   2e-108   
ref|XP_011017463.1|  PREDICTED: scarecrow-like protein 6 isoform X2     360   3e-108   
ref|XP_010056373.1|  PREDICTED: scarecrow-like protein 6                361   3e-108   
ref|XP_011017462.1|  PREDICTED: scarecrow-like protein 6 isoform X1     360   5e-108   
ref|XP_006477215.1|  PREDICTED: scarecrow-like protein 27-like          362   6e-108   
ref|XP_011017458.1|  PREDICTED: scarecrow-like protein 22               359   1e-107   
gb|KEH16798.1|  GRAS family transcription regulator                     359   3e-107   
ref|XP_006445316.1|  hypothetical protein CICLE_v10019083mg             358   3e-107   
gb|KEH16799.1|  GRAS family transcription regulator                     358   3e-107   
ref|XP_011093337.1|  PREDICTED: uncharacterized protein LOC105173333    372   6e-107   
ref|XP_004298643.1|  PREDICTED: uncharacterized protein LOC101309831    359   1e-106   
ref|XP_006573232.1|  PREDICTED: scarecrow-like protein 27-like          358   1e-106   
ref|XP_007140802.1|  hypothetical protein PHAVU_008G143400g             357   1e-106   
gb|KDP28800.1|  hypothetical protein JCGZ_14571                         371   2e-106   
ref|XP_003538071.1|  PREDICTED: scarecrow-like protein 6-like           354   2e-105   
gb|KDP39855.1|  hypothetical protein JCGZ_03386                         353   2e-105   
ref|XP_009343062.1|  PREDICTED: scarecrow-like protein 6                350   5e-105   
ref|XP_007210362.1|  hypothetical protein PRUPE_ppa001561mg             352   3e-104   
ref|XP_008238556.1|  PREDICTED: scarecrow-like protein 27               353   4e-104   
emb|CBI16583.3|  unnamed protein product                                362   4e-104   
ref|XP_011033759.1|  PREDICTED: uncharacterized protein LOC105132...    360   5e-104   
ref|XP_008367218.1|  PREDICTED: scarecrow-like protein 27               352   7e-104   
ref|XP_004163758.1|  PREDICTED: scarecrow-like protein 6-like           350   9e-104   
ref|XP_008458131.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    350   1e-103   
ref|XP_007052160.1|  Nucleotidyltransferase family protein isoform 4    362   1e-103   
ref|XP_007052158.1|  Nucleotidyltransferase family protein isoform 2    362   1e-103   
ref|XP_004140608.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    349   1e-103   
ref|XP_009342859.1|  PREDICTED: scarecrow-like protein 22               350   1e-103   
ref|XP_010661315.1|  PREDICTED: uncharacterized protein LOC100265...    362   2e-103   
ref|XP_010661312.1|  PREDICTED: uncharacterized protein LOC100265...    362   2e-103   
ref|XP_008377890.1|  PREDICTED: scarecrow-like protein 22               350   2e-103   
ref|XP_009343059.1|  PREDICTED: scarecrow-like protein 22               350   2e-103   
ref|XP_011033716.1|  PREDICTED: uncharacterized protein LOC105132...    360   5e-103   
ref|XP_009351036.1|  PREDICTED: scarecrow-like protein 22               349   6e-103   
ref|XP_002528940.1|  conserved hypothetical protein                     347   2e-102   Ricinus communis
gb|EYU30539.1|  hypothetical protein MIMGU_mgv1a025631mg                357   3e-102   
ref|XP_002320705.2|  hypothetical protein POPTR_0014s06140g             356   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_006368204.1|  hypothetical protein POPTR_0001s00480g             344   2e-101   
gb|KHN47911.1|  Scarecrow-like protein 6                                340   5e-101   
ref|XP_010264288.1|  PREDICTED: uncharacterized protein LOC104602...    354   8e-101   
emb|CBI31914.3|  unnamed protein product                                335   1e-100   
ref|XP_007039873.1|  GRAS family transcription factor                   342   2e-100   
ref|XP_006490856.1|  PREDICTED: uncharacterized protein LOC102608...    350   4e-100   
gb|AGJ83737.1|  GRAS family transcription factor                        328   5e-100   
ref|XP_003516440.1|  PREDICTED: scarecrow-like protein 6-like           339   6e-100   
ref|XP_007052157.1|  Nucleotidyltransferase family protein isoform 1    352   7e-100   
ref|XP_002872967.1|  hypothetical protein ARALYDRAFT_490555             333   9e-100   
gb|AAD24406.1|AF036303_1  scarecrow-like 6                              327   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445325.1|  hypothetical protein CICLE_v10018476mg             351   1e-99    
gb|KFK30592.1|  hypothetical protein AALP_AA6G001700                    334   1e-99    
ref|XP_010419546.1|  PREDICTED: scarecrow-like protein 6 isoform X1     332   2e-99    
ref|XP_010419547.1|  PREDICTED: scarecrow-like protein 6 isoform X2     332   2e-99    
ref|XP_010110817.1|  hypothetical protein L484_011800                   338   2e-99    
ref|XP_006576443.1|  PREDICTED: uncharacterized protein LOC100809...    348   3e-99    
ref|XP_007134751.1|  hypothetical protein PHAVU_010G072700g             335   3e-99    
ref|XP_010426616.1|  PREDICTED: scarecrow-like protein 6 isoform X1     331   6e-99    
ref|XP_006576436.1|  PREDICTED: uncharacterized protein LOC100809...    348   7e-99    
ref|XP_010426622.1|  PREDICTED: scarecrow-like protein 6 isoform X2     331   9e-99    
ref|XP_010544366.1|  PREDICTED: scarecrow-like protein 6                333   1e-98    
gb|AAL90911.1|  AT4g00060/F6N15_10                                      337   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304419.2|  hypothetical protein POPTR_0003s11020g             335   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011033959.1|  PREDICTED: scarecrow-like protein 27               335   4e-98    
ref|XP_010662426.1|  PREDICTED: scarecrow-like protein 22 isoform X2    333   1e-97    
ref|XP_010456318.1|  PREDICTED: scarecrow-like protein 6                327   2e-97    
ref|XP_010258971.1|  PREDICTED: scarecrow-like protein 6                334   2e-97    
ref|XP_009611447.1|  PREDICTED: uncharacterized protein LOC104104...    342   2e-97    
ref|XP_006287420.1|  hypothetical protein CARUB_v10000626mg             327   3e-97    
ref|XP_007218885.1|  hypothetical protein PRUPE_ppa000183mg             343   5e-97    
ref|NP_191926.1|  protein LOST MERISTEMS 3                              326   7e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611430.1|  PREDICTED: uncharacterized protein LOC104104...    343   7e-97    
ref|XP_009611446.1|  PREDICTED: uncharacterized protein LOC104104...    343   7e-97    
ref|XP_011018301.1|  PREDICTED: scarecrow-like protein 27 isoform X2    330   8e-97    
gb|KEH29150.1|  GRAS family transcription regulator                     327   1e-96    
ref|XP_006576434.1|  PREDICTED: scarecrow-like protein 6-like           330   1e-96    
ref|XP_002872974.1|  hypothetical protein ARALYDRAFT_912246             332   2e-96    
ref|XP_010692161.1|  PREDICTED: uncharacterized protein LOC104905346    341   2e-96    
gb|KHN38819.1|  Scarecrow-like protein 6                                330   2e-96    
ref|XP_011018300.1|  PREDICTED: scarecrow-like protein 27 isoform X1    330   3e-96    
ref|NP_191917.3|  protein MATERNAL EFFECT EMBRYO ARREST 44              340   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308471.1|  PREDICTED: uncharacterized protein LOC101305610    341   3e-96    
ref|XP_006286684.1|  hypothetical protein CARUB_v10002719mg             340   5e-96    
ref|XP_003605197.1|  GRAS family transcription factor                   325   6e-96    
ref|XP_009133973.1|  PREDICTED: uncharacterized protein LOC103858...    339   9e-96    
ref|XP_009133971.1|  PREDICTED: uncharacterized protein LOC103858...    339   1e-95    
ref|XP_007134738.1|  hypothetical protein PHAVU_010G071800g             339   1e-95    
emb|CDY21497.1|  BnaC03g27000D                                          338   2e-95    
ref|XP_006396205.1|  hypothetical protein EUTSA_v10028362mg             338   2e-95    
gb|KCW78315.1|  hypothetical protein EUGRSUZ_D02494                     337   5e-95    
ref|XP_010053939.1|  PREDICTED: uncharacterized protein LOC104442...    337   5e-95    
ref|XP_010053940.1|  PREDICTED: uncharacterized protein LOC104442...    337   5e-95    
emb|CDX83213.1|  BnaA03g22930D                                          337   6e-95    
gb|KEH29187.1|  nucleotidyltransferase family protein                   337   6e-95    
ref|XP_004506474.1|  PREDICTED: scarecrow-like protein 6-like           326   7e-95    
ref|XP_010426531.1|  PREDICTED: uncharacterized protein LOC104711527    337   7e-95    
ref|XP_010419530.1|  PREDICTED: uncharacterized protein LOC104705...    337   7e-95    
ref|XP_006396213.1|  hypothetical protein EUTSA_v10029148mg             320   2e-94    
ref|XP_004506480.1|  PREDICTED: uncharacterized protein LOC101499...    335   3e-94    
ref|XP_010523084.1|  PREDICTED: uncharacterized protein LOC104801...    334   4e-94    
ref|XP_008437781.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    335   5e-94    
ref|XP_010523091.1|  PREDICTED: uncharacterized protein LOC104801...    334   6e-94    
ref|XP_004134284.1|  PREDICTED: uncharacterized protein LOC101221970    334   6e-94    
gb|KGN56351.1|  hypothetical protein Csa_3G116880                       334   8e-94    
ref|XP_009349306.1|  PREDICTED: uncharacterized protein LOC103940...    331   7e-93    
ref|XP_010264405.1|  PREDICTED: scarecrow-like protein 27               321   3e-92    
ref|XP_004506481.1|  PREDICTED: uncharacterized protein LOC101499...    329   4e-92    
ref|XP_009375756.1|  PREDICTED: uncharacterized protein LOC103964...    328   6e-92    
ref|XP_007134753.1|  hypothetical protein PHAVU_010G072900g             317   1e-91    
ref|XP_008794842.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    327   2e-91    
ref|XP_008796962.1|  PREDICTED: uncharacterized protein LOC103712263    327   3e-91    
gb|KHG08006.1|  DNA polymerase sigma                                    326   5e-91    
ref|XP_010941141.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    325   1e-90    
ref|XP_010934990.1|  PREDICTED: uncharacterized protein LOC105055002    323   7e-90    
gb|EMT25920.1|  PAP-associated domain-containing protein 5              318   1e-88    
ref|XP_010240565.1|  PREDICTED: uncharacterized protein LOC100844132    316   1e-87    
emb|CDY63061.1|  BnaAnng18540D                                          300   3e-87    
ref|XP_009111514.1|  PREDICTED: scarecrow-like protein 6                300   4e-87    
emb|CDY63062.1|  BnaAnng18550D                                          300   5e-87    
ref|XP_006656355.1|  PREDICTED: uncharacterized protein LOC102706...    312   5e-87    
gb|EMS55426.1|  PAP-associated domain-containing protein 5              313   2e-86    
ref|XP_010695124.1|  PREDICTED: scarecrow-like protein 6 isoform X2     305   2e-86    
ref|XP_010695123.1|  PREDICTED: scarecrow-like protein 6 isoform X1     305   2e-86    
ref|XP_004966312.1|  PREDICTED: uncharacterized protein LOC101773...    312   5e-86    
ref|XP_002438829.1|  hypothetical protein SORBIDRAFT_10g026810          307   5e-86    Sorghum bicolor [broomcorn]
ref|XP_009418194.1|  PREDICTED: scarecrow-like protein 6                300   2e-85    
ref|XP_004155262.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    309   2e-85    
ref|XP_008796953.1|  PREDICTED: scarecrow-like protein 6                296   6e-85    
ref|XP_008648965.1|  PREDICTED: uncharacterized protein LOC100278...    306   7e-85    
ref|XP_009392804.1|  PREDICTED: uncharacterized protein LOC103978...    308   8e-85    
ref|XP_009392798.1|  PREDICTED: uncharacterized protein LOC103978...    307   2e-84    
gb|EEC81146.1|  hypothetical protein OsI_24054                          305   2e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_008648961.1|  PREDICTED: uncharacterized protein LOC100278...    306   2e-84    
ref|XP_008648962.1|  PREDICTED: uncharacterized protein LOC100278...    306   2e-84    
gb|EEE66190.1|  hypothetical protein OsJ_22308                          305   5e-84    Oryza sativa Japonica Group [Japonica rice]
gb|AFV91191.1|  GRAS family transcription regulator                     294   1e-83    
ref|XP_006355471.1|  PREDICTED: scarecrow-like protein 22-like          292   6e-83    
gb|AAM90848.1|AF481952_1  hairy meristem                                293   6e-83    Petunia x hybrida [garden petunia]
ref|XP_004245757.1|  PREDICTED: scarecrow-like protein 22 isoform X2    292   7e-83    
ref|XP_004245756.1|  PREDICTED: scarecrow-like protein 22 isoform X1    293   1e-82    
ref|XP_009407162.1|  PREDICTED: scarecrow-like protein 6                284   3e-82    
ref|XP_009803484.1|  PREDICTED: scarecrow-like protein 6 isoform X1     285   8e-81    
ref|XP_009628961.1|  PREDICTED: scarecrow-like protein 6                284   1e-80    
ref|XP_009628960.1|  PREDICTED: scarecrow-like protein 22               286   2e-80    
ref|XP_009382417.1|  PREDICTED: scarecrow-like protein 27               287   2e-80    
ref|XP_009411560.1|  PREDICTED: scarecrow-like protein 27               286   5e-80    
ref|XP_009803488.1|  PREDICTED: scarecrow-like protein 6 isoform X2     283   1e-79    
ref|XP_009803487.1|  PREDICTED: scarecrow-like protein 22 isoform X1    283   2e-79    
ref|XP_010264298.1|  PREDICTED: uncharacterized protein LOC104602...    290   8e-79    
ref|XP_009407846.1|  PREDICTED: scarecrow-like protein 6                281   9e-79    
ref|XP_004983724.1|  PREDICTED: scarecrow-like protein 6-like iso...    278   1e-78    
ref|XP_008232576.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    289   2e-78    
ref|XP_004983723.1|  PREDICTED: scarecrow-like protein 6-like iso...    278   2e-78    
gb|EMT28394.1|  hypothetical protein F775_07767                         271   2e-78    
ref|XP_011070112.1|  PREDICTED: scarecrow-like protein 22               280   4e-78    
ref|XP_010941132.1|  PREDICTED: scarecrow-like protein 27               280   5e-78    
emb|CDP09942.1|  unnamed protein product                                280   5e-78    
ref|NP_191622.1|  protein LOST MERISTEM 2                               276   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392803.1|  PREDICTED: uncharacterized protein LOC103978...    287   1e-77    
gb|AAO42084.1|  putative SCARECROW gene regulator                       276   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|NP_182041.1|  protein LOST MERISTEMS 1                              276   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006576441.1|  PREDICTED: uncharacterized protein LOC100809...    286   1e-77    
ref|XP_010934970.1|  PREDICTED: scarecrow-like protein 27               278   5e-77    
ref|XP_002878344.1|  scarecrow transcription factor family protein      273   1e-76    
gb|EMS67890.1|  hypothetical protein TRIUR3_03541                       267   1e-76    
ref|XP_009401671.1|  PREDICTED: scarecrow-like protein 27               276   3e-76    
ref|XP_009384468.1|  PREDICTED: scarecrow-like protein 27               275   4e-76    
ref|XP_010229344.1|  PREDICTED: scarecrow-like protein 6                271   4e-76    
ref|NP_001065323.2|  Os10g0551200                                       265   4e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010544618.1|  PREDICTED: scarecrow-like protein 22 isoform X1    271   5e-76    
gb|EMT26258.1|  hypothetical protein F775_27777                         266   9e-76    
ref|XP_002464970.1|  hypothetical protein SORBIDRAFT_01g029650          271   1e-75    Sorghum bicolor [broomcorn]
ref|XP_006290271.1|  hypothetical protein CARUB_v10016840mg             269   3e-75    
ref|XP_006295629.1|  hypothetical protein CARUB_v10024743mg             268   1e-74    
ref|XP_010469159.1|  PREDICTED: scarecrow-like protein 22               267   1e-74    
dbj|BAK03144.1|  predicted protein                                      267   7e-74    
ref|XP_010413536.1|  PREDICTED: scarecrow-like protein 22               265   1e-73    
gb|AAG13473.1|AC026758_10  putative Scl1 protein                        263   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006402563.1|  hypothetical protein EUTSA_v10006506mg             264   3e-73    
tpg|DAA46213.1|  TPA: hypothetical protein ZEAMMB73_837661              264   4e-73    
gb|ACN36344.1|  unknown                                                 259   4e-73    Zea mays [maize]
ref|XP_008794809.1|  PREDICTED: scarecrow-like protein 6                263   4e-73    
gb|EEC67412.1|  hypothetical protein OsI_34582                          266   7e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_003570043.1|  PREDICTED: scarecrow-like protein 27               265   7e-73    
emb|CDX95633.1|  BnaC03g25140D                                          260   1e-72    
emb|CDY56248.1|  BnaA07g37990D                                          261   1e-72    
gb|EAZ31587.1|  hypothetical protein OsJ_15728                          259   2e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010524396.1|  PREDICTED: scarecrow-like protein 22               261   2e-72    
emb|CDX89065.1|  BnaA04g01210D                                          259   3e-72    
emb|CDX83398.1|  BnaA03g21080D                                          260   3e-72    
ref|XP_006838154.1|  hypothetical protein AMTR_s00106p00100050          271   3e-72    
ref|XP_006397697.1|  hypothetical protein EUTSA_v10001784mg             261   5e-72    
emb|CDY67934.1|  BnaCnng57010D                                          259   8e-72    
ref|XP_010506453.1|  PREDICTED: scarecrow-like protein 27               260   1e-71    
gb|EPS65873.1|  hypothetical protein M569_08904                         268   1e-71    
ref|NP_001047654.1|  Os02g0662700                                       256   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010518129.1|  PREDICTED: scarecrow-like protein 27               259   2e-71    
ref|XP_009138823.1|  PREDICTED: scarecrow-like protein 22               256   3e-71    
ref|XP_009133708.1|  PREDICTED: scarecrow-like protein 27               257   4e-71    
ref|NP_001053514.1|  Os04g0555000                                       259   5e-71    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168417.1|  hypothetical protein                               259   1e-70    Zea mays [maize]
gb|AGK28600.1|  scarecrow-like 6 protein                                253   2e-70    
ref|XP_010508207.1|  PREDICTED: scarecrow-like protein 27               255   5e-70    
gb|EEE57522.1|  hypothetical protein OsJ_07831                          256   5e-70    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD25636.1|  Scl1 protein                                           256   7e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104096.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    253   8e-70    
gb|KFK37309.1|  hypothetical protein AALP_AA4G240400                    252   2e-69    
gb|EAY86976.1|  hypothetical protein OsI_08370                          254   3e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_006855813.1|  hypothetical protein AMTR_s00044p00228020          255   3e-69    
ref|XP_004953376.1|  PREDICTED: scarecrow-like protein 27-like          254   4e-69    
gb|KFK35266.1|  hypothetical protein AALP_AA5G262900                    252   4e-69    
ref|XP_002881998.1|  hypothetical protein ARALYDRAFT_483651             252   4e-69    
ref|XP_002446917.1|  hypothetical protein SORBIDRAFT_06g024820          254   6e-69    Sorghum bicolor [broomcorn]
ref|XP_008649813.1|  PREDICTED: scarecrow-like protein 6                247   7e-69    
ref|NP_001167982.1|  uncharacterized protein LOC100381701               253   9e-69    Zea mays [maize]
emb|CDY48367.1|  BnaC04g22080D                                          249   1e-68    
gb|AIF76070.1|  scarecrow-like protein 1                                236   2e-68    
ref|NP_001145756.1|  hypothetical protein                               246   3e-68    Zea mays [maize]
gb|AGK28599.1|  scarecrow-like 6 protein                                247   4e-68    
ref|XP_010933683.1|  PREDICTED: scarecrow-like protein 22               252   6e-68    
ref|XP_008796806.1|  PREDICTED: scarecrow-like protein 6                251   1e-67    
ref|XP_006648912.1|  PREDICTED: scarecrow-like protein 6-like           248   3e-67    
ref|XP_006650951.1|  PREDICTED: scarecrow-like protein 6-like           241   3e-67    
gb|EAY86977.1|  hypothetical protein OsI_08371                          248   5e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_010512394.1|  PREDICTED: scarecrow-like protein 22               246   5e-67    
ref|XP_002454517.1|  hypothetical protein SORBIDRAFT_04g032590          245   5e-66    Sorghum bicolor [broomcorn]
gb|ACN28201.1|  unknown                                                 245   6e-66    Zea mays [maize]
ref|NP_001047655.1|  Os02g0663100                                       244   9e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010662422.1|  PREDICTED: scarecrow-like protein 22 isoform X1    245   1e-65    
ref|XP_002452792.1|  hypothetical protein SORBIDRAFT_04g032570          241   1e-64    Sorghum bicolor [broomcorn]
ref|NP_001145903.1|  uncharacterized protein LOC100279420               236   9e-64    Zea mays [maize]
gb|EEE51370.1|  hypothetical protein OsJ_32391                          229   2e-63    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD45445.1|  nucleotidyltransferase-like                            242   6e-63    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74341.1|  hypothetical protein OsI_09637                          231   1e-62    
ref|NP_001048669.1|  Os03g0103400                                       229   1e-62    
gb|AFR66646.1|  scarecrow-like 6                                        233   2e-62    
ref|XP_010234984.1|  PREDICTED: scarecrow-like protein 6                233   2e-62    
ref|XP_006574233.1|  PREDICTED: poly(A) RNA polymerase cid14-like       216   5e-62    
ref|XP_008786976.1|  PREDICTED: scarecrow-like protein 27               234   1e-61    
gb|AAC98091.1|  Scl1 protein                                            219   2e-61    
emb|CDY69898.1|  BnaCnng65840D                                          213   2e-60    
ref|XP_004964284.1|  PREDICTED: scarecrow-like protein 6-like           226   2e-60    
gb|KDO85711.1|  hypothetical protein CISIN_1g0003871mg                  211   2e-60    
gb|ACG46488.1|  scarecrow-like 6                                        224   3e-60    
ref|XP_002436328.1|  hypothetical protein SORBIDRAFT_10g000520          224   3e-60    
ref|XP_010919532.1|  PREDICTED: scarecrow-like protein 22               230   3e-60    
ref|NP_001140725.1|  scarecrow-like 6                                   224   3e-60    
ref|XP_001768831.1|  predicted protein                                  233   7e-60    
gb|EAZ35543.1|  hypothetical protein OsJ_19826                          220   2e-59    
gb|AJC52498.1|  SCL12                                                   224   3e-59    
ref|NP_001142045.1|  uncharacterized protein LOC100274201               211   1e-58    
ref|XP_004987223.1|  PREDICTED: scarecrow-like protein 6-like           221   1e-58    
ref|XP_006856053.1|  hypothetical protein AMTR_s00059p00091580          216   1e-57    
gb|AAP54936.2|  GRAS family transcription factor containing prote...    219   2e-57    
gb|EAY99327.1|  hypothetical protein OsI_21297                          213   8e-57    
ref|XP_010228145.1|  PREDICTED: scarecrow-like protein 22               208   1e-54    
gb|KCW73065.1|  hypothetical protein EUGRSUZ_E01510                     206   6e-53    
ref|XP_010325555.1|  PREDICTED: uncharacterized protein LOC101252...    206   3e-51    
ref|XP_010255200.1|  PREDICTED: scarecrow-like protein 15               198   3e-51    
ref|XP_009356714.1|  PREDICTED: scarecrow-like protein 15               189   5e-50    
ref|XP_008341652.1|  PREDICTED: uncharacterized protein LOC103404...    196   4e-48    
ref|XP_008363118.1|  PREDICTED: scarecrow-like protein 15               188   8e-48    
ref|XP_009374236.1|  PREDICTED: scarecrow-like protein 15               188   1e-47    
emb|CDP02813.1|  unnamed protein product                                187   4e-47    
ref|XP_006363143.1|  PREDICTED: scarecrow-like protein 15-like          186   4e-47    
gb|ABU45212.1|  unknown                                                 186   5e-47    
gb|ABU45198.1|  unknown                                                 186   7e-47    
ref|XP_004232383.1|  PREDICTED: scarecrow-like protein 15               185   1e-46    
ref|XP_009803270.1|  PREDICTED: scarecrow-like protein 15               185   1e-46    
ref|XP_009590475.1|  PREDICTED: scarecrow-like protein 15               185   1e-46    
ref|XP_004300613.1|  PREDICTED: scarecrow-like protein 15-like          185   1e-46    
ref|XP_008393455.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    185   2e-46    
gb|ABU45178.1|  unknown                                                 184   4e-46    
ref|XP_011099583.1|  PREDICTED: scarecrow-like protein 15               182   7e-46    
dbj|BAJ99251.1|  predicted protein                                      176   8e-46    
ref|XP_008341656.1|  PREDICTED: uncharacterized protein LOC103404...    188   9e-46    
gb|AAF00139.1|AF149807_1  Scl1 protein                                  177   3e-45    
ref|XP_008453725.1|  PREDICTED: scarecrow-like protein 15               181   4e-45    
gb|AAY17058.1|  f-171-1_1                                               176   5e-45    
ref|XP_010099836.1|  hypothetical protein L484_009050                   179   1e-44    
gb|EEE58153.1|  hypothetical protein OsJ_09070                          178   1e-44    
ref|XP_007203757.1|  hypothetical protein PRUPE_ppa003675mg             179   2e-44    
ref|XP_008241642.1|  PREDICTED: scarecrow-like protein 15               177   6e-44    
ref|XP_004172401.1|  PREDICTED: scarecrow-like protein 15-like          176   8e-44    
gb|KGN53268.1|  GRAS family transcription factor                        176   2e-43    
ref|XP_004146542.1|  PREDICTED: scarecrow-like protein 15-like          176   2e-43    
ref|XP_008453726.1|  PREDICTED: scarecrow-like protein 15               175   2e-43    
ref|XP_003519903.1|  PREDICTED: scarecrow-like protein 15-like          171   4e-42    
ref|XP_004146541.1|  PREDICTED: scarecrow-like protein 15-like          171   6e-42    
ref|XP_006425721.1|  hypothetical protein CICLE_v10025246mg             171   2e-41    
ref|XP_010432142.1|  PREDICTED: scarecrow-like protein 15               169   2e-41    
gb|KHN24642.1|  Poly(A) RNA polymerase cid14                            171   3e-41    
dbj|BAP91520.1|  gras family protein                                    169   6e-41    
ref|XP_003547994.1|  PREDICTED: scarecrow-like protein 15-like          168   6e-41    
ref|XP_002268445.1|  PREDICTED: scarecrow-like protein 15               168   9e-41    
emb|CBI17555.3|  unnamed protein product                                168   1e-40    
gb|EYU28571.1|  hypothetical protein MIMGU_mgv1a003577mg                168   1e-40    
gb|ACF84214.1|  unknown                                                 160   2e-40    
ref|XP_006283643.1|  hypothetical protein CARUB_v10004700mg             165   4e-40    
ref|XP_006576442.1|  PREDICTED: uncharacterized protein LOC100809...    170   6e-40    
ref|XP_010446749.1|  PREDICTED: scarecrow-like protein 15 isoform X1    164   7e-40    
ref|XP_010446751.1|  PREDICTED: scarecrow-like protein 15 isoform X3    164   8e-40    
gb|AAT75161.1|  SCARECROW-like protein                                  164   9e-40    
dbj|BAJ33822.1|  unnamed protein product                                156   9e-40    
ref|XP_010437312.1|  PREDICTED: scarecrow-like protein 15 isoform X2    164   1e-39    
ref|NP_195389.4|  scarecrow-like protein 15                             164   1e-39    
ref|XP_006411970.1|  hypothetical protein EUTSA_v10025054mg             164   1e-39    
ref|XP_007156025.1|  hypothetical protein PHAVU_003G252200g             164   2e-39    
ref|XP_002869027.1|  hypothetical protein ARALYDRAFT_490963             163   2e-39    
ref|XP_002310797.1|  hypothetical protein POPTR_0007s12480g             164   3e-39    
ref|XP_010999954.1|  PREDICTED: scarecrow-like protein 15               163   4e-39    
ref|XP_003629479.1|  GRAS family transcription factor                   163   4e-39    
emb|CAB16826.1|  SCARECROW-like protein                                 162   4e-39    
ref|XP_006383233.1|  scarecrow transcription factor family protein      163   4e-39    
gb|KFK30292.1|  hypothetical protein AALP_AA7G242600                    162   5e-39    
gb|AFW76049.1|  hypothetical protein ZEAMMB73_902697                    150   9e-39    
ref|XP_009142446.1|  PREDICTED: scarecrow-like protein 15               161   9e-39    
ref|XP_010437311.1|  PREDICTED: scarecrow-like protein 15 isoform X1    161   1e-38    
ref|XP_006409136.1|  hypothetical protein EUTSA_v10023133mg             161   1e-38    
gb|KDO59927.1|  hypothetical protein CISIN_1g007284mg                   161   3e-38    
ref|XP_004509243.1|  PREDICTED: scarecrow-like protein 15-like          160   5e-38    
ref|XP_009133974.1|  PREDICTED: uncharacterized protein LOC103858...    164   5e-38    
emb|CDX69238.1|  BnaC01g02150D                                          159   7e-38    
ref|XP_002468689.1|  hypothetical protein SORBIDRAFT_01g050333          155   7e-38    
ref|XP_011025728.1|  PREDICTED: scarecrow-like protein 15               159   1e-37    
ref|XP_006428037.1|  hypothetical protein CICLE_v10025197mg             159   1e-37    
ref|XP_010667697.1|  PREDICTED: scarecrow-like protein 15               159   2e-37    
ref|XP_010419535.1|  PREDICTED: uncharacterized protein LOC104705...    159   6e-37    
ref|XP_006297491.1|  hypothetical protein CARUB_v10013509mg             156   7e-37    
ref|XP_003517241.1|  PREDICTED: scarecrow-like protein 15-like          154   2e-36    
ref|XP_010548348.1|  PREDICTED: scarecrow-like protein 15               154   7e-36    
ref|XP_011097216.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    153   8e-36    
ref|XP_010070042.1|  PREDICTED: scarecrow-like protein 15               152   9e-36    
ref|XP_007156910.1|  hypothetical protein PHAVU_002G027500g             152   1e-35    
ref|XP_009114695.1|  PREDICTED: scarecrow-like protein 15               152   1e-35    
ref|XP_010467682.1|  PREDICTED: scarecrow-like protein 15               151   2e-35    
emb|CDY43895.1|  BnaA07g01720D                                          151   3e-35    
gb|KDP31796.1|  hypothetical protein JCGZ_12257                         151   3e-35    
ref|XP_010523092.1|  PREDICTED: uncharacterized protein LOC104801...    155   4e-35    
emb|CDY13032.1|  BnaC07g03310D                                          150   4e-35    
ref|XP_008337344.1|  PREDICTED: DELLA protein GAI-like                  150   7e-35    
gb|AAY56753.1|  DELLA protein                                           150   7e-35    
gb|AEX97112.1|  spur-type DELLA protein                                 150   7e-35    
ref|XP_008343960.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    150   7e-35    
gb|AAY56754.1|  DELLA protein                                           149   1e-34    
ref|XP_010531168.1|  PREDICTED: scarecrow-like protein 15               149   2e-34    
ref|XP_003538842.1|  PREDICTED: scarecrow-like protein 15-like          149   2e-34    
gb|ABU63412.1|  DELLA protein                                           149   2e-34    
gb|EMS45600.1|  hypothetical protein TRIUR3_26732                       141   2e-34    
gb|EPS63021.1|  hypothetical protein M569_11763                         148   4e-34    
ref|XP_009371410.1|  PREDICTED: DELLA protein GAI-like                  148   5e-34    
ref|XP_008390123.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    149   6e-34    
ref|XP_009395624.1|  PREDICTED: scarecrow-like protein 15               147   6e-34    
ref|XP_004287380.1|  PREDICTED: DELLA protein GAI-like                  147   7e-34    
gb|ACV52014.1|  GAI/RGA-like 3-b                                        146   2e-33    
gb|ACV52013.1|  GAI/RGA-like 3-a                                        146   2e-33    
ref|XP_008648964.1|  PREDICTED: uncharacterized protein LOC100278...    149   2e-33    
ref|XP_009394367.1|  PREDICTED: scarecrow-like protein 15               145   2e-33    
ref|XP_011033743.1|  PREDICTED: uncharacterized protein LOC105132...    148   5e-33    
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like                 144   9e-33    
ref|XP_008242703.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    144   1e-32    
ref|XP_007013315.1|  GAI/RGA-like protein                               143   1e-32    
gb|AHW42470.1|  RGA                                                     143   2e-32    
ref|XP_007144131.1|  hypothetical protein PHAVU_007G131200g             142   2e-32    
ref|XP_002529354.1|  DELLA protein GAI1, putative                       142   2e-32    
dbj|BAQ20609.1|  GRAS-family protein 1                                  144   3e-32    
gb|EAY95113.1|  hypothetical protein OsI_16930                          143   3e-32    
ref|XP_006589312.1|  PREDICTED: DELLA protein RGA-like                  142   3e-32    
ref|XP_010249953.1|  PREDICTED: DELLA protein SLR1-like                 142   3e-32    
ref|XP_007203631.1|  hypothetical protein PRUPE_ppa003975mg             141   6e-32    
ref|XP_010489558.1|  PREDICTED: scarecrow-like protein 15               140   7e-32    
gb|AFW75202.1|  hypothetical protein ZEAMMB73_014446                    137   8e-32    
gb|KDO63869.1|  hypothetical protein CISIN_1g045762mg                   138   1e-31    
ref|XP_002284952.1|  PREDICTED: DELLA protein SLR1-like                 140   1e-31    
ref|XP_004146291.1|  PREDICTED: DELLA protein GAI-like                  140   1e-31    
ref|XP_007156503.1|  hypothetical protein PHAVU_003G291500g             140   1e-31    
ref|XP_004507626.1|  PREDICTED: DELLA protein RHT-1-like                140   1e-31    
gb|EYU44670.1|  hypothetical protein MIMGU_mgv1a026210mg                139   2e-31    
ref|XP_004504565.1|  PREDICTED: DELLA protein GAI1-like                 139   2e-31    
emb|CCG14223.1|  gibberellin DELLA protein                              139   3e-31    
ref|XP_009405522.1|  PREDICTED: DELLA protein GAI-like                  141   3e-31    
gb|EPS73060.1|  hypothetical protein M569_01698                         138   4e-31    
ref|NP_001240948.1|  DELLA protein GAI 1                                139   4e-31    
ref|XP_002525108.1|  DELLA protein GAIP-B, putative                     138   6e-31    
gb|ABI34432.1|  CRY                                                     138   6e-31    
ref|XP_006475770.1|  PREDICTED: DELLA protein GAI-like                  138   6e-31    
ref|XP_004161044.1|  PREDICTED: DELLA protein GAI-like                  138   8e-31    
ref|XP_006451026.1|  hypothetical protein CICLE_v10010825mg             138   8e-31    
gb|AHB17742.1|  GA repressor DELLA                                      138   8e-31    
gb|ACV52015.1|  GAI/RGA-like 4-a                                        137   8e-31    
ref|XP_004171790.1|  PREDICTED: DELLA protein GAI1-like                 139   9e-31    
ref|XP_004138798.1|  PREDICTED: DELLA protein GAI1-like                 139   9e-31    
ref|XP_009394750.1|  PREDICTED: scarecrow-like protein 15               137   1e-30    
ref|XP_008463334.1|  PREDICTED: DELLA protein SLR1-like                 137   1e-30    
gb|ABO61516.1|  GAI1                                                    137   1e-30    
ref|XP_008441631.1|  PREDICTED: DELLA protein RGL1-like                 139   1e-30    
gb|ACR58456.1|  GAI/RGA-like protein                                    137   1e-30    
ref|XP_008341654.1|  PREDICTED: uncharacterized protein LOC103404...    140   1e-30    
ref|XP_008341653.1|  PREDICTED: uncharacterized protein LOC103404...    140   1e-30    
gb|AHB17748.1|  GA repressor DELLA                                      137   1e-30    
ref|XP_003556343.1|  PREDICTED: DELLA protein GAI1-like                 136   2e-30    
dbj|BAF62636.1|  DELLA protein                                          137   2e-30    
gb|KDP32341.1|  hypothetical protein JCGZ_13266                         137   2e-30    
ref|XP_002266267.1|  PREDICTED: DELLA protein GAI-like                  137   2e-30    
ref|XP_011033752.1|  PREDICTED: uncharacterized protein LOC105132...    140   2e-30    
gb|AHB17747.1|  GA repressor DELLA                                      136   2e-30    
ref|XP_003528281.1|  PREDICTED: DELLA protein SLR1-like                 135   3e-30    
gb|AHB17744.1|  GA repressor DELLA                                      136   4e-30    
ref|XP_011023720.1|  PREDICTED: DELLA protein GAIP-B-like               136   4e-30    
emb|CAN59753.1|  hypothetical protein VITISV_036639                     136   4e-30    
gb|EYU30084.1|  hypothetical protein MIMGU_mgv1a027121mg                136   4e-30    
gb|ABU63411.1|  DELLA protein                                           136   5e-30    
gb|KDO85708.1|  hypothetical protein CISIN_1g0003872mg                  139   5e-30    
gb|ACR58457.1|  GAI/RGA-like protein                                    135   5e-30    
gb|EYU45810.1|  hypothetical protein MIMGU_mgv1a003644mg                135   5e-30    
gb|ABA93922.1|  GRAS family transcription factor containing protein     137   6e-30    
ref|XP_002993042.1|  hypothetical protein SELMODRAFT_136372             134   6e-30    
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg             135   6e-30    
ref|XP_010553798.1|  PREDICTED: DELLA protein GAI-like                  135   7e-30    
gb|AEK06229.1|  GAI1                                                    135   7e-30    
ref|XP_007046999.1|  GRAS family transcription factor, putative         136   7e-30    
ref|XP_002284648.1|  PREDICTED: DELLA protein GAI1                      135   7e-30    
ref|XP_006447014.1|  hypothetical protein CICLE_v10018153mg             136   7e-30    
ref|XP_002312450.2|  hypothetical protein POPTR_0008s13090g             135   8e-30    
ref|XP_002512896.1|  DELLA protein GAI1, putative                       136   8e-30    
ref|XP_011038614.1|  PREDICTED: DELLA protein GAIP                      135   8e-30    
ref|XP_010254273.1|  PREDICTED: DELLA protein GAI-like                  134   8e-30    
ref|XP_008680172.1|  PREDICTED: DELLA protein GAI-like                  137   8e-30    
gb|AFP58844.1|  DELLA domain GRAS family transcription factor GAI       135   9e-30    
gb|KDP41801.1|  hypothetical protein JCGZ_26819                         136   1e-29    
ref|XP_011099005.1|  PREDICTED: DELLA protein RGL2-like                 136   1e-29    
ref|XP_003524001.1|  PREDICTED: DELLA protein DWARF8-like               134   1e-29    
ref|XP_008231070.1|  PREDICTED: DELLA protein GAI-like                  135   2e-29    
ref|XP_010453948.1|  PREDICTED: DELLA protein RGL3-like                 134   2e-29    
ref|XP_010101954.1|  hypothetical protein L484_011971                   133   2e-29    
ref|XP_002992412.1|  hypothetical protein SELMODRAFT_135151             132   2e-29    
ref|XP_008791129.1|  PREDICTED: DELLA protein RGL3-like                 135   2e-29    
ref|XP_002450783.1|  hypothetical protein SORBIDRAFT_05g018070          135   2e-29    
ref|XP_010688103.1|  PREDICTED: DELLA protein GAI1-like                 133   2e-29    
ref|XP_009378007.1|  PREDICTED: DELLA protein RGL1-like                 135   2e-29    
ref|XP_009344215.1|  PREDICTED: DELLA protein RGL1-like                 135   2e-29    
gb|ACY74341.1|  putative DELLA protein                                  133   3e-29    
gb|KHN47913.1|  Scarecrow-like protein 6                                127   3e-29    
ref|XP_002314799.2|  hypothetical protein POPTR_0010s12080g             134   3e-29    
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    133   3e-29    
ref|XP_009346793.1|  PREDICTED: DELLA protein RGL1-like                 134   3e-29    
emb|CDY38434.1|  BnaA10g17240D                                          132   3e-29    
ref|XP_002972121.1|  GRAS family protein                                133   3e-29    
ref|XP_009789076.1|  PREDICTED: DELLA protein GAI1-like                 133   4e-29    
ref|XP_008341667.1|  PREDICTED: DELLA protein RGL1-like                 134   4e-29    
ref|XP_010264458.1|  PREDICTED: DELLA protein GAI1                      134   4e-29    
ref|XP_007225630.1|  hypothetical protein PRUPE_ppa005944mg             132   4e-29    
ref|XP_010049952.1|  PREDICTED: DELLA protein GAI-like                  133   4e-29    
gb|ACN33960.1|  unknown                                                 131   4e-29    



>ref|XP_011090295.1| PREDICTED: scarecrow-like protein 6 [Sesamum indicum]
Length=795

 Score =   427 bits (1099),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 247/295 (84%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE LEGFDRIHIVDFDIG+G QWASLMQELAL 
Sbjct  506   FKIGAYKSFSEISPLIQFANFTCNQALLEVLEGFDRIHIVDFDIGFGGQWASLMQELALR  565

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             +G  PSLKITALASP   +QLELG+ R NLIQFASEIN+ FEFE + ++ L+S   S   
Sbjct  566   SGGAPSLKITALASPSTHDQLELGLTRENLIQFASEINIAFEFEAMSIDSLDSGSWSLPF  625

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +    A+AVNLP+  L+ N Q+S+PL+L FVK+L P+IVVSVD GCDRTDLPF +HIIH
Sbjct  626   HASENEAVAVNLPIVSLA-NCQLSVPLVLRFVKQLSPRIVVSVDRGCDRTDLPFANHIIH  684

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             ALHS+SNLLESLDAVN+N D+LQKIE+F++QPGIEK V  RF   SPEK  TQHWR++FL
Sbjct  685   ALHSHSNLLESLDAVNVNMDSLQKIERFLLQPGIEKIVMGRF--HSPEK--TQHWRSLFL  740

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAECV+KRTPV GF VEKRQSSLVLCWQRKELISASAWRC
Sbjct  741   SSGFSPVTFSNFTESQAECVVKRTPVRGFQVEKRQSSLVLCWQRKELISASAWRC  795



>ref|XP_009762628.1| PREDICTED: scarecrow-like protein 22 [Nicotiana sylvestris]
Length=755

 Score =   419 bits (1076),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 242/295 (82%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE L+GF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  466   FKIGAYKSFSEISPVAQFANFTCNQALLEVLDGFERIHIVDFDIGYGRQWASLMQELALR  525

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             +G  P+LKITALASP   +QLELG+ R +LI FA+EINM FEFE L ++ LNS+  S   
Sbjct  526   SGGAPTLKITALASPSTHDQLELGLTRESLIHFANEINMEFEFEILSIDSLNSTSWSLPP  585

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVNLP+  L++  Q+SLPL+L FVK+L P+IVVSVD GCDRTDLPFP+H+I 
Sbjct  586   LVSENEAIAVNLPISSLAS-YQLSLPLVLRFVKQLSPRIVVSVDKGCDRTDLPFPNHVIQ  644

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              L SYSNLLESLDAVN+N DALQKIE+F++QP IE+ V +RF   SPEK  TQHWR +FL
Sbjct  645   ILQSYSNLLESLDAVNVNFDALQKIERFLLQPRIERIVMSRF--RSPEK--TQHWRALFL  700

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSG +P  FSNF ESQAECV+KRTPV GFHVEKRQSSLVLCWQRKELISASAWRC
Sbjct  701   SSGLSPLPFSNFTESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELISASAWRC  755



>emb|CDP09504.1| unnamed protein product [Coffea canephora]
Length=816

 Score =   419 bits (1076),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 210/295 (71%), Positives = 242/295 (82%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT  QALLE LEGFDRIHI+DFDIGYG QWAS MQELAL 
Sbjct  527   FKIGAYKSFSEISPVVQFANFTCIQALLEVLEGFDRIHIIDFDIGYGGQWASFMQELALR  586

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             +G  PSL+ITA ASP   +QLELG++R NL+ FASEINM FEFE + ++ LNS+  S   
Sbjct  587   SGGAPSLRITAFASPSTHDQLELGLMRENLMHFASEINMAFEFEIVSIDSLNSASWSLPL  646

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVNLPV   S+  Q+ L LIL FVK+L PKIVVSVD GC+RTDLPFP+H+IH
Sbjct  647   HVSENEAIAVNLPVSSFSSC-QLPLSLILRFVKQLSPKIVVSVDRGCNRTDLPFPNHVIH  705

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYSNLLESLDAVN+N D+LQKIE+F++QPGIE+ +  R+   SPEK  TQHWRT+FL
Sbjct  706   ALQSYSNLLESLDAVNVNLDSLQKIERFLLQPGIERILLGRY--HSPEK--TQHWRTLFL  761

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAECV+KRTPV GFHVEKRQS+LVLCWQRKELISASAWRC
Sbjct  762   SSGFSPLTFSNFTESQAECVVKRTPVRGFHVEKRQSALVLCWQRKELISASAWRC  816



>ref|XP_011093313.1| PREDICTED: scarecrow-like protein 27 [Sesamum indicum]
 ref|XP_011093314.1| PREDICTED: scarecrow-like protein 27 [Sesamum indicum]
Length=784

 Score =   417 bits (1073),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 240/295 (81%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE LEGFDRIHIVDFDIGYG QWASLMQELAL 
Sbjct  495   FKIGAYKSFSEISPLIQFANFTCNQALLEVLEGFDRIHIVDFDIGYGGQWASLMQELALR  554

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             NG  P LKITAL S L  +QLEL + R NL+QFAS+IN+GFEFE + ++ L+S   S   
Sbjct  555   NGGAPLLKITALVSTLTHDQLELSLTRENLLQFASDINIGFEFEVISIDSLDSGSWSLPF  614

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                    +AVNLP G L+ N Q+S+P +L FVK+L P+IVVSVD GCDR+DLPF +HIIH
Sbjct  615   HVLENEGVAVNLPAGCLA-NYQLSVPFVLRFVKQLSPRIVVSVDRGCDRSDLPFANHIIH  673

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYSNLLESLDAVN+N DALQKIE+F++QPGIEK V  RF   SPEK  +QHWRT+FL
Sbjct  674   ALQSYSNLLESLDAVNVNMDALQKIERFLLQPGIEKIVMGRF--RSPEK--SQHWRTLFL  729

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAECV+KRTPV GF VEKRQSSLVLCWQ+KEL+SAS WRC
Sbjct  730   SSGFSPVTFSNFTESQAECVVKRTPVRGFQVEKRQSSLVLCWQQKELVSASVWRC  784



>ref|XP_006347894.1| PREDICTED: scarecrow-like protein 22-like [Solanum tuberosum]
Length=768

 Score =   415 bits (1067),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 241/295 (82%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE L+GF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  479   FKIGAYKSFSEISPVAQFANFTCNQALLEVLDGFERIHIVDFDIGYGGQWASLMQELALR  538

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             +G  P+LKITALASP   +QLELG+ R NLI FASEINM FEFE L ++ LNS+  S   
Sbjct  539   SGGAPTLKITALASPSTHDQLELGLTRENLIHFASEINMAFEFEILSIDSLNSTSWSLPP  598

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVNLPV  LS+ Q     L+L FVK+L P+IVVSVD GCDRTDLPFP+H+I 
Sbjct  599   LVSENEAIAVNLPVSSLSSYQLSLP-LVLRFVKQLSPRIVVSVDRGCDRTDLPFPNHVIQ  657

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYSNLLESLDAVN+N DALQKIE+F++QPGIE+ V  RF   SPEK  TQHWR++FL
Sbjct  658   ALQSYSNLLESLDAVNVNFDALQKIERFLLQPGIERIVMGRF--RSPEK--TQHWRSLFL  713

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P S SNF ESQAECV+KRTPV GFHVEKRQSSLVLCWQRKELISASAWRC
Sbjct  714   SSGFSPLSLSNFTESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELISASAWRC  768



>ref|XP_010325595.1| PREDICTED: scarecrow-like protein 22 [Solanum lycopersicum]
Length=769

 Score =   415 bits (1067),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 240/295 (81%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE L+GF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  480   FKIGAYKSFSEISPVAQFANFTCNQALLEVLDGFERIHIVDFDIGYGGQWASLMQELALR  539

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             +G  P+LKITALASP   +QLELG+ R NLI FASEINM FEFE L ++ LNS+  S   
Sbjct  540   SGGAPTLKITALASPSTHDQLELGLTRENLIHFASEINMAFEFEILSIDSLNSTSWSLPP  599

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVNLPV  LS+ Q     L+L FVK+L P+IVVSVD GCDRTDLPFP+H+I 
Sbjct  600   LVSENEAIAVNLPVSSLSSYQLSLP-LVLRFVKQLSPRIVVSVDRGCDRTDLPFPNHVIQ  658

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYSNLLESLDAVN+N DALQKIE+F++QPGIE+ V  RF   SPEK  TQHWR++FL
Sbjct  659   ALQSYSNLLESLDAVNVNFDALQKIERFLLQPGIERIVMGRF--RSPEK--TQHWRSLFL  714

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF P S SNF ESQAECV+KRTPV GFHVEKRQSSLVLCWQRKELISASAWRC
Sbjct  715   SSGFAPLSLSNFTESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELISASAWRC  769



>ref|XP_009591500.1| PREDICTED: scarecrow-like protein 22 [Nicotiana tomentosiformis]
Length=754

 Score =   406 bits (1044),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 238/295 (81%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE L+GF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  465   FKIGAYKSFSEISPVAQFANFTCNQALLEVLDGFERIHIVDFDIGYGRQWASLMQELALR  524

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             +G  P+LKITALASP   +QLELG+ R +LI FA+EINM FEFE L ++ LNS+  S   
Sbjct  525   SGGAPTLKITALASPSTHDQLELGLTRESLIHFANEINMEFEFEILSIDSLNSTSWSLPP  584

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVNLPV  LS+ Q     L+L FVK+L P+IVVSVD GCDRTDLPFP+H+I 
Sbjct  585   LVSENEAIAVNLPVSSLSSYQLSLP-LVLGFVKQLSPRIVVSVDKGCDRTDLPFPNHVIQ  643

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              L SYSNLLESLDAVN+N DALQKIE+F++QP IE+TV  RF   SPEK   QHWR +FL
Sbjct  644   VLQSYSNLLESLDAVNVNFDALQKIERFLLQPRIERTVMGRF--RSPEK--AQHWRALFL  699

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSG +P  FSNFAESQAECV+KRTPV GFHVEKRQSSLVLCWQRKELISASAWRC
Sbjct  700   SSGLSPLPFSNFAESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELISASAWRC  754



>emb|CBI38908.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   393 bits (1009),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 228/293 (78%), Gaps = 7/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT  QA+LEALEGFDRIHI+DFDIGYG QWASLMQELAL 
Sbjct  288   FKIGAYKSFSEISPLIQFANFTCIQAILEALEGFDRIHIIDFDIGYGGQWASLMQELALR  347

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  PSLKITA AS    +QLELG+ R NL  FA EINM FE E L ++ LN  S     
Sbjct  348   NGGAPSLKITAFASLSNHDQLELGLARENLNHFAGEINMAFELEILSLDSLN--SLPLHL  405

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+AVNLPVG  S N  + LPL+L  VK+L PKI+VS+D GCDRTDLP+  HI+HA 
Sbjct  406   SENEAVAVNLPVGSFS-NYPLPLPLVLRVVKQLSPKIMVSLDRGCDRTDLPYSHHILHAF  464

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              SY  LLESLDAVN+N DALQKIE+F++QPGIEK V  R    SPEKT    WR + LSS
Sbjct  465   QSYLALLESLDAVNVNSDALQKIERFLLQPGIEKIVLGR--HRSPEKTPP--WRALLLSS  520

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF+P +FSNF+ESQAEC++KRTPV GFHVEKRQSSLVLCWQRK+LISASAWRC
Sbjct  521   GFSPLTFSNFSESQAECLVKRTPVRGFHVEKRQSSLVLCWQRKDLISASAWRC  573



>ref|XP_010661679.1| PREDICTED: scarecrow-like protein 27 [Vitis vinifera]
Length=750

 Score =   393 bits (1010),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 228/293 (78%), Gaps = 7/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT  QA+LEALEGFDRIHI+DFDIGYG QWASLMQELAL 
Sbjct  465   FKIGAYKSFSEISPLIQFANFTCIQAILEALEGFDRIHIIDFDIGYGGQWASLMQELALR  524

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  PSLKITA AS    +QLELG+ R NL  FA EINM FE E L ++ LN  S     
Sbjct  525   NGGAPSLKITAFASLSNHDQLELGLARENLNHFAGEINMAFELEILSLDSLN--SLPLHL  582

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+AVNLPVG  S N  + LPL+L  VK+L PKI+VS+D GCDRTDLP+  HI+HA 
Sbjct  583   SENEAVAVNLPVGSFS-NYPLPLPLVLRVVKQLSPKIMVSLDRGCDRTDLPYSHHILHAF  641

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              SY  LLESLDAVN+N DALQKIE+F++QPGIEK V  R    SPEKT    WR + LSS
Sbjct  642   QSYLALLESLDAVNVNSDALQKIERFLLQPGIEKIVLGRH--RSPEKTPP--WRALLLSS  697

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF+P +FSNF+ESQAEC++KRTPV GFHVEKRQSSLVLCWQRK+LISASAWRC
Sbjct  698   GFSPLTFSNFSESQAECLVKRTPVRGFHVEKRQSSLVLCWQRKDLISASAWRC  750



>ref|XP_009374164.1| PREDICTED: scarecrow-like protein 27 [Pyrus x bretschneideri]
Length=748

 Score =   390 bits (1003),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 234/295 (79%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  459   FKIGAYKSFSEISPVVQFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALR  518

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG   SLKITA  S    ++ E+   R NL  FASE+N+ FE E + +E LNS S     
Sbjct  519   NGGASSLKITAFISSSAHDEFEVSFTRENLKHFASELNLAFELELVSLESLNSGSWGLPI  578

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +    A+AVNLP+G  S+N  + LPLIL FVK+L P+IVVS+D G DRTD+PFP  II 
Sbjct  579   HASDGVAVAVNLPIGSFSSNPLL-LPLILRFVKQLSPRIVVSLDRGSDRTDVPFPHQIIQ  637

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             ALHSYS LLES+DAVN+NPDALQKIE++++QPGIEK VT R    SP++T +  WRT+FL
Sbjct  638   ALHSYSGLLESIDAVNVNPDALQKIERYLLQPGIEKIVTGRH--HSPKRTPS--WRTLFL  693

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFHVEKRQSSLVLCWQRK+LISASAWRC
Sbjct  694   SSGFSPLTFSNFTESQAECLVQRTPVGGFHVEKRQSSLVLCWQRKDLISASAWRC  748



>ref|XP_007052139.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOX96296.1| GRAS family transcription factor [Theobroma cacao]
Length=730

 Score =   389 bits (1000),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 227/295 (77%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLE  EG  RIHI+DFDIGYG QWASLMQEL L 
Sbjct  441   FKIGAYKSFSEISPIVQFANFTCNQALLEVFEGCSRIHIIDFDIGYGGQWASLMQELVLR  500

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG  PSLKITA +SP   ++LELG  + NL  FASEINM FE E + +E L+S S     
Sbjct  501   NGGAPSLKITAFSSPSTHDELELGFTQDNLKHFASEINMAFEIERMSLEALSSGSWPLPL  560

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVNLP+G  S N   +LPL+L FVK+L PKIVVS+D GCDRTD+ FP H++H
Sbjct  561   HLPENEAIAVNLPIGCFS-NYPSTLPLVLRFVKQLSPKIVVSLDRGCDRTDVSFPHHVVH  619

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYS LLESLDAVNMN DALQKIE+F++QPGIEK V  R  S      +T  WR++F+
Sbjct  620   ALQSYSGLLESLDAVNMNLDALQKIERFLLQPGIEKIVLGRHRS----LERTPPWRSLFV  675

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF+P +FSNF ESQAEC+++RTP+ GFHVEKRQSSLVLCWQR+ELI+ASAWRC
Sbjct  676   QSGFSPLTFSNFTESQAECLVQRTPISGFHVEKRQSSLVLCWQRRELIAASAWRC  730



>gb|KDP28794.1| hypothetical protein JCGZ_14565 [Jatropha curcas]
Length=658

 Score =   387 bits (993),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 229/293 (78%), Gaps = 7/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLEA EGFDRIHI+DFDIG+G QWASLMQELAL 
Sbjct  373   FKIGAYKSFSEISPILQFANFTCNQALLEACEGFDRIHIIDFDIGFGGQWASLMQELALR  432

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  PSL+ITA ASP  ++++ELG  + NL  FASEINM FE E LG E LN  S     
Sbjct  433   NGGAPSLRITAFASPSSRDEVELGFTQENLRIFASEINMPFELEILGFESLN--SMPFRG  490

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +  I VNLP+G  S N   SLP+ L FVK+L PKIVVS+D GCDRTDLPF  H+ +++
Sbjct  491   SEKEVIVVNLPIGPFS-NYPSSLPVALRFVKQLSPKIVVSLDRGCDRTDLPFASHVNNSI  549

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              SYS+LLESL+AVNMN +ALQKIE+F++QPGIEK V  R     P++T    W+++FL S
Sbjct  550   QSYSSLLESLEAVNMNSEALQKIERFLVQPGIEKIVLGRH--RHPDRTPP--WKSLFLQS  605

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GFTP  FSNFAESQA+C+++RTP  GFHVEKRQSSLVLCWQRKELISASAWRC
Sbjct  606   GFTPIQFSNFAESQADCLVQRTPARGFHVEKRQSSLVLCWQRKELISASAWRC  658



>gb|EPS74456.1| hypothetical protein M569_00292, partial [Genlisea aurea]
Length=371

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 235/299 (79%), Gaps = 13/299 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSE+SP+ QFANFT NQA+LEA++GFD IHIVDFDIGYG QWASLMQE+ L 
Sbjct  80    FKVGAYKLFSEISPVVQFANFTANQAVLEAVDGFDAIHIVDFDIGYGVQWASLMQEIGLR  139

Query  2425  NG-TTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
              G +TPS+KITA  SP   +QLELG+IR NLI FASE+N+ FEF+ +G++ L SS  W  
Sbjct  140   GGSSTPSVKITAFISPGTHDQLELGLIRENLIHFASEVNIPFEFQAIGIDSLGSSGPWLL  199

Query  2248  sySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
               S+A    +AVNLP G L +    S+P ILSF+K+L P+IVVSV+TGCDRTDL F DH+
Sbjct  200   PESKAEDEGVAVNLPFGSLPS----SMPSILSFLKRLSPRIVVSVETGCDRTDLSFADHV  255

Query  2077  IHALHSYSNLLESLDAVN--MNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             +H L S+S+LLESLDAVN  MN DALQKIE+F+++P IE+ V ARF   SP+K Q QHW+
Sbjct  256   VHVLQSHSDLLESLDAVNLHMNNDALQKIERFLLKPAIERAVAARF--RSPDKAQ-QHWK  312

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             ++ LS GF+P  FS+  ESQAECV+KR+PV GF VEK QSSL+LCWQ+KEL+S SAWRC
Sbjct  313   SLLLSCGFSPVMFSSLTESQAECVVKRSPVRGFRVEKSQSSLLLCWQKKELLSVSAWRC  371



>ref|XP_009375779.1| PREDICTED: scarecrow-like protein 22 [Pyrus x bretschneideri]
Length=702

 Score =   382 bits (981),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 232/295 (79%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  413   FKIGAYKSFSEISPVVQFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALR  472

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  PSLKITA  S    ++ E+   R NL  FA+E+N+ FE E + +E LNS S     
Sbjct  473   NGGVPSLKITAFISSSTHDEFEVSFTRENLKHFATELNLAFELELVSLEALNSGSLGLPL  532

Query  2245  ySE--AAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
             ++    A+AVNLP+G  S N  +SLPLIL FVK+L P+IVVS+D G DRTDLPFP  II 
Sbjct  533   HASEGVAVAVNLPIGSFSNN-PLSLPLILRFVKQLSPRIVVSLDRGSDRTDLPFPHQIIQ  591

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL+SYS LLES+DA N+NPDALQKIE++++QPGIEK VT       P++T +  WRT+FL
Sbjct  592   ALYSYSGLLESIDAANVNPDALQKIERYLLQPGIEKIVTGCH--LLPKRTPS--WRTLFL  647

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFH+EKRQSSLVLCWQ K+LISASAWRC
Sbjct  648   SSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQCKDLISASAWRC  702



>ref|XP_008371269.1| PREDICTED: scarecrow-like protein 6 [Malus domestica]
Length=750

 Score =   382 bits (982),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 231/295 (78%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSF+E+SP+ QFANFT NQA+LEA+EGF R+H++DFDIGYG QWAS MQE+AL 
Sbjct  461   FKIGAYKSFTEISPVVQFANFTCNQAILEAVEGFKRVHVIDFDIGYGGQWASFMQEVALR  520

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG   SLK+TA  S    ++ E+   R NL  FASE+N+ FE E + +E LNS S     
Sbjct  521   NGGASSLKMTAFISSSAHDEFEVSFTRENLKHFASELNLAFELELVSLESLNSGSWGLPL  580

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +    A+AVNLP+G   +N  + LPLIL FVK+L P IVVS+D G DRTD+PFP  II 
Sbjct  581   HASDGVAVAVNLPIGSFLSNPLL-LPLILRFVKQLSPTIVVSLDRGSDRTDVPFPHQIIQ  639

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             ALHSYS LLES+DAVN+NPDALQKIE++++QPGIEK VT R    SP++T +  WRT+FL
Sbjct  640   ALHSYSGLLESIDAVNINPDALQKIERYLLQPGIEKIVTGR--HHSPKRTPS--WRTLFL  695

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFHVEK+QSSLVLCWQRK+LISASAWRC
Sbjct  696   SSGFSPLTFSNFTESQAECLVQRTPVGGFHVEKKQSSLVLCWQRKDLISASAWRC  750



>ref|XP_008341645.1| PREDICTED: scarecrow-like protein 22 [Malus domestica]
Length=748

 Score =   382 bits (981),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 231/295 (78%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  459   FKIGAYKSFSEISPVVQFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALG  518

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG  PSLKITA  S    ++ E+   R NL  FASE+N+ FE E + +E LNS S     
Sbjct  519   NGGVPSLKITAFISSSTHDEFEVSFTRENLKHFASELNLAFELELVSLESLNSGSWGLPL  578

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +    A+AVNLP+G  S N  +SLPLIL FVK+L P+IVVS+D G DR D+PFP  II 
Sbjct  579   HASEGVAVAVNLPIGSFSNN-PLSLPLILRFVKQLSPRIVVSLDRGSDRIDVPFPHQIIQ  637

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+HSYS LLES+DA N+NPDALQKIE++++QPGIEK VT R     P++T +  WRT+FL
Sbjct  638   AIHSYSGLLESIDAANVNPDALQKIERYLLQPGIEKIVTGRH--LLPKRTPS--WRTLFL  693

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFH+EK+QSSLVLCWQ K+LISASAWRC
Sbjct  694   SSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKKQSSLVLCWQCKDLISASAWRC  748



>ref|XP_009349895.1| PREDICTED: scarecrow-like protein 6, partial [Pyrus x bretschneideri]
Length=679

 Score =   379 bits (974),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 231/295 (78%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+  FANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  390   FKIGAYKSFSEISPVVHFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALR  449

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  PSLKITA  S    ++ E+   R NL  FASE+N+ FE E + +E LNS S     
Sbjct  450   NGGVPSLKITAFISSSTHDEFEVSFTRENLEHFASELNLAFELELVSLESLNSGSLGLPL  509

Query  2245  ySE--AAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
             ++    A+AVNLP+G  S N  +SLPLIL FVK+L P+IVVS+D G DRTD+PFP  II 
Sbjct  510   HASEGVAVAVNLPIGSFSNN-PLSLPLILRFVKQLSPRIVVSLDRGSDRTDVPFPHQIIQ  568

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL+SYS LLES+DA N+NPDALQKIE++++QPGIEK VT       P++T +  WRT+FL
Sbjct  569   ALYSYSGLLESIDAANVNPDALQKIERYLLQPGIEKIVTGCH--LLPKRTPS--WRTLFL  624

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFH+EKRQSSLVLCWQ K+LISASAWRC
Sbjct  625   SSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQCKDLISASAWRC  679



>gb|AEL95438.1| GRAS transcription factor [Populus euphratica]
Length=378

 Score =   368 bits (944),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 220/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ LLEA EGF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  89    FKIGAYKSFSEISPILQFANFTCNQVLLEAFEGFERIHIVDFDIGYGGQWASLMQELALR  148

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
              G  PSLKITA ASP   ++LELG  + NL  FASEINM FE E L +E L S S     
Sbjct  149   TGGAPSLKITAFASPSSYDELELGFTQENLRIFASEINMPFELEILSLESLGSGSWPMPP  208

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +  +   AVNLP+G  S N   +LPL L FVK+L PK+VVS+D GCDR+DLP   HI H
Sbjct  209   RTSEKEVTAVNLPIGSFS-NDPSTLPLALRFVKQLSPKVVVSLDRGCDRSDLPLAYHINH  267

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SYS+LLESLDAVN+N D +QKIE+F++QPG EK V  R     P++T    WR +FL
Sbjct  268   AIQSYSSLLESLDAVNVNLDTIQKIERFLVQPGTEKIVLGR--HRRPDRTPP--WRNLFL  323

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE ++ RTPV GFHVE RQSSLVLCWQRK+LISASAW C
Sbjct  324   QSGFTPLTFSNFTESQAEYLVHRTPVRGFHVETRQSSLVLCWQRKDLISASAWTC  378



>ref|XP_006375288.1| hypothetical protein POPTR_0014s05940g [Populus trichocarpa]
 gb|ERP53085.1| hypothetical protein POPTR_0014s05940g [Populus trichocarpa]
Length=666

 Score =   377 bits (969),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 221/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ LLEA EGF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  377   FKIGAYKSFSEISPILQFANFTCNQVLLEASEGFERIHIVDFDIGYGGQWASLMQELALR  436

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
              G  PSLKITA ASP   ++LELG  R NL  FASEINM FE E L +E L S S     
Sbjct  437   TGGAPSLKITAFASPSSHDELELGFTRENLRIFASEINMPFELEILSLESLGSGSWPMPL  496

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                 +   AVNLP+G  S N   +LPL L FVK L PK+VVS+D GCDR+DLPF  H+ H
Sbjct  497   RMPEKEVTAVNLPIGSFS-NDTSTLPLALRFVKHLSPKVVVSLDRGCDRSDLPFAHHVNH  555

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SYS LLESLDAVN+N DALQKIE F++QPGIEK V  R     P++T    WR++FL
Sbjct  556   AIQSYSTLLESLDAVNVNLDALQKIESFLVQPGIEKIVLGRH--RCPDRTSP--WRSLFL  611

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP  FSNF ESQAE ++ RTPV GFHVEKRQSSLVLCWQRK+LI+ASAWRC
Sbjct  612   QSGFTPLPFSNFTESQAEYLVHRTPVRGFHVEKRQSSLVLCWQRKDLIAASAWRC  666



>ref|XP_009342426.1| PREDICTED: scarecrow-like protein 6 [Pyrus x bretschneideri]
Length=748

 Score =   379 bits (973),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 231/295 (78%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+  FANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  459   FKIGAYKSFSEISPVVHFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALR  518

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  PSLKITA  S    ++ E+   R NL  FASE+N+ FE E + +E LNS S     
Sbjct  519   NGGVPSLKITAFISSSTHDEFEVSFTRENLEHFASELNLAFELELVSLESLNSGSLGLPL  578

Query  2245  ySE--AAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
             ++    A+AVNLP+G  S N  +SLPLIL FVK+L P+IVVS+D G DRTD+PFP  II 
Sbjct  579   HASEGVAVAVNLPIGSFSNN-PLSLPLILRFVKQLSPRIVVSLDRGSDRTDVPFPHQIIQ  637

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL+SYS LLES+DA N+NPDALQKIE++++QPGIEK VT       P++T +  WRT+FL
Sbjct  638   ALYSYSGLLESIDAANVNPDALQKIERYLLQPGIEKIVTGCH--LLPKRTPS--WRTLFL  693

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFH+EKRQSSLVLCWQ K+LISASAWRC
Sbjct  694   SSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQCKDLISASAWRC  748



>ref|XP_009611444.1| PREDICTED: uncharacterized protein LOC104104938 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009611445.1| PREDICTED: uncharacterized protein LOC104104938 isoform X2 [Nicotiana 
tomentosiformis]
Length=1575

 Score =   393 bits (1010),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/250 (80%), Positives = 220/250 (88%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNP-FQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I  S S+ QTP+A+    T+ EGN  FQAD T SESS+SP+W KMN+  KD
Sbjct  1321  LVVEVPHDLILSSLSNLQTPKAEPTQLTVEEGNAVFQADSTCSESSSSPQWSKMNECRKD  1380

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VK+VRLDISFKSPSHTGLQT+ELVKELTEQFPA+ PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1381  VKAVRLDISFKSPSHTGLQTTELVKELTEQFPASTPLALVLKQFLADRSLDQSYSGGLSS  1440

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHHHGR   QN GSLLMDF YFFGNVFDPRQMRVSIQGSGLYINRER
Sbjct  1441  YCLVLLITRFLQHEHHHGRLIDQNLGSLLMDFFYFFGNVFDPRQMRVSIQGSGLYINRER  1500

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI IDDPL+PTNNVGRNCFRIHQCIKAFADAYSTLE+EI  LPSND+S++ +P +
Sbjct  1501  GCSIDPICIDDPLYPTNNVGRNCFRIHQCIKAFADAYSTLENEIPSLPSNDESNS-VPQV  1559

Query  706   KLLPKVIPSI  735
             KLLP++IPSI
Sbjct  1560  KLLPRIIPSI  1569



>ref|XP_009802870.1| PREDICTED: uncharacterized protein LOC104248329 [Nicotiana sylvestris]
Length=1578

 Score =   393 bits (1009),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 201/250 (80%), Positives = 219/250 (88%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNP-FQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I  S S+ QTP+A+     + EGN  FQAD T SESS+SP+W KMN+  KD
Sbjct  1324  LVVEVPHDLILSSLSNLQTPKAEPTQLIVEEGNAVFQADSTCSESSSSPQWSKMNECRKD  1383

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VK+VRLDISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1384  VKAVRLDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1443

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHHHGR   QN GSLLMDF YFFGNVFDPRQMRVSIQGSGLYINRER
Sbjct  1444  YCLVLLITRFLQHEHHHGRLIDQNLGSLLMDFFYFFGNVFDPRQMRVSIQGSGLYINRER  1503

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI IDDPL+PTNNVGRNCFRIHQCIKAFADAYSTLE+EI  LPSND+S++ +P +
Sbjct  1504  GCSIDPICIDDPLYPTNNVGRNCFRIHQCIKAFADAYSTLENEIPSLPSNDESNS-VPQV  1562

Query  706   KLLPKVIPSI  735
             KLLP++IPSI
Sbjct  1563  KLLPRIIPSI  1572



>ref|XP_002511661.1| hypothetical protein RCOM_1610560 [Ricinus communis]
 gb|EEF50330.1| hypothetical protein RCOM_1610560 [Ricinus communis]
Length=733

 Score =   377 bits (967),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 227/295 (77%), Gaps = 8/295 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QF+NFT NQALLEA EG DRIHIVDFDIG+G QWASLMQELAL 
Sbjct  445   LKIGAYKSFSEISPILQFSNFTCNQALLEACEGSDRIHIVDFDIGFGGQWASLMQELALR  504

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             NG   SLKITA  SP   +++ELG  + NL  FA EINM FE E LG++ LNS   S   
Sbjct  505   NGGVSSLKITAFVSP-SHDEIELGFTQENLRVFAGEINMPFELEILGLDALNSGSWSMPI  563

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                 +  IAVNLP+   S N   SLP++L FVK+L PKIVVS+D GCDRTDLPF  HI H
Sbjct  564   RISDKEVIAVNLPIAPFS-NYPSSLPVVLRFVKQLSPKIVVSLDRGCDRTDLPFAHHINH  622

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             ++ SYS LLESL+AVNMN DALQKIE+F++QP IEK V +R     P++T    W+++FL
Sbjct  623   SIQSYSGLLESLEAVNMNIDALQKIERFLVQPAIEKIVLSRH--GHPDRTTP--WKSLFL  678

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTPF FSNFAESQAEC+++RTPV GFHVEKRQS+LVLCWQRKELISASAWRC
Sbjct  679   QSGFTPFQFSNFAESQAECLVQRTPVRGFHVEKRQSTLVLCWQRKELISASAWRC  733



>ref|XP_008232583.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6 [Prunus 
mume]
Length=769

 Score =   377 bits (968),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 226/295 (77%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  480   FKIGAYKSFSEISPVLQFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEIALR  539

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             N   PS KITA  S    ++ E+G  R NL  FASE+N+ FE E + +E LNS S     
Sbjct  540   NCGAPSFKITAFISSSTHDEFEIGFTRENLKHFASELNLSFELELVSLEALNSGSWGLPL  599

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   A+AVNLP+G  S N  +SL + L FVK+L PKIVVS+D G DRTD+PF   +I 
Sbjct  600   HVSEGVAVAVNLPIGSFSNN-PLSLTMALGFVKQLSPKIVVSLDRGSDRTDVPFAHQVIQ  658

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             ALHSYS LLESLDAVN+NPDALQKIE++++QPGIEK VT R    SP++T    WRT+F 
Sbjct  659   ALHSYSGLLESLDAVNVNPDALQKIERYLLQPGIEKIVTGRH--LSPKRTPP--WRTLFS  714

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFH+EKRQSSLVLCWQRK+LIS S WRC
Sbjct  715   SSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQRKDLISVSVWRC  769



>ref|XP_004306953.1| PREDICTED: scarecrow-like protein 6-like [Fragaria vesca subsp. 
vesca]
Length=737

 Score =   376 bits (965),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 229/296 (77%), Gaps = 6/296 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             +KI AYKSFSE+SP+ QFANFT NQA+LE++EG++R+H++DFDIGYG QWAS MQE+AL 
Sbjct  445   YKIAAYKSFSEISPVLQFANFTCNQAILESVEGYNRVHVIDFDIGYGGQWASFMQEVALR  504

Query  2428  NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sw  2255
             N G+ PSLKITA       ++ EL   + NL  FASE+N+ FE E + +E LNS S    
Sbjct  505   NGGSPPSLKITAFVCSSVHDEFELAFTQENLKNFASELNLAFELEIVSIEALNSGSWPLP  564

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    A+AVNLP+G    N  +SLPL+L FVK+L PKIVVS++ G DRTD+PFP  II
Sbjct  565   LHGSDSVAVAVNLPIGSF-LNSPLSLPLVLRFVKQLSPKIVVSLERGSDRTDIPFPHQII  623

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
              ALHSYS+LLESLDAVN N DALQKIE++++QP IEK V  R  S  P++T T  WRT+F
Sbjct  624   QALHSYSSLLESLDAVNANLDALQKIERYLLQPSIEKIVMGRHLS--PKRTPTPSWRTLF  681

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             LSSGF+P +FSNF ESQAEC+++RTPVGGFHVEKRQSSLVLCWQRK+L+SASAWRC
Sbjct  682   LSSGFSPLTFSNFTESQAECLVQRTPVGGFHVEKRQSSLVLCWQRKDLVSASAWRC  737



>ref|XP_006375286.1| hypothetical protein POPTR_0014s05910g [Populus trichocarpa]
 gb|ERP53083.1| hypothetical protein POPTR_0014s05910g [Populus trichocarpa]
Length=715

 Score =   375 bits (962),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 223/295 (76%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ LLEA EGF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  426   FKIGAYKSFSEISPILQFANFTCNQVLLEAFEGFERIHIVDFDIGYGGQWASLMQELALK  485

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
              G  PSLKITA ASP   ++LELG  + NL  FASE+NM FE E L +E L S S     
Sbjct  486   TGGAPSLKITAFASPSSHDELELGFTQENLRIFASEMNMPFELEILSLESLGSGSWPMPP  545

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +  +   AVNLP+G  S N   +LPL L FVK+L PK+VVS+D GCDR+DLPF  HI H
Sbjct  546   RTSEKEVTAVNLPIGSFS-NDPSTLPLALRFVKQLSPKVVVSLDRGCDRSDLPFGHHINH  604

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SYS LLESLDAVN+N D LQKIE+F++QPGIEK V  R     P++T    WR +FL
Sbjct  605   AIQSYSGLLESLDAVNVNLDTLQKIERFLVQPGIEKIVLGR--HRCPDRTPP--WRNLFL  660

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE +++RTPV GFHVE RQSSLVLCWQRK+LISASAWRC
Sbjct  661   QSGFTPLTFSNFTESQAEYLVQRTPVRGFHVETRQSSLVLCWQRKDLISASAWRC  715



>ref|XP_006347902.1| PREDICTED: uncharacterized protein LOC102580618 isoform X1 [Solanum 
tuberosum]
 ref|XP_006347903.1| PREDICTED: uncharacterized protein LOC102580618 isoform X2 [Solanum 
tuberosum]
 ref|XP_006347904.1| PREDICTED: uncharacterized protein LOC102580618 isoform X3 [Solanum 
tuberosum]
 ref|XP_006347905.1| PREDICTED: uncharacterized protein LOC102580618 isoform X4 [Solanum 
tuberosum]
Length=1585

 Score =   390 bits (1003),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 218/249 (88%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP D I+ S S+ QTP+A+    T+ EGN FQAD T S+SS+SP+W KMND  KDV
Sbjct  1332  LVVEVPHDLISSSLSNLQTPKAEPTQLTVEEGNTFQADSTCSDSSSSPQWSKMNDCVKDV  1391

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             K+VRLDISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1392  KAVRLDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSSY  1451

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLITRFLQHEHHH R   QN GSLLMDF YFFGNVFDPRQ+RVSIQGSGLYINRERG
Sbjct  1452  CLVLLITRFLQHEHHHSRPIDQNLGSLLMDFFYFFGNVFDPRQIRVSIQGSGLYINRERG  1511

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
              SIDPI IDDPL+PTNNVGRNCFRIHQCIKAFADAYS LE+EI  LP ND+S++ +P +K
Sbjct  1512  CSIDPICIDDPLYPTNNVGRNCFRIHQCIKAFADAYSILENEIPSLPCNDESNS-VPQVK  1570

Query  709   LLPKVIPSI  735
             LLP+++PSI
Sbjct  1571  LLPRIVPSI  1579



>ref|XP_006347906.1| PREDICTED: uncharacterized protein LOC102580618 isoform X5 [Solanum 
tuberosum]
Length=1584

 Score =   390 bits (1003),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 218/249 (88%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP D I+ S S+ QTP+A+    T+ EGN FQAD T S+SS+SP+W KMND  KDV
Sbjct  1331  LVVEVPHDLISSSLSNLQTPKAEPTQLTVEEGNTFQADSTCSDSSSSPQWSKMNDCVKDV  1390

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             K+VRLDISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1391  KAVRLDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSSY  1450

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLITRFLQHEHHH R   QN GSLLMDF YFFGNVFDPRQ+RVSIQGSGLYINRERG
Sbjct  1451  CLVLLITRFLQHEHHHSRPIDQNLGSLLMDFFYFFGNVFDPRQIRVSIQGSGLYINRERG  1510

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
              SIDPI IDDPL+PTNNVGRNCFRIHQCIKAFADAYS LE+EI  LP ND+S++ +P +K
Sbjct  1511  CSIDPICIDDPLYPTNNVGRNCFRIHQCIKAFADAYSILENEIPSLPCNDESNS-VPQVK  1569

Query  709   LLPKVIPSI  735
             LLP+++PSI
Sbjct  1570  LLPRIVPSI  1578



>ref|XP_010325553.1| PREDICTED: uncharacterized protein LOC101252827 isoform X2 [Solanum 
lycopersicum]
Length=1550

 Score =   389 bits (998),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/249 (78%), Positives = 217/249 (87%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP D I+ S S+ QTP+A+    T+ EGN FQAD T S+SS+SP+W KMN+  KDV
Sbjct  1297  LVVEVPHDLISSSLSNLQTPKAEPTELTVEEGNTFQADSTCSDSSSSPQWSKMNECVKDV  1356

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             K+VRLDISFKSPSHTGLQT+ELVKELTEQFPA  PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1357  KAVRLDISFKSPSHTGLQTTELVKELTEQFPATTPLALVLKQFLADRSLDQSYSGGLSSY  1416

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLITRFLQHEHHH R   QN GSLLMDF YFFGNVFDPRQ+RVSIQGSGLYINRERG
Sbjct  1417  CLVLLITRFLQHEHHHSRPIDQNLGSLLMDFFYFFGNVFDPRQIRVSIQGSGLYINRERG  1476

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
              SIDPI IDDPL+PTNNVGRNCFRIHQCIKAFADAYS LE+EI  LP ND+S++ +P +K
Sbjct  1477  CSIDPICIDDPLYPTNNVGRNCFRIHQCIKAFADAYSILENEIASLPCNDESNS-VPQVK  1535

Query  709   LLPKVIPSI  735
             LLP+++PSI
Sbjct  1536  LLPRIVPSI  1544



>ref|XP_010325546.1| PREDICTED: uncharacterized protein LOC101252827 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325550.1| PREDICTED: uncharacterized protein LOC101252827 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325551.1| PREDICTED: uncharacterized protein LOC101252827 isoform X1 [Solanum 
lycopersicum]
Length=1582

 Score =   389 bits (998),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/249 (78%), Positives = 217/249 (87%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP D I+ S S+ QTP+A+    T+ EGN FQAD T S+SS+SP+W KMN+  KDV
Sbjct  1329  LVVEVPHDLISSSLSNLQTPKAEPTELTVEEGNTFQADSTCSDSSSSPQWSKMNECVKDV  1388

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             K+VRLDISFKSPSHTGLQT+ELVKELTEQFPA  PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1389  KAVRLDISFKSPSHTGLQTTELVKELTEQFPATTPLALVLKQFLADRSLDQSYSGGLSSY  1448

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLITRFLQHEHHH R   QN GSLLMDF YFFGNVFDPRQ+RVSIQGSGLYINRERG
Sbjct  1449  CLVLLITRFLQHEHHHSRPIDQNLGSLLMDFFYFFGNVFDPRQIRVSIQGSGLYINRERG  1508

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
              SIDPI IDDPL+PTNNVGRNCFRIHQCIKAFADAYS LE+EI  LP ND+S++ +P +K
Sbjct  1509  CSIDPICIDDPLYPTNNVGRNCFRIHQCIKAFADAYSILENEIASLPCNDESNS-VPQVK  1567

Query  709   LLPKVIPSI  735
             LLP+++PSI
Sbjct  1568  LLPRIVPSI  1576



>ref|XP_007220242.1| hypothetical protein PRUPE_ppa001781mg [Prunus persica]
 gb|EMJ21441.1| hypothetical protein PRUPE_ppa001781mg [Prunus persica]
Length=765

 Score =   374 bits (959),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 225/295 (76%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQA+LEA+EGF+R+H++DFDIGYG QWAS MQE+AL 
Sbjct  476   FKIGAYKSFSEISPVLQFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALR  535

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             N   PS KITA  S    ++ E+G  R NL  FASE+N+ FE E + +E LNS S     
Sbjct  536   NCGAPSFKITAFISSSTHDEFEIGFTRENLKHFASELNLSFELELVSLEALNSGSWGLPL  595

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   A+AVNLP+G  S N  +SL + L FVK+L PKIVVS+D G DRTD+PF   II 
Sbjct  596   HVSEGVAVAVNLPIGSFSNN-PLSLTMALRFVKQLSPKIVVSLDRGSDRTDVPFAHQIIQ  654

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             +LHSYS LLESLDAVN+NPDALQKIE++++QPGIEK VT R    SP++T    WRT+F 
Sbjct  655   SLHSYSGLLESLDAVNVNPDALQKIERYLLQPGIEKIVTGRH--LSPKRTPP--WRTLFS  710

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++RTPVGGFH+EKRQSSLVLCWQ K+LIS S WRC
Sbjct  711   SSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQHKDLISVSVWRC  765



>ref|XP_002302518.1| scarecrow transcription factor family protein [Populus trichocarpa]
 gb|EEE81791.1| scarecrow transcription factor family protein [Populus trichocarpa]
Length=602

 Score =   368 bits (944),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 226/297 (76%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLEA EGF+RIH+VDFDIGYG QWASLMQELAL 
Sbjct  311   FKIGAYKSFSEISPILQFANFTCNQALLEAFEGFERIHVVDFDIGYGGQWASLMQELALR  370

Query  2425  NGTTPSLKITALASPLKQE--QLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             NG  PSLKITA  SP   +  +LELG  + NL  FASEINM FE E L +E L S S   
Sbjct  371   NGGAPSLKITAFVSPSSHDELELELGFTQENLRIFASEINMPFELEILSLESLGSVSRPM  430

Query  2251  d--sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                +  +  IAVNLP+G  S N   +LP++L FVK+L PK+VVS+D+GCDR+DLPF  HI
Sbjct  431   TLCTLDKEVIAVNLPLGVFS-NYPSTLPVVLRFVKQLSPKVVVSLDSGCDRSDLPFAHHI  489

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
              HA+ SY++LLESLDAVN+N D LQKIE+F++QP IE+ V  R         +T  WR++
Sbjct  490   NHAIQSYTSLLESLDAVNVNLDILQKIERFLVQPCIERMVLGRHGCSD----RTTPWRSL  545

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             FL SGFTP +FSNF ESQAEC+++RTPV GFHVEK+QSSLVLCWQ+++L+S SAW C
Sbjct  546   FLQSGFTPLTFSNFTESQAECLVQRTPVKGFHVEKKQSSLVLCWQQRDLVSVSAWSC  602



>ref|XP_006445315.1| hypothetical protein CICLE_v10019094mg [Citrus clementina]
 ref|XP_006490865.1| PREDICTED: scarecrow-like protein 27-like isoform X1 [Citrus 
sinensis]
 ref|XP_006490866.1| PREDICTED: scarecrow-like protein 27-like isoform X2 [Citrus 
sinensis]
 gb|ESR58555.1| hypothetical protein CICLE_v10019094mg [Citrus clementina]
 gb|KDO85729.1| hypothetical protein CISIN_1g005326mg [Citrus sinensis]
Length=702

 Score =   370 bits (951),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 221/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT NQALLEA EG +RIHI+DFDIGYG QWASLMQEL L 
Sbjct  413   FKISAYKSFSEISPILQFANFTCNQALLEAFEGCNRIHIIDFDIGYGGQWASLMQELVLR  472

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssw--s  2252
             +   PSLKITA ASP   ++LEL   R NL  FASEINM FE E L +E LNS+S     
Sbjct  473   SEGPPSLKITAFASPSTHDELELSFTRENLKHFASEINMPFELEILSLEALNSASLALPL  532

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   A AVNLP+G    N   + P +L FVK+L+PKIVVS+D GCDRTD+PFP H+IH
Sbjct  533   RGLESEATAVNLPIGTF-CNYPATFPSVLCFVKQLKPKIVVSLDRGCDRTDVPFPHHMIH  591

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYS LLESLDAVN+N DALQKIE+F++ P IEK V  R    SPE+     W+++F+
Sbjct  592   ALQSYSCLLESLDAVNVNLDALQKIERFLVYPCIEKIVLGR--HHSPERLPP--WKSLFM  647

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF P +FSNF ESQA+C+++RTPV GFHVEKRQSSL LCWQRKELI A+AWRC
Sbjct  648   QSGFAPLTFSNFTESQADCLVQRTPVKGFHVEKRQSSLALCWQRKELILATAWRC  702



>gb|ACV95482.1| SCL6 [Citrus trifoliata]
Length=706

 Score =   370 bits (949),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 220/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT NQALLEA EG +RIHI+DFDIGYG QWASLMQEL L 
Sbjct  417   FKISAYKSFSEISPILQFANFTCNQALLEAFEGCNRIHIIDFDIGYGGQWASLMQELVLR  476

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
             +   PSLKITA ASP   ++LEL   R NL  FASEINM FE E L +E LNS+S     
Sbjct  477   SEGPPSLKITAFASPSTHDELELSFTRENLKHFASEINMPFELEILSLEALNSASLALPF  536

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   A AVNLP+G    N   + P +L FVK+L+PKIVVS+D GCDRTD+PFP H IH
Sbjct  537   RGLESEATAVNLPIGTF-CNYPATFPSVLCFVKQLKPKIVVSLDRGCDRTDVPFPHHTIH  595

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYS LLESLDAVN+N DALQKIE+F++ P IEK V  R    SPE+     W+++F+
Sbjct  596   ALQSYSCLLESLDAVNVNLDALQKIERFLVYPCIEKIVLGR--HRSPERLPP--WKSLFM  651

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF P +FSNF ESQA+C+++RTPV GFHVEKRQSSLV CWQRKELI A+AWRC
Sbjct  652   QSGFAPLTFSNFTESQADCLVQRTPVKGFHVEKRQSSLVFCWQRKELILATAWRC  706



>ref|XP_002301269.1| hypothetical protein POPTR_0002s14550g [Populus trichocarpa]
 gb|EEE80542.1| hypothetical protein POPTR_0002s14550g [Populus trichocarpa]
Length=732

 Score =   370 bits (949),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 231/295 (78%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFA+FT NQALLEA EGF+RIH+VDFDIGYG QWASLMQELAL 
Sbjct  443   FKIGAYKSFSEISPILQFASFTCNQALLEAFEGFERIHVVDFDIGYGGQWASLMQELALR  502

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG  PSLKITA ASP   ++LELG  + NL  FASEINM FE E L +E L+S S     
Sbjct  503   NGGAPSLKITAFASPSSHDELELGFTQENLKMFASEINMPFEIEILSLESLSSGSWPMPL  562

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                 +  IAVNLPVG  S N   +LPL+L FVK+L PK+VVS+D GCDR+DLPF  H+ H
Sbjct  563   RLTEKEVIAVNLPVGSFS-NYPSTLPLVLRFVKQLLPKVVVSLDRGCDRSDLPFAHHVNH  621

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SY++LLESLDAVN+N DA+QKIE+F++QPGIEKTV  R     P++T    WR++FL
Sbjct  622   AIQSYTSLLESLDAVNVNLDAVQKIERFLVQPGIEKTVLGR--HSCPDRTPP--WRSLFL  677

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE +++RTPV GFHVEKRQSSLVLCWQ K+L+SASAWRC
Sbjct  678   QSGFTPLTFSNFTESQAEYLVQRTPVRGFHVEKRQSSLVLCWQHKDLVSASAWRC  732



>ref|XP_011033505.1| PREDICTED: scarecrow-like protein 22 isoform X2 [Populus euphratica]
Length=695

 Score =   368 bits (945),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 221/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ LLEA EGF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  406   FKIGAYKSFSEISPILQFANFTCNQVLLEAFEGFERIHIVDFDIGYGGQWASLMQELALR  465

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
              G  PSLKITA +SP   ++LELG  + NL  FASEINM FE E L +E L S S     
Sbjct  466   TGGAPSLKITAFSSPSSYDELELGFTQENLRIFASEINMPFELEILSLESLGSGSWPMPP  525

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +  +   AVNLP+G  S N   +LPL L FVK+L PK+VVS+D GCDR+DLP   HI H
Sbjct  526   RTSEKEVTAVNLPIGSFS-NDPSTLPLALRFVKQLSPKVVVSLDRGCDRSDLPLAHHINH  584

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SYS+LLESLDAVN+N D +QKIE+F++QPGIEK V  R     P++T    WR +FL
Sbjct  585   AIQSYSSLLESLDAVNVNLDTIQKIERFLVQPGIEKIVLGRH--RRPDRTPP--WRNLFL  640

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE ++ RTPV GFHVE RQSSLVLCWQRK+LISASAW C
Sbjct  641   QSGFTPLTFSNFTESQAEYLVHRTPVRGFHVETRQSSLVLCWQRKDLISASAWTC  695



>ref|XP_011033489.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Populus euphratica]
 ref|XP_011033496.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Populus euphratica]
Length=701

 Score =   368 bits (945),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 221/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ LLEA EGF+RIHIVDFDIGYG QWASLMQELAL 
Sbjct  412   FKIGAYKSFSEISPILQFANFTCNQVLLEAFEGFERIHIVDFDIGYGGQWASLMQELALR  471

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
              G  PSLKITA +SP   ++LELG  + NL  FASEINM FE E L +E L S S     
Sbjct  472   TGGAPSLKITAFSSPSSYDELELGFTQENLRIFASEINMPFELEILSLESLGSGSWPMPP  531

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +  +   AVNLP+G  S N   +LPL L FVK+L PK+VVS+D GCDR+DLP   HI H
Sbjct  532   RTSEKEVTAVNLPIGSFS-NDPSTLPLALRFVKQLSPKVVVSLDRGCDRSDLPLAHHINH  590

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SYS+LLESLDAVN+N D +QKIE+F++QPGIEK V  R     P++T    WR +FL
Sbjct  591   AIQSYSSLLESLDAVNVNLDTIQKIERFLVQPGIEKIVLGRH--RRPDRTPP--WRNLFL  646

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE ++ RTPV GFHVE RQSSLVLCWQRK+LISASAW C
Sbjct  647   QSGFTPLTFSNFTESQAEYLVHRTPVRGFHVETRQSSLVLCWQRKDLISASAWTC  701



>gb|KGN55872.1| hypothetical protein Csa_3G020600 [Cucumis sativus]
Length=770

 Score =   370 bits (949),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 223/296 (75%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSE+SP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL+L 
Sbjct  480   FKMGAYKVFSEISPLIQFVNFTCNQALLEALDDIDRIHIVDFDIGFGAQWASFMQELSLR  539

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssw---  2255
             N   PSLKITA ASP     +ELG++R NL QFA++I + FEFE +  + LN +S     
Sbjct  540   NRGAPSLKITAFASPSTHHPIELGLMRENLTQFANDIGISFEFEVVNFDSLNQNSFSLPF  599

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               S    A+AVN P+ W S+NQ   LP +L F+K+L PKIVVS+D GCDR+DLPFP H++
Sbjct  600   PRSSENEAVAVNFPL-WCSSNQPAMLPSLLRFIKQLSPKIVVSLDRGCDRSDLPFPQHML  658

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
              AL SY NLLESLDA+NMN DA+ KIE+F++QP IE TV  R    +PE+     W+T+F
Sbjct  659   QALQSYINLLESLDAINMNSDAVNKIERFLLQPRIESTVLGRL--RAPERMPP--WKTLF  714

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GFTP +FSNF E+QAECV KRT V GFHVEKRQ+SLVLCWQR+ELISASAWRC
Sbjct  715   ASAGFTPVTFSNFTETQAECVAKRTSVRGFHVEKRQASLVLCWQRRELISASAWRC  770



>ref|XP_004147202.1| PREDICTED: scarecrow-like protein 27-like [Cucumis sativus]
Length=774

 Score =   370 bits (949),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 223/296 (75%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSE+SP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL+L 
Sbjct  484   FKMGAYKVFSEISPLIQFVNFTCNQALLEALDDIDRIHIVDFDIGFGAQWASFMQELSLR  543

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N   PSLKITA ASP     +ELG++R NL QFA++I + FEFE +  + LN +S     
Sbjct  544   NRGAPSLKITAFASPSTHHPIELGLMRENLTQFANDIGISFEFEVVNFDSLNQNSFSLPF  603

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   A+AVN P+ W S+NQ   LP +L F+K+L PKIVVS+D GCDR+DLPFP H++
Sbjct  604   PRSSENEAVAVNFPL-WCSSNQPAMLPSLLRFIKQLSPKIVVSLDRGCDRSDLPFPQHML  662

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
              AL SY NLLESLDA+NMN DA+ KIE+F++QP IE TV  R    +PE+     W+T+F
Sbjct  663   QALQSYINLLESLDAINMNSDAVNKIERFLLQPRIESTVLGRL--RAPERMPP--WKTLF  718

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GFTP +FSNF E+QAECV KRT V GFHVEKRQ+SLVLCWQR+ELISASAWRC
Sbjct  719   ASAGFTPVTFSNFTETQAECVAKRTSVRGFHVEKRQASLVLCWQRRELISASAWRC  774



>ref|XP_004169643.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 27-like 
[Cucumis sativus]
Length=774

 Score =   370 bits (949),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 223/296 (75%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSE+SP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL+L 
Sbjct  484   FKMGAYKVFSEISPLIQFVNFTCNQALLEALDDIDRIHIVDFDIGFGAQWASFMQELSLR  543

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N   PSLKITA ASP     +ELG++R NL QFA++I + FEFE +  + LN +S     
Sbjct  544   NRGAPSLKITAFASPSTHHPIELGLMRENLTQFANDIGISFEFEVVNFDSLNQNSFSLPF  603

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   A+AVN P+ W S+NQ   LP +L F+K+L PKIVVS+D GCDR+DLPFP H++
Sbjct  604   PRSSENEAVAVNFPL-WCSSNQPAMLPSLLRFIKQLSPKIVVSLDRGCDRSDLPFPQHML  662

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
              AL SY NLLESLDA+NMN DA+ KIE+F++QP IE TV  R    +PE+     W+T+F
Sbjct  663   QALQSYINLLESLDAINMNSDAVNKIERFLLQPRIESTVLGRL--RAPERMPP--WKTLF  718

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GFTP +FSNF E+QAECV KRT V GFHVEKRQ+SLVLCWQR+ELISASAWRC
Sbjct  719   ASAGFTPVTFSNFTETQAECVAKRTSVRGFHVEKRQASLVLCWQRRELISASAWRC  774



>ref|XP_010088896.1| hypothetical protein L484_020885 [Morus notabilis]
 gb|EXB37093.1| hypothetical protein L484_020885 [Morus notabilis]
Length=776

 Score =   367 bits (942),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 188/299 (63%), Positives = 224/299 (75%), Gaps = 10/299 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYK+FSE+SP+ QFANFT NQA+LEA EGF R+H++DFDIGYG QWAS MQELAL 
Sbjct  482   LKIGAYKTFSEISPVLQFANFTCNQAILEATEGFTRVHVIDFDIGYGGQWASFMQELALR  541

Query  2425  N---GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--  2261
             N   G   SLKITA ASP   ++ ELG  + NL  FASEIN+ FE E L +E LNS    
Sbjct  542   NSGVGNGVSLKITAFASPSTHDEFELGFTQENLKHFASEINLAFELEILSLEMLNSGLWP  601

Query  2260  swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                      AIAVNLP+G  S N  +SLPL+L FVK+L PKIVVS++ GCDRTD+PFP  
Sbjct  602   QNLHVSDNEAIAVNLPIGPFS-NYPLSLPLVLRFVKQLSPKIVVSLERGCDRTDVPFPAQ  660

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             ++HALHSYS LLESLDAVN+N DA+QKIEK ++QPGIEK V  R  +      +   WR+
Sbjct  661   LVHALHSYSGLLESLDAVNVNLDAMQKIEKCLLQPGIEKIVLGRHRNS---LDRMLPWRS  717

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ-SSLVLCWQRKELISASAWRC  1727
              FL+ GF+P +FSNF ESQAEC+++RTPV GFHVEK+Q SSLVLCWQRKEL+SASAWRC
Sbjct  718   AFLNLGFSPLTFSNFTESQAECLVQRTPVRGFHVEKKQSSSLVLCWQRKELVSASAWRC  776



>emb|CDP09497.1| unnamed protein product [Coffea canephora]
Length=1353

 Score =   377 bits (969),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/250 (74%), Positives = 211/250 (84%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI----SEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP+D I  S+S+ Q  + +++     E N FQAD T   +  S K   M  +  KD
Sbjct  1099  LVVEVPQDLIASSASNGQASKEESVQKTSKENNSFQADPTGLATGASNKCCHMKYEMEKD  1158

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKSVRLDISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLK+FLADRSLDQSYSGGLSS
Sbjct  1159  VKSVRLDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKKFLADRSLDQSYSGGLSS  1218

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GRS  QNYGSLLMDFLYFFGNVFDPRQMR+S+QGSG+YINRE+
Sbjct  1219  YCLVLLIMRFLQHEHHLGRSINQNYGSLLMDFLYFFGNVFDPRQMRISVQGSGVYINREQ  1278

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPIYIDDPL+P NNVGRNCFRIHQCIKAFADAYSTLE+E+T LP++D+ + + P+ 
Sbjct  1279  GYSIDPIYIDDPLYPANNVGRNCFRIHQCIKAFADAYSTLENELTCLPNSDELNTK-PAC  1337

Query  706   KLLPKVIPSI  735
             KLLPK+IPSI
Sbjct  1338  KLLPKIIPSI  1347



>ref|XP_004515466.1| PREDICTED: scarecrow-like protein 27-like isoform X2 [Cicer arietinum]
Length=727

 Score =   364 bits (934),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 220/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT+NQALLEA+EGFDRIHI+DFDIG+G QW+S MQELAL 
Sbjct  438   LKIGAYKSFSEISPVLQFANFTSNQALLEAVEGFDRIHIIDFDIGFGGQWSSFMQELALR  497

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  P+LKITA  SP   +++EL     NL Q+ASEINM FE E L  E +NS+S     
Sbjct  498   NGGAPALKITAFVSPSHHDEIELSFTHENLKQYASEINMSFELEILTFESMNSASWPQPL  557

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VNLP+G  S N    LPL+L FVK+L PKIVV++D  CDRTD PFP H+I AL
Sbjct  558   RDCEAVVVNLPIGSFS-NYPSYLPLVLRFVKQLMPKIVVTLDRSCDRTDAPFPQHLIFAL  616

Query  2065  HSYSNLLESLDA--VNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              SYS+LLESLDA  VN++PD LQ IEK+ +QP IEK V+ R  S    + +T  W+ + L
Sbjct  617   QSYSSLLESLDAVSVNVHPDVLQMIEKYYLQPAIEKLVSGRLRS----QDRTLPWKNLML  672

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++R P  GFHVEK+QSSLVLCWQRK+LIS S WRC
Sbjct  673   SSGFSPMTFSNFTESQAECLVQRIPGRGFHVEKKQSSLVLCWQRKDLISVSTWRC  727



>ref|XP_004515465.1| PREDICTED: scarecrow-like protein 27-like isoform X1 [Cicer arietinum]
Length=736

 Score =   364 bits (935),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 220/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT+NQALLEA+EGFDRIHI+DFDIG+G QW+S MQELAL 
Sbjct  447   LKIGAYKSFSEISPVLQFANFTSNQALLEAVEGFDRIHIIDFDIGFGGQWSSFMQELALR  506

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  P+LKITA  SP   +++EL     NL Q+ASEINM FE E L  E +NS+S     
Sbjct  507   NGGAPALKITAFVSPSHHDEIELSFTHENLKQYASEINMSFELEILTFESMNSASWPQPL  566

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VNLP+G  S N    LPL+L FVK+L PKIVV++D  CDRTD PFP H+I AL
Sbjct  567   RDCEAVVVNLPIGSFS-NYPSYLPLVLRFVKQLMPKIVVTLDRSCDRTDAPFPQHLIFAL  625

Query  2065  HSYSNLLESLDA--VNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              SYS+LLESLDA  VN++PD LQ IEK+ +QP IEK V+ R  S    + +T  W+ + L
Sbjct  626   QSYSSLLESLDAVSVNVHPDVLQMIEKYYLQPAIEKLVSGRLRS----QDRTLPWKNLML  681

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++R P  GFHVEK+QSSLVLCWQRK+LIS S WRC
Sbjct  682   SSGFSPMTFSNFTESQAECLVQRIPGRGFHVEKKQSSLVLCWQRKDLISVSTWRC  736



>ref|XP_010056372.1| PREDICTED: scarecrow-like protein 22 [Eucalyptus grandis]
 gb|KCW73063.1| hypothetical protein EUGRSUZ_E01509 [Eucalyptus grandis]
Length=729

 Score =   364 bits (934),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 229/294 (78%), Gaps = 7/294 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             +KIGAYKSFSEVSP+ QFANFT NQA LEALE +DR+HI+ FD+GYG QWASLMQELAL 
Sbjct  440   YKIGAYKSFSEVSPVLQFANFTCNQAFLEALEEYDRVHILSFDVGYGGQWASLMQELALR  499

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             N  + SLKITA ASP+  ++LELG+ + NL  FA+E+N+  EFE + +E L+SSS     
Sbjct  500   NKGSRSLKITAFASPMIHDELELGLTQENLKHFANELNIYVEFEVVNIEALSSSSWPEPL  559

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
             +     AIAVNLP+   ST+  + LP +L F+K+L PKIVVS+D  CDR D PFP H++ 
Sbjct  560   NIRDGEAIAVNLPIASFSTHPSI-LPSVLRFIKQLSPKIVVSLDRSCDRIDAPFPQHVVQ  618

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL+SYS+LLESLDA+N+N D +QKIE++ +QPGIEK +  R    SPEKT +  WR++FL
Sbjct  619   ALNSYSSLLESLDALNVNFDVMQKIERYFLQPGIEKIIRGRH--RSPEKTDS--WRSLFL  674

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             SSGF+P +FSNF ESQAEC+++RTPV GFHVEKRQ SLVLCWQRKEL+S SAWR
Sbjct  675   SSGFSPLAFSNFNESQAECLVQRTPVRGFHVEKRQHSLVLCWQRKELLSVSAWR  728



>ref|XP_008448862.1| PREDICTED: scarecrow-like protein 6 [Cucumis melo]
Length=777

 Score =   365 bits (936),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 222/296 (75%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSE+SP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL+L 
Sbjct  487   FKMGAYKVFSEISPLIQFVNFTCNQALLEALDDVDRIHIVDFDIGFGAQWASFMQELSLR  546

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLKITA ASP     +ELG++R NL QFA++I + FEFE +  + LN +S     
Sbjct  547   SRGAPSLKITAFASPSTHHPIELGLMRENLTQFANDIGISFEFEVVNFDSLNQNSFPLPF  606

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIAVN P+ W S+NQ   LP +L F+K+L PKIVVS+D GCDR+DLPFP H++
Sbjct  607   TRSSENEAIAVNFPL-WCSSNQPAMLPSLLRFIKQLSPKIVVSLDRGCDRSDLPFPQHML  665

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
              AL SY NLLESLDA+NMN DA+ KIE+F++QP IE TV  R    +PE+     W+T+F
Sbjct  666   QALQSYINLLESLDAINMNSDAVNKIERFLLQPRIESTVLGRL--RAPERMPL--WKTLF  721

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GFTP +FSNF E+QAECV KRT V GF VEKRQ+SLVLCWQR+ELISASAWRC
Sbjct  722   ASAGFTPVTFSNFTETQAECVAKRTSVRGFQVEKRQASLVLCWQRRELISASAWRC  777



>ref|XP_006440333.1| hypothetical protein CICLE_v10018916mg [Citrus clementina]
 gb|ESR53573.1| hypothetical protein CICLE_v10018916mg [Citrus clementina]
Length=793

 Score =   364 bits (934),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 223/297 (75%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FK+GAYK FSEVSP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL++ 
Sbjct  502   FKMGAYKVFSEVSPLIQFINFTCNQALLEALDDADRIHIVDFDIGFGAQWASFMQELSMR  561

Query  2428  NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +N  TPS+KITA ASP     +ELG++R NL QFA+ I + FE + +  E L+ +S    
Sbjct  562   SNRGTPSMKITAFASPSTHHHIELGLMRENLTQFANAIGVSFELDVINFESLDQTSYTLP  621

Query  2248  sySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                 +   A+AVN P+ W S+NQ  +LP +L FVK+L PKIVVS D GCD++DLPFP+HI
Sbjct  622   ILQSSENEAVAVNFPI-WSSSNQPSALPSLLRFVKQLSPKIVVSADRGCDKSDLPFPEHI  680

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             +HAL SY NLLESLDAVN+ PDAL KIE+F++QP IE  V  R         +   W+TV
Sbjct  681   LHALQSYINLLESLDAVNVMPDALNKIERFLLQPRIESVVLGRLRGPG----RMPMWKTV  736

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F S+GF+P +FSNF E+QAECV+KRTPV GFHVEKRQ+SLVLCWQ++ELISASAWRC
Sbjct  737   FASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQASLVLCWQQRELISASAWRC  793



>ref|XP_002511652.1| nucleotidyltransferase, putative [Ricinus communis]
 gb|EEF50321.1| nucleotidyltransferase, putative [Ricinus communis]
Length=1420

 Score =   375 bits (964),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/256 (73%), Positives = 211/256 (82%), Gaps = 6/256 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQT----PEAQTISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D I  ++S+ Q+    P   T    N   +D   SE S+SPK  ++N DS KD
Sbjct  1166  LVVEVPSDLIISATSNIQSTKDEPTRMTAENENCVNSDIVISEESSSPKCLQVNHDSRKD  1225

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKS+RLDISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1226  VKSIRLDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1285

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+S+QGSG+YINRER
Sbjct  1286  YCLVLLITRFLQHEHHLGRPINQNWGSLLMDFLYFFGNVFDPRQMRISVQGSGIYINRER  1345

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T  PS  D+ +R P  
Sbjct  1346  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTSFPSEADACSRSP-Y  1404

Query  706   KLLPKVIPSIMQLEGF  753
             +LLPK+IPSI    GF
Sbjct  1405  RLLPKLIPSINSSAGF  1420



>gb|KDO61473.1| hypothetical protein CISIN_1g042460mg [Citrus sinensis]
Length=729

 Score =   362 bits (928),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 225/297 (76%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FK+GAYK FSEVSP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL++ 
Sbjct  438   FKMGAYKVFSEVSPLIQFINFTCNQALLEALDDADRIHIVDFDIGFGAQWASFMQELSMR  497

Query  2428  NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +N  TPS+KITA ASP     +ELG++R NL QFA+ I + F+ + +  E L+ +S    
Sbjct  498   SNRGTPSMKITAFASPSTHHHIELGLMRENLTQFANAIGVSFDLDVINFESLDQTSYTLP  557

Query  2248  sySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                 +   A+AVN P+ W S+NQ  +LP +L FVK+L PKIVVS D GCD++DLPFP+HI
Sbjct  558   IIQSSENEAVAVNFPI-WSSSNQPSALPSLLRFVKQLSPKIVVSADRGCDKSDLPFPEHI  616

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             +HAL SY NLLESLDAVN+ PDAL KIE+F++QP IE  V  R     P++     W+T+
Sbjct  617   LHALQSYINLLESLDAVNVMPDALNKIERFLLQPRIESVVLGRL--RGPDRMPM--WKTL  672

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F S+GF+P +FSNF E+QAECV+KRTPV GFHVEKRQ+SLVLCWQ++ELISASAWRC
Sbjct  673   FASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQASLVLCWQQRELISASAWRC  729



>ref|XP_011017463.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Populus euphratica]
Length=689

 Score =   360 bits (924),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 230/295 (78%), Gaps = 8/295 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFA+FT NQALLEA +GF+RIH+VDFDIGYG QWASLMQELAL 
Sbjct  401   FKIGAYKSFSEISPILQFASFTCNQALLEAFDGFERIHVVDFDIGYGGQWASLMQELALR  460

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG  PSL+ITA AS    ++LELG  + NL  FASEINM FE E L +E L+S S     
Sbjct  461   NGGAPSLRITAFASSSSHDELELGFTQENLKIFASEINMPFEIEILSLESLSSGSWPMPL  520

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                 +  IAVNLPVG  S N   +LPL+L FVK+L PK++VS+D+GCDR+DL F  H+ H
Sbjct  521   RLTEKEVIAVNLPVGSFS-NYPSTLPLVLRFVKQLLPKVMVSLDSGCDRSDLSFAHHVNH  579

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SY+ LLESLDAVN+N DA+QKIE+F++QPGIEKTV  R     P++T    WR++FL
Sbjct  580   AIQSYTGLLESLDAVNVNLDAVQKIERFLVQPGIEKTVLGRH--SCPDRTP---WRSLFL  634

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE +++RTPV GFHVEKRQSSLVLCWQ+K+L+SASAWRC
Sbjct  635   QSGFTPLTFSNFTESQAEYLVQRTPVRGFHVEKRQSSLVLCWQQKDLVSASAWRC  689



>ref|XP_010056373.1| PREDICTED: scarecrow-like protein 6 [Eucalyptus grandis]
 gb|KCW73064.1| hypothetical protein EUGRSUZ_E01510 [Eucalyptus grandis]
Length=714

 Score =   361 bits (926),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 226/295 (77%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             +KIGA+KSFSE+SP+ QFANFT NQA LEALEGF+R+HI+ FDIGYG QWASLMQELAL 
Sbjct  425   YKIGAFKSFSEISPVLQFANFTCNQAFLEALEGFERVHIISFDIGYGGQWASLMQELALR  484

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss--ssws  2252
             NG  PSLKITA ASP   +++EL + + NL  FA+EIN+  EFE + +E L+S+      
Sbjct  485   NGGAPSLKITAFASPTTHDEVELTLTQENLKHFANEINVALEFEVINIEALSSTPWPLPL  544

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
             +     AIAVNLP+G  S +    LPL L FVK+L PKIV+S+D  CDRTD+PFP  ++H
Sbjct  545   NVPDGEAIAVNLPIGSFSAHPSF-LPLALRFVKQLSPKIVMSLDRSCDRTDVPFPQQVVH  603

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL  +S+LLESLDAV++N + LQKIEK+ +QPGIEK +  R    +PE+T    WR++FL
Sbjct  604   ALDCHSSLLESLDAVHVNLEVLQKIEKYFLQPGIEKIIMGR--HRTPERTVP--WRSLFL  659

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAE +L+RT V GFHVEKRQ SLVLCWQRKEL+SASAWRC
Sbjct  660   SSGFSPLTFSNFNESQAEYLLQRTAVRGFHVEKRQHSLVLCWQRKELVSASAWRC  714



>ref|XP_011017462.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Populus euphratica]
Length=695

 Score =   360 bits (923),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 230/295 (78%), Gaps = 8/295 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFA+FT NQALLEA +GF+RIH+VDFDIGYG QWASLMQELAL 
Sbjct  407   FKIGAYKSFSEISPILQFASFTCNQALLEAFDGFERIHVVDFDIGYGGQWASLMQELALR  466

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             NG  PSL+ITA AS    ++LELG  + NL  FASEINM FE E L +E L+S S     
Sbjct  467   NGGAPSLRITAFASSSSHDELELGFTQENLKIFASEINMPFEIEILSLESLSSGSWPMPL  526

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                 +  IAVNLPVG  S N   +LPL+L FVK+L PK++VS+D+GCDR+DL F  H+ H
Sbjct  527   RLTEKEVIAVNLPVGSFS-NYPSTLPLVLRFVKQLLPKVMVSLDSGCDRSDLSFAHHVNH  585

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             A+ SY+ LLESLDAVN+N DA+QKIE+F++QPGIEKTV  R     P++T    WR++FL
Sbjct  586   AIQSYTGLLESLDAVNVNLDAVQKIERFLVQPGIEKTVLGRH--SCPDRTP---WRSLFL  640

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGFTP +FSNF ESQAE +++RTPV GFHVEKRQSSLVLCWQ+K+L+SASAWRC
Sbjct  641   QSGFTPLTFSNFTESQAEYLVQRTPVRGFHVEKRQSSLVLCWQQKDLVSASAWRC  695



>ref|XP_006477215.1| PREDICTED: scarecrow-like protein 27-like [Citrus sinensis]
Length=793

 Score =   362 bits (930),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 225/297 (76%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FK+GAYK FSEVSP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL++ 
Sbjct  502   FKMGAYKVFSEVSPLIQFINFTCNQALLEALDDADRIHIVDFDIGFGAQWASFMQELSMR  561

Query  2428  NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +N  TPS+KITA ASP     +ELG++R NL QFA+ I + F+ + +  E L+ +S    
Sbjct  562   SNRGTPSMKITAFASPSTHHHIELGLMRENLTQFANAIGVSFDLDVINFESLDQTSYTLP  621

Query  2248  sySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                 +   A+AVN P+ W S+NQ  +LP +L FVK+L PKIVVS D GCD++DLPFP+HI
Sbjct  622   IIQSSENEAVAVNFPI-WSSSNQPSALPSLLRFVKQLSPKIVVSADRGCDKSDLPFPEHI  680

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             +HAL SY NLLESLDAVN+ PDAL KIE+F++QP IE  V  R     P++     W+T+
Sbjct  681   LHALQSYINLLESLDAVNVMPDALNKIERFLLQPRIESVVLGRL--RGPDRMPM--WKTL  736

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F S+GF+P +FSNF E+QAECV+KRTPV GFHVEKRQ+SLVLCWQ++ELISASAWRC
Sbjct  737   FASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQASLVLCWQQRELISASAWRC  793



>ref|XP_011017458.1| PREDICTED: scarecrow-like protein 22 [Populus euphratica]
Length=702

 Score =   359 bits (922),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 222/297 (75%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQALLEA EGF RIH+VDFDIGYG QWASLMQELAL 
Sbjct  411   FKIGAYKSFSEISPILQFANFTCNQALLEAFEGFQRIHVVDFDIGYGGQWASLMQELALR  470

Query  2425  NGTTPSLKITALASPLKQE--QLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--s  2258
             NG  PSLKITA  SP   +  +LELG  + NL  FASEINM FE E L +E L   S   
Sbjct  471   NGGAPSLKITAFVSPSSHDELELELGFTQENLRIFASEINMPFELEILSLESLGCGSGPM  530

Query  2257  wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                +  +  IAVNLP+G+ S N   +LP++L FVK+L PK+VVS+D+G DR+DLPF  HI
Sbjct  531   TLCTLDKEVIAVNLPLGFFS-NYPSTLPVVLRFVKQLSPKVVVSLDSGYDRSDLPFAHHI  589

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
              HA+ SY++LLESLDAVN+N D LQKIE+F++QP IE+ V  R         +T  WR++
Sbjct  590   NHAIQSYTSLLESLDAVNVNLDVLQKIERFLVQPCIERMVLGRHGCSD----RTTPWRSL  645

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             FL SGF+P +FSNF ESQAEC+++R PV GFHVE +QSSLVLCWQ+++L+S SAW C
Sbjct  646   FLQSGFSPLTFSNFTESQAECLVQRAPVKGFHVEMKQSSLVLCWQQRDLVSVSAWSC  702



>gb|KEH16798.1| GRAS family transcription regulator [Medicago truncatula]
Length=729

 Score =   359 bits (921),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 217/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT+NQALLEA+EGFDRIHI+DFDIG+G QW+S MQELAL 
Sbjct  440   LKIGAYKSFSEISPVLQFANFTSNQALLEAVEGFDRIHIIDFDIGFGGQWSSFMQELALR  499

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  P+LKITA  SP   +++EL     NL+Q+A EINM FE E L +E LNS S     
Sbjct  500   NGGAPALKITAFVSPSHHDEIELSFTNENLMQYAGEINMSFELEILTLESLNSVSWPQPL  559

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VNLP+   S N    LPL+L FVK+L PKIVV++D  CDRTD PFP H++ AL
Sbjct  560   RDCEAVVVNLPICSFS-NYPSYLPLVLRFVKQLMPKIVVTLDRSCDRTDAPFPQHMVFAL  618

Query  2065  HSYSNLLESLDA--VNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              SYS LLESLDA  VN++PD LQ IEK+ +QP IEK V  R  S    + +T  W+ + L
Sbjct  619   QSYSGLLESLDAVSVNVHPDVLQMIEKYYLQPAIEKLVLGRLRS----QDRTLPWKNLLL  674

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++R P  GFHVEK+Q+SLVLCWQRK+LIS S WRC
Sbjct  675   SSGFSPLTFSNFTESQAECLVQRIPGRGFHVEKKQNSLVLCWQRKDLISVSTWRC  729



>ref|XP_006445316.1| hypothetical protein CICLE_v10019083mg [Citrus clementina]
 ref|XP_006490864.1| PREDICTED: scarecrow-like protein 6-like [Citrus sinensis]
 gb|ESR58556.1| hypothetical protein CICLE_v10019083mg [Citrus clementina]
 gb|KDO85728.1| hypothetical protein CISIN_1g005237mg [Citrus sinensis]
Length=706

 Score =   358 bits (918),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 217/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT NQALLEA EG +RIHI+DFDIGYG QWASLMQEL   
Sbjct  417   FKISAYKSFSEISPILQFANFTCNQALLEAFEGCNRIHIIDFDIGYGGQWASLMQELVFR  476

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             +   PSLKITA  S    ++ ELG  + NL  FASEIN+ FE E L +E L S+S     
Sbjct  477   SEGPPSLKITAFTSSSTHDEFELGFTQENLKHFASEINIPFELEILSLETLISASWPLPL  536

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                     AVNLP+G  S N   + PL+L FVK+LQPKIVVS+D  CDR D PF  H++H
Sbjct  537   QGLENDVTAVNLPIGVFS-NYPATFPLVLRFVKQLQPKIVVSLDRSCDRPDFPFAHHMVH  595

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL SYS LLESLD+VN+N DALQKIE+F++ P IEK V  R    SPE+     WR++F+
Sbjct  596   ALQSYSGLLESLDSVNVNLDALQKIERFLVYPCIEKIVLGR--HRSPERLPP--WRSLFM  651

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF P +FSNFAESQA+C+++RTPV GFHVEKRQSSLVLCWQRKELISA+AWRC
Sbjct  652   QSGFAPLTFSNFAESQADCLVQRTPVRGFHVEKRQSSLVLCWQRKELISATAWRC  706



>gb|KEH16799.1| GRAS family transcription regulator [Medicago truncatula]
Length=732

 Score =   358 bits (920),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 217/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT+NQALLEA+EGFDRIHI+DFDIG+G QW+S MQELAL 
Sbjct  443   LKIGAYKSFSEISPVLQFANFTSNQALLEAVEGFDRIHIIDFDIGFGGQWSSFMQELALR  502

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  P+LKITA  SP   +++EL     NL+Q+A EINM FE E L +E LNS S     
Sbjct  503   NGGAPALKITAFVSPSHHDEIELSFTNENLMQYAGEINMSFELEILTLESLNSVSWPQPL  562

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VNLP+   S N    LPL+L FVK+L PKIVV++D  CDRTD PFP H++ AL
Sbjct  563   RDCEAVVVNLPICSFS-NYPSYLPLVLRFVKQLMPKIVVTLDRSCDRTDAPFPQHMVFAL  621

Query  2065  HSYSNLLESLDA--VNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              SYS LLESLDA  VN++PD LQ IEK+ +QP IEK V  R  S    + +T  W+ + L
Sbjct  622   QSYSGLLESLDAVSVNVHPDVLQMIEKYYLQPAIEKLVLGRLRS----QDRTLPWKNLLL  677

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             SSGF+P +FSNF ESQAEC+++R P  GFHVEK+Q+SLVLCWQRK+LIS S WRC
Sbjct  678   SSGFSPLTFSNFTESQAECLVQRIPGRGFHVEKKQNSLVLCWQRKDLISVSTWRC  732



>ref|XP_011093337.1| PREDICTED: uncharacterized protein LOC105173333 [Sesamum indicum]
Length=1537

 Score =   372 bits (955),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 211/255 (83%), Gaps = 6/255 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTP--EAQTIS--EGNPFQADGTSSESSTSPKWPKMNDSGKD-  165
             LVVEVP   I+ + S+ QTP  EA  ++  +GNPFQ D  S E +TSPKW K+ +   D 
Sbjct  1283  LVVEVPLALISTTMSNVQTPKEEADQVASEDGNPFQTDAASLEGTTSPKWSKIRNGANDG  1342

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVRLDISFKSP+HTGLQT+ LVK+LTE+FP+  PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1343  FKSVRLDISFKSPTHTGLQTTGLVKDLTERFPSVTPLALVLKQFLADRSLDQSYSGGLSS  1402

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCL+LLITRFLQHEHHHGR   QNYGSLLMDFLYFFGNVFDPRQMR+S+QGSGLY+NRER
Sbjct  1403  YCLILLITRFLQHEHHHGRPINQNYGSLLMDFLYFFGNVFDPRQMRISVQGSGLYLNRER  1462

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDP+YIDDPLF TNNVGRNCFRIHQCIKAFADAY+ LE+E+T L  N+++    P+ 
Sbjct  1463  GCSIDPLYIDDPLFLTNNVGRNCFRIHQCIKAFADAYAMLENELTCL-HNEENPDVQPTC  1521

Query  706   KLLPKVIPSIMQLEG  750
             +LLPK+IPSI  L G
Sbjct  1522  QLLPKLIPSIGHLVG  1536



>ref|XP_004298643.1| PREDICTED: uncharacterized protein LOC101309831 [Fragaria vesca 
subsp. vesca]
Length=783

 Score =   359 bits (921),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 221/298 (74%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEA+   D+IHIVDFDIG+G  WAS MQEL L 
Sbjct  491   FKMGAYKVFSEVSPLIQFVNFTCNQALLEAVSEADQIHIVDFDIGFGAHWASFMQELPLR  550

Query  2425  N--GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N  GT+PSLKITA ASP     +EL ++R NL QFA EI +GFE E + ++ L+ +S   
Sbjct  551   NRGGTSPSLKITAFASPSTHHTVELSLMRDNLTQFADEIGIGFELEVVNIDLLDQNSYSL  610

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +    A+AVN P+ W S+NQ  +LP +L FVK+L PKIVVS+D GCDR+DLPFP H
Sbjct  611   PFFRANDNEAVAVNFPI-WSSSNQPAALPNLLRFVKQLSPKIVVSLDRGCDRSDLPFPQH  669

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  670   ILQALQSYINLLESLDAVNVTSDAVNKIERFLLQPKIESTVLGRL--RTPDKMPL--WKT  725

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP SFSNF E+QAECV+KR+   GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  726   LFASAGFTPLSFSNFTETQAECVVKRSTARGFHVEKRQESLVLCWQRRELISASAWRC  783



>ref|XP_006573232.1| PREDICTED: scarecrow-like protein 27-like [Glycine max]
 gb|KHN31643.1| Scarecrow-like protein 6 [Glycine soja]
Length=744

 Score =   358 bits (918),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 216/293 (74%), Gaps = 5/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT NQALLEA+EGFDRIHI+DFDIG G QW+S MQELAL 
Sbjct  457   LKIGAYKSFSEISPVLQFANFTCNQALLEAVEGFDRIHIIDFDIGLGGQWSSFMQELALR  516

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG+ P LKITA  SP   +++EL   + +L Q+A E++M FE E L +E LNS+S     
Sbjct  517   NGSAPELKITAFVSPSHHDEIELSFSQESLKQYAGELHMSFELEILSLESLNSASWPQPL  576

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VN+P+G  S N    LPL+L FVK+L PKIVV++D  CDRTD PFP H+I AL
Sbjct  577   RDCEAVVVNMPIGSFS-NYPSYLPLVLRFVKQLMPKIVVTLDRSCDRTDAPFPQHLIFAL  635

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              SYS LLESLDAVN++PD LQ IEK+ +QP +EK V  R       + +   W+ + LSS
Sbjct  636   QSYSGLLESLDAVNVHPDVLQMIEKYYLQPSMEKLVLGRHGL----QERALPWKNLLLSS  691

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF+P +FSNF ESQAEC+++RTP  GFHVEKRQSSLVLCWQRK+LIS S WRC
Sbjct  692   GFSPLTFSNFTESQAECLVQRTPSKGFHVEKRQSSLVLCWQRKDLISVSTWRC  744



>ref|XP_007140802.1| hypothetical protein PHAVU_008G143400g [Phaseolus vulgaris]
 ref|XP_007140803.1| hypothetical protein PHAVU_008G143400g [Phaseolus vulgaris]
 gb|ESW12796.1| hypothetical protein PHAVU_008G143400g [Phaseolus vulgaris]
 gb|ESW12797.1| hypothetical protein PHAVU_008G143400g [Phaseolus vulgaris]
Length=742

 Score =   357 bits (917),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 214/293 (73%), Gaps = 5/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT NQALLEA+EGFDRIHI+DFDIG+G QW+S MQELAL 
Sbjct  455   LKIGAYKSFSEISPVLQFANFTCNQALLEAVEGFDRIHIIDFDIGFGGQWSSFMQELALR  514

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  P L+ITA  SP   +++EL   + NL Q+A EINM FE E L  E LNS+S     
Sbjct  515   NGGAPELRITAFLSPSHHDEIELSFTQENLKQYAGEINMSFELEILSFESLNSASWPQPL  574

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VN+P+G  S+     LPL L FVK+L PK+VV++D  CDRTD PFP H+I AL
Sbjct  575   RDCEAVVVNMPIGSFSSYPSY-LPLALRFVKQLMPKVVVTLDRSCDRTDAPFPQHLIFAL  633

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              SYS LLESLDAVN++PD LQ IEK+ +QP +EK V  R       + +   W+ + +SS
Sbjct  634   QSYSGLLESLDAVNVHPDVLQMIEKYYLQPAMEKLVLGRHGF----QERILSWKNLLMSS  689

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF+P +FSNF ESQAEC+++RTP  GFHVEKRQSSLVLCWQRK+LIS S WRC
Sbjct  690   GFSPLAFSNFTESQAECLVQRTPGKGFHVEKRQSSLVLCWQRKDLISVSTWRC  742



>gb|KDP28800.1| hypothetical protein JCGZ_14571 [Jatropha curcas]
Length=1591

 Score =   371 bits (952),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 210/257 (82%), Gaps = 6/257 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D I  ++S+ Q+P+ +    T    N ++ D   SE S SP   + N DS KD
Sbjct  1336  LVVEVPSDLIISATSNIQSPKEEPTRMTGDHENNYRTDVVGSEDSISPNCSQSNCDSTKD  1395

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKS+RLDISFKSPSHTG QT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1396  VKSIRLDISFKSPSHTGFQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1455

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+S+QG+G+YINRER
Sbjct  1456  YCLVLLITRFLQHEHHLGRPINQNWGSLLMDFLYFFGNVFDPRQMRISVQGTGVYINRER  1515

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E T LP + D+ +R P  
Sbjct  1516  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSILENESTSLPDDGDACSRSP-Y  1574

Query  706   KLLPKVIPSIMQLEGFQ  756
             KLL K+IPSI  L+  Q
Sbjct  1575  KLLSKIIPSINSLQAKQ  1591



>ref|XP_003538071.1| PREDICTED: scarecrow-like protein 6-like [Glycine max]
 gb|KHN41697.1| Scarecrow-like protein 6 [Glycine soja]
Length=742

 Score =   354 bits (909),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 214/293 (73%), Gaps = 5/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYKSFSE+SP+ QFANFT NQALLEA++GFDRIHI+DFDIG G QW+S MQELAL 
Sbjct  455   LKIGAYKSFSEISPVLQFANFTCNQALLEAVKGFDRIHIIDFDIGLGGQWSSFMQELALR  514

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             NG  P LKITA  SP   +++EL   + +L Q+A E+ M FE E L +E LNS+S     
Sbjct  515   NGGAPELKITAFVSPSHHDEIELSFTQESLKQYAGELRMPFELEILSLESLNSASWPQPL  574

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
                 A+ VN+P+G  S N    LPL+L FVK+L PKIVV++D  CDRTD PFP H+I AL
Sbjct  575   RDCKAVVVNMPIGSFS-NYPSYLPLVLRFVKQLMPKIVVTLDRSCDRTDAPFPQHLIFAL  633

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              SYS LLESLDAVN++PD LQ IEK+ +QP +EK V  R       + +   W+ + LSS
Sbjct  634   QSYSGLLESLDAVNVHPDVLQMIEKYYLQPSMEKLVLGRHGL----QERALPWKNLLLSS  689

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF+P +FSNF ESQAEC+++RTP  GFHVEKRQSSLVLCWQRK+LIS S WRC
Sbjct  690   GFSPLTFSNFTESQAECLVQRTPSKGFHVEKRQSSLVLCWQRKDLISVSTWRC  742



>gb|KDP39855.1| hypothetical protein JCGZ_03386 [Jatropha curcas]
Length=717

 Score =   353 bits (907),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 217/296 (73%), Gaps = 9/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   DRIHI+DFDIG+G QWAS MQEL  N
Sbjct  428   FKMGAYKVFSEVSPLIQFVNFTCNQALLEALSDADRIHIIDFDIGFGAQWASFMQELPRN  487

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G  PS+KITA ASP     +E+ ++R NL QFA+EI + FE + +  + L  +      
Sbjct  488   RGP-PSMKITAFASPSTHHPVEILLMRDNLTQFANEIGISFELDVVNFDSLEQNCYSLPI  546

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    AIAVN P+ W S+NQ   LP +L FVK+L PKIVVS+D GCDRTDLPFP HI+
Sbjct  547   FRPNENEAIAVNFPI-WSSSNQPSVLPSLLRFVKQLSPKIVVSLDRGCDRTDLPFPQHIL  605

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL SY +LLESLDAVN+  DA+ KIEKF++QP IE TV  R    +PE     +W+T+F
Sbjct  606   HALQSYIHLLESLDAVNVASDAVNKIEKFLLQPKIESTVLGRL--RAPEI--MPNWKTIF  661

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSNF E+QAECV+KRTPV GFHVEKRQ+ LVLCWQR+ELISASAWRC
Sbjct  662   ASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQALLVLCWQRRELISASAWRC  717



>ref|XP_009343062.1| PREDICTED: scarecrow-like protein 6 [Pyrus x bretschneideri]
Length=660

 Score =   350 bits (899),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   D+IHIVDFDIG+G  WAS MQEL + 
Sbjct  368   FKMGAYKVFSEVSPLLQFVNFTCNQALLEALSDTDQIHIVDFDIGFGAHWASFMQELPIR  427

Query  2425  N--GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   + PSL+ITA  SP     +EL ++R NL QFA+EI + F+ E + ++ L+ +S   
Sbjct  428   NRGASAPSLRITAFTSPSTHHPVELRLMRDNLTQFANEIGISFDLEVVNIDSLDQNSYSL  487

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 + +  A+AVN P+ W ++NQ  +LP +L FVK+L PKIVVS+D GCDR+DLPFP H
Sbjct  488   PIFRANNNEAVAVNFPI-WSTSNQPAALPNVLRFVKQLSPKIVVSLDRGCDRSDLPFPQH  546

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  547   ILQALQSYINLLESLDAVNVTSDAVNKIERFLLQPKIESTVLGRL--RTPDKMPL--WKT  602

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KR P  GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  603   LFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLVLCWQRRELISASAWRC  660



>ref|XP_007210362.1| hypothetical protein PRUPE_ppa001561mg [Prunus persica]
 gb|EMJ11561.1| hypothetical protein PRUPE_ppa001561mg [Prunus persica]
Length=802

 Score =   352 bits (904),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEA+   D+IHIVDFDIG+G  WAS MQEL + 
Sbjct  510   FKMGAYKVFSEVSPLIQFVNFTCNQALLEAVSDTDQIHIVDFDIGFGAHWASFMQELPVR  569

Query  2425  N--GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   T PSL+ITA ASP     +ELG++R NL QFA+EI + FE E +  + L+ SS   
Sbjct  570   NRGATAPSLRITAFASPSTHHPVELGLMRDNLTQFANEIGISFELEVVNFDSLDQSSYSL  629

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +     +AVN P+ W ++NQ  +LP +L FVK+L PKI+VS+D GCDR+DLPFP H
Sbjct  630   PIFRANDNETVAVNFPI-WSTSNQPAALPNLLRFVKQLSPKIMVSLDRGCDRSDLPFPQH  688

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  689   ILQALQSYINLLESLDAVNVTSDAVNKIERFLLQPKIESTVLGRL--RTPDKMPL--WKT  744

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KRTP  GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  745   LFASAGFTPVPFSNFTETQAECVVKRTPARGFHVEKRQESLVLCWQRRELISASAWRC  802



>ref|XP_008238556.1| PREDICTED: scarecrow-like protein 27 [Prunus mume]
Length=813

 Score =   353 bits (905),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEA+   D+IHIVDFDIG+G  WAS MQEL + 
Sbjct  521   FKMGAYKVFSEVSPLIQFVNFTCNQALLEAVSDTDQIHIVDFDIGFGAHWASFMQELPVR  580

Query  2425  N--GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   T PSL+ITA ASP     +ELG++R NL QFA+EI + FE E +  + L+ SS   
Sbjct  581   NRGATAPSLRITAFASPSTHHPVELGLMRDNLTQFANEIGISFELEVVNFDSLDQSSYSL  640

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +     +AVN P+ W ++NQ  +LP +L FVK+L PKI+VS+D GCDR+DLPFP H
Sbjct  641   PIFRANDNETVAVNFPI-WSTSNQPAALPNLLRFVKQLSPKIMVSLDRGCDRSDLPFPQH  699

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  700   ILQALQSYINLLESLDAVNVTSDAVNKIERFLLQPKIESTVLGRL--RAPDKMPL--WKT  755

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KRTP  GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  756   LFASAGFTPVPFSNFTETQAECVVKRTPARGFHVEKRQESLVLCWQRRELISASAWRC  813



>emb|CBI16583.3| unnamed protein product [Vitis vinifera]
Length=1331

 Score =   362 bits (930),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 206/250 (82%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQT----PEAQTISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D  T ++ + QT    P      +G+  Q +    E+S SPK  ++N D+ KD
Sbjct  1080  LVVEVPPDLTTSAAPNLQTSKEEPTPMPGGQGSHIQTEMGGLENSASPKCAQINYDNSKD  1139

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1140  SKSVRIDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1199

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+S+QGSG+YINRER
Sbjct  1200  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISVQGSGVYINRER  1259

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF+DAYS LE+E+T LP + DSS   P  
Sbjct  1260  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSDAYSILENELTCLPISGDSSTS-PPY  1318

Query  706   KLLPKVIPSI  735
             +LLPK+I SI
Sbjct  1319  RLLPKIISSI  1328



>ref|XP_011033759.1| PREDICTED: uncharacterized protein LOC105132110 isoform X4 [Populus 
euphratica]
Length=1212

 Score =   360 bits (925),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 179/250 (72%), Positives = 205/250 (82%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI----SEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT ++S+ Q+P+ + I          Q +    E S SPK  ++N DS +D
Sbjct  956   LVVEVPTDLITSAASNVQSPKEEPIHLTGEHDIQVQPNMVVLEDSISPKCAQLNCDSKRD  1015

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKS+RLDISFKSPSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1016  VKSIRLDISFKSPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1075

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN GSLLMD LYFFGNVFDPRQMR+S+QGSG+YINRER
Sbjct  1076  YCLVLLIIRFLQHEHHLGRPINQNVGSLLMDLLYFFGNVFDPRQMRISVQGSGVYINRER  1135

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE E+  LP   D+ +R P+ 
Sbjct  1136  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLEKELACLPDEGDTCSR-PAH  1194

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1195  RLLPKIIPSI  1204



>ref|XP_008367218.1| PREDICTED: scarecrow-like protein 27 [Malus domestica]
Length=799

 Score =   352 bits (902),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   D+IHIVDFDIG+G  WAS MQEL + 
Sbjct  507   FKMGAYKVFSEVSPLLQFVNFTCNQALLEALSDADQIHIVDFDIGFGAHWASFMQELPIR  566

Query  2425  N--GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   + PSL+ITA ASP     +ELG++  NL QFA+EI + F+ E + ++ L+ +S   
Sbjct  567   NRGASAPSLRITAFASPSTHHPVELGLMXDNLTQFANEIGVSFDLEVVNIDSLDQNSYSL  626

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +    A+AVN P+ W ++NQ  +LP +L FVK+L PKIVVS+D GCDR+DLPFP H
Sbjct  627   PIFRANDNEAVAVNFPI-WSTSNQPAALPNVLRFVKQLSPKIVVSLDRGCDRSDLPFPQH  685

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  686   ILQALQSYINLLESLDAVNVTSDAVNKIERFLLQPKIESTVLGRL--RTPDKMPL--WKT  741

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KR P  GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  742   LFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLVLCWQRRELISASAWRC  799



>ref|XP_004163758.1| PREDICTED: scarecrow-like protein 6-like [Cucumis sativus]
 gb|KGN46568.1| hypothetical protein Csa_6G109640 [Cucumis sativus]
Length=754

 Score =   350 bits (898),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 217/298 (73%), Gaps = 11/298 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSEVSP+ QFANFT+NQALLEA  GFDRIHI+DFDIGYG QWASLMQELAL 
Sbjct  461   FKIAAYKSFSEVSPVLQFANFTSNQALLEAFNGFDRIHIIDFDIGYGGQWASLMQELALR  520

Query  2425  NGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
             + TT    P L+ITA AS    +  ELG  + NL  FA+++N+GFE E + VE LNS S 
Sbjct  521   SSTTGGGPPFLRITAFASTSTHDDFELGFTQENLKNFANDLNIGFELEVVNVECLNSGSW  580

Query  2260  -swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                 +     AIAVNLPVG    N  +SLP+IL FVK L PKIVVSVD GC R D PFP 
Sbjct  581   PLPLNVSENEAIAVNLPVGSF-FNYSLSLPMILRFVKHLNPKIVVSVDRGCSRMDAPFPH  639

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
              +I+ALHSYS LLES++AV +N D   KIE++++QP IEK VT    S+     +   W+
Sbjct  640   RVINALHSYSALLESMEAVTVNMDTQLKIERYLVQPCIEKVVTNPQSSNE----RAAPWK  695

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             +VFLSSGF P +FSNF ESQAEC+L+RTPV GFH++KR SSLVLCW RKEL+S SAWR
Sbjct  696   SVFLSSGFCPLTFSNFTESQAECLLQRTPVQGFHIDKRHSSLVLCWHRKELVSISAWR  753



>ref|XP_008458131.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6 [Cucumis 
melo]
Length=754

 Score =   350 bits (898),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 217/298 (73%), Gaps = 11/298 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSEVSP+ QFANFT+NQALLEA  GFDRIHI+DFDIGYG QWASLMQELAL 
Sbjct  461   FKIAAYKSFSEVSPVLQFANFTSNQALLEAFNGFDRIHIIDFDIGYGGQWASLMQELALR  520

Query  2425  NGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
             + TT    P L+ITA AS    +  ELG  + NL  FA+++N+GFE E + VE LNS S 
Sbjct  521   SNTTGGGPPFLRITAFASTSTHDNFELGFTQENLKNFANDLNIGFELEVVNVECLNSGSW  580

Query  2260  -swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                 +     AIAVNLPVG    N  +SLP+IL FVK L PKIVVSVD GC R D PFP 
Sbjct  581   PLPLNVSENEAIAVNLPVGSF-FNYSLSLPMILRFVKHLNPKIVVSVDRGCSRMDAPFPH  639

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
              +I+ALHSYS LLES++AV +N D   KIE++++QP IEK VT    S+     +   W+
Sbjct  640   RVINALHSYSALLESMEAVTVNMDTQLKIERYLVQPCIEKVVTNPQSSNE----RAAPWK  695

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             +VFLSSGF P +FSNF ESQAEC+L+RTPV GFH++KR SSLVLCW RKEL+S SAWR
Sbjct  696   SVFLSSGFCPLTFSNFTESQAECLLQRTPVQGFHIDKRHSSLVLCWHRKELVSISAWR  753



>ref|XP_007052160.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 ref|XP_007052161.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 ref|XP_007052165.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 ref|XP_007052166.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 ref|XP_007052168.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 gb|EOX96317.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 gb|EOX96318.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 gb|EOX96322.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 gb|EOX96323.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
 gb|EOX96325.1| Nucleotidyltransferase family protein isoform 4 [Theobroma cacao]
Length=1538

 Score =   362 bits (930),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 209/250 (84%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISE----GNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT ++S+ Q+P  + I +    GN   +D    E S SPK  K++  + KD
Sbjct  1287  LVVEVPDDLITSAASNLQSPTDEQIEKSAERGNHAHSDTVGLEDSASPKCSKISYGNMKD  1346

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKSVRLDISFKSPSHTGLQT+ELV+ELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1347  VKSVRLDISFKSPSHTGLQTTELVRELTEQFPAAMPLALVLKQFLADRSLDQSYSGGLSS  1406

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQM++S+QGSG+YINRER
Sbjct  1407  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMQISVQGSGVYINRER  1466

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYSTLE+E+T L SN +S    P  
Sbjct  1467  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSTLENELTCLSSNINSCFN-PPC  1525

Query  706   KLLPKVIPSI  735
             ++L K+IPS+
Sbjct  1526  RMLQKIIPSM  1535



>ref|XP_007052158.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052159.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052163.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052164.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOX96315.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOX96316.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOX96320.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOX96321.1| Nucleotidyltransferase family protein isoform 2 [Theobroma cacao]
Length=1577

 Score =   362 bits (930),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 209/250 (84%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISE----GNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT ++S+ Q+P  + I +    GN   +D    E S SPK  K++  + KD
Sbjct  1326  LVVEVPDDLITSAASNLQSPTDEQIEKSAERGNHAHSDTVGLEDSASPKCSKISYGNMKD  1385

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKSVRLDISFKSPSHTGLQT+ELV+ELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1386  VKSVRLDISFKSPSHTGLQTTELVRELTEQFPAAMPLALVLKQFLADRSLDQSYSGGLSS  1445

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQM++S+QGSG+YINRER
Sbjct  1446  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMQISVQGSGVYINRER  1505

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYSTLE+E+T L SN +S    P  
Sbjct  1506  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSTLENELTCLSSNINSCFN-PPC  1564

Query  706   KLLPKVIPSI  735
             ++L K+IPS+
Sbjct  1565  RMLQKIIPSM  1574



>ref|XP_004140608.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6-like 
[Cucumis sativus]
Length=751

 Score =   349 bits (896),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 217/298 (73%), Gaps = 11/298 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSEVSP+ QFANFT+NQALLEA  GFDRIHI+DFDIGYG QWASLMQELAL 
Sbjct  458   FKIAAYKSFSEVSPVLQFANFTSNQALLEAFNGFDRIHIIDFDIGYGGQWASLMQELALR  517

Query  2425  NGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
             + TT    P L+ITA AS    +  ELG  + NL  FA+++N+GFE E + VE LNS S 
Sbjct  518   SSTTGGGPPFLRITAFASTSTHDDFELGFTQENLKNFANDLNIGFELEVVNVECLNSGSW  577

Query  2260  -swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                 +     AIAVNLPVG    N  +SLP+IL FVK L PKIVVSVD GC R D PFP 
Sbjct  578   PLPLNVSENEAIAVNLPVGSF-FNYSLSLPMILRFVKHLNPKIVVSVDRGCSRMDAPFPH  636

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
              +I+ALHSYS LLES++AV +N D   KIE++++QP IEK VT    S+     +   W+
Sbjct  637   RVINALHSYSALLESMEAVTVNMDTQLKIERYLVQPCIEKVVTNPQSSNE----RAAPWK  692

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             +VFLSSGF P +FSNF ESQAEC+L+RTPV GFH++KR SSLVLCW RKEL+S SAWR
Sbjct  693   SVFLSSGFCPLTFSNFTESQAECLLQRTPVQGFHIDKRHSSLVLCWHRKELVSISAWR  750



>ref|XP_009342859.1| PREDICTED: scarecrow-like protein 22 [Pyrus x bretschneideri]
Length=794

 Score =   350 bits (899),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 219/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   D+IHIVDFDIG+G  WAS MQEL   
Sbjct  502   FKMGAYKVFSEVSPLLQFVNFTCNQALLEALSDADQIHIVDFDIGFGAHWASFMQELPTR  561

Query  2425  NG--TTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   + PSL+ITA ASP     +ELG++R NL +FA+EI + FE + + +++L+ +S   
Sbjct  562   NRGVSAPSLRITAFASPSTHHPVELGLMRDNLTEFANEIGISFELDVVNLDYLDQNSYSL  621

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +    A+AVN P+ W ++NQ  +LP +L FVK+L PKIVVS+D GCDR+DLPFP H
Sbjct  622   PIIQTNDGEAVAVNFPI-WSTSNQPAALPNVLRFVKQLSPKIVVSLDRGCDRSDLPFPQH  680

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDA+N+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  681   ILQALQSYINLLESLDAINVTSDAVSKIERFLLQPKIESTVLGRL--RTPDKMPI--WKT  736

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KR P  GFHVEKRQ SL+LCWQR+ELISASAWRC
Sbjct  737   LFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLILCWQRRELISASAWRC  794



>ref|XP_010661315.1| PREDICTED: uncharacterized protein LOC100265029 isoform X2 [Vitis 
vinifera]
Length=1568

 Score =   362 bits (929),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 206/250 (82%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQT----PEAQTISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D  T ++ + QT    P      +G+  Q +    E+S SPK  ++N D+ KD
Sbjct  1317  LVVEVPPDLTTSAAPNLQTSKEEPTPMPGGQGSHIQTEMGGLENSASPKCAQINYDNSKD  1376

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1377  SKSVRIDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1436

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+S+QGSG+YINRER
Sbjct  1437  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISVQGSGVYINRER  1496

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF+DAYS LE+E+T LP + DSS   P  
Sbjct  1497  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSDAYSILENELTCLPISGDSSTS-PPY  1555

Query  706   KLLPKVIPSI  735
             +LLPK+I SI
Sbjct  1556  RLLPKIISSI  1565



>ref|XP_010661312.1| PREDICTED: uncharacterized protein LOC100265029 isoform X1 [Vitis 
vinifera]
 ref|XP_010661313.1| PREDICTED: uncharacterized protein LOC100265029 isoform X1 [Vitis 
vinifera]
 ref|XP_010661314.1| PREDICTED: uncharacterized protein LOC100265029 isoform X1 [Vitis 
vinifera]
Length=1571

 Score =   362 bits (929),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 206/250 (82%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQT----PEAQTISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D  T ++ + QT    P      +G+  Q +    E+S SPK  ++N D+ KD
Sbjct  1320  LVVEVPPDLTTSAAPNLQTSKEEPTPMPGGQGSHIQTEMGGLENSASPKCAQINYDNSKD  1379

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1380  SKSVRIDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1439

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+S+QGSG+YINRER
Sbjct  1440  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISVQGSGVYINRER  1499

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF+DAYS LE+E+T LP + DSS   P  
Sbjct  1500  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSDAYSILENELTCLPISGDSSTS-PPY  1558

Query  706   KLLPKVIPSI  735
             +LLPK+I SI
Sbjct  1559  RLLPKIISSI  1568



>ref|XP_008377890.1| PREDICTED: scarecrow-like protein 22 [Malus domestica]
Length=794

 Score =   350 bits (899),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   D+IHIVDFDIG+G  WAS MQEL   
Sbjct  502   FKMGAYKVFSEVSPLLQFVNFTCNQALLEALSDADQIHIVDFDIGFGAHWASFMQELPTR  561

Query  2425  NG--TTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   + PSL+ITA ASP     +ELG++R NL QFA+EI + FE + + +++L+ +S   
Sbjct  562   NRGISAPSLRITAFASPSTHHPVELGLMRDNLTQFANEIGISFELDVVNLDYLDQNSYSL  621

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +    A+AVN P+ W ++NQ  +LP +L FVK+L PKIVVS+D GCDR+DLPFP H
Sbjct  622   PIFQTNDSEAVAVNFPI-WSTSNQPDALPNVLRFVKQLSPKIVVSLDRGCDRSDLPFPQH  680

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+ 
Sbjct  681   ILQALQSYINLLESLDAVNVTSDAVSKIERFLLQPKIESTVLGRL--RTPDKMPI--WKA  736

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KR P  GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  737   LFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLVLCWQRRELISASAWRC  794



>ref|XP_009343059.1| PREDICTED: scarecrow-like protein 22 [Pyrus x bretschneideri]
Length=799

 Score =   350 bits (898),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   D+IHIVDFDIG+G  WAS MQEL + 
Sbjct  507   FKMGAYKVFSEVSPLLQFVNFTCNQALLEALSDTDQIHIVDFDIGFGAHWASFMQELPIR  566

Query  2425  N--GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   + PSL+ITA  SP     +EL ++R NL QFA+EI + F+ E + ++ L+ +S   
Sbjct  567   NRGASAPSLRITAFTSPSTHHPVELRLMRDNLTQFANEIGISFDLEVVNIDSLDQNSYSL  626

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 + +  A+AVN P+ W ++NQ  +LP +L FVK+L PKIVVS+D GCDR+DLPFP H
Sbjct  627   PIFRANNNEAVAVNFPI-WSTSNQPAALPNVLRFVKQLSPKIVVSLDRGCDRSDLPFPQH  685

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDAVN+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  686   ILQALQSYINLLESLDAVNVTSDAVNKIERFLLQPKIESTVLGRL--RTPDKMPL--WKT  741

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KR P  GFHVEKRQ SLVLCWQR+ELISASAWRC
Sbjct  742   LFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLVLCWQRRELISASAWRC  799



>ref|XP_011033716.1| PREDICTED: uncharacterized protein LOC105132110 isoform X1 [Populus 
euphratica]
 ref|XP_011033726.1| PREDICTED: uncharacterized protein LOC105132110 isoform X1 [Populus 
euphratica]
 ref|XP_011033734.1| PREDICTED: uncharacterized protein LOC105132110 isoform X1 [Populus 
euphratica]
Length=1570

 Score =   360 bits (925),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 179/250 (72%), Positives = 205/250 (82%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI----SEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT ++S+ Q+P+ + I          Q +    E S SPK  ++N DS +D
Sbjct  1314  LVVEVPTDLITSAASNVQSPKEEPIHLTGEHDIQVQPNMVVLEDSISPKCAQLNCDSKRD  1373

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKS+RLDISFKSPSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1374  VKSIRLDISFKSPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1433

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN GSLLMD LYFFGNVFDPRQMR+S+QGSG+YINRER
Sbjct  1434  YCLVLLIIRFLQHEHHLGRPINQNVGSLLMDLLYFFGNVFDPRQMRISVQGSGVYINRER  1493

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE E+  LP   D+ +R P+ 
Sbjct  1494  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLEKELACLPDEGDTCSR-PAH  1552

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1553  RLLPKIIPSI  1562



>ref|XP_009351036.1| PREDICTED: scarecrow-like protein 22 [Pyrus x bretschneideri]
Length=794

 Score =   349 bits (895),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 218/298 (73%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   D+IHIVDFDIG+G  WAS MQEL   
Sbjct  502   FKMGAYKVFSEVSPLLQFVNFTCNQALLEALSDADQIHIVDFDIGFGAHWASFMQELPTR  561

Query  2425  NG--TTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws  2252
             N   + PSL+ITA ASP     +ELG++R NL +FA+EI + FE + + +++L+ +S   
Sbjct  562   NRGVSAPSLRITAFASPSTHHPVELGLMRDNLTEFANEIGISFELDVVNLDYLDQNSYSL  621

Query  2251  ---dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 +    A+AVN P+ W ++NQ  +LP +L FVK L PKIVVS+D GCDR+DLPFP H
Sbjct  622   PIIQTNDGEAVAVNFPI-WSTSNQPAALPNVLRFVKLLSPKIVVSLDRGCDRSDLPFPQH  680

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+ AL SY NLLESLDA+N+  DA+ KIE+F++QP IE TV  R    +P+K     W+T
Sbjct  681   ILQALQSYINLLESLDAINVTSDAVSKIERFLLQPKIESTVLGRL--RTPDKMPI--WKT  736

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GFTP  FSNF E+QAECV+KR P  GFHVEKRQ SL+LCWQR+ELISASAWRC
Sbjct  737   LFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLILCWQRRELISASAWRC  794



>ref|XP_002528940.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33469.1| conserved hypothetical protein [Ricinus communis]
Length=787

 Score =   347 bits (890),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 219/296 (74%), Gaps = 10/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL   DRIHI+DFDIG+G QWAS MQEL  N
Sbjct  499   FKLGAYKVFSEVSPLIQFVNFTCNQALLEALSEADRIHIIDFDIGFGAQWASFMQELPRN  558

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G  PSLKITA ASP     +E+ ++R NL QFA+EI + FE + +  + L  S      
Sbjct  559   RGA-PSLKITAFASPSTHHPVEVLLMRENLTQFANEIGISFELDVINFDSLEQSCYSLPI  617

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               S    AIAV+ PV W ++NQ  +LP +L FVK+L PKIVVS+D G DRTDLPFP HI+
Sbjct  618   FRSKENEAIAVHFPV-WSASNQPAALPSLLRFVKQLSPKIVVSLDRG-DRTDLPFPQHIL  675

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL S+  LLESLDAVN+  DA+ KIEKF++QP IE TV  R  +  P+K  T  W+T+F
Sbjct  676   HALQSHILLLESLDAVNVASDAVNKIEKFLLQPRIESTVLGRLRA--PDKMPT--WKTIF  731

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSNF E+QAECV+KRTPV GFHVEKRQ+SLVLCWQR++LISASAWRC
Sbjct  732   ASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQASLVLCWQRRDLISASAWRC  787



>gb|EYU30539.1| hypothetical protein MIMGU_mgv1a025631mg [Erythranthe guttata]
Length=1361

 Score =   357 bits (916),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 203/248 (82%), Gaps = 5/248 (2%)
 Frame = +1

Query  1     LVVEVPRDFI-TLSSSHSQTPEAQTIS--EGNPFQADGTSSESSTSPKWPKMNDSGKDVK  171
             LVVEVP+D + TLS+ H    EA  ++  EG+ FQAD   SE +T       ND  +  +
Sbjct  1110  LVVEVPQDLVSTLSNVHIPKEEANLVASEEGSTFQADAIGSEDTTPTFSKTRNDVNEGFE  1169

Query  172   SVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYC  351
             SVRLDISFKSP+HTGL T+ LVK+LTE+FPA  PLALVLKQFLADRSLDQSYSGGLSSYC
Sbjct  1170  SVRLDISFKSPTHTGLLTTGLVKDLTERFPAVTPLALVLKQFLADRSLDQSYSGGLSSYC  1229

Query  352   LVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGY  531
             L+LLITRFLQHEHHHGR   QNYGSLLMDFLYFFGNVFDPRQMR+S+QGSG+Y+NRERG 
Sbjct  1230  LILLITRFLQHEHHHGRPINQNYGSLLMDFLYFFGNVFDPRQMRISVQGSGVYLNRERGC  1289

Query  532   SIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKL  711
             SIDP+YIDDPLF TNNVGRNCFRIHQCIKAFADAY+ LESE+T L  NDD   + P+ KL
Sbjct  1290  SIDPLYIDDPLFLTNNVGRNCFRIHQCIKAFADAYAMLESELTCL-HNDDKDTK-PTCKL  1347

Query  712   LPKVIPSI  735
             LPK+IPSI
Sbjct  1348  LPKLIPSI  1355



>ref|XP_002320705.2| hypothetical protein POPTR_0014s06140g [Populus trichocarpa]
 gb|EEE99020.2| hypothetical protein POPTR_0014s06140g [Populus trichocarpa]
Length=1566

 Score =   356 bits (914),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/260 (69%), Positives = 208/260 (80%), Gaps = 16/260 (6%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT ++S+ Q+P+ +    T+      Q++    E S SPK  ++N DS +D
Sbjct  1300  LVVEVPTDLITSTASNVQSPKEEPIHLTVEHDIQVQSNMVVLEDSISPKCTQLNCDSKRD  1359

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKS+RLDISFKSPSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1360  VKSIRLDISFKSPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1419

Query  346   YCLVLLITRFLQHEHHHGR----------STIQNYGSLLMDFLYFFGNVFDPRQMRVSIQ  495
             YCLVLLI RFLQHEHH GR          S + N GSLLMD LYFFGNVFDPRQMR+S+Q
Sbjct  1420  YCLVLLIIRFLQHEHHLGRPINQCSLLKTSDVLNVGSLLMDLLYFFGNVFDPRQMRISVQ  1479

Query  496   GSGLYINRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSN  675
             GSG+YINRERGYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE E+  LP  
Sbjct  1480  GSGVYINRERGYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLEKELACLPDE  1539

Query  676   DDSSARMPSLKLLPKVIPSI  735
              D+ +R P+ +LLPK+IPSI
Sbjct  1540  GDTCSR-PAHRLLPKIIPSI  1558



>ref|XP_006368204.1| hypothetical protein POPTR_0001s00480g [Populus trichocarpa]
 gb|ERP64773.1| hypothetical protein POPTR_0001s00480g [Populus trichocarpa]
Length=777

 Score =   344 bits (883),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 214/296 (72%), Gaps = 9/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+ AYK  SEVSP+ QF NFT NQALLEA++  D IHIVDFDIG+G QWAS MQEL  N
Sbjct  488   FKMSAYKVLSEVSPLIQFVNFTCNQALLEAVDDADSIHIVDFDIGFGAQWASFMQELPRN  547

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G   SLK TA ASP     +ELG++R NL QFA+EI + FE + +  + L  +      
Sbjct  548   RGVR-SLKTTAFASPSTHHPVELGLMRDNLTQFANEIGLSFELDVINFDSLEQNCYSLPF  606

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               +    A+ VN P+ W S+NQ  +LP +L F+K+L PKIVVS+D GCDR+DLPFP HI+
Sbjct  607   FRTNENEAVVVNFPI-WCSSNQPSALPSLLRFIKQLSPKIVVSLDRGCDRSDLPFPQHIL  665

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL SY +LLESLDAVN   DA+ KIE+F++QP IE TV  R    +PEK    +W+T+F
Sbjct  666   HALQSYVHLLESLDAVNATTDAVNKIERFLLQPRIESTVLGRL--RAPEK--MPNWKTIF  721

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S GF+P +FSNF E+QAECV+KRTPV GFHVEKRQ+ LVLCWQR+EL+SASAWRC
Sbjct  722   ASVGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQALLVLCWQRRELMSASAWRC  777



>gb|KHN47911.1| Scarecrow-like protein 6 [Glycine soja]
Length=665

 Score =   340 bits (872),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 213/295 (72%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQAL+EA+E FDRIH++DFDIG+G QW+S MQELAL 
Sbjct  376   FKIGAYKSFSEISPVLQFANFTCNQALIEAVERFDRIHVIDFDIGFGVQWSSFMQELALR  435

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLK+TA+ SP   +++EL   R NLIQ+A +IN+ FE     +E LNS+S     
Sbjct  436   SSGAPSLKVTAIVSPSTCDEVELNFTRENLIQYAKDINVSFELNVFSIESLNSASCPLLG  495

Query  2245  y--SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVN+PV    TN     P +L FVK+L+PK+VV++D  CDR D+P P +++H
Sbjct  496   QFFDNEAIAVNMPVSSF-TNYPALFPSVLHFVKQLRPKVVVTLDRICDRIDVPLPTNVVH  554

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              L  YS LLESLDAVN+N DALQKIE+  IQP I+K +     S    + +   WR +F+
Sbjct  555   VLQCYSALLESLDAVNVNLDALQKIERHFIQPAIKKIILGHHHS----QEKLPPWRNLFI  610

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF+PF+FSNF E+QAEC+++R PV GFHVE++ SSLVLCWQRKELIS S WRC
Sbjct  611   QSGFSPFTFSNFTEAQAECLVQRAPVRGFHVERKPSSLVLCWQRKELISVSTWRC  665



>ref|XP_010264288.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264289.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264290.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264291.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264292.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264293.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264294.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264296.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264297.1| PREDICTED: uncharacterized protein LOC104602344 isoform X1 [Nelumbo 
nucifera]
Length=1567

 Score =   354 bits (909),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 197/252 (78%), Gaps = 8/252 (3%)
 Frame = +1

Query  1     LVVEVPRDF--ITLSSSHSQTPEAQTISEGNPFQADGTSSESSTS-PKWPKM----NDSG  159
             LV EVP D    T   S+ QTP  ++            S     S   WPK     ND+ 
Sbjct  1314  LVAEVPLDLSATTGKLSNVQTPNIESTQMTGKLDCTTQSDIMGLSNSSWPKCSSVENDNA  1373

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              DVKSVRLDISFKSPSHTGLQT+ELV+ LTEQFPAA PLALVLKQFLADRSLD SYSGGL
Sbjct  1374  MDVKSVRLDISFKSPSHTGLQTTELVRGLTEQFPAATPLALVLKQFLADRSLDHSYSGGL  1433

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GRS  QN GSLLMDFLYFFGNVFDPRQMR+SIQGSG+Y+NR
Sbjct  1434  SSYCLVLLIIRFLQHEHHLGRSINQNLGSLLMDFLYFFGNVFDPRQMRISIQGSGIYVNR  1493

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG+ IDPI+IDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLE+E+T LPS+ DS  R  
Sbjct  1494  ERGHCIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLENELTCLPSDSDSRTRQ-  1552

Query  700   SLKLLPKVIPSI  735
             S KLLPK+IPS+
Sbjct  1553  SYKLLPKIIPSL  1564



>emb|CBI31914.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   335 bits (858),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 209/297 (70%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FS+VSP+ QFANFT NQALLEAL+  DRIHI+DFDIG+G QWAS MQEL + 
Sbjct  221   FKMGAYKVFSDVSPLIQFANFTCNQALLEALDDADRIHIIDFDIGFGAQWASFMQELPVR  280

Query  2425  NGTTPSLKITALASP-LKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws-  2252
             N   PSLKITALASP      LEL ++R NL  FA EI + FE + +  +  +  S    
Sbjct  281   NRGAPSLKITALASPSTTHHPLELKLLRENLTLFADEIGIAFELQVVNFDSFDPVSYSMP  340

Query  2251  --dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                +    AI VN P+ W S+N   +LPL+L F+K+L PK++VS+D GCDR DLP   H+
Sbjct  341   YFRTSENEAIVVNFPI-WSSSNHPAALPLLLRFIKQLSPKLMVSLDRGCDRGDLPLQQHL  399

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             +H + SY+NLLESLDA N   D + KIE+F+ QP IE T   R    SP+K     W+T+
Sbjct  400   LHGIQSYTNLLESLDATNAMTDTVSKIERFLFQPRIESTTLGRL--RSPDKMPP--WKTL  455

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F S+GFTP SFSNF ESQA+CV+KRT V GFHVEKRQ+ L+LCWQ +ELISASAWRC
Sbjct  456   FASAGFTPVSFSNFTESQADCVVKRTLVRGFHVEKRQALLILCWQNRELISASAWRC  512



>ref|XP_007039873.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY24374.1| GRAS family transcription factor [Theobroma cacao]
Length=795

 Score =   342 bits (877),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 212/296 (72%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQALLEAL+  DRIHIVDFDIG+G QWAS MQEL + 
Sbjct  505   FKMGAYKVFSEVSPLIQFVNFTCNQALLEALDDADRIHIVDFDIGFGAQWASFMQELPMR  564

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
             +   PSL+ITA ASP     +ELG++R NL+QFA+EI + FE E L  + L+ +      
Sbjct  565   SRGAPSLRITAFASPSTHHPIELGLMRENLMQFANEIGVNFELEVLNFDCLDQTPYSLPM  624

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               S    A+AVN PV W S+NQ  +LP +L FVK+L PKI+VS+D G DR DLPFP HII
Sbjct  625   FRSNENEAVAVNFPV-WSSSNQPSALPNLLRFVKQLSPKIMVSLDRGGDRNDLPFPQHII  683

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HA  SY NL ESLDAVN+  DA+ KIEKF+  P IE TV  R    +PEK     WRT+F
Sbjct  684   HAFQSYINLFESLDAVNVTSDAVNKIEKFLFVPRIESTVLGRL--HAPEKMPL--WRTLF  739

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSNF E+QAECV+KR  V GF VEKRQ+SLVLCW + +LIS SAWRC
Sbjct  740   SSAGFSPVTFSNFTETQAECVVKRAQVRGFRVEKRQASLVLCWLQGDLISVSAWRC  795



>ref|XP_006490856.1| PREDICTED: uncharacterized protein LOC102608196 isoform X4 [Citrus 
sinensis]
Length=1278

 Score =   350 bits (899),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 200/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D I  ++S  Q+P+      T+   N   +D  + + S SPK    + D+ K 
Sbjct  1025  LVVEVPHDLIASAASSVQSPKEDAAHTTLKHDNHVHSDMVALDDSASPKCSHTSSDNIKA  1084

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVRLDISFKSPSHTGLQT++LVKELTEQFPA+ PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1085  ATSVRLDISFKSPSHTGLQTTDLVKELTEQFPASTPLALVLKQFLADRSLDQSYSGGLSS  1144

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCL+LLITRFLQHEHH GR   QNYG LLMDFLYFFGNVFDPRQMR+S+QGSG+YI RER
Sbjct  1145  YCLMLLITRFLQHEHHLGRPINQNYGRLLMDFLYFFGNVFDPRQMRISVQGSGVYIKRER  1204

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDP FPTNNVGRNCFRIHQCIKAF+DAYS LE+E+T L   DD  +R P  
Sbjct  1205  GYSIDPIHIDDPRFPTNNVGRNCFRIHQCIKAFSDAYSILENELTSLTPADDQCSR-PPY  1263

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1264  RLLPKIIPSI  1273



>gb|AGJ83737.1| GRAS family transcription factor, partial [Caragana korshinskii]
Length=384

 Score =   328 bits (842),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/292 (56%), Positives = 202/292 (69%), Gaps = 7/292 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQAL+EALE FDRIHI+DFDIG+G QW+S MQEL L 
Sbjct  100   FKIGAYKSFSEISPVLQFANFTCNQALIEALERFDRIHIIDFDIGFGVQWSSFMQELVLR  159

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLK+TA  +P    ++EL   R NL Q+A ++NM FEF  L +E LN  S     
Sbjct  160   SSGAPSLKVTAGVTPSTCNEIELNFTRENLNQYAKDVNMSFEFNVLNIESLN--SLPGHL  217

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
             +   AIAVNLPV     +     P+ L FVK+L+PK+VV++D  CDR D+P P +++H L
Sbjct  218   FDNEAIAVNLPVSCF-LSYPTCFPMALHFVKQLRPKVVVTLDRNCDRIDVPLPTNVVHVL  276

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
               YS LLESLDAVN+N D LQKIE+  IQP I K +     S      +   WR + L S
Sbjct  277   QCYSALLESLDAVNVNLDVLQKIERHFIQPAINKIILGHHRSHD----KLPPWRNLLLQS  332

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             GF PF+FSNF E+QAEC+++R PV GF VE++ SSLVLCWQRKELIS S WR
Sbjct  333   GFIPFTFSNFTEAQAECLVQRAPVRGFQVERKPSSLVLCWQRKELISVSTWR  384



>ref|XP_003516440.1| PREDICTED: scarecrow-like protein 6-like [Glycine max]
Length=737

 Score =   339 bits (870),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 213/295 (72%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQAL+EA+E FDRIH++DFDIG+G QW+S MQELAL 
Sbjct  448   FKIGAYKSFSEISPVLQFANFTCNQALIEAVERFDRIHVIDFDIGFGVQWSSFMQELALR  507

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLK+TA+ SP   +++EL   R NLIQ+A +IN+ FE     +E LNS+S     
Sbjct  508   SSGAPSLKVTAIVSPSTCDEVELNFTRENLIQYAKDINVSFELNVFSIESLNSASCPLLG  567

Query  2245  y--SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVN+PV    TN     P +L FVK+L+PK+VV++D  CDR D+P P +++H
Sbjct  568   QFFDNEAIAVNMPVSSF-TNYPSLFPSVLHFVKQLRPKVVVTLDRICDRIDVPLPTNVVH  626

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              L  YS LLESLDAVN+N DALQKIE+  IQP I+K +     S    + +   WR +F+
Sbjct  627   VLQCYSALLESLDAVNVNLDALQKIERHFIQPAIKKIILGHHHS----QEKLPPWRNLFI  682

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF+PF+FSNF E+QAEC+++R PV GFHVE++ SSLVLCWQRKELIS S WRC
Sbjct  683   QSGFSPFTFSNFTEAQAECLVQRAPVRGFHVERKPSSLVLCWQRKELISVSTWRC  737



>ref|XP_007052157.1| Nucleotidyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX96314.1| Nucleotidyltransferase family protein isoform 1 [Theobroma cacao]
Length=1577

 Score =   352 bits (902),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 195/227 (86%), Gaps = 5/227 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISE----GNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT ++S+ Q+P  + I +    GN   +D    E S SPK  K++  + KD
Sbjct  1326  LVVEVPDDLITSAASNLQSPTDEQIEKSAERGNHAHSDTVGLEDSASPKCSKISYGNMKD  1385

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKSVRLDISFKSPSHTGLQT+ELV+ELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1386  VKSVRLDISFKSPSHTGLQTTELVRELTEQFPAAMPLALVLKQFLADRSLDQSYSGGLSS  1445

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQM++S+QGSG+YINRER
Sbjct  1446  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMQISVQGSGVYINRER  1505

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLL  666
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYSTLE+E+T L
Sbjct  1506  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSTLENELTCL  1552



>ref|XP_002872967.1| hypothetical protein ARALYDRAFT_490555 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49226.1| hypothetical protein ARALYDRAFT_490555 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   333 bits (855),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 211/295 (72%), Gaps = 12/295 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  270   FKIAAYKSFSEISPVLQFANFTSNQALLESFHGFHRLHIVDFDIGYGGQWASLMQELVLR  329

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT LASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  + 
Sbjct  330   DNAAPLSLKITVLASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNS  389

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  EA +AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPFP  + H+
Sbjct  390   SEKEA-VAVNISAASFS-----HLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQVAHS  443

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDS-DSPEKTQTQHWRTVFL  1892
             LHS++ LLESLDAVN N DA+QKIE+F+IQP IEK V  R  S + P  T    W+T+FL
Sbjct  444   LHSHAALLESLDAVNANLDAMQKIERFLIQPEIEKLVLDRSRSIERPMMT----WQTMFL  499

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
               GF P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  500   QMGFLPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLILCWQRTELVGVSAWRC  554



>gb|AAD24406.1|AF036303_1 scarecrow-like 6 [Arabidopsis thaliana]
Length=378

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 206/294 (70%), Gaps = 10/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HI+DFDIGYG QWASLMQEL L 
Sbjct  91    FKIAAYKSFSEISPVLQFANFTSNQALLESFHGFHRLHIIDFDIGYGGQWASLMQELVLR  150

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  + 
Sbjct  151   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNS  210

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  E A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPF   + H+
Sbjct  211   SEKE-AVAVNISAASFS-----HLPLVLRFVKHLSPTIIVCSDRGCERTDLPFSQQLAHS  264

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ L ESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W+ +FL 
Sbjct  265   LHSHTALFESLDAVNANLDAMQKIERFLIQPEIEKLV---LDRSRPIERPMMTWQAMFLQ  321

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  322   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  375



>ref|XP_006445325.1| hypothetical protein CICLE_v10018476mg [Citrus clementina]
 ref|XP_006490853.1| PREDICTED: uncharacterized protein LOC102608196 isoform X1 [Citrus 
sinensis]
 ref|XP_006490854.1| PREDICTED: uncharacterized protein LOC102608196 isoform X2 [Citrus 
sinensis]
 gb|ESR58565.1| hypothetical protein CICLE_v10018476mg [Citrus clementina]
Length=1588

 Score =   351 bits (901),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 200/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D I  ++S  Q+P+      T+   N   +D  + + S SPK    + D+ K 
Sbjct  1335  LVVEVPHDLIASAASSVQSPKEDAAHTTLKHDNHVHSDMVALDDSASPKCSHTSSDNIKA  1394

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVRLDISFKSPSHTGLQT++LVKELTEQFPA+ PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1395  ATSVRLDISFKSPSHTGLQTTDLVKELTEQFPASTPLALVLKQFLADRSLDQSYSGGLSS  1454

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCL+LLITRFLQHEHH GR   QNYG LLMDFLYFFGNVFDPRQMR+S+QGSG+YI RER
Sbjct  1455  YCLMLLITRFLQHEHHLGRPINQNYGRLLMDFLYFFGNVFDPRQMRISVQGSGVYIKRER  1514

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDP FPTNNVGRNCFRIHQCIKAF+DAYS LE+E+T L   DD  +R P  
Sbjct  1515  GYSIDPIHIDDPRFPTNNVGRNCFRIHQCIKAFSDAYSILENELTSLTPADDQCSR-PPY  1573

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1574  RLLPKIIPSI  1583



>gb|KFK30592.1| hypothetical protein AALP_AA6G001700 [Arabis alpina]
Length=587

 Score =   334 bits (856),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 213/294 (72%), Gaps = 6/294 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQ+LLE+ +GF  +HI+DFDIGYG QWASLMQELAL 
Sbjct  297   FKIAAYKSFSEISPVLQFANFTSNQSLLESFQGFHNLHIIDFDIGYGGQWASLMQELALR  356

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             + T P SLKIT  ASP   +QLELG  R NL  FASEIN+  E + L ++ L S S  + 
Sbjct  357   DNTAPLSLKITVFASPTNHDQLELGFTRDNLNHFASEINISLEIQVLSLDLLGSVSWPNS  416

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  E A+AVN+     S N    LPL+L FVK L P I+V  D GC+RTDLPFP  ++H+
Sbjct  417   SEKE-AVAVNISAASFS-NMPSYLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLVHS  474

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             L S++ LLESLDAVN N +A+QKIE+F+IQP IEK V    D   P +     W+ +FL 
Sbjct  475   LQSHAALLESLDAVNANLEAMQKIERFLIQPEIEKLVA---DRSRPVERPMMTWQAMFLQ  531

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR+EL++ SAWRC
Sbjct  532   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRRELVAVSAWRC  585



>ref|XP_010419546.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Camelina sativa]
Length=554

 Score =   332 bits (852),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 210/294 (71%), Gaps = 9/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+ +GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  266   FKIAAYKSFSEISPVLQFANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLR  325

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  ++
Sbjct  326   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNE  385

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  + A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPFP  +  +
Sbjct  386   SEEKEAVAVNISPASFS-----QLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQS  440

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ LLESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W++VFL 
Sbjct  441   LHSHAALLESLDAVNANLDAMQKIERFLIQPEIEKLV---MDRSRPIERPMMTWQSVFLQ  497

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  498   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  551



>ref|XP_010419547.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Camelina sativa]
Length=553

 Score =   332 bits (852),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 210/294 (71%), Gaps = 9/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+ +GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  265   FKIAAYKSFSEISPVLQFANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLR  324

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  ++
Sbjct  325   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNE  384

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  + A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPFP  +  +
Sbjct  385   SEEKEAVAVNISPASFS-----QLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQS  439

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ LLESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W++VFL 
Sbjct  440   LHSHAALLESLDAVNANLDAMQKIERFLIQPEIEKLV---MDRSRPIERPMMTWQSVFLQ  496

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  497   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  550



>ref|XP_010110817.1| hypothetical protein L484_011800 [Morus notabilis]
 gb|EXC28296.1| hypothetical protein L484_011800 [Morus notabilis]
Length=772

 Score =   338 bits (868),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 214/301 (71%), Gaps = 12/301 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQEL---  2435
             FK+GAYK FSE+SP+ QF NFT+NQALLEAL     IHIVDFDIG+G QWAS MQEL   
Sbjct  475   FKMGAYKLFSEISPLIQFLNFTSNQALLEALSDSATIHIVDFDIGFGAQWASFMQELNRG  534

Query  2434  --ALNNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
                     TPSLKITA ASP     +EL ++R NL QFA+EI + F+ E +  + L  +S
Sbjct  535   VGGGGGSATPSLKITAFASPSTHHPVELALMRDNLAQFAAEIGVAFDLEVVNFDSLEQTS  594

Query  2260  swsdsySEAA--IAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFP  2087
                  +      IAVN P+ W ++NQ  +LP +L F+K+L PKIVVS+D GCDR+DLPFP
Sbjct  595   YSMPVFRAEGEVIAVNFPI-WAASNQPAALPNLLRFIKQLSPKIVVSLDRGCDRSDLPFP  653

Query  2086  DHIIHALHSYSNLLESLD-AVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQH  1910
              HI+ ALHSY NLLESLD AVN+  DA+ KIEKF++QP IE TV  R     P+K     
Sbjct  654   QHILQALHSYINLLESLDAAVNVTSDAVNKIEKFLLQPKIESTVLGRLRGPVPDKMPL--  711

Query  1909  WRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             W+T+F S+GF P +FSNFAE+QAECV+KRT V GFHVEKRQ+SL LCWQR+EL+S SAWR
Sbjct  712   WKTLFASAGFAPVTFSNFAETQAECVVKRT-VRGFHVEKRQASLTLCWQRRELVSVSAWR  770

Query  1729  C  1727
             C
Sbjct  771   C  771



>ref|XP_006576443.1| PREDICTED: uncharacterized protein LOC100809291 isoform X8 [Glycine 
max]
Length=1256

 Score =   348 bits (892),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 197/249 (79%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFIT----LSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP+D IT    +  S ++ P       GN  Q+D    E S  PK  +M       
Sbjct  1006  LVVEVPQDVITSLAPMIQSLNEEPHCTPGEHGNDNQSDSIRLEDSALPKGSQMKFDALKS  1065

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             KSVRLDISFKSPSHTGLQT+E+VKELT QFPAA PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1066  KSVRLDISFKSPSHTGLQTTEMVKELTAQFPAATPLALVLKQFLADRSLDQSYSGGLSSY  1125

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLI RFLQHEHH GR   QNYGSLLMDFLYFFGNVFDPRQMR+S+QG+GLYI RERG
Sbjct  1126  CLVLLIIRFLQHEHHLGRPINQNYGSLLMDFLYFFGNVFDPRQMRISVQGTGLYIKRERG  1185

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
              SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+  L S+ +S +R P  +
Sbjct  1186  CSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELKFLNSDGESCSRPPD-R  1244

Query  709   LLPKVIPSI  735
             LLPK+IPS+
Sbjct  1245  LLPKIIPSL  1253



>ref|XP_007134751.1| hypothetical protein PHAVU_010G072700g [Phaseolus vulgaris]
 gb|ESW06745.1| hypothetical protein PHAVU_010G072700g [Phaseolus vulgaris]
Length=652

 Score =   335 bits (859),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 215/295 (73%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT+NQA++EALE FDRIHI+DFDIG+G QW+S MQ LA+ 
Sbjct  363   FKIGAYKSFSEISPVIQFANFTSNQAIIEALERFDRIHIIDFDIGFGVQWSSFMQALAMR  422

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss--sws  2252
             +   PSLKITA+ SPL  ++ EL + +  L Q+A +I+M FEF  L  E LN+SS     
Sbjct  423   SNGVPSLKITAIVSPLTYDEFELNVTQEKLNQYAKDISMSFEFNVLSTESLNTSSCPLSV  482

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
               Y   A AVN+P+    TN     PL+L FVK+L+PK+VV++D  CD+ D PF  +I+H
Sbjct  483   QYYDNEATAVNMPLSCF-TNYPTLFPLVLRFVKQLRPKVVVTLDRNCDQLDAPFSTNIVH  541

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             ALHSYS LLESLDA+N+N D LQKIEK  I P ++KT+T    S   EK  +  WR +FL
Sbjct  542   ALHSYSALLESLDALNVNLDVLQKIEKHFILPALKKTITVPLRSQ--EKLPS--WRNMFL  597

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
               GF+PF+FSNF E+QAEC++++ PV GF +E++ SSLVLCWQRKELI+ S WRC
Sbjct  598   QYGFSPFTFSNFTEAQAECLVQKAPVRGFQLERKHSSLVLCWQRKELITVSTWRC  652



>ref|XP_010426616.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Camelina sativa]
Length=553

 Score =   331 bits (849),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 209/294 (71%), Gaps = 9/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+ +GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  265   FKIAAYKSFSEISPVLQFANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLR  324

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  ++
Sbjct  325   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNE  384

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  + A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPFP  +  +
Sbjct  385   SEEKEAVAVNISPASFS-----QLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQS  439

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ LLESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W+ +FL 
Sbjct  440   LHSHAALLESLDAVNANLDAMQKIERFLIQPEIEKLV---MDRSRPIERPMMTWQAMFLQ  496

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  497   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  550



>ref|XP_006576436.1| PREDICTED: uncharacterized protein LOC100809291 isoform X1 [Glycine 
max]
 ref|XP_006576437.1| PREDICTED: uncharacterized protein LOC100809291 isoform X2 [Glycine 
max]
 ref|XP_006576438.1| PREDICTED: uncharacterized protein LOC100809291 isoform X3 [Glycine 
max]
 ref|XP_006576439.1| PREDICTED: uncharacterized protein LOC100809291 isoform X4 [Glycine 
max]
 ref|XP_006576440.1| PREDICTED: uncharacterized protein LOC100809291 isoform X5 [Glycine 
max]
Length=1547

 Score =   348 bits (894),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 197/249 (79%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFIT----LSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP+D IT    +  S ++ P       GN  Q+D    E S  PK  +M       
Sbjct  1297  LVVEVPQDVITSLAPMIQSLNEEPHCTPGEHGNDNQSDSIRLEDSALPKGSQMKFDALKS  1356

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             KSVRLDISFKSPSHTGLQT+E+VKELT QFPAA PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1357  KSVRLDISFKSPSHTGLQTTEMVKELTAQFPAATPLALVLKQFLADRSLDQSYSGGLSSY  1416

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLI RFLQHEHH GR   QNYGSLLMDFLYFFGNVFDPRQMR+S+QG+GLYI RERG
Sbjct  1417  CLVLLIIRFLQHEHHLGRPINQNYGSLLMDFLYFFGNVFDPRQMRISVQGTGLYIKRERG  1476

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
              SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+  L S+ +S +R P  +
Sbjct  1477  CSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELKFLNSDGESCSRPPD-R  1535

Query  709   LLPKVIPSI  735
             LLPK+IPS+
Sbjct  1536  LLPKIIPSL  1544



>ref|XP_010426622.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Camelina sativa]
Length=551

 Score =   331 bits (848),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 209/294 (71%), Gaps = 9/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+ +GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  263   FKIAAYKSFSEISPVLQFANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLR  322

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  ++
Sbjct  323   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNE  382

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  + A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPFP  +  +
Sbjct  383   SEEKEAVAVNISPASFS-----QLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQS  437

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ LLESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W+ +FL 
Sbjct  438   LHSHAALLESLDAVNANLDAMQKIERFLIQPEIEKLV---MDRSRPIERPMMTWQAMFLQ  494

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  495   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  548



>ref|XP_010544366.1| PREDICTED: scarecrow-like protein 6 [Tarenaya hassleriana]
Length=628

 Score =   333 bits (853),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 213/296 (72%), Gaps = 15/296 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT+NQALLE+  G D +HI+DFDIGYG QWASLMQEL L 
Sbjct  343   FKIGAYKSFSEISPVLQFANFTSNQALLESFHGLDHVHIIDFDIGYGGQWASLMQELVLR  402

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                 PSLKIT  ASP   +++ELG  + NL  FAS+IN+ FE + L ++ LNS SSW+  
Sbjct  403   ENGPPSLKITVFASPATHDEVELGFTQENLKHFASDINISFEIQVLSLDLLNSVSSWNPP  462

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               E A+AVNL      +N Q  LP +L FVK++ P I+V  D GC+RTDLPFP  ++H+L
Sbjct  463   ERE-AVAVNLSF----SNIQSYLPSVLRFVKQVSPTILVCSDRGCERTDLPFPQQLVHSL  517

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTAR---FDSDSPEKTQTQHWRTVF  1895
              S+  LLES+DAVN N DA+QKIE+F+IQP IEK V  R    D   P       W+ +F
Sbjct  518   QSHVALLESIDAVNANLDAMQKIERFLIQPSIEKLVVNRGRSIDRRVP-------WQAMF  570

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +  GF+P + SNF ESQAEC+++RTPV GFHVEK+Q+SLVLCWQR+EL+  SAWRC
Sbjct  571   MQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKQNSLVLCWQRRELVGVSAWRC  626



>gb|AAL90911.1| AT4g00060/F6N15_10 [Arabidopsis thaliana]
 gb|AAN72296.1| At4g00060/F6N15_10 [Arabidopsis thaliana]
Length=839

 Score =   337 bits (865),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 192/247 (78%), Gaps = 1/247 (0%)
 Frame = +1

Query  1    LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
            LVVEVP D I    S    P+  T+ + +    +    E S +    P    +    KSV
Sbjct  591  LVVEVPCDLICSIQSPKDGPDCITVDQDSNGNTEMVGFEDSAAANSLPTNTGNLAIAKSV  650

Query  178  RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
            RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  651  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  710

Query  358  LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
            LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERGYSI
Sbjct  711  LLITRFLQHEHHLGRSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGYSI  770

Query  538  DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
            DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S  DS  +     LLP
Sbjct  771  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSTSDSCGKQQLHNLLP  830

Query  718  KVIPSIM  738
            K+IPSI+
Sbjct  831  KIIPSII  837



>ref|XP_002304419.2| hypothetical protein POPTR_0003s11020g [Populus trichocarpa]
 gb|EEE79398.2| hypothetical protein POPTR_0003s11020g [Populus trichocarpa]
Length=753

 Score =   335 bits (859),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 211/296 (71%), Gaps = 9/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+ AYK  SEVSP+ QF NFT NQALLEA++  DRIHIVDFDIG+G QWAS MQEL  N
Sbjct  464   FKMSAYKVLSEVSPLIQFVNFTCNQALLEAVDDADRIHIVDFDIGFGAQWASFMQELPRN  523

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G   SLK TA ASP     +EL ++R NL QFA+EI + FE + +  + L         
Sbjct  524   RGGR-SLKTTAFASPSTHHPVELSLMRDNLTQFANEIGLSFELDVINFDSLEQHCYSLPF  582

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               +    A+ VN P+ W S+NQ  +LP +L F+K+L PKIVVS+D GCDR+DLPFP HI+
Sbjct  583   FRTSEHEAVVVNFPI-WCSSNQPSALPSLLRFIKQLSPKIVVSLDRGCDRSDLPFPQHIL  641

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL SY++LLESLDAVN   D + KIE+F++QP IE TV  R  +      +  +W+T+F
Sbjct  642   HALQSYTHLLESLDAVNATTDDVNKIERFLLQPRIESTVLGRLRATD----KMPNWKTIF  697

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSNF E+QAECV+KRTPV GFHVE++Q+ LVL WQR+EL+SASAWRC
Sbjct  698   ASAGFSPVTFSNFTETQAECVVKRTPVRGFHVERQQALLVLFWQRRELMSASAWRC  753



>ref|XP_011033959.1| PREDICTED: scarecrow-like protein 27 [Populus euphratica]
Length=768

 Score =   335 bits (860),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 209/296 (71%), Gaps = 9/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+ AYK  SEVSP+ QF NFT NQALLEA++  DRIHIVDFDIG+G QWAS MQEL  N
Sbjct  479   FKMSAYKVLSEVSPLVQFVNFTCNQALLEAVDDADRIHIVDFDIGFGAQWASFMQELPRN  538

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G   SLK TA ASP     +EL ++R NL QFA EI + FE + +  + L         
Sbjct  539   RGVR-SLKTTAFASPSTHHPVELSLMRDNLTQFADEIGLSFELDVINFDSLEQHCYSLPF  597

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               +    A+ VN P+ W S NQ  +LP +L F+K+L P+IVVS+D GCDR+DLPFP HI+
Sbjct  598   FRTSEHEAVVVNFPI-WCSANQPSALPSLLRFIKQLSPRIVVSLDRGCDRSDLPFPQHIL  656

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL SY++LLESLDAVN   D + KIE+F++QP IE TV  R  +      +  +W+T+F
Sbjct  657   HALQSYTHLLESLDAVNATTDDVNKIERFLLQPRIESTVLGRLRATD----KMPNWKTIF  712

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSNF E+QAECV+KRTPV GFHVEK+Q+ LVL WQR+EL+SASAWRC
Sbjct  713   ASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKQQALLVLFWQRRELMSASAWRC  768



>ref|XP_010662426.1| PREDICTED: scarecrow-like protein 22 isoform X2 [Vitis vinifera]
Length=750

 Score =   333 bits (854),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 209/297 (70%), Gaps = 9/297 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FS+VSP+ QFANFT NQALLEAL+  DRIHI+DFDIG+G QWAS MQEL + 
Sbjct  459   FKMGAYKVFSDVSPLIQFANFTCNQALLEALDDADRIHIIDFDIGFGAQWASFMQELPVR  518

Query  2425  NGTTPSLKITALASP-LKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws-  2252
             N   PSLKITALASP      LEL ++R NL  FA EI + FE + +  +  +  S    
Sbjct  519   NRGAPSLKITALASPSTTHHPLELKLLRENLTLFADEIGIAFELQVVNFDSFDPVSYSMP  578

Query  2251  --dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                +    AI VN P+ W S+N   +LPL+L F+K+L PK++VS+D GCDR DLP   H+
Sbjct  579   YFRTSENEAIVVNFPI-WSSSNHPAALPLLLRFIKQLSPKLMVSLDRGCDRGDLPLQQHL  637

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             +H + SY+NLLESLDA N   D + KIE+F+ QP IE T   R    SP+K     W+T+
Sbjct  638   LHGIQSYTNLLESLDATNAMTDTVSKIERFLFQPRIESTTLGRL--RSPDKMPP--WKTL  693

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F S+GFTP SFSNF ESQA+CV+KRT V GFHVEKRQ+ L+LCWQ +ELISASAWRC
Sbjct  694   FASAGFTPVSFSNFTESQADCVVKRTLVRGFHVEKRQALLILCWQNRELISASAWRC  750



>ref|XP_010456318.1| PREDICTED: scarecrow-like protein 6 [Camelina sativa]
Length=553

 Score =   327 bits (839),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 207/294 (70%), Gaps = 9/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+ +GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  265   FKIAAYKSFSEISPVLQFANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLR  324

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  ++
Sbjct  325   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNE  384

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  + A+AVN+     S       PL+L FVK L P I+V  D GC+RTDLPFP  +  +
Sbjct  385   SEEKEAVAVNISPASFSQR-----PLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQS  439

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ LLESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W+ +FL 
Sbjct  440   LHSHAALLESLDAVNANLDAMQKIERFLIQPEIEKLV---MDRSRPIERPMMTWQAMFLQ  496

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  S WRC
Sbjct  497   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSTWRC  550



>ref|XP_010258971.1| PREDICTED: scarecrow-like protein 6 [Nelumbo nucifera]
Length=810

 Score =   334 bits (857),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 213/296 (72%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYK+FSE+SP+ QFANFT NQALLEAL+  DRIHI+DFDIG G QWAS MQELA  
Sbjct  520   LKIGAYKAFSEISPLLQFANFTCNQALLEALDRSDRIHIIDFDIGIGGQWASFMQELASK  579

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss---sw  2255
              G  PSLKITA  SP   +QLEL + R NL  FA+++ + F+ + + ++  + +S   + 
Sbjct  580   PGGAPSLKITAFTSPTSHDQLELRLTRENLTHFANDLGIAFDLDIVNLDSFDPASWSLAP  639

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    A+AVNLPVG  S  Q  S+P +L FVK+L PKIVVSVD GCDR+DLPF  H +
Sbjct  640   LHVSDSEAVAVNLPVG-SSVTQLSSVPSLLRFVKQLSPKIVVSVDRGCDRSDLPFSHHFL  698

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             ++L S+S LL+SLDAVN+N DA+ KIEKF+ QP IE  V  R    +PEK     WR VF
Sbjct  699   YSLQSFSILLDSLDAVNVNSDAVHKIEKFLFQPRIEGIVLGR--QRAPEKMLP--WRNVF  754

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P  F+NF E+QAEC++KR  V GFHVEKRQ+SL+LCWQR EL+SASAWRC
Sbjct  755   ASAGFSPVPFTNFTETQAECLVKRLHVRGFHVEKRQASLILCWQRGELVSASAWRC  810



>ref|XP_009611447.1| PREDICTED: uncharacterized protein LOC104104938 isoform X4 [Nicotiana 
tomentosiformis]
Length=1218

 Score =   342 bits (877),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 185/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNP-FQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I  S S+ QTP+A+    T+ EGN  FQAD T SESS+SP+W KMN+  KD
Sbjct  960   LVVEVPHDLILSSLSNLQTPKAEPTQLTVEEGNAVFQADSTCSESSSSPQWSKMNECRKD  1019

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VK+VRLDISFKSPSHTGLQT+ELVKELTEQFPA+ PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1020  VKAVRLDISFKSPSHTGLQTTELVKELTEQFPASTPLALVLKQFLADRSLDQSYSGGLSS  1079

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHHHGR   QN GSLLMDF YFFGNVFDPRQMRVSIQGSGLYINRER
Sbjct  1080  YCLVLLITRFLQHEHHHGRLIDQNLGSLLMDFFYFFGNVFDPRQMRVSIQGSGLYINRER  1139

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAF  624
             G SIDPI IDDPL+PTNNVGRNCFRIHQCIK  
Sbjct  1140  GCSIDPICIDDPLYPTNNVGRNCFRIHQCIKML  1172



>ref|XP_006287420.1| hypothetical protein CARUB_v10000626mg [Capsella rubella]
 gb|EOA20318.1| hypothetical protein CARUB_v10000626mg [Capsella rubella]
Length=551

 Score =   327 bits (837),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 206/294 (70%), Gaps = 10/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  262   FKIAAYKSFSEISPVLQFANFTSNQALLESFHGFHRLHIVDFDIGYGGQWASLMQELVLR  321

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT   SP   +QLELG  + NL  FASEIN+  + + L ++ L S S  S 
Sbjct  322   DNAAPLSLKITVFDSPASHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPSA  381

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  E A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPFP  + H+
Sbjct  382   SEKE-AVAVNISAASFS-----HLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAHS  435

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS+  LLESLDAVN N +A+QKIE+F+IQP IEK V    D   P +  T  W+ +FL 
Sbjct  436   LHSHGALLESLDAVNANLEAMQKIERFLIQPEIEKLV---MDRSRPMERPTMTWQAMFLQ  492

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+  + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  493   MGFSAVAHSNFTESQAECLVQRTPVRGFHVEKKHNSLILCWQRTELVGVSAWRC  546



>ref|XP_007218885.1| hypothetical protein PRUPE_ppa000183mg [Prunus persica]
 gb|EMJ20084.1| hypothetical protein PRUPE_ppa000183mg [Prunus persica]
Length=1506

 Score =   343 bits (879),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 200/250 (80%), Gaps = 5/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVPRD I  S+S+ Q+P+ +    +  +G+   +     E S  PK  ++N D  KD
Sbjct  1254  LVVEVPRDLIASSASNVQSPKEEPPHMSGEQGSHVNSSVVVLEESALPKCSQINYDVTKD  1313

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVR+DISFKSPSHTGLQT+ELVK+LTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1314  SVSVRIDISFKSPSHTGLQTTELVKDLTEQFPAAAPLALVLKQFLADRSLDQSYSGGLSS  1373

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHE+H  R   QN+G+LLM+FLYFFGNVFDPRQMR+S+QGSG+YI RER
Sbjct  1374  YCLVLLIIRFLQHEYHLSRPINQNFGNLLMNFLYFFGNVFDPRQMRISVQGSGVYIKRER  1433

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+  LPS D      PS 
Sbjct  1434  GCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSILENELASLPSGDGDLCSRPSY  1493

Query  706   KLLPKVIPSI  735
             ++L K+IPSI
Sbjct  1494  RMLSKIIPSI  1503



>ref|NP_191926.1| protein LOST MERISTEMS 3 [Arabidopsis thaliana]
 sp|O81316.1|SCL6_ARATH RecName: Full=Scarecrow-like protein 6; Short=AtSCL6; AltName: 
Full=GRAS family protein 22; Short=AtGRAS-22; AltName: Full=SCL6-IV 
[Arabidopsis thaliana]
 gb|AAL58919.1|AF462831_1 AT4g00150/F6N15_20 [Arabidopsis thaliana]
 gb|AAC19296.1| contains similarity to Arabidopsis scarecrow (GB:U62798) [Arabidopsis 
thaliana]
 emb|CAB80773.1| scarecrow-like 6 (SCL6) [Arabidopsis thaliana]
 gb|AAM91367.1| At4g00150/F6N15_20 [Arabidopsis thaliana]
 gb|AEE81829.1| LOST MERISTEMS family protein [Arabidopsis thaliana]
Length=558

 Score =   326 bits (835),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 206/294 (70%), Gaps = 10/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HI+DFDIGYG QWASLMQEL L 
Sbjct  271   FKIAAYKSFSEISPVLQFANFTSNQALLESFHGFHRLHIIDFDIGYGGQWASLMQELVLR  330

Query  2425  NGTTP-SLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsd  2249
             +   P SLKIT  ASP   +QLELG  + NL  FASEIN+  + + L ++ L S S  + 
Sbjct  331   DNAAPLSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNS  390

Query  2248  sySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHA  2069
             S  E A+AVN+     S      LPL+L FVK L P I+V  D GC+RTDLPF   + H+
Sbjct  391   SEKE-AVAVNISAASFS-----HLPLVLRFVKHLSPTIIVCSDRGCERTDLPFSQQLAHS  444

Query  2068  LHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLS  1889
             LHS++ L ESLDAVN N DA+QKIE+F+IQP IEK V    D   P +     W+ +FL 
Sbjct  445   LHSHTALFESLDAVNANLDAMQKIERFLIQPEIEKLV---LDRSRPIERPMMTWQAMFLQ  501

Query  1888  SGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  502   MGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  555



>ref|XP_009611430.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611431.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611432.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611434.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611435.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611436.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611437.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611438.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611440.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611441.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611442.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611443.1| PREDICTED: uncharacterized protein LOC104104938 isoform X1 [Nicotiana 
tomentosiformis]
Length=1579

 Score =   343 bits (879),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 185/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNP-FQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I  S S+ QTP+A+    T+ EGN  FQAD T SESS+SP+W KMN+  KD
Sbjct  1321  LVVEVPHDLILSSLSNLQTPKAEPTQLTVEEGNAVFQADSTCSESSSSPQWSKMNECRKD  1380

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VK+VRLDISFKSPSHTGLQT+ELVKELTEQFPA+ PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1381  VKAVRLDISFKSPSHTGLQTTELVKELTEQFPASTPLALVLKQFLADRSLDQSYSGGLSS  1440

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHHHGR   QN GSLLMDF YFFGNVFDPRQMRVSIQGSGLYINRER
Sbjct  1441  YCLVLLITRFLQHEHHHGRLIDQNLGSLLMDFFYFFGNVFDPRQMRVSIQGSGLYINRER  1500

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAF  624
             G SIDPI IDDPL+PTNNVGRNCFRIHQCIK  
Sbjct  1501  GCSIDPICIDDPLYPTNNVGRNCFRIHQCIKML  1533



>ref|XP_009611446.1| PREDICTED: uncharacterized protein LOC104104938 isoform X3 [Nicotiana 
tomentosiformis]
Length=1555

 Score =   343 bits (879),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 185/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNP-FQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I  S S+ QTP+A+    T+ EGN  FQAD T SESS+SP+W KMN+  KD
Sbjct  1297  LVVEVPHDLILSSLSNLQTPKAEPTQLTVEEGNAVFQADSTCSESSSSPQWSKMNECRKD  1356

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VK+VRLDISFKSPSHTGLQT+ELVKELTEQFPA+ PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1357  VKAVRLDISFKSPSHTGLQTTELVKELTEQFPASTPLALVLKQFLADRSLDQSYSGGLSS  1416

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHHHGR   QN GSLLMDF YFFGNVFDPRQMRVSIQGSGLYINRER
Sbjct  1417  YCLVLLITRFLQHEHHHGRLIDQNLGSLLMDFFYFFGNVFDPRQMRVSIQGSGLYINRER  1476

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAF  624
             G SIDPI IDDPL+PTNNVGRNCFRIHQCIK  
Sbjct  1477  GCSIDPICIDDPLYPTNNVGRNCFRIHQCIKML  1509



>ref|XP_011018301.1| PREDICTED: scarecrow-like protein 27 isoform X2 [Populus euphratica]
Length=708

 Score =   330 bits (846),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 209/296 (71%), Gaps = 9/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+ AYK  SEVSP+ QF NFT NQALLEA++  D IHIVDFDIG+G QWAS MQEL  N
Sbjct  419   FKMSAYKVLSEVSPLIQFVNFTCNQALLEAVDDADSIHIVDFDIGFGAQWASFMQELPRN  478

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G   SLK TA ASP     +ELG++R NL QFA+EI + FE + +  + L  +      
Sbjct  479   RGVR-SLKTTAFASPSTHHPVELGLMRDNLTQFANEIGLSFELDVINFDSLEQNCYSLPF  537

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               +    A+ VN P+ W S+NQ  +LP +L F+K+L PKIVVS+D GCDR+DLPF  HI+
Sbjct  538   FRTNENEAVVVNFPI-WCSSNQPSALPSLLRFIKQLSPKIVVSLDRGCDRSDLPFSQHIL  596

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL SY +LLESLDAVN   D + KIE+F++QP IE TV  R  +      +  +W+T+F
Sbjct  597   HALQSYVHLLESLDAVNATTDDVNKIERFLLQPRIESTVLGRLRATD----KMPNWKTIF  652

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S GF+P +FSNF E+QAECV+KRTPV GFHVEK+Q+ LVL WQR+EL+SASAWRC
Sbjct  653   ASVGFSPVTFSNFTEAQAECVVKRTPVRGFHVEKQQALLVLFWQRRELMSASAWRC  708



>gb|KEH29150.1| GRAS family transcription regulator [Medicago truncatula]
Length=625

 Score =   327 bits (839),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 208/296 (70%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ+L+EALE FDRIH++DFDIG+G QW+S MQE+ L 
Sbjct  335   FKIGAYKSFSEISPVLQFANFTCNQSLIEALERFDRIHVIDFDIGFGVQWSSFMQEIVLR  394

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss---w  2255
             +   PSLKITA+ SP    ++EL   + NL Q+A ++N+ FEF  L +E LN  S     
Sbjct  395   SNGKPSLKITAVVSPSSCNEIELNFTQENLSQYAKDLNILFEFNVLNIESLNLPSCPLPG  454

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                 S  AI VN PV    +N     P+ L F+K+L+PKIVV++D  CDR D+P P +++
Sbjct  455   HFFDSNEAIGVNFPVSSFISNPSC-FPVALHFLKQLRPKIVVTLDKNCDRMDVPLPTNVV  513

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             H L  YS LLESLDAVN+N D LQKIE+  IQP I K V +  +    ++ +   WR +F
Sbjct  514   HVLQCYSALLESLDAVNVNLDVLQKIERHYIQPTINKIVLSHHN----QRDKLPPWRNMF  569

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             L SGF+PFSFSNF E+QAEC+++R PV GF VE++ SSLVLCWQRKELIS S WRC
Sbjct  570   LQSGFSPFSFSNFTEAQAECLVQRAPVRGFQVERKPSSLVLCWQRKELISVSTWRC  625



>ref|XP_006576434.1| PREDICTED: scarecrow-like protein 6-like [Glycine max]
Length=703

 Score =   330 bits (845),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/297 (55%), Positives = 210/297 (71%), Gaps = 11/297 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQAL+EA+E  DRIH++DFDIG+G QW+S MQE+AL 
Sbjct  414   FKIGAYKSFSEISPVLQFANFTCNQALIEAVERSDRIHVIDFDIGFGVQWSSFMQEIALR  473

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLK+TA+ SP   +++EL   R NLIQ+A +IN+ FEF  L +E LNS S     
Sbjct  474   SSGAPSLKVTAIVSPSTCDEVELNFTRENLIQYAKDINVSFEFNVLSIESLNSPSCPLLG  533

Query  2245  y--SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AI VN+PV    TN     P +L FVK+L+PK+VV++D  CD+ D+P P +++H
Sbjct  534   KFFDNEAIVVNMPVSSF-TNYPSLFPSVLHFVKQLRPKVVVTLDRICDQMDVPLPTNVVH  592

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTA--RFDSDSPEKTQTQHWRTV  1898
              L  YS LLESLDAVN+N D LQKIE+  IQP I+K +     F    P       WR +
Sbjct  593   VLQCYSALLESLDAVNVNLDVLQKIERHFIQPAIKKIILGHHHFQEKLPP------WRNL  646

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F+ SGF+PF+FSNF E+QAEC+++R PV GFHVE++ SSLVLCWQ+KELIS S WRC
Sbjct  647   FMQSGFSPFTFSNFTEAQAECLVQRAPVRGFHVERKPSSLVLCWQKKELISVSTWRC  703



>ref|XP_002872974.1| hypothetical protein ARALYDRAFT_912246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49233.1| hypothetical protein ARALYDRAFT_912246 [Arabidopsis lyrata subsp. 
lyrata]
Length=840

 Score =   332 bits (852),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 194/251 (77%), Gaps = 7/251 (3%)
 Frame = +1

Query  1    LVVEVPRDFITLSSSHSQTPEAQTI-----SEGNPFQADGTSSESSTSPKWPKMNDSGKD  165
            LVVEVP D +    S    P+  +I     S GN        S ++ S   P    +  +
Sbjct  590  LVVEVPCDLVCSIQSPKDGPDCISITVDQDSNGNTEMVGFEDSAAANS--LPTNTGNLAN  647

Query  166  VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             KSVRLDISFK+PSHTGLQT++LVK+LT+QFPAA PLALVLKQFLADR+LDQSYSGGLSS
Sbjct  648  AKSVRLDISFKTPSHTGLQTTQLVKDLTDQFPAATPLALVLKQFLADRTLDQSYSGGLSS  707

Query  346  YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
            YCLVLLITRFLQHEHH G S  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRER
Sbjct  708  YCLVLLITRFLQHEHHLGLSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRER  767

Query  526  GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
            GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +    
Sbjct  768  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDSCGKQQLH  827

Query  706  KLLPKVIPSIM  738
             LLPK+IPSI+
Sbjct  828  NLLPKIIPSII  838



>ref|XP_010692161.1| PREDICTED: uncharacterized protein LOC104905346 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692162.1| PREDICTED: uncharacterized protein LOC104905346 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692163.1| PREDICTED: uncharacterized protein LOC104905346 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692164.1| PREDICTED: uncharacterized protein LOC104905346 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692165.1| PREDICTED: uncharacterized protein LOC104905346 [Beta vulgaris 
subsp. vulgaris]
Length=1551

 Score =   341 bits (875),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 199/250 (80%), Gaps = 8/250 (3%)
 Frame = +1

Query  1     LVVEVPRDFIT-LSSSHSQTP-EAQTISEGNPF--QADGTSSESSTSPKWPKM-NDSGKD  165
             LVV+VP DF+T +++    TP   Q      P   Q D   S+SS SP   ++ N+  KD
Sbjct  1302  LVVDVPHDFVTAIAAPSVHTPLSGQNQLHDAPAVDQNDTVGSDSSPSPTCSELINNLDKD  1361

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVRLDISF+SPSHTGLQT+ELVK+LT+QFPAA PLALVLKQFL+DRSLDQSYSGGLSS
Sbjct  1362  STSVRLDISFRSPSHTGLQTTELVKQLTDQFPAAIPLALVLKQFLSDRSLDQSYSGGLSS  1421

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHHHGR   QN GSL MDFLYFFGNVFDPRQMRVSIQGSGLYINRER
Sbjct  1422  YCLVLLITRFLQHEHHHGRPINQNLGSLFMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  1481

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G  IDPIYIDDPLFPTNNVG+NCFRIHQCIKAFADAY+TLE+E++ L +  D        
Sbjct  1482  G--IDPIYIDDPLFPTNNVGKNCFRIHQCIKAFADAYATLENEVSCLSAESDVET-TKQY  1538

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1539  RLLPKIIPSI  1548



>gb|KHN38819.1| Scarecrow-like protein 6 [Glycine soja]
Length=732

 Score =   330 bits (845),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/297 (55%), Positives = 210/297 (71%), Gaps = 11/297 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQAL+EA+E  DRIH++DFDIG+G QW+S MQE+AL 
Sbjct  443   FKIGAYKSFSEISPVLQFANFTCNQALIEAVERSDRIHVIDFDIGFGVQWSSFMQEIALR  502

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLK+TA+ SP   +++EL   R NLIQ+A +IN+ FEF  L +E LNS S     
Sbjct  503   SSGAPSLKVTAIVSPSTCDEVELNFTRENLIQYAKDINVSFEFNVLSIESLNSPSCPLLG  562

Query  2245  y--SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AI VN+PV    TN     P +L FVK+L+PK+VV++D  CD+ D+P P +++H
Sbjct  563   KFFDNEAIVVNMPVSSF-TNYPSLFPSVLHFVKQLRPKVVVTLDRICDQMDVPLPTNVVH  621

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTA--RFDSDSPEKTQTQHWRTV  1898
              L  YS LLESLDAVN+N D LQKIE+  IQP I+K +     F    P       WR +
Sbjct  622   VLQCYSALLESLDAVNVNLDVLQKIERHFIQPAIKKIILGHHHFQEKLPP------WRNL  675

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             F+ SGF+PF+FSNF E+QAEC+++R PV GFHVE++ SSLVLCWQ+KELIS S WRC
Sbjct  676   FMQSGFSPFTFSNFTEAQAECLVQRAPVRGFHVERKPSSLVLCWQKKELISVSTWRC  732



>ref|XP_011018300.1| PREDICTED: scarecrow-like protein 27 isoform X1 [Populus euphratica]
Length=766

 Score =   330 bits (846),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 209/296 (71%), Gaps = 9/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+ AYK  SEVSP+ QF NFT NQALLEA++  D IHIVDFDIG+G QWAS MQEL  N
Sbjct  477   FKMSAYKVLSEVSPLIQFVNFTCNQALLEAVDDADSIHIVDFDIGFGAQWASFMQELPRN  536

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws--  2252
              G   SLK TA ASP     +ELG++R NL QFA+EI + FE + +  + L  +      
Sbjct  537   RGVR-SLKTTAFASPSTHHPVELGLMRDNLTQFANEIGLSFELDVINFDSLEQNCYSLPF  595

Query  2251  -dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               +    A+ VN P+ W S+NQ  +LP +L F+K+L PKIVVS+D GCDR+DLPF  HI+
Sbjct  596   FRTNENEAVVVNFPI-WCSSNQPSALPSLLRFIKQLSPKIVVSLDRGCDRSDLPFSQHIL  654

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL SY +LLESLDAVN   D + KIE+F++QP IE TV  R  +      +  +W+T+F
Sbjct  655   HALQSYVHLLESLDAVNATTDDVNKIERFLLQPRIESTVLGRLRATD----KMPNWKTIF  710

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S GF+P +FSNF E+QAECV+KRTPV GFHVEK+Q+ LVL WQR+EL+SASAWRC
Sbjct  711   ASVGFSPVTFSNFTEAQAECVVKRTPVRGFHVEKQQALLVLFWQRRELMSASAWRC  766



>ref|NP_191917.3| protein MATERNAL EFFECT EMBRYO ARREST 44 [Arabidopsis thaliana]
 gb|AEE81819.1| Nucleotidyltransferase family protein [Arabidopsis thaliana]
Length=1481

 Score =   340 bits (873),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 192/247 (78%), Gaps = 1/247 (0%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
             LVVEVP D I    S    P+  T+ + +    +    E S +    P    +    KSV
Sbjct  1233  LVVEVPCDLICSIQSPKDGPDCITVDQDSNGNTEMVGFEDSAAANSLPTNTGNLAIAKSV  1292

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  1293  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  1352

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERGYSI
Sbjct  1353  LLITRFLQHEHHLGRSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGYSI  1412

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S  DS  +     LLP
Sbjct  1413  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSTSDSCGKQQLHNLLP  1472

Query  718   KVIPSIM  738
             K+IPSI+
Sbjct  1473  KIIPSII  1479



>ref|XP_004308471.1| PREDICTED: uncharacterized protein LOC101305610 [Fragaria vesca 
subsp. vesca]
Length=1552

 Score =   341 bits (874),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 200/251 (80%), Gaps = 7/251 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D I  S+S+ Q+P+ +    T    N   + G   E S  PK P++  D+ KD
Sbjct  1300  LVVEVPNDLIASSASNVQSPKEEAPHNTGEPDNNAHSSGVVLEESAMPKCPQITYDATKD  1359

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               S+R+DISFKSPSHTG QT++LVK+LTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1360  SVSIRIDISFKSPSHTGFQTTQLVKDLTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1419

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFG-NVFDPRQMRVSIQGSGLYINRE  522
             YCLVLLI RFLQHE+H GR   QN+G+LLM+FLYF G NVFDPRQMR+S+QGSG+YI RE
Sbjct  1420  YCLVLLIVRFLQHEYHLGRPINQNFGNLLMNFLYFLGKNVFDPRQMRISVQGSGVYIKRE  1479

Query  523   RGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPS  702
             RG SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS +E+E+  LP NDD +   P 
Sbjct  1480  RGCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSIMETELASLP-NDDDAESSPP  1538

Query  703   LKLLPKVIPSI  735
              +LLPK+IPSI
Sbjct  1539  YRLLPKIIPSI  1549



>ref|XP_006286684.1| hypothetical protein CARUB_v10002719mg [Capsella rubella]
 gb|EOA19582.1| hypothetical protein CARUB_v10002719mg [Capsella rubella]
Length=1489

 Score =   340 bits (872),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 195/249 (78%), Gaps = 5/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI---SEGNPFQADGTSSESSTSPKWPKMNDSGKDVK  171
             LVVEVP D +    +    P+  T+   S GN   A G    +  +   P       + K
Sbjct  1241  LVVEVPCDLVCSIQTPKDGPDCITVDQDSSGNSEMA-GFEDSAGGATSLPTNTGVLANAK  1299

Query  172   SVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYC  351
             SVRLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYC
Sbjct  1300  SVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYC  1359

Query  352   LVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGY  531
             LVLLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERGY
Sbjct  1360  LVLLITRFLQHEHHLGRSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGY  1419

Query  532   SIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKL  711
             SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +    KL
Sbjct  1420  SIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCMTSSSDSCGKQLH-KL  1478

Query  712   LPKVIPSIM  738
             LPK+IPSI+
Sbjct  1479  LPKIIPSII  1487



>ref|XP_003605197.1| GRAS family transcription factor [Medicago truncatula]
Length=599

 Score =   325 bits (832),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 207/295 (70%), Gaps = 8/295 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQ+L+EALE FDRIH++DFDIG+G QW+S MQE+ L 
Sbjct  262   FKIGAYKSFSEISPVLQFANFTCNQSLIEALERFDRIHVIDFDIGFGVQWSSFMQEIVLR  321

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLKITA+ SP    ++EL   + NL Q+A ++N+ FEF  L +E LN  S     
Sbjct  322   SNGKPSLKITAVVSPSSCNEIELNFTQENLSQYAKDLNILFEFNVLNIESLNLPSCPLPG  381

Query  2245  ---ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                 S  AI VN PV    +N     P+ L F+K+L+PKIVV++D  CDR D+P P +++
Sbjct  382   HFFDSNEAIGVNFPVSSFISNPSC-FPVALHFLKQLRPKIVVTLDKNCDRMDVPLPTNVV  440

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             H L  YS LLESLDAVN+N D LQKIE+  IQP I K V +  +    ++ +   WR +F
Sbjct  441   HVLQCYSALLESLDAVNVNLDVLQKIERHYIQPTINKIVLSHHN----QRDKLPPWRNMF  496

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
             L SGF+PFSFSNF E+QAEC+++R PV GF VE++ SSLVLCWQRKELIS S WR
Sbjct  497   LQSGFSPFSFSNFTEAQAECLVQRAPVRGFQVERKPSSLVLCWQRKELISVSTWR  551



>ref|XP_009133973.1| PREDICTED: uncharacterized protein LOC103858376 isoform X2 [Brassica 
rapa]
Length=1447

 Score =   339 bits (869),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 194/247 (79%), Gaps = 2/247 (1%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
             LVVEVP D +    S    P+  T+ + +    D    E S +    P    +  + K V
Sbjct  1200  LVVEVPCDLVCSIQSPKDGPDCITVDQDSNSNTDMVGFEDSAAANSLPTKAGNMANAKCV  1259

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  1260  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  1319

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERG+SI
Sbjct  1320  LLITRFLQHEHHLGRSINQNIGRLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGHSI  1379

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +    KLLP
Sbjct  1380  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDSCEKQ-LYKLLP  1438

Query  718   KVIPSIM  738
             K+IPSI+
Sbjct  1439  KIIPSII  1445



>ref|XP_009133971.1| PREDICTED: uncharacterized protein LOC103858376 isoform X1 [Brassica 
rapa]
 ref|XP_009133972.1| PREDICTED: uncharacterized protein LOC103858376 isoform X1 [Brassica 
rapa]
Length=1455

 Score =   339 bits (869),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 194/247 (79%), Gaps = 2/247 (1%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
             LVVEVP D +    S    P+  T+ + +    D    E S +    P    +  + K V
Sbjct  1208  LVVEVPCDLVCSIQSPKDGPDCITVDQDSNSNTDMVGFEDSAAANSLPTKAGNMANAKCV  1267

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  1268  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  1327

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERG+SI
Sbjct  1328  LLITRFLQHEHHLGRSINQNIGRLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGHSI  1387

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +    KLLP
Sbjct  1388  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDSCEKQ-LYKLLP  1446

Query  718   KVIPSIM  738
             K+IPSI+
Sbjct  1447  KIIPSII  1453



>ref|XP_007134738.1| hypothetical protein PHAVU_010G071800g [Phaseolus vulgaris]
 gb|ESW06732.1| hypothetical protein PHAVU_010G071800g [Phaseolus vulgaris]
Length=1547

 Score =   339 bits (869),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 202/252 (80%), Gaps = 14/252 (6%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDVK---  171
             LVVEVP+D I  +S+    P  Q+++E +P +  G     + S    ++ D G  +K   
Sbjct  1300  LVVEVPQDVIVTTSA----PMIQSLNE-DPHRTPGEHGNDNNSDTI-QLEDLGTQMKFDA  1353

Query  172   ----SVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
                 SVRLDISFK+PSHTGLQT+E+VKELTEQFPAA PLALVLKQFL+DRSLDQSYSGGL
Sbjct  1354  LKSKSVRLDISFKTPSHTGLQTTEMVKELTEQFPAATPLALVLKQFLSDRSLDQSYSGGL  1413

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GR   QNYGSLLMDFLYFFGNVFDPRQMR+S+QGSGLYI R
Sbjct  1414  SSYCLVLLIIRFLQHEHHLGRPINQNYGSLLMDFLYFFGNVFDPRQMRISVQGSGLYIKR  1473

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+  L S+ +SS+R P
Sbjct  1474  ERGCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELKFLSSDGESSSR-P  1532

Query  700   SLKLLPKVIPSI  735
               +LLPK+IPS+
Sbjct  1533  PYRLLPKIIPSL  1544



>emb|CDY21497.1| BnaC03g27000D [Brassica napus]
Length=1457

 Score =   338 bits (867),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 194/247 (79%), Gaps = 2/247 (1%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
             LVVEVP D +    S    P+  T+ + +    D    E S +    P    +  + K V
Sbjct  1210  LVVEVPCDLVCSIQSPKDGPDCITVDQDSNSNTDMVGFEDSAAANSLPTKAGNLANAKCV  1269

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  1270  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  1329

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERG+SI
Sbjct  1330  LLITRFLQHEHHLGRSINQNIGRLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGHSI  1389

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +    KLLP
Sbjct  1390  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDSCEKQ-LYKLLP  1448

Query  718   KVIPSIM  738
             K+IPSI+
Sbjct  1449  KIIPSII  1455



>ref|XP_006396205.1| hypothetical protein EUTSA_v10028362mg [Eutrema salsugineum]
 gb|ESQ37658.1| hypothetical protein EUTSA_v10028362mg [Eutrema salsugineum]
Length=1478

 Score =   338 bits (867),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 194/247 (79%), Gaps = 2/247 (1%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
             LVVEVP D I    S  + P+  T+ + +    +    E S +    P    +  + KSV
Sbjct  1231  LVVEVPCDLICSIQSPKEGPDCITVDQDSNSNTEMVGFEDSVAANSLPTFTGNLANAKSV  1290

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  1291  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  1350

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERGYSI
Sbjct  1351  LLITRFLQHEHHLGRSINQNLGRLLMDFLYFFGNVFDPRQMRVSVQGSGVYRNRERGYSI  1410

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ D   +     LLP
Sbjct  1411  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDPCGKQLH-NLLP  1469

Query  718   KVIPSIM  738
             K+IPSI+
Sbjct  1470  KIIPSII  1476



>gb|KCW78315.1| hypothetical protein EUGRSUZ_D02494 [Eucalyptus grandis]
Length=1406

 Score =   337 bits (863),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 201/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEG----NPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP+D ++ S+S  Q+P+ +    G    N  QA     E S     P+ N +  D 
Sbjct  1155  LVVEVPQDLVSSSASSVQSPKEEPSHNGQELSNLAQAHSDVQEDSAPQVCPQTNYNNTDS  1214

Query  169   -KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVRLDISF+S SHTGLQT+ELVKELTE+FPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1215  SKSVRLDISFESASHTGLQTAELVKELTERFPAATPLALVLKQFLADRSLDQSYSGGLSS  1274

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GRS  QN+GSLLMDFLYFFGNVFDPR+MRVS++GSGLY+ RER
Sbjct  1275  YCLVLLITRFLQHEHHLGRSINQNFGSLLMDFLYFFGNVFDPREMRVSVRGSGLYLKRER  1334

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAFA+AYS L+ E T + +N D+ +R P  
Sbjct  1335  GSSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFAEAYSALKQERTWIQNNGDACSR-PPY  1393

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1394  RLLPKIIPSI  1403



>ref|XP_010053939.1| PREDICTED: uncharacterized protein LOC104442273 isoform X1 [Eucalyptus 
grandis]
Length=1581

 Score =   337 bits (865),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 201/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEG----NPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP+D ++ S+S  Q+P+ +    G    N  QA     E S     P+ N +  D 
Sbjct  1330  LVVEVPQDLVSSSASSVQSPKEEPSHNGQELSNLAQAHSDVQEDSAPQVCPQTNYNNTDS  1389

Query  169   -KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVRLDISF+S SHTGLQT+ELVKELTE+FPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1390  SKSVRLDISFESASHTGLQTAELVKELTERFPAATPLALVLKQFLADRSLDQSYSGGLSS  1449

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GRS  QN+GSLLMDFLYFFGNVFDPR+MRVS++GSGLY+ RER
Sbjct  1450  YCLVLLITRFLQHEHHLGRSINQNFGSLLMDFLYFFGNVFDPREMRVSVRGSGLYLKRER  1509

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAFA+AYS L+ E T + +N D+ +R P  
Sbjct  1510  GSSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFAEAYSALKQERTWIQNNGDACSR-PPY  1568

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1569  RLLPKIIPSI  1578



>ref|XP_010053940.1| PREDICTED: uncharacterized protein LOC104442273 isoform X2 [Eucalyptus 
grandis]
Length=1545

 Score =   337 bits (865),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 201/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEG----NPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP+D ++ S+S  Q+P+ +    G    N  QA     E S     P+ N +  D 
Sbjct  1294  LVVEVPQDLVSSSASSVQSPKEEPSHNGQELSNLAQAHSDVQEDSAPQVCPQTNYNNTDS  1353

Query  169   -KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVRLDISF+S SHTGLQT+ELVKELTE+FPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1354  SKSVRLDISFESASHTGLQTAELVKELTERFPAATPLALVLKQFLADRSLDQSYSGGLSS  1413

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GRS  QN+GSLLMDFLYFFGNVFDPR+MRVS++GSGLY+ RER
Sbjct  1414  YCLVLLITRFLQHEHHLGRSINQNFGSLLMDFLYFFGNVFDPREMRVSVRGSGLYLKRER  1473

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAFA+AYS L+ E T + +N D+ +R P  
Sbjct  1474  GSSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFAEAYSALKQERTWIQNNGDACSR-PPY  1532

Query  706   KLLPKVIPSI  735
             +LLPK+IPSI
Sbjct  1533  RLLPKIIPSI  1542



>emb|CDX83213.1| BnaA03g22930D [Brassica napus]
Length=1497

 Score =   337 bits (864),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 193/247 (78%), Gaps = 2/247 (1%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPK-WPKMNDSGKDVKSV  177
             LVVEVP D +    S    P+  T+ + +    D    E S +    P    +  + K V
Sbjct  1250  LVVEVPCDLVCSIQSPKDGPDCITVDQDSNSNTDMVGFEDSAAANSLPTKAGNFANAKCV  1309

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             RLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYCLV
Sbjct  1310  RLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYCLV  1369

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLITRFLQHEHH GRS  QN G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERG+SI
Sbjct  1370  LLITRFLQHEHHLGRSINQNIGRLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGHSI  1429

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E T + S+ DS  +    KLLP
Sbjct  1430  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENERTCITSSSDSCEKQ-LYKLLP  1488

Query  718   KVIPSIM  738
             K+IPSI+
Sbjct  1489  KIIPSII  1495



>gb|KEH29187.1| nucleotidyltransferase family protein [Medicago truncatula]
Length=1573

 Score =   337 bits (864),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 199/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSS--HSQTPEAQTIS--EGNPFQADGTSSESSTSPKWPKMNDSG-KD  165
             LVVEVP+D IT S+   HS   E+ + +    N   +D    E S   K  + N    KD
Sbjct  1322  LVVEVPQDVITSSAPTLHSLKEESHSTTGEHVNDSHSDIIQLEDSALLKRSQTNVYALKD  1381

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVR+DISFKSPSHTGLQT+ +VKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1382  SNSVRVDISFKSPSHTGLQTTGMVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1441

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QNYGSLL+DFLYFFGNVFDPR MR+S+QGSGLYI RER
Sbjct  1442  YCLVLLIIRFLQHEHHLGRPINQNYGSLLVDFLYFFGNVFDPRHMRISVQGSGLYIKRER  1501

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AY+ LE+E+T L  + +SS+R PS 
Sbjct  1502  GCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYTVLENELTFLSGDGESSSR-PSY  1560

Query  706   KLLPKVIPSI  735
             +LLPK+IPS+
Sbjct  1561  RLLPKIIPSL  1570



>ref|XP_004506474.1| PREDICTED: scarecrow-like protein 6-like [Cicer arietinum]
Length=733

 Score =   326 bits (835),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 205/296 (69%), Gaps = 7/296 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QFANFT NQAL+EALE FDRIH++DFDIG+G QW+S MQEL L 
Sbjct  442   FKIGAYKSFSEISPVLQFANFTCNQALVEALERFDRIHVIDFDIGFGVQWSSFMQELVLR  501

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss---w  2255
             +  TPSLK+TA+ SP    ++EL   R NL Q+A ++NM FEF  L +E LNSSS     
Sbjct  502   SNGTPSLKVTAVVSPSSCNEIELNFTRENLSQYAKDLNMSFEFNVLNIESLNSSSCPLPG  561

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                 S  AI VN PV    +      PL L F+K+L+PK+VV++D  CDR D+P   + +
Sbjct  562   HFFDSNEAIGVNFPVSSFISYPSC-FPLALHFIKQLRPKVVVTLDKNCDRIDVPLQTNAV  620

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             H L  YS L ESLDAVN+N D LQKIE+  IQP I K +    +       +   WR++F
Sbjct  621   HVLQCYSALFESLDAVNVNHDVLQKIERHYIQPAINKIILGHHNR---SHDKLPPWRSLF  677

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             L SGF+PF+FSNF E+QAEC+++R PV GF VE++ SSLVLCWQRKELIS S WRC
Sbjct  678   LQSGFSPFTFSNFTEAQAECLVQRAPVRGFQVERKPSSLVLCWQRKELISISTWRC  733



>ref|XP_010426531.1| PREDICTED: uncharacterized protein LOC104711527 [Camelina sativa]
Length=1480

 Score =   337 bits (863),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 194/249 (78%), Gaps = 6/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPE---AQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDVK  171
             LVVEVP D +    S    P+   A   S GN        S ++ S   P       + K
Sbjct  1233  LVVEVPCDLVCSIQSPKDGPDCIAADQDSNGNTEMVGFEGSAAANS--LPTNTGILANAK  1290

Query  172   SVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYC  351
             SVRLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYC
Sbjct  1291  SVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYC  1350

Query  352   LVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGY  531
             LVLLITRFLQHEHH GRS  QN+G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERGY
Sbjct  1351  LVLLITRFLQHEHHLGRSINQNFGGLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGY  1410

Query  532   SIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKL  711
             SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +     L
Sbjct  1411  SIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDSCGKKLH-NL  1469

Query  712   LPKVIPSIM  738
             LPK+IPSI+
Sbjct  1470  LPKIIPSII  1478



>ref|XP_010419530.1| PREDICTED: uncharacterized protein LOC104705261 isoform X1 [Camelina 
sativa]
 ref|XP_010419531.1| PREDICTED: uncharacterized protein LOC104705261 isoform X1 [Camelina 
sativa]
 ref|XP_010419532.1| PREDICTED: uncharacterized protein LOC104705261 isoform X1 [Camelina 
sativa]
 ref|XP_010419533.1| PREDICTED: uncharacterized protein LOC104705261 isoform X1 [Camelina 
sativa]
 ref|XP_010419534.1| PREDICTED: uncharacterized protein LOC104705261 isoform X1 [Camelina 
sativa]
Length=1479

 Score =   337 bits (863),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 194/249 (78%), Gaps = 6/249 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPE---AQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDVK  171
             LVVEVP D +    S    P+   A   S GN        S ++ S   P       + K
Sbjct  1232  LVVEVPCDLVCSIQSPKDGPDCIAADQDSNGNTEMVGFEGSAAANS--LPTNTGILANAK  1289

Query  172   SVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYC  351
             SVRLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSSYC
Sbjct  1290  SVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSSYC  1349

Query  352   LVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGY  531
             LVLLITRFLQHEHH GRS  QN+G LLMDFLYFFGNVFDPRQMRVS+QGSG+Y NRERGY
Sbjct  1350  LVLLITRFLQHEHHLGRSINQNFGGLLMDFLYFFGNVFDPRQMRVSVQGSGIYRNRERGY  1409

Query  532   SIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKL  711
             SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+T + S+ DS  +     L
Sbjct  1410  SIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSSSDSCGKKLH-NL  1468

Query  712   LPKVIPSIM  738
             LPK+IPSI+
Sbjct  1469  LPKIIPSII  1477



>ref|XP_006396213.1| hypothetical protein EUTSA_v10029148mg [Eutrema salsugineum]
 gb|ESQ37666.1| hypothetical protein EUTSA_v10029148mg [Eutrema salsugineum]
Length=580

 Score =   320 bits (819),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 207/298 (69%), Gaps = 10/298 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FKI AYKSFSE+SP+ QF NFT+NQALLE+ +GF R+HIVDFDIGYG QWASLMQEL L 
Sbjct  286   FKIAAYKSFSEISPVLQFTNFTSNQALLESFQGFYRLHIVDFDIGYGGQWASLMQELVLR  345

Query  2428  ---NNGTTPSLKITALASPLKQE-QLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
                N G   SLKIT  ASP   + QLELG  + NL   ASEIN+  + + L  + L S S
Sbjct  346   DNNNKGPPLSLKITVFASPASHDDQLELGFTQDNLKHLASEINISLDIQVLSFDLLASVS  405

Query  2260  swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  EA +AVNL     S +    LPL+L FVK L P I+V  D GC+RTDLPFP  
Sbjct  406   WPHSSDKEA-VAVNLSAASFS-DMPSHLPLLLRFVKHLSPTIIVCSDRGCERTDLPFPQQ  463

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             ++H+LHS++ LLESLDAVN N DALQKIE+F+IQP IEK V+ R     P +     W+ 
Sbjct  464   LLHSLHSHAALLESLDAVNANLDALQKIERFLIQPEIEKLVSNR---SRPIERPMMTWQA  520

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             + L  GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  521   MLLQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  578



>ref|XP_004506480.1| PREDICTED: uncharacterized protein LOC101499411 isoform X1 [Cicer 
arietinum]
Length=1554

 Score =   335 bits (860),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 197/250 (79%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSS--HSQTPEA--QTISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP D IT S+   HS   E+   T   GN    D    E S   K  + N     V
Sbjct  1303  LVVEVPEDVITSSAPTLHSLKEESLCTTGEHGNDSHYDIIQLEDSALRKRSQTNFYAFKV  1362

Query  169   -KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFKS SHTGLQT+E+VKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1363  SKSVRVDISFKSSSHTGLQTTEMVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1422

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QNYGS+L+DFLYFFGNVFDPRQMR+S+QGSGLYI RER
Sbjct  1423  YCLVLLIIRFLQHEHHLGRPINQNYGSILVDFLYFFGNVFDPRQMRISVQGSGLYIKRER  1482

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AY  LE+E+ LL S+ +S +R PS 
Sbjct  1483  GCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYIVLENELALLNSDGESCSR-PSY  1541

Query  706   KLLPKVIPSI  735
             +LLPK+IPS+
Sbjct  1542  RLLPKIIPSL  1551



>ref|XP_010523084.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523085.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523086.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523087.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523088.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523089.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523090.1| PREDICTED: uncharacterized protein LOC104801481 isoform X1 [Tarenaya 
hassleriana]
Length=1484

 Score =   334 bits (857),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 199/250 (80%), Gaps = 8/250 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTIS-----EGNPFQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I+ ++S     + Q  +         ++  G    ++   +  + + S  +
Sbjct  1235  LVVEVPWDLISSTASGLSPKDGQICTIVDHDSNGQYEIVGFGDSATNCSQ--ENSGSCTN  1292

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVRLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSS
Sbjct  1293  AKSVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSS  1352

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMRVS+QGSG+Y +RER
Sbjct  1353  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRVSVQGSGVYRSRER  1412

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDP+FPTNNVGRNCFRIHQCIKAF++AYS LE+++T L S+ D S R PS 
Sbjct  1413  GYSIDPIHIDDPIFPTNNVGRNCFRIHQCIKAFSEAYSILENDLTCLASSTD-SCRKPSY  1471

Query  706   KLLPKVIPSI  735
             KLL K+IPS+
Sbjct  1472  KLLSKIIPSM  1481



>ref|XP_008437781.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103483113 
[Cucumis melo]
Length=1550

 Score =   335 bits (858),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 199/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQA----DGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT S+S+ Q+P+ ++ +           D  S E S  PK  ++N DS   
Sbjct  1299  LVVEVPHDLITSSTSNMQSPKEESSAVSGEQDTNNLNDMASLEDSILPKCLEVNYDSSIS  1358

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFK+PSHTGLQTSELVKELTEQFPA  PLALVLK+FLADRSLDQSYSGGLSS
Sbjct  1359  TKSVRIDISFKTPSHTGLQTSELVKELTEQFPATIPLALVLKKFLADRSLDQSYSGGLSS  1418

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+SIQGSG+YI RER
Sbjct  1419  YCLVLLIIRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISIQGSGVYIKRER  1478

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDP++IDDPLFP NNVGRNCFRIHQCIKAF++AYS +ES +  L  + D+S+   + 
Sbjct  1479  GYSIDPLHIDDPLFPMNNVGRNCFRIHQCIKAFSEAYSIMESVLISLHDHGDASSDATN-  1537

Query  706   KLLPKVIPSI  735
             ++L K+IPSI
Sbjct  1538  RMLQKIIPSI  1547



>ref|XP_010523091.1| PREDICTED: uncharacterized protein LOC104801481 isoform X2 [Tarenaya 
hassleriana]
Length=1460

 Score =   334 bits (856),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 199/250 (80%), Gaps = 8/250 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTIS-----EGNPFQADGTSSESSTSPKWPKMNDSGKD  165
             LVVEVP D I+ ++S     + Q  +         ++  G    ++   +  + + S  +
Sbjct  1211  LVVEVPWDLISSTASGLSPKDGQICTIVDHDSNGQYEIVGFGDSATNCSQ--ENSGSCTN  1268

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVRLDISFK+PSHTGLQT++LVK+LTEQFPAA PLALVLKQFLADR+LDQSYSGGLSS
Sbjct  1269  AKSVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYSGGLSS  1328

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMRVS+QGSG+Y +RER
Sbjct  1329  YCLVLLITRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRVSVQGSGVYRSRER  1388

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDPI+IDDP+FPTNNVGRNCFRIHQCIKAF++AYS LE+++T L S+ D S R PS 
Sbjct  1389  GYSIDPIHIDDPIFPTNNVGRNCFRIHQCIKAFSEAYSILENDLTCLASSTD-SCRKPSY  1447

Query  706   KLLPKVIPSI  735
             KLL K+IPS+
Sbjct  1448  KLLSKIIPSM  1457



>ref|XP_004134284.1| PREDICTED: uncharacterized protein LOC101221970 [Cucumis sativus]
Length=1526

 Score =   334 bits (856),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQA----DGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP + +T S+S+ Q+P+ ++ +      A    D  S E S  PK  ++N DS   
Sbjct  1275  LVVEVPHELVTSSTSNMQSPKEESSAVSGEQDANNLNDMASLEDSILPKCLEVNYDSSIS  1334

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFK+PSHTGLQTSELVKELTEQFPA  PLALVLK+FLADRSLDQSYSGGLSS
Sbjct  1335  TKSVRIDISFKTPSHTGLQTSELVKELTEQFPATIPLALVLKKFLADRSLDQSYSGGLSS  1394

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+SIQGSG+YI RER
Sbjct  1395  YCLVLLIIRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISIQGSGVYIKRER  1454

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDP++IDDPLFP NNVGRNCFRIHQCIKAF++AYS +ES +  L  + D+S+   + 
Sbjct  1455  GYSIDPLHIDDPLFPMNNVGRNCFRIHQCIKAFSEAYSIMESVLISLHDHGDASSDATN-  1513

Query  706   KLLPKVIPSI  735
             ++L K+IPSI
Sbjct  1514  RVLQKIIPSI  1523



>gb|KGN56351.1| hypothetical protein Csa_3G116880 [Cucumis sativus]
Length=1550

 Score =   334 bits (856),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQA----DGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP + +T S+S+ Q+P+ ++ +      A    D  S E S  PK  ++N DS   
Sbjct  1299  LVVEVPHELVTSSTSNMQSPKEESSAVSGEQDANNLNDMASLEDSILPKCLEVNYDSSIS  1358

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFK+PSHTGLQTSELVKELTEQFPA  PLALVLK+FLADRSLDQSYSGGLSS
Sbjct  1359  TKSVRIDISFKTPSHTGLQTSELVKELTEQFPATIPLALVLKKFLADRSLDQSYSGGLSS  1418

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+SIQGSG+YI RER
Sbjct  1419  YCLVLLIIRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISIQGSGVYIKRER  1478

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSL  705
             GYSIDP++IDDPLFP NNVGRNCFRIHQCIKAF++AYS +ES +  L  + D+S+   + 
Sbjct  1479  GYSIDPLHIDDPLFPMNNVGRNCFRIHQCIKAFSEAYSIMESVLISLHDHGDASSDATN-  1537

Query  706   KLLPKVIPSI  735
             ++L K+IPSI
Sbjct  1538  RVLQKIIPSI  1547



>ref|XP_009349306.1| PREDICTED: uncharacterized protein LOC103940849 isoform X1 [Pyrus 
x bretschneideri]
Length=1568

 Score =   331 bits (849),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 201/252 (80%), Gaps = 8/252 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI----SEGNPFQADGTSSESSTSPKWPKMNDSG-KD  165
             LVVEVP D I  S+S+ Q+P+ ++       G    +     E S  PK  ++ND   KD
Sbjct  1315  LVVEVPHDLIVSSASNVQSPKEESPPMSGEHGINVNSSVVVLEESVVPKCLQINDDATKD  1374

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVR+DISFKSPSHTGLQT++LVK+L EQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1375  SVSVRIDISFKSPSHTGLQTTQLVKDLAEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1434

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHE+H GR   QN+GSLLM+FLYFFGNVFDPRQMR+S+QGSG+YI RER
Sbjct  1435  YCLVLLITRFLQHEYHLGRPINQNFGSLLMNFLYFFGNVFDPRQMRISVQGSGVYIKRER  1494

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSN--DDSSARMP  699
             G SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++A+S LE+E+   P++  DD+ +R P
Sbjct  1495  GCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAHSILENELASFPNDGGDDACSR-P  1553

Query  700   SLKLLPKVIPSI  735
               +LL K+IPSI
Sbjct  1554  PYRLLWKIIPSI  1565



>ref|XP_010264405.1| PREDICTED: scarecrow-like protein 27 [Nelumbo nucifera]
Length=835

 Score =   321 bits (822),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 212/296 (72%), Gaps = 10/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KIGAYK+FSE+SP+ QFANFT NQALL+ L GFDRIHI+DFDIG G QW+S MQELA  
Sbjct  547   LKIGAYKAFSEISPLLQFANFTCNQALLDVLLGFDRIHIMDFDIGIGAQWSSFMQELASR  606

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                 PSLKITA AS    + LEL + R NL  FA+++ + FE + + ++  + +S     
Sbjct  607   G--APSLKITAFASQASHDALELVLTRENLTHFANDLGIAFELDIVNLDSFDPASWSLAQ  664

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                A   A+AVNLPVG  S+    S+P +L FVK+L PKIVVSVD GCDR+DLPF  H +
Sbjct  665   LHVAENEAVAVNLPVG-SSSAHPSSVPSLLRFVKQLSPKIVVSVDRGCDRSDLPFSHHFL  723

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL S+S LL+SLDAVN+N DA+ KIEKF++QP IE  V  R    +PEK     WR +F
Sbjct  724   HALQSFSVLLDSLDAVNVNSDAVHKIEKFLLQPRIESIVLGR--QRAPEKMPP--WRNLF  779

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P  F+NFAE+QAE ++KR  V GFHVEKRQ+SL+L WQR+EL+SASAW+C
Sbjct  780   ASAGFSPLPFTNFAETQAEYLVKRLQVRGFHVEKRQASLILYWQRRELVSASAWKC  835



>ref|XP_004506481.1| PREDICTED: uncharacterized protein LOC101499411 isoform X2 [Cicer 
arietinum]
Length=1526

 Score =   329 bits (843),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 168/246 (68%), Positives = 192/246 (78%), Gaps = 26/246 (11%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDV-KSV  177
             LVVEVP D IT     S  P   ++ E +                   +  +G+ V KSV
Sbjct  1303  LVVEVPEDVIT-----SSAPTLHSLKEES-------------------LCTTGEHVSKSV  1338

Query  178   RLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLV  357
             R+DISFKS SHTGLQT+E+VKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSSYCLV
Sbjct  1339  RVDISFKSSSHTGLQTTEMVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSSYCLV  1398

Query  358   LLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSI  537
             LLI RFLQHEHH GR   QNYGS+L+DFLYFFGNVFDPRQMR+S+QGSGLYI RERG SI
Sbjct  1399  LLIIRFLQHEHHLGRPINQNYGSILVDFLYFFGNVFDPRQMRISVQGSGLYIKRERGCSI  1458

Query  538   DPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLKLLP  717
             DPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AY  LE+E+ LL S+ +S +R PS +LLP
Sbjct  1459  DPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYIVLENELALLNSDGESCSR-PSYRLLP  1517

Query  718   KVIPSI  735
             K+IPS+
Sbjct  1518  KIIPSL  1523



>ref|XP_009375756.1| PREDICTED: uncharacterized protein LOC103964538 isoform X2 [Pyrus 
x bretschneideri]
Length=1568

 Score =   328 bits (842),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 200/252 (79%), Gaps = 8/252 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI----SEGNPFQADGTSSESSTSPKWPKMNDSG-KD  165
             LVVEVP D I  S+S+ Q+P+ ++       G    +     E S  PK  ++ND   KD
Sbjct  1315  LVVEVPHDLIVSSASNVQSPKEESPPMSGEHGINVNSSVVVLEESVVPKCLQINDDATKD  1374

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVR+DISFKSPSHTGLQT++LVK+L EQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1375  SVSVRIDISFKSPSHTGLQTTQLVKDLAEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1434

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLITRFLQHE+H GR   QN+GSLLM+FLYFFGNVFDPRQMR+S+QGSG+YI RER
Sbjct  1435  YCLVLLITRFLQHEYHLGRPINQNFGSLLMNFLYFFGNVFDPRQMRISVQGSGVYIKRER  1494

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSN--DDSSARMP  699
               SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++A+S LE+E+   P++  DD+ +R P
Sbjct  1495  XXSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAHSILENELASFPNDGGDDACSR-P  1553

Query  700   SLKLLPKVIPSI  735
               +LL K+IPSI
Sbjct  1554  PYRLLWKIIPSI  1565



>ref|XP_007134753.1| hypothetical protein PHAVU_010G072900g [Phaseolus vulgaris]
 gb|ESW06747.1| hypothetical protein PHAVU_010G072900g [Phaseolus vulgaris]
Length=724

 Score =   317 bits (812),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/295 (54%), Positives = 209/295 (71%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FKIGAYKSFSE+SP+ QF+NFT NQAL+EA+E  DRIH++DFDIG+G QW+S MQE+AL 
Sbjct  435   FKIGAYKSFSEISPVLQFSNFTCNQALIEAVERCDRIHVIDFDIGFGVQWSSFMQEIALR  494

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +   PSLK+TA+ SP   +++EL   + NL+Q+A +IN+ FEF  L +E L+SSSS    
Sbjct  495   STAAPSLKVTAIVSPSTCDEVELNFTKENLMQYAKDINVSFEFSVLNIESLHSSSSPLVG  554

Query  2245  y--SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
                   AIAVN+PV   + N  +  P  L FVK+L+PK+VV++D  CDR D+  P   +H
Sbjct  555   QFFDNEAIAVNMPVSSFTNNPSL-FPSALHFVKQLRPKVVVTLDRICDRIDVSLPTKAVH  613

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              L  YS LL+SLDAVN+N D LQKIE+  IQP ++K +     S    + +   WR + L
Sbjct  614   VLQCYSALLDSLDAVNVNLDVLQKIERHFIQPVMKKIILGHHHS----QEKLPPWRNLLL  669

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              SGF+P +FSNF E+QAEC+++R PV GFHVE++ SSLVLCWQRKELIS S WRC
Sbjct  670   QSGFSPSTFSNFTEAQAECLVQRAPVRGFHVERKPSSLVLCWQRKELISVSTWRC  724



>ref|XP_008794842.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103710741 
[Phoenix dactylifera]
Length=1596

 Score =   327 bits (838),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 197/256 (77%), Gaps = 9/256 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHS---QTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDV-  168
             LV +VP D I+LS+ +S   +TPEA +               SS +  WP  +   KDV 
Sbjct  1343  LVADVPHD-ISLSNDNSSIVETPEAHSTKMPGKQSIPCPDLSSSANTSWPMCSKMKKDVA  1401

Query  169   ---KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
                KS+RLDISFKSPSHTGL+TSELV+ELT+QFPAA PLAL+LK+FL+DRSLDQSYSG L
Sbjct  1402  VDEKSIRLDISFKSPSHTGLETSELVRELTQQFPAAGPLALILKKFLSDRSLDQSYSGAL  1461

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHE+H GR   QN GSLLMDFLYFFGNVFDPRQMR+SIQGSG+Y+NR
Sbjct  1462  SSYCLVLLIIRFLQHEYHIGRPINQNLGSLLMDFLYFFGNVFDPRQMRISIQGSGVYMNR  1521

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADAYS LE+EI+   S + +   M 
Sbjct  1522  ERGLSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAYSVLENEISQF-SGNCAPTSMG  1580

Query  700   SLKLLPKVIPSIMQLE  747
             + +LLPK+IPSI+  E
Sbjct  1581  TFRLLPKIIPSIVDEE  1596



>ref|XP_008796962.1| PREDICTED: uncharacterized protein LOC103712263 [Phoenix dactylifera]
Length=1558

 Score =   327 bits (837),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 202/256 (79%), Gaps = 9/256 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHS---QTPEA---QTISEGNPFQADGTSSESSTSPKWPKMN-DSG  159
             LV EV  D I LS+ +S   ++PEA   + + + +    D  SS++++ P   KM  D  
Sbjct  1305  LVAEVAHD-INLSNENSSIVESPEACSTKMLGKQSIPGPDLCSSDNTSWPMCSKMKKDDP  1363

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              DVKS+ LDISFKSPSHTGLQTSELV+ELT+QFPA+ PLAL+LK+FLADRSLD SYSGGL
Sbjct  1364  IDVKSIHLDISFKSPSHTGLQTSELVRELTQQFPASVPLALILKKFLADRSLDHSYSGGL  1423

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLITRFLQHEHH GR   QN GSLLMDFLYFFGNVFDPRQMR+SIQGSG+Y+NR
Sbjct  1424  SSYCLVLLITRFLQHEHHIGRPVNQNLGSLLMDFLYFFGNVFDPRQMRISIQGSGVYMNR  1483

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG SIDPIYIDDPL+P NNVGRNCFR+HQCIKAFADAYS LE+E++   S + +     
Sbjct  1484  ERGLSIDPIYIDDPLYPANNVGRNCFRVHQCIKAFADAYSVLENELSQF-SGNCAPTSTG  1542

Query  700   SLKLLPKVIPSIMQLE  747
             + ++LPK+IPSI + E
Sbjct  1543  TFRILPKIIPSIGREE  1558



>gb|KHG08006.1| DNA polymerase sigma [Gossypium arboreum]
Length=1576

 Score =   326 bits (835),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 178/211 (84%), Gaps = 5/211 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTI----SEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP D IT +SS+ Q+P  + I      G+   +D  + + S SPK  ++N  + K 
Sbjct  1295  LVVEVPGDLITSASSNVQSPTDEQIDRTAEHGDHAHSDTVALDDSASPKCSQINYGNTKG  1354

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
             VKSVRLDISFKSPSHTGLQT+ELVKELTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1355  VKSVRLDISFKSPSHTGLQTTELVKELTEQFPAATPLALVLKQFLADRSLDQSYSGGLSS  1414

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMRVS+QGSG+YINRER
Sbjct  1415  YCLVLLIIRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRVSVQGSGVYINRER  1474

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIK  618
             GYSIDPI+IDDPLFPTNNVGRNCFRIHQCIK
Sbjct  1475  GYSIDPIHIDDPLFPTNNVGRNCFRIHQCIK  1505



>ref|XP_010941141.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105059516 
[Elaeis guineensis]
Length=1596

 Score =   325 bits (832),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 198/256 (77%), Gaps = 17/256 (7%)
 Frame = +1

Query  1     LVVEVPRD---------FITLSSSHS-QTPEAQTISEGNPFQADGTSSESSTSPKWPKMN  150
             LV +VP D          +  S +HS + P  Q+I       AD ++SE+++ P   KM 
Sbjct  1343  LVADVPCDNSLSNEKSSIVDTSEAHSTKMPGKQSIP-----GADLSNSENTSWPMCSKMK  1397

Query  151   -DSGKDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSY  327
              D   DVKS+RLDISFKSPSHTGL+TS+LV+ELT+QFPAA PLAL+LK+FL+DRSLDQSY
Sbjct  1398  KDDAVDVKSIRLDISFKSPSHTGLETSQLVRELTQQFPAAGPLALILKKFLSDRSLDQSY  1457

Query  328   SGGLSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGL  507
             SGGLSSYCLVLLITRFLQHEHH G+   QN GSLLMDFLYFFGNVFDPRQMR SIQGSG+
Sbjct  1458  SGGLSSYCLVLLITRFLQHEHHIGQPVNQNLGSLLMDFLYFFGNVFDPRQMRTSIQGSGV  1517

Query  508   YINRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSS  687
             Y+NRERG SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADAYS LE+E++   S + + 
Sbjct  1518  YMNRERGLSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAYSVLENELSQF-SGNCAP  1576

Query  688   ARMPSLKLLPKVIPSI  735
                 + +LLPK+IPSI
Sbjct  1577  TSTGTFRLLPKIIPSI  1592



>ref|XP_010934990.1| PREDICTED: uncharacterized protein LOC105055002 [Elaeis guineensis]
Length=1598

 Score =   323 bits (827),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 198/256 (77%), Gaps = 9/256 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHS---QTPEAQTISEGNPFQADGTSSESSTSPKWP---KMN-DSG  159
             LV EVP D I LS+ +S   ++PEA ++         G    SS +  WP   KM  D  
Sbjct  1345  LVAEVPHD-INLSNENSSIVESPEAYSMKMPGGQSIPGPDQSSSDNTSWPMCSKMKKDEP  1403

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              D+KS+ LDISFKSPSHTGLQTSELV+EL++QFPA+ PLAL+LK+FLADRSLD SYSGGL
Sbjct  1404  IDMKSIHLDISFKSPSHTGLQTSELVRELSQQFPASVPLALILKKFLADRSLDHSYSGGL  1463

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH G+   QN GSLLMDFLYFFGNVFDPRQMR+SIQGSG+Y+NR
Sbjct  1464  SSYCLVLLIARFLQHEHHIGQPVNQNLGSLLMDFLYFFGNVFDPRQMRISIQGSGVYMNR  1523

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG SIDPI+IDDPL+P NNVGRNCFR+HQCIKAFADAYS LE+E++   S + +S    
Sbjct  1524  ERGLSIDPIHIDDPLYPANNVGRNCFRVHQCIKAFADAYSVLENELSQF-SGNCASTSTG  1582

Query  700   SLKLLPKVIPSIMQLE  747
             + K+L K++PSI + E
Sbjct  1583  TFKILQKIVPSIGREE  1598



>gb|EMT25920.1| PAP-associated domain-containing protein 5 [Aegilops tauschii]
Length=1459

 Score =   318 bits (815),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 191/251 (76%), Gaps = 9/251 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTIS------EGNPFQADGTSSESSTSPKWPKMN-DSG  159
             LV +VP D    +   S    +Q IS      +G+P ++D +SSE S +    KMN D  
Sbjct  1070  LVAQVPCDINMSNEYPSVLDSSQEISVNVLGEQGSPPRSDNSSSEGSNALAGSKMNKDDC  1129

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
               V+S+RLDISFKSPSHTGLQT+ELV ELT+QFPAA PLAL++K+FLADRSLD  YSGGL
Sbjct  1130  DAVRSIRLDISFKSPSHTGLQTTELVGELTQQFPAALPLALIMKKFLADRSLDHPYSGGL  1189

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLITRFLQHEHH GR   QN GSLLMDFLYFFGNVFDPR MR+SIQGSG+Y+NR
Sbjct  1190  SSYCLVLLITRFLQHEHHLGRPINQNLGSLLMDFLYFFGNVFDPRHMRISIQGSGIYLNR  1249

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E  LL    + +    
Sbjct  1250  ERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFAVLENE--LLQFTAECNVPAS  1307

Query  700   SLKLLPKVIPS  732
             S  LL K+IP+
Sbjct  1308  SFSLLKKIIPN  1318



>ref|XP_010240565.1| PREDICTED: uncharacterized protein LOC100844132 [Brachypodium 
distachyon]
Length=1515

 Score =   316 bits (809),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 191/252 (76%), Gaps = 9/252 (4%)
 Frame = +1

Query  1     LVVEVPRDF---ITLSS--SHSQTPEAQTISE-GNPFQADGTSSESSTSPKWPKMN-DSG  159
             LV +VP D    I  SS    SQ      ++E  +P ++D +SSE S +    KMN D  
Sbjct  1261  LVAQVPCDTNMSIEYSSVLDSSQDNSVNVLAEQASPPRSDNSSSEGSNTLMGSKMNKDDC  1320

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
               VKS+RLDISFKSPSHTGLQT+ELV ELT+QFPAA PLAL+LK+FLADRSLD  YSGGL
Sbjct  1321  DAVKSIRLDISFKSPSHTGLQTTELVCELTQQFPAALPLALILKKFLADRSLDHPYSGGL  1380

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GR   QN GSLLMDFLYFFGNVFDPR MR+SIQGSG+Y+NR
Sbjct  1381  SSYCLVLLIIRFLQHEHHLGRPMNQNLGSLLMDFLYFFGNVFDPRHMRISIQGSGIYLNR  1440

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E+   P  ++      
Sbjct  1441  ERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFAVLENELLQYP--EECCMPAS  1498

Query  700   SLKLLPKVIPSI  735
             S  LL K+IPSI
Sbjct  1499  SFGLLKKIIPSI  1510



>emb|CDY63061.1| BnaAnng18540D [Brassica napus]
Length=562

 Score =   300 bits (768),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 205/300 (68%), Gaps = 15/300 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HI+DFDIGYG  WASLMQEL L 
Sbjct  269   FKISAYKSFSEISPVLQFANFTSNQALLESFHGFTRLHIIDFDIGYGGHWASLMQELVLL  328

Query  2428  ---NNGTTPSLKITALASP-LKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
                N+    SLKIT  ASP   Q+QLEL   + NL  FASEIN+  + + +    L +S 
Sbjct  329   RVDNHAPPLSLKITVFASPDHHQQQLELAFTQDNLKHFASEINISLDIQ-VLSLDLLASL  387

Query  2260  swsdsySEAAIAVNL-PVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDT-GCDRTDLPFP  2087
             SW  S  E A+AVNL P  + +T       L+L FVK L P I+V  D  GC+RTDLPFP
Sbjct  388   SWPSSDKEEAVAVNLSPASFSNTPSS----LLLRFVKHLSPSIIVCSDRGGCERTDLPFP  443

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
               ++H+L S++ LLESLDAVN N DA+ KIE+F+IQP IEK V    D   P +     W
Sbjct  444   QQLLHSLQSHAALLESLDAVNANLDAMHKIERFLIQPEIEKLV---LDRSRPIQRPMMTW  500

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
               +F+  GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  501   HAMFMQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  560



>ref|XP_009111514.1| PREDICTED: scarecrow-like protein 6 [Brassica rapa]
Length=562

 Score =   300 bits (768),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 205/300 (68%), Gaps = 15/300 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HI+DFDIGYG  WASLMQEL L 
Sbjct  269   FKISAYKSFSEISPVLQFANFTSNQALLESFHGFTRLHIIDFDIGYGGHWASLMQELVLL  328

Query  2428  ---NNGTTPSLKITALASP-LKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
                N+    SLKIT  ASP   Q QLEL   + NL  FASEIN+  + + +    L +S 
Sbjct  329   RVDNHAPPLSLKITVFASPDHHQHQLELAFTQDNLKHFASEINISLDIQ-VLSLDLLASL  387

Query  2260  swsdsySEAAIAVNL-PVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDT-GCDRTDLPFP  2087
             SW  S  E A+AVNL P  + +T       L+L FVK L P I+V  D  GC+RTDLPFP
Sbjct  388   SWPSSDKEEAVAVNLSPASFSNTPSS----LLLRFVKHLSPSIIVCSDRGGCERTDLPFP  443

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
               ++H+L S++ LLESLDAVN N DA+ KIE+F+IQP IEK V    D   P +     W
Sbjct  444   QQLLHSLQSHAALLESLDAVNANLDAMHKIERFLIQPEIEKLV---LDRSRPIQRPMMTW  500

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             + +F+  GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  501   QAMFMQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  560



>emb|CDY63062.1| BnaAnng18550D [Brassica napus]
Length=562

 Score =   300 bits (767),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 204/300 (68%), Gaps = 15/300 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
             FKI AYKSFSE+SP+ QFANFT+NQALLE+  GF R+HI+DFDIGYG  WASLMQEL L 
Sbjct  269   FKISAYKSFSEISPVLQFANFTSNQALLESFHGFTRLHIIDFDIGYGGHWASLMQELVLL  328

Query  2428  ---NNGTTPSLKITALASP-LKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
                N+    SLKIT  ASP   Q QLEL   + NL  FASEIN+  + + +    L +S 
Sbjct  329   RVDNHAPPLSLKITVFASPDHHQHQLELAFTQDNLKHFASEINISLDIQ-VLSLDLLASL  387

Query  2260  swsdsySEAAIAVNL-PVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDT-GCDRTDLPFP  2087
             SW  S  E A+AVNL P  + +T       L+L FVK L P I+V  D  GC+RTDLPFP
Sbjct  388   SWPSSDKEEAVAVNLSPASFSNTPSS----LLLRFVKHLSPSIIVCSDRGGCERTDLPFP  443

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
               ++H+L S++ LLESLDAVN N DA+ KIE+F+IQP IEK V    D   P +     W
Sbjct  444   QQLLHSLQSHAALLESLDAVNANLDAMHKIERFLIQPEIEKLV---LDRSRPIQRPMMTW  500

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
               +F+  GF+P + SNF ESQAEC+++RTPV GFHVEK+ +SL+LCWQR EL+  SAWRC
Sbjct  501   HAMFMQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRC  560



>ref|XP_006656355.1| PREDICTED: uncharacterized protein LOC102706205 isoform X1 [Oryza 
brachyantha]
 ref|XP_006656356.1| PREDICTED: uncharacterized protein LOC102706205 isoform X2 [Oryza 
brachyantha]
Length=1188

 Score =   312 bits (799),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 199/254 (78%), Gaps = 12/254 (5%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQ----TPEAQTIS----EGNPFQADGTSSESSTSPKWPKMN-D  153
             LV +VP D   LSS +S     +P+  +I+    +G+P ++D +SSE S+ P   + N D
Sbjct  933   LVAQVPCD-TNLSSEYSSVLDSSPDQLSINVLGDQGSPPRSDNSSSEGSSMPLCSRANKD  991

Query  154   SGKDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSG  333
              G  V+S+RLDISFKSPSHTGLQT+ELV+ELT+QFPAA PLAL+LK+FLADRSLD  YSG
Sbjct  992   DGNVVQSIRLDISFKSPSHTGLQTTELVRELTQQFPAAVPLALILKKFLADRSLDHPYSG  1051

Query  334   GLSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYI  513
             GLSSYCLVLLI RFLQHEHH GR   QN GSLLMDFLYFFGNVFDPR MR+SIQGSG+Y+
Sbjct  1052  GLSSYCLVLLIVRFLQHEHHLGRPINQNLGSLLMDFLYFFGNVFDPRHMRISIQGSGIYL  1111

Query  514   NRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSAR  693
             NRERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E+    +  D+ A 
Sbjct  1112  NRERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFTVLENELLQFSAESDTPAS  1171

Query  694   MPSLKLLPKVIPSI  735
               S  LL K++PSI
Sbjct  1172  --SFNLLKKIMPSI  1183



>gb|EMS55426.1| PAP-associated domain-containing protein 5 [Triticum urartu]
Length=1626

 Score =   313 bits (802),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 180/226 (80%), Gaps = 7/226 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTIS------EGNPFQADGTSSESSTSPKWPKMN-DSG  159
             LV +VP D    +   S    +Q IS      +G+P ++D +SSE S +    KMN D  
Sbjct  1173  LVAQVPCDINMSNEYPSVLDSSQEISVNVLGEQGSPPRSDNSSSEGSNALAGSKMNKDDC  1232

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
               V+S+RLDISFKSPSHTGLQT+ELV ELT+QFPAA PLAL++K+FLADRSLD  YSGGL
Sbjct  1233  DAVRSIRLDISFKSPSHTGLQTTELVGELTQQFPAALPLALIMKKFLADRSLDHPYSGGL  1292

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLITRFLQHEHH GR   QN GSLLMDFLYFFGNVFDPR MR+SIQGSG+Y+NR
Sbjct  1293  SSYCLVLLITRFLQHEHHLGRPINQNLGSLLMDFLYFFGNVFDPRHMRISIQGSGIYLNR  1352

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEI  657
             ERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E+
Sbjct  1353  ERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFAVLENEL  1398



>ref|XP_010695124.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=836

 Score =   305 bits (781),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 204/295 (69%), Gaps = 8/295 (3%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+ AYK FSEVSP+ QF NFT+ QA+LEAL+  D IHI+DFDIG G QWAS +QEL L  
Sbjct  547   KMNAYKVFSEVSPITQFVNFTSTQAILEALDDADAIHIIDFDIGCGAQWASFIQELPLRK  606

Query  2422  GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws---  2252
                PSLKITALA        ELG+IR NL+QFA++I + FE + + ++  + S       
Sbjct  607   RGAPSLKITALAPLSVTNPFELGLIRENLVQFANDIGLAFELQVVNLDMFDPSLCSMPNF  666

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +  + AIAV++P+ W S+N+   L  +L F+K+  PKIVVS+D G DR+D+PFP H++H
Sbjct  667   RASEDEAIAVSIPI-WCSSNRPSILAPLLQFIKQQSPKIVVSLDRGFDRSDVPFPQHLVH  725

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              + S +N LESLD +N+  D + K+EKF +QP IE TV  R     PEK    HW+ +F 
Sbjct  726   TVDSCTNFLESLDGLNVASDIVNKVEKFFVQPMIENTVMGRV--QFPEK--MPHWKNLFA  781

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             S+G +P  FSNF E+QA+ V+KRTP  GFHVEKRQSSLVL WQR+EL++ASAWRC
Sbjct  782   SAGLSPVQFSNFTETQADYVVKRTPGRGFHVEKRQSSLVLSWQRRELVAASAWRC  836



>ref|XP_010695123.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=846

 Score =   305 bits (781),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 204/295 (69%), Gaps = 8/295 (3%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+ AYK FSEVSP+ QF NFT+ QA+LEAL+  D IHI+DFDIG G QWAS +QEL L  
Sbjct  557   KMNAYKVFSEVSPITQFVNFTSTQAILEALDDADAIHIIDFDIGCGAQWASFIQELPLRK  616

Query  2422  GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssws---  2252
                PSLKITALA        ELG+IR NL+QFA++I + FE + + ++  + S       
Sbjct  617   RGAPSLKITALAPLSVTNPFELGLIRENLVQFANDIGLAFELQVVNLDMFDPSLCSMPNF  676

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              +  + AIAV++P+ W S+N+   L  +L F+K+  PKIVVS+D G DR+D+PFP H++H
Sbjct  677   RASEDEAIAVSIPI-WCSSNRPSILAPLLQFIKQQSPKIVVSLDRGFDRSDVPFPQHLVH  735

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
              + S +N LESLD +N+  D + K+EKF +QP IE TV  R     PEK    HW+ +F 
Sbjct  736   TVDSCTNFLESLDGLNVASDIVNKVEKFFVQPMIENTVMGRV--QFPEK--MPHWKNLFA  791

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             S+G +P  FSNF E+QA+ V+KRTP  GFHVEKRQSSLVL WQR+EL++ASAWRC
Sbjct  792   SAGLSPVQFSNFTETQADYVVKRTPGRGFHVEKRQSSLVLSWQRRELVAASAWRC  846



>ref|XP_004966312.1| PREDICTED: uncharacterized protein LOC101773929 isoform X1 [Setaria 
italica]
Length=1620

 Score =   312 bits (799),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 190/252 (75%), Gaps = 9/252 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTIS------EGNPFQADGTSSESSTSPKWPKMNDSGK  162
             LV +VP D    +   S    +Q  S      +G+P ++D +SSE S      K+N    
Sbjct  1366  LVADVPCDTNMFNEYSSVLDSSQEYSVNVLGEQGSPPRSDTSSSEGSNMLVSSKLNKDDC  1425

Query  163   D-VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
             D V+S+RLDISFKSPSHTGLQT+ELV+ELT+QFPA  PLAL+LK+FLADRSLD  YSGGL
Sbjct  1426  DIVQSIRLDISFKSPSHTGLQTTELVRELTQQFPAVVPLALILKKFLADRSLDHPYSGGL  1485

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GR   QN GSLLMDFLYFFGN+FDPR MR+SIQGSG+Y+NR
Sbjct  1486  SSYCLVLLIVRFLQHEHHLGRPINQNLGSLLMDFLYFFGNIFDPRHMRISIQGSGIYLNR  1545

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E  LL  + + S    
Sbjct  1546  ERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFAVLENE--LLQFSSECSMPES  1603

Query  700   SLKLLPKVIPSI  735
             S  +L K+IPSI
Sbjct  1604  SFNILKKIIPSI  1615



>ref|XP_002438829.1| hypothetical protein SORBIDRAFT_10g026810 [Sorghum bicolor]
 gb|EER90196.1| hypothetical protein SORBIDRAFT_10g026810 [Sorghum bicolor]
Length=1031

 Score =   307 bits (787),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +1

Query  79    EGNPFQADGTSSESSTSPKWPKMNDSGKD-VKSVRLDISFKSPSHTGLQTSELVKELTEQ  255
             +G+P ++D +SSE S      K+N    D V+S+RLDISFKS SHTGLQT+ELV+ELT+Q
Sbjct  809   QGSPPRSDTSSSEGSNMLVCSKLNKDDCDIVQSIRLDISFKSSSHTGLQTTELVRELTQQ  868

Query  256   FPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLM  435
             FPA  PLAL+LK+FLADRSLD  YSGGLSSYCLVLLI RFLQHEHH GR   QN GSLLM
Sbjct  869   FPAVVPLALILKKFLADRSLDHPYSGGLSSYCLVLLIVRFLQHEHHLGRPINQNLGSLLM  928

Query  436   DFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCI  615
             DFLYFFGN+FDPR MR+SIQGSG+Y+NRERG+SIDPI+IDDPL P NNVGRNCFRIHQCI
Sbjct  929   DFLYFFGNIFDPRHMRISIQGSGIYLNRERGHSIDPIHIDDPLCPANNVGRNCFRIHQCI  988

Query  616   KAFADAYSTLESEITLLPSNDDSSARMPSLKLLPKVIPSI  735
             KAFADA++ LE+E  LL  + + S    +  +L K+IPSI
Sbjct  989   KAFADAFAVLENE--LLQFSSECSMPASAFNILKKIIPSI  1026



>ref|XP_009418194.1| PREDICTED: scarecrow-like protein 6 [Musa acuminata subsp. malaccensis]
Length=726

 Score =   300 bits (768),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 200/299 (67%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
              K+GAYK+FS+VSP+ QFA+FT  Q LLEAL+G  RIHI+DFDIG G QW++ MQELA  
Sbjct  436   LKLGAYKTFSDVSPIVQFASFTCIQPLLEALDGASRIHIIDFDIGVGMQWSAFMQELAQR  495

Query  2428  ---NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss  2258
                +  T P LKITA AS      LEL +I  NL  FAS +N+ FEF  L ++  + +  
Sbjct  496   WSSSMATAPFLKITAFASAYSHHSLELNLIHQNLSHFASSLNIPFEFNVLSLDPFDPTVL  555

Query  2257  -wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  + A+AVNLP+G   +  +  +P +L FVK+L PKIVVSVD GCDR DLPF  H
Sbjct  556   FRMCSAMDEAVAVNLPIG---SAIRPPIPTLLRFVKQLSPKIVVSVDYGCDRIDLPFAHH  612

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD-SDSPEKTQTQHWR  1904
             I+HA  S + LL+S+DA   N DA  KIE+F+++P IE  V  R   SD     +T  WR
Sbjct  613   ILHAFQSCTVLLDSIDAAGANQDAANKIERFLVRPRIESAVLGRHHLSD-----KTLPWR  667

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             T+F S+GF    FSNF E+QAEC+LKR  V GFHVEKRQSSL LCWQR EL+S SAW+C
Sbjct  668   TLFASAGFMHVQFSNFTETQAECLLKRVLVRGFHVEKRQSSLSLCWQRGELVSVSAWKC  726



>ref|XP_004155262.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221970 
[Cucumis sativus]
Length=1514

 Score =   309 bits (792),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQA----DGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVP + +T S+S+ Q+P+ ++ +      A    D  S E S  PK  ++N DS   
Sbjct  1276  LVVEVPHELVTSSTSNMQSPKEESSAVSGEQDANNLNDMASLEDSILPKCLEVNYDSSIS  1335

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
              KSVR+DISFK+PSHTGLQTSELVKELTEQFPA  PLALVLK+FLADRSLDQSYSGGLSS
Sbjct  1336  TKSVRIDISFKTPSHTGLQTSELVKELTEQFPATIPLALVLKKFLADRSLDQSYSGGLSS  1395

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRER  525
             YCLVLLI RFLQHEHH GR   QN+GSLLMDFLYFFGNVFDPRQMR+SIQGSG+YI RER
Sbjct  1396  YCLVLLIIRFLQHEHHLGRPINQNFGSLLMDFLYFFGNVFDPRQMRISIQGSGVYIKRER  1455

Query  526   GYSIDPIYIDDPLFPTNNVGRNCFRIHQCIK  618
             GYSIDP++IDDPLFP NNVGRNCFRIHQCIK
Sbjct  1456  GYSIDPLHIDDPLFPMNNVGRNCFRIHQCIK  1486



>ref|XP_008796953.1| PREDICTED: scarecrow-like protein 6 [Phoenix dactylifera]
Length=655

 Score =   296 bits (759),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 200/300 (67%), Gaps = 14/300 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+G  K+FS+VSP+ QF NFT+ QALLE LE   RIH+VDFDIG G QW++ MQELA  
Sbjct  363   LKLGTVKAFSDVSPVLQFTNFTSVQALLEELEAAPRIHVVDFDIGVGGQWSAFMQELAQR  422

Query  2425  NGT-----TPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
               T     +PSLKITA ASP     LEL + R NL  FA+++N+ FEF  L ++  + S 
Sbjct  423   RCTAAGAASPSLKITAFASPCSHHPLELHLTRENLAHFAADLNIPFEFNLLSLDPFDPSL  482

Query  2260  swsdsyS--EAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFP  2087
               S S +  + AIAVN+PVG   +     +P +L  VK+L PKIV+SVD G DR+DLPFP
Sbjct  483   LLSLSSASADEAIAVNIPVG---SAVHPPVPTLLRLVKQLSPKIVISVDHGGDRSDLPFP  539

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
              H  HA  SY+ LL+S+DA   N ++  KIE+F++QP IE  V  R  +      +   W
Sbjct  540   QHFWHAFQSYTVLLDSIDAAGTNLESANKIERFLVQPRIENAVLGRHRN----ADKLLPW  595

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             RT+F S+GF P  FSNFAE+QAEC+LKR  V GFHVEKRQ+SL LCWQR EL+S SAWRC
Sbjct  596   RTLFPSAGFVPVQFSNFAETQAECLLKRVQVRGFHVEKRQASLSLCWQRMELVSVSAWRC  655



>ref|XP_008648965.1| PREDICTED: uncharacterized protein LOC100278145 isoform X5 [Zea 
mays]
 ref|XP_008648966.1| PREDICTED: uncharacterized protein LOC100278145 isoform X5 [Zea 
mays]
Length=1269

 Score =   306 bits (784),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +1

Query  79    EGNPFQADGTSSESSTSPKWPKMNDSGKD-VKSVRLDISFKSPSHTGLQTSELVKELTEQ  255
             +G+P ++D +SSE S      K+N    D V+S+RLDISFKSPSHTGLQT+ELV+EL++Q
Sbjct  1047  QGSPPRSDTSSSEGSNMLMCSKLNKDDCDIVQSIRLDISFKSPSHTGLQTTELVRELSQQ  1106

Query  256   FPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLM  435
             FPA  PLAL+LK+FLADRSLD  YSGGLSSYCLVLLI RFLQHEHH GR   +N GSLLM
Sbjct  1107  FPAVIPLALILKKFLADRSLDHPYSGGLSSYCLVLLIVRFLQHEHHLGRPINKNLGSLLM  1166

Query  436   DFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCI  615
             DFLYFFGN+FDPR MR+SIQGSG+Y+NRERG SIDPI+IDDP  P NNVGRNCFRIHQCI
Sbjct  1167  DFLYFFGNIFDPRHMRISIQGSGIYLNRERGQSIDPIHIDDPHCPANNVGRNCFRIHQCI  1226

Query  616   KAFADAYSTLESEITLLPSNDDSSARMPSLKLLPKVIPSI  735
             KAFADA++ LE+E  LL  + + S  + S  +L K+IPSI
Sbjct  1227  KAFADAFAVLENE--LLQFSSECSMPVSSFNILKKIIPSI  1264



>ref|XP_009392804.1| PREDICTED: uncharacterized protein LOC103978659 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1515

 Score =   308 bits (788),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 188/256 (73%), Gaps = 9/256 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLS---SSHSQTPEA-QTISEGNPFQADGTSSESSTSPKWP--KMN-DSG  159
             LV EVP D I +S   SS    P A  ++  G       T   SS    WP  KM  D  
Sbjct  1262  LVAEVPDD-IDISRKKSSMVDIPRALSSMVPGRQCNIPTTDLSSSDCTSWPYSKMKKDDN  1320

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              DVKS+RLDISFKS SHTGLQTSELV+ELT+QFPA+ PLALVLK+FLADRSLD +YSGGL
Sbjct  1321  IDVKSIRLDISFKSASHTGLQTSELVRELTQQFPASVPLALVLKKFLADRSLDHAYSGGL  1380

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GR   QN G LLMDFLYFFG +F+PR MRVSIQGSG+Y+NR
Sbjct  1381  SSYCLVLLIIRFLQHEHHVGRPNNQNLGGLLMDFLYFFGYIFEPRHMRVSIQGSGIYMNR  1440

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG SIDPI+IDDPL+PTNNVGRNCFRIHQCIKAFADAYS LE+E+     N   S+   
Sbjct  1441  ERGLSIDPIHIDDPLYPTNNVGRNCFRIHQCIKAFADAYSVLENELPHFSGNSVPSS-TG  1499

Query  700   SLKLLPKVIPSIMQLE  747
               +LL K+I +I  +E
Sbjct  1500  KFRLLQKIISNIDCVE  1515



>ref|XP_009392798.1| PREDICTED: uncharacterized protein LOC103978659 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392799.1| PREDICTED: uncharacterized protein LOC103978659 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392800.1| PREDICTED: uncharacterized protein LOC103978659 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392801.1| PREDICTED: uncharacterized protein LOC103978659 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392802.1| PREDICTED: uncharacterized protein LOC103978659 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1608

 Score =   307 bits (787),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 188/256 (73%), Gaps = 9/256 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLS---SSHSQTPEA-QTISEGNPFQADGTSSESSTSPKWP--KMN-DSG  159
             LV EVP D I +S   SS    P A  ++  G       T   SS    WP  KM  D  
Sbjct  1355  LVAEVPDD-IDISRKKSSMVDIPRALSSMVPGRQCNIPTTDLSSSDCTSWPYSKMKKDDN  1413

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              DVKS+RLDISFKS SHTGLQTSELV+ELT+QFPA+ PLALVLK+FLADRSLD +YSGGL
Sbjct  1414  IDVKSIRLDISFKSASHTGLQTSELVRELTQQFPASVPLALVLKKFLADRSLDHAYSGGL  1473

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GR   QN G LLMDFLYFFG +F+PR MRVSIQGSG+Y+NR
Sbjct  1474  SSYCLVLLIIRFLQHEHHVGRPNNQNLGGLLMDFLYFFGYIFEPRHMRVSIQGSGIYMNR  1533

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
             ERG SIDPI+IDDPL+PTNNVGRNCFRIHQCIKAFADAYS LE+E+     N   S+   
Sbjct  1534  ERGLSIDPIHIDDPLYPTNNVGRNCFRIHQCIKAFADAYSVLENELPHFSGNSVPSS-TG  1592

Query  700   SLKLLPKVIPSIMQLE  747
               +LL K+I +I  +E
Sbjct  1593  KFRLLQKIISNIDCVE  1608



>gb|EEC81146.1| hypothetical protein OsI_24054 [Oryza sativa Indica Group]
Length=1254

 Score =   305 bits (781),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 193/253 (76%), Gaps = 10/253 (4%)
 Frame = +1

Query  1     LVVEVPRDF-------ITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMN-DS  156
             LV +VP D          L SSH Q        +G+P ++D +SSE S+ P   ++N D 
Sbjct  999   LVAQVPCDTNLSSEYSSVLDSSHEQLSINVLGDQGSPSRSDNSSSEGSSMPMCSRINKDD  1058

Query  157   GKDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGG  336
             G  V+S+RLDISFKSPSHTGLQT+ELV ELT+QFPAA PLAL+LK+FLADRSLD  YSGG
Sbjct  1059  GNVVQSIRLDISFKSPSHTGLQTTELVCELTQQFPAAVPLALILKKFLADRSLDHPYSGG  1118

Query  337   LSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYIN  516
             LSSYCLVLLI RFLQHEHH GR   QN GSLLMDFLYFFGNVFDPR MR+SIQGSG+Y+N
Sbjct  1119  LSSYCLVLLIVRFLQHEHHLGRPINQNLGSLLMDFLYFFGNVFDPRHMRISIQGSGIYLN  1178

Query  517   RERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARM  696
             RERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E  LL  + +    +
Sbjct  1179  RERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFTVLENE--LLQFSAECYTPV  1236

Query  697   PSLKLLPKVIPSI  735
              S  LL K++PSI
Sbjct  1237  SSFNLLKKIMPSI  1249



>ref|XP_008648961.1| PREDICTED: uncharacterized protein LOC100278145 isoform X1 [Zea 
mays]
Length=1563

 Score =   306 bits (785),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +1

Query  79    EGNPFQADGTSSESSTSPKWPKMNDSGKD-VKSVRLDISFKSPSHTGLQTSELVKELTEQ  255
             +G+P ++D +SSE S      K+N    D V+S+RLDISFKSPSHTGLQT+ELV+EL++Q
Sbjct  1341  QGSPPRSDTSSSEGSNMLMCSKLNKDDCDIVQSIRLDISFKSPSHTGLQTTELVRELSQQ  1400

Query  256   FPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLM  435
             FPA  PLAL+LK+FLADRSLD  YSGGLSSYCLVLLI RFLQHEHH GR   +N GSLLM
Sbjct  1401  FPAVIPLALILKKFLADRSLDHPYSGGLSSYCLVLLIVRFLQHEHHLGRPINKNLGSLLM  1460

Query  436   DFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCI  615
             DFLYFFGN+FDPR MR+SIQGSG+Y+NRERG SIDPI+IDDP  P NNVGRNCFRIHQCI
Sbjct  1461  DFLYFFGNIFDPRHMRISIQGSGIYLNRERGQSIDPIHIDDPHCPANNVGRNCFRIHQCI  1520

Query  616   KAFADAYSTLESEITLLPSNDDSSARMPSLKLLPKVIPSI  735
             KAFADA++ LE+E  LL  + + S  + S  +L K+IPSI
Sbjct  1521  KAFADAFAVLENE--LLQFSSECSMPVSSFNILKKIIPSI  1558



>ref|XP_008648962.1| PREDICTED: uncharacterized protein LOC100278145 isoform X2 [Zea 
mays]
Length=1558

 Score =   306 bits (785),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +1

Query  79    EGNPFQADGTSSESSTSPKWPKMNDSGKD-VKSVRLDISFKSPSHTGLQTSELVKELTEQ  255
             +G+P ++D +SSE S      K+N    D V+S+RLDISFKSPSHTGLQT+ELV+EL++Q
Sbjct  1336  QGSPPRSDTSSSEGSNMLMCSKLNKDDCDIVQSIRLDISFKSPSHTGLQTTELVRELSQQ  1395

Query  256   FPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLM  435
             FPA  PLAL+LK+FLADRSLD  YSGGLSSYCLVLLI RFLQHEHH GR   +N GSLLM
Sbjct  1396  FPAVIPLALILKKFLADRSLDHPYSGGLSSYCLVLLIVRFLQHEHHLGRPINKNLGSLLM  1455

Query  436   DFLYFFGNVFDPRQMRVSIQGSGLYINRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCI  615
             DFLYFFGN+FDPR MR+SIQGSG+Y+NRERG SIDPI+IDDP  P NNVGRNCFRIHQCI
Sbjct  1456  DFLYFFGNIFDPRHMRISIQGSGIYLNRERGQSIDPIHIDDPHCPANNVGRNCFRIHQCI  1515

Query  616   KAFADAYSTLESEITLLPSNDDSSARMPSLKLLPKVIPSI  735
             KAFADA++ LE+E  LL  + + S  + S  +L K+IPSI
Sbjct  1516  KAFADAFAVLENE--LLQFSSECSMPVSSFNILKKIIPSI  1553



>gb|EEE66190.1| hypothetical protein OsJ_22308 [Oryza sativa Japonica Group]
Length=1486

 Score =   305 bits (781),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 193/253 (76%), Gaps = 10/253 (4%)
 Frame = +1

Query  1     LVVEVPRDF-------ITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMN-DS  156
             LV +VP D          L SSH Q        +G+P ++D +SSE S+ P   ++N D 
Sbjct  1231  LVAQVPCDTNLSSEYSSVLDSSHEQLSINVLGDQGSPSRSDNSSSEGSSMPMCSRINKDD  1290

Query  157   GKDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGG  336
             G  V+S+RLDISFKSPSHTGLQT+ELV ELT+QFPAA PLAL+LK+FLADRSLD  YSGG
Sbjct  1291  GNVVQSIRLDISFKSPSHTGLQTTELVCELTQQFPAAVPLALILKKFLADRSLDHPYSGG  1350

Query  337   LSSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYIN  516
             LSSYCLVLLI RFLQHEHH GR   QN GSLLMDFLYFFGNVFDPR MR+SIQGSG+Y+N
Sbjct  1351  LSSYCLVLLIVRFLQHEHHLGRPINQNLGSLLMDFLYFFGNVFDPRHMRISIQGSGIYLN  1410

Query  517   RERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARM  696
             RERG+SIDPI+IDDPL P NNVGRNCFRIHQCIKAFADA++ LE+E  LL  + +    +
Sbjct  1411  RERGHSIDPIHIDDPLCPANNVGRNCFRIHQCIKAFADAFTVLENE--LLQFSAECYTPV  1468

Query  697   PSLKLLPKVIPSI  735
              S  LL K++PSI
Sbjct  1469  SSFNLLKKIMPSI  1481



>gb|AFV91191.1| GRAS family transcription regulator [Capsicum annuum]
Length=693

 Score =   294 bits (752),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 203/296 (69%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYKSFSE+SP+ QF NFT+NQA+LEAL   ++IHI+DFDIG+G QW+S MQEL  +
Sbjct  403   LKMDAYKSFSEISPLIQFMNFTSNQAILEALGDAEQIHIIDFDIGFGAQWSSFMQELPSS  462

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             +     LKITA ASP     +E+GI+  +L QFA++  M FE E + ++  +  S    S
Sbjct  463   SRKATYLKITAFASPSTHHSVEIGIMHESLTQFANDAGMRFELEVINLDSFDPKSYPLSS  522

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +++L PK+VVS++ GC+RT+LP   H++
Sbjct  523   LRSSECEAIAINFPI-WSISSLPFAFPSLLHCMRQLSPKVVVSLECGCERTELPLKHHLL  581

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ ++QP IE  +  R    SP++     WR +F
Sbjct  582   HALQYYETLLASIDAANLTPDIAKKIERSLLQPSIENMILGRL--RSPDRMPP--WRNLF  637

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAECV+KRT VGGFHVEKRQ+SLVLCW+++EL+SA+ WRC
Sbjct  638   TSAGFSPIAFSNMTEVQAECVVKRTHVGGFHVEKRQTSLVLCWKQQELLSAATWRC  693



>ref|XP_006355471.1| PREDICTED: scarecrow-like protein 22-like [Solanum tuberosum]
Length=700

 Score =   292 bits (748),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 202/296 (68%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSE+SP+ QF NFT+NQA+LEAL   ++IHI+DFDIG+G QW+S MQEL  +
Sbjct  410   LKMDAYKAFSEISPLIQFMNFTSNQAILEALGDAEQIHIIDFDIGFGAQWSSFMQELPSS  469

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA ASP     +E+GI+  +L QFA++  + FE E + ++  +  S    +
Sbjct  470   NRKATSLKITAFASPSTHHSVEIGIMHESLTQFANDAGIRFELEVINLDSFDPKSYPLST  529

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H+I
Sbjct  530   LRSSECEAIAINFPI-WSISSCLFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLI  588

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ + QP IE  +  R    SP++     WR +F
Sbjct  589   HALQYYETLLASIDAANLTPDIGKKIERSLFQPSIENMILGRL--RSPDRMPP--WRNLF  644

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAECV+KRT VGGFHV+KRQ+SLVLCW+++EL+SA  WRC
Sbjct  645   ASAGFSPVAFSNMTEIQAECVVKRTQVGGFHVQKRQTSLVLCWKQQELLSAVTWRC  700



>gb|AAM90848.1|AF481952_1 hairy meristem [Petunia x hybrida]
Length=721

 Score =   293 bits (749),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 202/296 (68%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYKSFSEVSP+ QF NFT+NQA+LEAL   +RIHI+DFDIG+G QW+S MQEL  +
Sbjct  431   LKMDAYKSFSEVSPLIQFMNFTSNQAILEALGDVERIHIIDFDIGFGAQWSSFMQELPSS  490

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA ASP     +E+ I+  +L QFA++  + FE E + ++  +  S    S
Sbjct  491   NRKATSLKITAFASPSTHHSVEIAIMHESLTQFANDAGIRFELEVINLDTFDPKSYPLSS  550

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L ++K+L PKI+VS++ GC+RT+LP   H++
Sbjct  551   LRSSDCEAIAINFPI-WSISSCLFAFPSLLHYMKQLSPKIIVSLERGCERTELPLKHHLL  609

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ P+  +KIEK ++ P IE  V  R    SP++     WR +F
Sbjct  610   HALQYYEILLASIDAANVTPEIGKKIEKSLLLPSIENMVLGRL--RSPDR--MPQWRNLF  665

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAECV+KRT VGGFHVEKRQSSLVLCW+++EL+SA  WRC
Sbjct  666   ASAGFSPVAFSNLTEIQAECVVKRTQVGGFHVEKRQSSLVLCWKQQELLSALTWRC  721



>ref|XP_004245757.1| PREDICTED: scarecrow-like protein 22 isoform X2 [Solanum lycopersicum]
Length=701

 Score =   292 bits (747),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 200/296 (68%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSE+SP+ QF NFT+NQA+LEAL   ++IHI+DFDIG+G QW+S MQEL  +
Sbjct  411   LKMDAYKAFSEISPLIQFMNFTSNQAILEALGDAEQIHIIDFDIGFGAQWSSFMQELPSS  470

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA ASP     +E+GI+  +L QFA++  + FE E + ++  +  S    +
Sbjct  471   NRKATSLKITAFASPSTHHSIEIGIMHESLTQFANDAGIRFELEVINLDSFDPKSYPLST  530

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H+I
Sbjct  531   LRSSECEAIAINFPI-WSISSCPFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLI  589

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ + QP IE  +  R  S      +   WR +F
Sbjct  590   HALQYYETLLASIDAANITPDIGKKIERSLFQPSIENMILGRLRSSD----RMPPWRNLF  645

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAECV+KRT VGGFHV+KRQ+SLVLCW+++EL+SA  WRC
Sbjct  646   ASAGFSPVAFSNMTEIQAECVVKRTQVGGFHVQKRQTSLVLCWKQQELLSAVTWRC  701



>ref|XP_004245756.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Solanum lycopersicum]
Length=745

 Score =   293 bits (749),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 200/296 (68%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSE+SP+ QF NFT+NQA+LEAL   ++IHI+DFDIG+G QW+S MQEL  +
Sbjct  455   LKMDAYKAFSEISPLIQFMNFTSNQAILEALGDAEQIHIIDFDIGFGAQWSSFMQELPSS  514

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA ASP     +E+GI+  +L QFA++  + FE E + ++  +  S    +
Sbjct  515   NRKATSLKITAFASPSTHHSIEIGIMHESLTQFANDAGIRFELEVINLDSFDPKSYPLST  574

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H+I
Sbjct  575   LRSSECEAIAINFPI-WSISSCPFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLI  633

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ + QP IE  +  R  S      +   WR +F
Sbjct  634   HALQYYETLLASIDAANITPDIGKKIERSLFQPSIENMILGRLRSSD----RMPPWRNLF  689

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAECV+KRT VGGFHV+KRQ+SLVLCW+++EL+SA  WRC
Sbjct  690   ASAGFSPVAFSNMTEIQAECVVKRTQVGGFHVQKRQTSLVLCWKQQELLSAVTWRC  745



>ref|XP_009407162.1| PREDICTED: scarecrow-like protein 6 [Musa acuminata subsp. malaccensis]
Length=486

 Score =   284 bits (727),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 195/299 (65%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+G YK+FS+VSP+ QF +FT  QALLEAL    RI+I+DFDIG G QW++ MQELA  
Sbjct  196   LKLGTYKTFSDVSPIVQFTSFTCIQALLEALGSATRIYIIDFDIGIGVQWSAFMQELAQR  255

Query  2425  NGT----TPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
               T     P LKITA  SP     LEL +I  NL  FAS +++ FEF+ L +     S+ 
Sbjct  256   WSTAMAAVPYLKITAFTSPSSHHPLELHLIHQNLCHFASSLSIPFEFDVLNLNDFEPSNF  315

Query  2260  swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  +AA+AVNL VG  +      +  +L FV +L PKIVVSVD GCDR DLPF  H
Sbjct  316   LRMCSALDAAVAVNLRVGSAACP---PISTLLRFVTQLCPKIVVSVDHGCDRVDLPFAHH  372

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTAR-FDSDSPEKTQTQHWR  1904
             ++HA  S + LL+S+DA   N D + KIE++++QP IE  V  R + SD     +T  WR
Sbjct  373   VLHAFQSCTVLLDSIDAAGTNQDVVSKIERYLVQPRIENAVLGRRWSSD-----KTLPWR  427

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             T++ S+GF P  FSNF E+QAEC+LKR    GFHVEKRQ+SL LCWQR+EL+S SAW+C
Sbjct  428   TLYASAGFVPMRFSNFTETQAECLLKRVLARGFHVEKRQTSLSLCWQRRELVSVSAWKC  486



>ref|XP_009803484.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Nicotiana sylvestris]
 ref|XP_009803485.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Nicotiana sylvestris]
 ref|XP_009803486.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=626

 Score =   285 bits (728),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 198/296 (67%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSE+SP+ QF NFT+NQ +LEAL     IHI+DFDIG G QW+S MQEL  +
Sbjct  336   LKMDAYKAFSEISPLIQFMNFTSNQPILEALGDAKEIHIIDFDIGCGAQWSSFMQELRSS  395

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA  SP     +E+GI+  +L  FA+++ + FE E + ++  +  +    S
Sbjct  396   NRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDPKTYPLSS  455

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H++
Sbjct  456   LRSSECEAIAINFPI-WSISSCLFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLL  514

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ P+  +KIE+ ++QP IE TV  R    SP++     WR +F
Sbjct  515   HALQYYEILLASIDAANLTPEIGKKIERSLLQPSIENTVLGRL--RSPDRMPP--WRNLF  570

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P  FSN AE QAECV+KRT VGGFHVEKRQ SLVLCW+++EL+S  AWRC
Sbjct  571   ASAGFSPIEFSNMAEIQAECVVKRTQVGGFHVEKRQMSLVLCWKQQELLSILAWRC  626



>ref|XP_009628961.1| PREDICTED: scarecrow-like protein 6 [Nicotiana tomentosiformis]
Length=624

 Score =   284 bits (727),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/296 (48%), Positives = 199/296 (67%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSE+SP+ QF NFT+NQ +LEAL    +IHI+DFDIG G QW+S MQEL  +
Sbjct  334   LKMDAYKAFSEISPLIQFMNFTSNQPILEALGDAKQIHIIDFDIGCGAQWSSFMQELRSS  393

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA  SP     +E+GI+  +L  FA+++ + FE E + ++  +  +    S
Sbjct  394   NRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDPKTYPLSS  453

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H++
Sbjct  454   LRSSECEAIAINFPI-WSISSCLFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLL  512

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ P+  +KIE+ ++QP IE  V  R    SP++     WR +F
Sbjct  513   HALQYYEILLASIDAANLTPEIGKKIERSLLQPSIENMVLGRL--RSPDRMPP--WRNLF  568

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P  FSN AE QAECV+KRT VGGFHVEKRQ+SLVLCW+++EL+S  AWRC
Sbjct  569   ASAGFSPIEFSNMAEIQAECVVKRTQVGGFHVEKRQTSLVLCWKQQELLSILAWRC  624



>ref|XP_009628960.1| PREDICTED: scarecrow-like protein 22 [Nicotiana tomentosiformis]
Length=714

 Score =   286 bits (731),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 200/296 (68%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSE+SP+ QF NFT+NQA+LEAL    +IHI+DFDIG G QW+SLMQEL  +
Sbjct  424   LKMDAYKAFSEISPLIQFMNFTSNQAILEALGAAKQIHIIDFDIGCGAQWSSLMQELPSS  483

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA  SP     +E+GI+  +L  FA+++ + FE E + ++  +  +    S
Sbjct  484   NRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDPKTYPLSS  543

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H++
Sbjct  544   LRSSECEAIAINFPI-WSISSCLFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLL  602

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ + Q  IE  V  R    SP++     WR +F
Sbjct  603   HALQYYEILLASIDAANLTPDVGKKIERSLFQSSIENMVLGRL--RSPDRIPP--WRNLF  658

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAEC++KRT VGGFHVEKRQSSLVLCW+++EL+SA +WRC
Sbjct  659   ASAGFSPVAFSNLTEIQAECLVKRTQVGGFHVEKRQSSLVLCWKQRELLSALSWRC  714



>ref|XP_009382417.1| PREDICTED: scarecrow-like protein 27 [Musa acuminata subsp. malaccensis]
Length=790

 Score =   287 bits (735),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/296 (53%), Positives = 191/296 (65%), Gaps = 14/296 (5%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+ AYK+FSEVSP+ QFANFT  QALLE L G DRIHIVD DIG+G QW+S MQELA   
Sbjct  505   KLSAYKAFSEVSPIIQFANFTCIQALLEELNGSDRIHIVDSDIGFGGQWSSFMQELAQRR  564

Query  2422  GTTPS----LKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssw  2255
              +T      LKITAL        LEL ++R NL  FAS++N+ FEF    ++  + S   
Sbjct  565   CSTAGAVRMLKITALLPHYPHNNLELHLVRDNLSHFASDLNIPFEFNIHSLDSFDPSELL  624

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    AIAVNLPVG    +     P +   VK+L PKIVVSVD GCDR+DLPF  H +
Sbjct  625   GLGGE--AIAVNLPVG----SANFPFPALFRLVKQLSPKIVVSVDQGCDRSDLPFLQHFL  678

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HA  S   L++S+DA   N D   KIEKF++QP IE +V  R+ +      +   WRT+F
Sbjct  679   HAFKSSLVLMDSIDASGTNQDMACKIEKFLLQPRIESSVLGRYHA----ADKMLPWRTLF  734

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              ++GF P  FSNF E+QAEC+LKR  V GFHVEKRQ+SL L WQRKEL+S SAWRC
Sbjct  735   TNTGFVPLQFSNFTETQAECLLKRVQVRGFHVEKRQASLYLYWQRKELVSVSAWRC  790



>ref|XP_009411560.1| PREDICTED: scarecrow-like protein 27 [Musa acuminata subsp. malaccensis]
Length=786

 Score =   286 bits (732),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 193/295 (65%), Gaps = 14/295 (5%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+ AYK+FSEVSP+ QF+NFT  QALLE L+G DRIHI+DFDIG+G QW+S MQELA   
Sbjct  501   KLNAYKAFSEVSPIIQFSNFTCIQALLEELDGCDRIHIMDFDIGFGGQWSSFMQELAQRR  560

Query  2422  ----GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssw  2255
                 G    LKIT   S      +EL +I+ NL  FAS++N+ FE +   ++  +     
Sbjct  561   CSSAGAVRMLKITVFVSHYSHNNMELHLIQDNLSHFASDLNIPFELKVRSLDSFDPLELH  620

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    AIAVNLP+G    +  +S P++L  VK+L PKIVVSVD GCDR+DLPF  H +
Sbjct  621   GLGGE--AIAVNLPIG----SANLSFPVLLRLVKQLSPKIVVSVDQGCDRSDLPFLQHFL  674

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HA  S   L++S+DA   N D   KIE+F++QP IE +V  R+ +      +   WRT+F
Sbjct  675   HAFQSSLVLMDSIDASGTNQDTASKIERFLLQPKIESSVLGRYCA----ADKMLPWRTLF  730

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWR  1730
              ++GF P  FSNF E+QAEC+LKR  + GFHVEKRQ+SL L WQRKEL+S SAWR
Sbjct  731   ETAGFVPIQFSNFTETQAECLLKRVQIRGFHVEKRQASLYLYWQRKELVSVSAWR  785



>ref|XP_009803488.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Nicotiana sylvestris]
Length=686

 Score =   283 bits (723),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/296 (48%), Positives = 198/296 (67%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSEVSP+ QF NFT+NQA+LEAL    +IHI+DFDIG G QW+S MQEL  +
Sbjct  396   LKMDAYKAFSEVSPLIQFMNFTSNQAILEALGDAKQIHIIDFDIGCGAQWSSFMQELPSS  455

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA  SP     +E+GI+  +L  FA+++ + FE E + ++  +  +    S
Sbjct  456   NRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDPKTYPLSS  515

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H++
Sbjct  516   LRSSECEAIAINFPI-WSISSCLFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLL  574

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ ++Q  IE  V  R  S      +   WR +F
Sbjct  575   HALQYYEILLASIDAANLTPDVGKKIERSLLQSSIENMVLGRLRS----PNRIPPWRNLF  630

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAEC++KRT VGGFHVEKRQ+SLVLCW+++EL+SA +WRC
Sbjct  631   ASAGFSPVAFSNLTEIQAECLVKRTQVGGFHVEKRQTSLVLCWKQQELLSALSWRC  686



>ref|XP_009803487.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Nicotiana sylvestris]
Length=714

 Score =   283 bits (723),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/296 (48%), Positives = 198/296 (67%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ AYK+FSEVSP+ QF NFT+NQA+LEAL    +IHI+DFDIG G QW+S MQEL  +
Sbjct  424   LKMDAYKAFSEVSPLIQFMNFTSNQAILEALGDAKQIHIIDFDIGCGAQWSSFMQELPSS  483

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA  SP     +E+GI+  +L  FA+++ + FE E + ++  +  +    S
Sbjct  484   NRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDPKTYPLSS  543

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                +   AIA+N P+ W  ++   + P +L  +K+L PK+VVS++ GC+RT+LP   H++
Sbjct  544   LRSSECEAIAINFPI-WSISSCLFAFPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLL  602

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HAL  Y  LL S+DA N+ PD  +KIE+ ++Q  IE  V  R  S      +   WR +F
Sbjct  603   HALQYYEILLASIDAANLTPDVGKKIERSLLQSSIENMVLGRLRS----PNRIPPWRNLF  658

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+P +FSN  E QAEC++KRT VGGFHVEKRQ+SLVLCW+++EL+SA +WRC
Sbjct  659   ASAGFSPVAFSNLTEIQAECLVKRTQVGGFHVEKRQTSLVLCWKQQELLSALSWRC  714



>ref|XP_010264298.1| PREDICTED: uncharacterized protein LOC104602344 isoform X2 [Nelumbo 
nucifera]
Length=1541

 Score =   290 bits (743),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 172/252 (68%), Gaps = 34/252 (13%)
 Frame = +1

Query  1     LVVEVPRDF--ITLSSSHSQTPEAQTISEGNPFQADGTSSESSTS-PKWPKM----NDSG  159
             LV EVP D    T   S+ QTP  ++            S     S   WPK     ND+ 
Sbjct  1314  LVAEVPLDLSATTGKLSNVQTPNIESTQMTGKLDCTTQSDIMGLSNSSWPKCSSVENDNA  1373

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              DVKSVRLDISFKSPSHTGLQT+ELV+ LTEQFPAA PLALVLKQFLADRSLD SYSGGL
Sbjct  1374  MDVKSVRLDISFKSPSHTGLQTTELVRGLTEQFPAATPLALVLKQFLADRSLDHSYSGGL  1433

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GRS  QN GSLLMDFLYFFG                     
Sbjct  1434  SSYCLVLLIIRFLQHEHHLGRSINQNLGSLLMDFLYFFG---------------------  1472

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMP  699
                  IDPI+IDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLE+E+T LPS+ DS  R  
Sbjct  1473  -----IDPIHIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLENELTCLPSDSDSRTRQ-  1526

Query  700   SLKLLPKVIPSI  735
             S KLLPK+IPS+
Sbjct  1527  SYKLLPKIIPSL  1538



>ref|XP_009407846.1| PREDICTED: scarecrow-like protein 6 [Musa acuminata subsp. malaccensis]
Length=718

 Score =   281 bits (719),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 190/298 (64%), Gaps = 12/298 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELAL-  2429
              K+G YK+FS+VSP+ QFA FT+ Q LLEAL+G   IHI+DFDIG G QW+  MQELA  
Sbjct  428   LKLGTYKTFSDVSPIVQFAIFTSIQPLLEALDGARCIHIIDFDIGVGMQWSVFMQELAQQ  487

Query  2428  ---NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss  2258
                    TP LKI+A  SP     LEL +I  NL +FA  +N+ FEF  L ++  + S  
Sbjct  488   WSSTMAATPCLKISAFTSPCTHHPLELHLIHQNLCRFAGSLNIPFEFNFLSLDPFDPSVL  547

Query  2257  w-sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  + AIA+NLPVG      +   P ++ FVK+L PKI+VSVD GCDR+DLPF  H
Sbjct  548   LGRCSAVDEAIAINLPVG---CAIRPPFPTLIDFVKQLSPKILVSVDHGCDRSDLPFAHH  604

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
             I+HA  S + LL+S+DA   N DA  K E+F+++P +E  V         EK     WRT
Sbjct  605   ILHAFQSCTVLLDSIDAAGANQDAANKFEQFLVRPRVESAVLGHHCLS--EKVLP--WRT  660

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F+S+GF P  FSNF E QAEC+LKR  V GFHVEKRQSSL LCWQ  ELIS SAW C
Sbjct  661   LFVSAGFVPMQFSNFTEMQAECLLKRVLVRGFHVEKRQSSLSLCWQHGELISVSAWNC  718



>ref|XP_004983724.1| PREDICTED: scarecrow-like protein 6-like isoform X2 [Setaria 
italica]
Length=618

 Score =   278 bits (712),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 195/293 (67%), Gaps = 6/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G  RIH++DFDIG GEQWASLMQELA  
Sbjct  332   LKLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGRIHVLDFDIGMGEQWASLMQELA-Q  390

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                  +LK+TAL S      LEL +I  NL  FA+E+ +  +F    ++ L+ +   + +
Sbjct  391   RCPAATLKVTALVSSASHHPLELQLIHENLSGFAAELGVFLQFAPFNIDTLDPAELVAIT  450

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +A +AV+LPVG   +    ++P IL  VK+L  K+VVSVD GCDRT+LPF  H+  AL
Sbjct  451   GGDA-VAVHLPVG---SAHVAAMPAILRLVKRLGAKVVVSVDHGCDRTELPFAAHLFQAL  506

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              S  +LLES+DA   + DA+ KIE+F++QPG+E+ V AR  + + +K     WRTVF S+
Sbjct  507   QSCVSLLESVDAARPDGDAVAKIERFLVQPGVEQRVVARHRAAALDKPPLP-WRTVFASA  565

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   S FAESQAE +LKR  + GF VEKR  +L L WQR EL+S SAWRC
Sbjct  566   GFVPVQASTFAESQAEALLKRMALMGFRVEKRGGALCLYWQRGELVSVSAWRC  618



>ref|XP_008232576.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103331707 
[Prunus mume]
Length=1563

 Score =   289 bits (740),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 186/251 (74%), Gaps = 14/251 (6%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQ----TISEGNPFQADGTSSESSTSPKWPKMN-DSGKD  165
             LVVEVPRD I  S+S+ Q+P+ +    +  +G+   +   + E S  PK  ++N D+ KD
Sbjct  1318  LVVEVPRDLIASSASNVQSPKEEPPHMSGEQGSHVNSSVVALEESALPKCSQINYDATKD  1377

Query  166   VKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSS  345
               SVR+DISFKSPSHTGLQT+ELVK+LTEQFPAA PLALVLKQFLADRSLDQSYSGGLSS
Sbjct  1378  SVSVRIDISFKSPSHTGLQTTELVKDLTEQFPAAAPLALVLKQFLADRSLDQSYSGGLSS  1437

Query  346   YCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR-E  522
             YCLVLLI RFLQHE+H  R   QN+G+LLM+FLYFFGN F        ++   L I+   
Sbjct  1438  YCLVLLIIRFLQHEYHLSRPINQNFGNLLMNFLYFFGNEF--------LKFHPLLISXYS  1489

Query  523   RGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPS  702
                SIDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+  LP +D      PS
Sbjct  1490  TPCSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSILENELASLPIDDGDLCSRPS  1549

Query  703   LKLLPKVIPSI  735
              +LL K+IPSI
Sbjct  1550  YRLLSKIIPSI  1560



>ref|XP_004983723.1| PREDICTED: scarecrow-like protein 6-like isoform X1 [Setaria 
italica]
Length=644

 Score =   278 bits (712),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 195/293 (67%), Gaps = 6/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G  RIH++DFDIG GEQWASLMQELA  
Sbjct  358   LKLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGRIHVLDFDIGMGEQWASLMQELA-Q  416

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                  +LK+TAL S      LEL +I  NL  FA+E+ +  +F    ++ L+ +   + +
Sbjct  417   RCPAATLKVTALVSSASHHPLELQLIHENLSGFAAELGVFLQFAPFNIDTLDPAELVAIT  476

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +A +AV+LPVG   +    ++P IL  VK+L  K+VVSVD GCDRT+LPF  H+  AL
Sbjct  477   GGDA-VAVHLPVG---SAHVAAMPAILRLVKRLGAKVVVSVDHGCDRTELPFAAHLFQAL  532

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              S  +LLES+DA   + DA+ KIE+F++QPG+E+ V AR  + + +K     WRTVF S+
Sbjct  533   QSCVSLLESVDAARPDGDAVAKIERFLVQPGVEQRVVARHRAAALDKPPLP-WRTVFASA  591

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   S FAESQAE +LKR  + GF VEKR  +L L WQR EL+S SAWRC
Sbjct  592   GFVPVQASTFAESQAEALLKRMALMGFRVEKRGGALCLYWQRGELVSVSAWRC  644



>gb|EMT28394.1| hypothetical protein F775_07767 [Aegilops tauschii]
Length=400

 Score =   271 bits (693),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 189/294 (64%), Gaps = 8/294 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G   IH++DFDIG GEQWASLMQELA  
Sbjct  114   LKLGAYKAFSEVSPVLQFAHLTCVQAVLDGLRGAGCIHVLDFDIGMGEQWASLMQELAQR  173

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                T +LK+TAL SP     LEL +I  NL  FA+E+ + F+F    ++ L+ +   + +
Sbjct  174   RPAT-ALKVTALVSPASHHPLELQLIHENLSSFAAELGVFFQFTVFNIDTLDPADLVAIA  232

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +A +AV+LPVG        +   +L  VK L  K+VVSVD GCDRT+LPF  H+  A 
Sbjct  233   GGDA-LAVHLPVGAAHAAAMPA---VLRLVKSLGAKVVVSVDRGCDRTELPFAAHLFQAF  288

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              S   LLES+DAV  +PD   KIE+F++QP +E+ V  R  + S EK     WR VF S+
Sbjct  289   QSTVFLLESVDAVGTDPDTAGKIERFLVQPAVEQCVVGRHRA-SIEKAPLP-WRAVFASA  346

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ-SSLVLCWQRKELISASAWRC  1727
             GFTP   S FAESQAE +L + PV GF VEKR   SL L WQR EL+S SAWRC
Sbjct  347   GFTPVQASTFAESQAESLLHKVPVRGFRVEKRAPGSLCLYWQRAELVSVSAWRC  400



>ref|XP_011070112.1| PREDICTED: scarecrow-like protein 22 [Sesamum indicum]
Length=734

 Score =   280 bits (715),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/299 (50%), Positives = 190/299 (64%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK FSEVSP+ QF NFT NQ +LEAL   +RIH++DFDIG+G  W+S +QEL L 
Sbjct  444   FKMGAYKVFSEVSPVIQFMNFTANQIILEALGDAERIHLIDFDIGFGAHWSSFLQELPLK  503

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLN---ssssw  2255
             N    S+KITA ASP     LE+ ++  NL QFA++I + FE E + ++  +   SS S 
Sbjct  504   NRGATSIKITAFASPSTHHSLEISLMHENLTQFANDIGLNFELEVVNIDSFDPNCSSVSS  563

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
               S     IAVN PV W  T+   +LP  L  +KKL PK++VS+  GC+R DLPF  HI+
Sbjct  564   LRSSESEVIAVNFPV-WSFTSYLSALPSYLCLMKKLSPKVLVSLGRGCERGDLPFSHHIL  622

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARF---DSDSPEKTQTQHWR  1904
               L  Y  LL+S+DA N+  DA  KIEKF+ QP IE TV  R    D   P       WR
Sbjct  623   QTLQYYEALLDSVDAANVKSDASNKIEKFLFQPRIESTVLGRLVHPDIIPP-------WR  675

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              +F S GF+P S S+F E+QAECV+KR  V GFH E+RQ+SL L W+  EL+S SAW C
Sbjct  676   NLFASVGFSPASISSFTETQAECVVKRMQVSGFHAERRQASLSLYWKHSELVSVSAWNC  734



>ref|XP_010941132.1| PREDICTED: scarecrow-like protein 27 [Elaeis guineensis]
Length=773

 Score =   280 bits (717),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 150/298 (50%), Positives = 189/298 (63%), Gaps = 12/298 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+G  K+FS+VSP+ QF NFT+ QALLE L    RIH+VDFDIG G QW++ MQELA  
Sbjct  483   LKLGTVKAFSDVSPVLQFTNFTSIQALLEELGAASRIHVVDFDIGVGGQWSAFMQELAQR  542

Query  2425  NGTT-----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
               TT     PSLKITA AS      LEL + R NL  FA+++N+ FEF  L ++  + S 
Sbjct  543   RCTTAGASSPSLKITAFASRCSHHPLELHLTRENLSHFAADLNIPFEFNVLSLDPFDPSP  602

Query  2260  swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
               S S    AIAVNLP+G   +      P +L  VK+L PKIV+SVD GCDR+DL F  H
Sbjct  603   LLSLSSGSEAIAVNLPIG---SAVHPLAPTLLRLVKQLSPKIVISVDHGCDRSDLSFARH  659

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRT  1901
              + A  S + LL+S+DA   + +   KIE+F++QP IE  V     +      +   WR 
Sbjct  660   FVQAFQSCTVLLDSIDAAGTDMEVANKIERFLVQPRIENAVLGHHRT----ADKMLPWRA  715

Query  1900  VFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +F S+GF P  FSNF E+QAEC+LKR  V GFHVEKRQ+SL LCWQR EL+S SAWRC
Sbjct  716   LFNSAGFVPVQFSNFTETQAECLLKRVQVRGFHVEKRQASLSLCWQRGELVSVSAWRC  773



>emb|CDP09942.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   280 bits (717),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 196/296 (66%), Gaps = 8/296 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             FK+GAYK  SEVSP+ QF NFT+NQALLEAL+    IHI+DFDIG G QW+S MQEL   
Sbjct  479   FKMGAYKMLSEVSPLIQFKNFTSNQALLEALDDAANIHIIDFDIGCGAQWSSFMQELPRK  538

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
             N    SLKITA ASP     +E+ ++  +L  FA+++ + FE E +  +  + S   + S
Sbjct  539   NRGATSLKITAFASPSAYHSVEISLMHESLTHFANDLGLKFELEVVNFDSFDPSGYSASS  598

Query  2245  ySEA---AIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
             +  +    IAVN P+ W  +++   LP +L F+K+L PKIVV +D GC+R +LP   H++
Sbjct  599   FRSSESDTIAVNFPL-WSVSSRPTILPSLLCFIKQLSPKIVVMLDHGCERFELPPSHHLL  657

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             +AL  Y   L+S+DA NM  DA+ KIE+F+IQP +E  V  R  S      Q   W  +F
Sbjct  658   NALQYYEVFLDSVDAANMASDAVNKIERFLIQPTVESIVFGRLQS----PNQIPPWTNLF  713

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              S+GF+    SNFAE+QAECV+KR+ V GFHVEKRQ+SLVL WQR+EL+SAS W+C
Sbjct  714   ASAGFSSVPISNFAETQAECVVKRSQVRGFHVEKRQASLVLSWQRRELLSASVWKC  769



>ref|NP_191622.1| protein LOST MERISTEM 2 [Arabidopsis thaliana]
 sp|Q9M000.1|SCL22_ARATH RecName: Full=Scarecrow-like protein 22; Short=AtSCL22; AltName: 
Full=GRAS family protein 21; Short=AtGRAS-21; AltName: Full=SCL6-III 
[Arabidopsis thaliana]
 emb|CAB82667.1| scarecrow-like protein [Arabidopsis thaliana]
 gb|AAL36418.1| putative scarecrow protein [Arabidopsis thaliana]
 gb|AAM20013.1| putative scarecrow protein [Arabidopsis thaliana]
 gb|AEE80090.1| protein LOST MERISTEM 2 [Arabidopsis thaliana]
Length=623

 Score =   276 bits (705),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 202/306 (66%), Gaps = 20/306 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             F+I AY++FSE SP  QF NFT NQ +LE+ EGFDRIHIVDFDIGYG QWASL+QELA  
Sbjct  325   FRIAAYRAFSETSPFLQFVNFTANQTILESFEGFDRIHIVDFDIGYGGQWASLIQELAGK  384

Query  2425  ---NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
                + + PSLKITA ASP    ++ EL     NL  FA E  + FE E L +E L + + 
Sbjct  385   RNRSSSAPSLKITAFASPSTVSDEFELRFTEENLRSFAGETGVSFEIELLNMEILLNPTY  444

Query  2260  ---swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR-TDLP  2093
                S   S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D  CDR  D P
Sbjct  445   WPLSLFRSSEKEAIAVNLPISSMVSGY---LPLILRFLKQISPNVVVCSDRSCDRNNDAP  501

Query  2092  FPDHIIHALHSYSNLLESLDAVNM-NPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQT  1916
             FP+ +I+AL  Y++LLESLD+ N+ N +A   IE+F +QP I+K +T R+        ++
Sbjct  502   FPNGVINALQYYTSLLESLDSGNLNNAEAATSIERFCVQPSIQKLLTNRYR----WMERS  557

Query  1915  QHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQS---SLVLCWQRKELIS  1745
               WR++F   GFTP + S  AE+QAE +L+R P+ GFH+EKRQS   SLVLCWQRKEL++
Sbjct  558   PPWRSLFGQCGFTPVTLSQTAETQAEYLLQRNPMRGFHLEKRQSSSPSLVLCWQRKELVT  617

Query  1744  ASAWRC  1727
              SAW+C
Sbjct  618   VSAWKC  623



>ref|XP_009392803.1| PREDICTED: uncharacterized protein LOC103978659 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1576

 Score =   287 bits (734),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 166/221 (75%), Gaps = 8/221 (4%)
 Frame = +1

Query  1     LVVEVPRDFITLS---SSHSQTPEA-QTISEGNPFQADGTSSESSTSPKWP--KMN-DSG  159
             LV EVP D I +S   SS    P A  ++  G       T   SS    WP  KM  D  
Sbjct  1355  LVAEVPDD-IDISRKKSSMVDIPRALSSMVPGRQCNIPTTDLSSSDCTSWPYSKMKKDDN  1413

Query  160   KDVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGL  339
              DVKS+RLDISFKS SHTGLQTSELV+ELT+QFPA+ PLALVLK+FLADRSLD +YSGGL
Sbjct  1414  IDVKSIRLDISFKSASHTGLQTSELVRELTQQFPASVPLALVLKKFLADRSLDHAYSGGL  1473

Query  340   SSYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINR  519
             SSYCLVLLI RFLQHEHH GR   QN G LLMDFLYFFG +F+PR MRVSIQGSG+Y+NR
Sbjct  1474  SSYCLVLLIIRFLQHEHHVGRPNNQNLGGLLMDFLYFFGYIFEPRHMRVSIQGSGIYMNR  1533

Query  520   ERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYST  642
             ERG SIDPI+IDDPL+PTNNVGRNCFRIHQCIK F    ++
Sbjct  1534  ERGLSIDPIHIDDPLYPTNNVGRNCFRIHQCIKGFCKVCTS  1574



>gb|AAO42084.1| putative SCARECROW gene regulator [Arabidopsis thaliana]
Length=640

 Score =   276 bits (706),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 195/307 (64%), Gaps = 25/307 (8%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE--GFDRIHIVDFDIGYGEQWASLMQELA  2432
              +I AY+SFSE SP  QF NFT NQ++LE+    GFDRIHI+DFD+GYG QW+SLMQELA
Sbjct  345   LRIAAYRSFSETSPFLQFVNFTANQSILESCNESGFDRIHIIDFDVGYGGQWSSLMQELA  404

Query  2431  LNNG-----TTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHL  2273
                G        SLK+T  A P     ++ EL     NL  FA E+ + FE E L VE L
Sbjct  405   SGVGGRRRNRASSLKLTVFAPPPSTVSDEFELRFTEENLKTFAGEVKIPFEIELLSVELL  464

Query  2272  Nssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRT  2102
              + +       S  + AIAVNLPV  +++     LPLIL F+K+L P IVV  D GCDR 
Sbjct  465   LNPAYWPLSLRSSEKEAIAVNLPVNSVASGY---LPLILRFLKQLSPNIVVCSDRGCDRN  521

Query  2101  DLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD--SDSPE  1928
             D PFP+ +IH+L  +++LLESLDA N N D    IE+F +QP IEK +  R      SP 
Sbjct  522   DAPFPNAVIHSLQYHTSLLESLDA-NQNQDD-SSIERFWVQPSIEKLLMKRHRWIERSPP  579

Query  1927  KTQTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELI  1748
                   WR +F   GF+P S S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKEL+
Sbjct  580   ------WRILFTQCGFSPASLSQMAEAQAECLLQRNPVRGFHVEKRQSSLVMCWQRKELV  633

Query  1747  SASAWRC  1727
             + SAW+C
Sbjct  634   TVSAWKC  640



>ref|NP_182041.1| protein LOST MERISTEMS 1 [Arabidopsis thaliana]
 sp|Q7XJM8.1|SCL27_ARATH RecName: Full=Scarecrow-like protein 27; Short=AtSCL27; AltName: 
Full=GRAS family protein 14; Short=AtGRAS-14 [Arabidopsis 
thaliana]
 gb|AAW80864.1| At2g45160 [Arabidopsis thaliana]
 gb|ACL13987.1| At2g45160 [Arabidopsis thaliana]
 gb|AEC10518.1| protein LOST MERISTEMS 1 [Arabidopsis thaliana]
Length=640

 Score =   276 bits (706),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 195/307 (64%), Gaps = 25/307 (8%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE--GFDRIHIVDFDIGYGEQWASLMQELA  2432
              +I AY+SFSE SP  QF NFT NQ++LE+    GFDRIHI+DFD+GYG QW+SLMQELA
Sbjct  345   LRIAAYRSFSETSPFLQFVNFTANQSILESCNESGFDRIHIIDFDVGYGGQWSSLMQELA  404

Query  2431  LNNG-----TTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHL  2273
                G        SLK+T  A P     ++ EL     NL  FA E+ + FE E L VE L
Sbjct  405   SGVGGRRRNRASSLKLTVFAPPPSTVSDEFELRFTEENLKTFAGEVKIPFEIELLSVELL  464

Query  2272  Nssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRT  2102
              + +       S  + AIAVNLPV  +++     LPLIL F+K+L P IVV  D GCDR 
Sbjct  465   LNPAYWPLSLRSSEKEAIAVNLPVNSVASGY---LPLILRFLKQLSPNIVVCSDRGCDRN  521

Query  2101  DLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD--SDSPE  1928
             D PFP+ +IH+L  +++LLESLDA N N D    IE+F +QP IEK +  R      SP 
Sbjct  522   DAPFPNAVIHSLQYHTSLLESLDA-NQNQDD-SSIERFWVQPSIEKLLMKRHRWIERSPP  579

Query  1927  KTQTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELI  1748
                   WR +F   GF+P S S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKEL+
Sbjct  580   ------WRILFTQCGFSPASLSQMAEAQAECLLQRNPVRGFHVEKRQSSLVMCWQRKELV  633

Query  1747  SASAWRC  1727
             + SAW+C
Sbjct  634   TVSAWKC  640



>ref|XP_006576441.1| PREDICTED: uncharacterized protein LOC100809291 isoform X6 [Glycine 
max]
Length=1521

 Score =   286 bits (733),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 173/249 (69%), Gaps = 31/249 (12%)
 Frame = +1

Query  1     LVVEVPRDFIT----LSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDV  168
             LVVEVP+D IT    +  S ++ P       GN  Q+D    E S  PK  +M       
Sbjct  1297  LVVEVPQDVITSLAPMIQSLNEEPHCTPGEHGNDNQSDSIRLEDSALPKGSQMKFDALKS  1356

Query  169   KSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSY  348
             KSVRLDISFKSPSHTGLQT+E+VKELT QFPAA PLALVLKQFLADRSLDQSYSGGLSSY
Sbjct  1357  KSVRLDISFKSPSHTGLQTTEMVKELTAQFPAATPLALVLKQFLADRSLDQSYSGGLSSY  1416

Query  349   CLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRERG  528
             CLVLLI RFLQHEHH GR   QNYGSLLMDFLYFFG                        
Sbjct  1417  CLVLLIIRFLQHEHHLGRPINQNYGSLLMDFLYFFG------------------------  1452

Query  529   YSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFADAYSTLESEITLLPSNDDSSARMPSLK  708
               IDPI+IDDPLFPTNNVGRNCFRIHQCIKAF++AYS LE+E+  L S+ +S +R P  +
Sbjct  1453  --IDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELKFLNSDGESCSRPPD-R  1509

Query  709   LLPKVIPSI  735
             LLPK+IPS+
Sbjct  1510  LLPKIIPSL  1518



>ref|XP_010934970.1| PREDICTED: scarecrow-like protein 27 [Elaeis guineensis]
Length=781

 Score =   278 bits (710),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 191/300 (64%), Gaps = 14/300 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+G  K+FS+VSP+ QF NFT+ QALLE L    RIH+VDFDIG G QW++ MQELA  
Sbjct  489   LKLGTVKAFSDVSPVLQFTNFTSVQALLEELRAAPRIHVVDFDIGVGGQWSAFMQELAQR  548

Query  2425  NGT-----TPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEF--ETLGVEHLNs  2267
               T     +PSLKITA AS      LEL + R NL  FA+++N+ FEF   +L     + 
Sbjct  549   RCTAAGAASPSLKITAFASSCSHHSLELHLTRENLSHFAADLNIPFEFILHSLNPFDPSP  608

Query  2266  ssswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFP  2087
               S S + ++ AI VNLPVG         +P +L  VK+L PKIV+SVD   DR+DLPF 
Sbjct  609   LLSLSSAGADEAIVVNLPVGSFV---HPPVPTLLRLVKQLSPKIVISVDHCSDRSDLPFA  665

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
              H  HA  SY+ LL+S+DA   N ++  KIE+F++QP IE  V  R  +      +   W
Sbjct  666   QHFAHAFQSYTVLLDSIDAAGTNLESANKIERFLVQPRIENAVLGRHRN----ADKMLPW  721

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             R +F S+GF P  FSNFAE+QAEC+LKR    GFHVEKRQ+SL LCWQR EL+S SAWRC
Sbjct  722   RALFNSAGFVPVQFSNFAETQAECLLKRVQARGFHVEKRQASLSLCWQRMELVSVSAWRC  781



>ref|XP_002878344.1| scarecrow transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54603.1| scarecrow transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=623

 Score =   273 bits (698),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 203/306 (66%), Gaps = 20/306 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             F+I AY++FSE SP  QF NFT NQ +LE+ EGFDRIHIVDFDIGYG QWASL+QELA  
Sbjct  325   FRIAAYRAFSETSPFLQFVNFTANQTILESFEGFDRIHIVDFDIGYGGQWASLIQELAGK  384

Query  2425  ---NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
                + + PSLKITA ASP    ++ EL     NL  FA E  + FE E L +E L + + 
Sbjct  385   RNRSSSPPSLKITAFASPSTVSDEFELRFTEENLRNFAGETGVSFEIELLNMEILLNPTY  444

Query  2260  ---swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR-TDLP  2093
                S+  S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D  CDR  D P
Sbjct  445   WPLSFFRSSEKEAIAVNLPISSIVSGY---LPLILRFLKQISPNVVVCSDRSCDRNNDAP  501

Query  2092  FPDHIIHALHSYSNLLESLDAVNM-NPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQT  1916
             FP+ +I+AL  Y++LLESLD+ N+ N +A   IE+F +QP I+K +T R+        ++
Sbjct  502   FPNGVINALQYYTSLLESLDSGNLNNAEAASSIERFCVQPSIQKLLTNRYR----WMERS  557

Query  1915  QHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ---SSLVLCWQRKELIS  1745
               WR++F   GF+P + S  AE+QAE +L+R P+ GFH+EKRQ   SSLVLCWQRKEL++
Sbjct  558   PPWRSLFGQCGFSPVTLSQTAETQAEYLLQRNPMRGFHLEKRQSSSSSLVLCWQRKELVT  617

Query  1744  ASAWRC  1727
              SAW+C
Sbjct  618   VSAWKC  623



>gb|EMS67890.1| hypothetical protein TRIUR3_03541 [Triticum urartu]
Length=430

 Score =   267 bits (683),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 191/293 (65%), Gaps = 6/293 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSE+SP+ QFA+FT  QA+L+ L G   IH++DFDIG GEQWASLMQELA  
Sbjct  144   LKLGAYKAFSELSPVLQFAHFTCVQAVLDELGGAGCIHVLDFDIGVGEQWASLMQELAQR  203

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                  +LK+TAL  P     LEL +I  NL  FA+E+ + F+F    ++ ++ +   + +
Sbjct  204   R-PGAALKVTALVLPSTHHPLELQLIHENLANFAAELGVPFQFVVFNLDSVDPTELLAIA  262

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +A IAV+LPVG   +    ++P +L  V++L  K+V+SVD   DR +LPF  H++ A 
Sbjct  263   GGDA-IAVHLPVG---SVHAAAVPSVLHLVRRLGAKLVISVDRSGDRGELPFAAHLLQAF  318

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              S + LLESLDAV   PD   KIE+F+IQP IE  V  R  + +    +   WRT+F S+
Sbjct  319   QSCAFLLESLDAVGTEPDVASKIERFLIQPKIESCVMRRHQA-AAAGDKLLPWRTMFTSA  377

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   SNFAE+QA+ +LK+ PV GF VEKR  SLVL WQR EL+S SAWRC
Sbjct  378   GFVPVHISNFAEAQADSLLKKVPVRGFRVEKRAGSLVLHWQRAELVSVSAWRC  430



>ref|XP_009401671.1| PREDICTED: scarecrow-like protein 27 [Musa acuminata subsp. malaccensis]
Length=784

 Score =   276 bits (705),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 187/296 (63%), Gaps = 14/296 (5%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+ AYK FSEVSP+ QF+NFT  QALLE L G DRIHI+DFDIG+G QW+S MQELAL  
Sbjct  499   KLSAYKVFSEVSPIIQFSNFTCTQALLEELGGSDRIHIIDFDIGFGGQWSSFMQELALRR  558

Query  2422  ----GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssw  2255
                 G    LKITA      Q  L+L ++R NL  FAS +N+  EF    ++  +     
Sbjct  559   CSAAGPVRLLKITAFVPYRSQNNLDLCLVRDNLSHFASNVNIPLEFSVHSLDSFDPLKLL  618

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    AIAVNLPVG  S N  +S   +L  V++L P+IVVSVD GC+R+DLPF  H I
Sbjct  619   GAGGE--AIAVNLPVG--SVN--LSFTALLRVVRQLSPRIVVSVDQGCNRSDLPFLQHFI  672

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HA  S   L+ES+DA  +N D   KIE+F++QP IE +V  R  +      +   WR  +
Sbjct  673   HAFQSSMALMESIDACGINQDTASKIERFLLQPRIESSVLGRHRA----ADKMLPWRMHY  728

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              ++GF P  FS+F E+QAEC+LKR  V GFHVEK Q+SL L WQ KEL+S SAWRC
Sbjct  729   TTTGFVPMQFSDFTETQAECLLKRVQVRGFHVEKCQASLCLYWQHKELVSVSAWRC  784



>ref|XP_009384468.1| PREDICTED: scarecrow-like protein 27 [Musa acuminata subsp. malaccensis]
Length=782

 Score =   275 bits (704),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 190/296 (64%), Gaps = 14/296 (5%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+ AYK+FSEVSP+ QF+NFT  QALLE L G DRIHI+DFDIG+G QW+S MQELA   
Sbjct  497   KLSAYKAFSEVSPIIQFSNFTCIQALLEELSGSDRIHIIDFDIGFGGQWSSFMQELAQRR  556

Query  2422  ----GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssssw  2255
                 G+   LKIT LAS   Q  LEL +IR NL  FAS++N+ FEF    ++  + S   
Sbjct  557   SSVAGSVWLLKITVLASGYSQNDLELQLIRENLSHFASDLNIPFEFNVHCLDSFDPSKLL  616

Query  2254  sdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHII  2075
                    A+AVNLPV     +  +S  ++L  VK+L PKIVVSVD GC+ + LPF  + +
Sbjct  617   GMGGE--AVAVNLPV----ASANLSSMVLLCLVKQLSPKIVVSVDQGCEPSGLPFLQYFL  670

Query  2074  HALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVF  1895
             HA  S   L+ES+DA   + D + KIE+F++QP IE ++  R   D     +   W   F
Sbjct  671   HAFQSSMVLMESIDASGTDQDMISKIERFLLQPRIESSILRRHRVDD----KMVSWLAHF  726

Query  1894  LSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              ++GF P  FSNF E+QAEC+LKR  + GFHVEKRQ+SL LCWQ  EL+S SAWRC
Sbjct  727   ATTGFVPIRFSNFTETQAECLLKRVSIKGFHVEKRQASLFLCWQHNELVSVSAWRC  782



>ref|XP_010229344.1| PREDICTED: scarecrow-like protein 6 [Brachypodium distachyon]
Length=620

 Score =   271 bits (694),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 194/295 (66%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSEVSP+ QFA+FT  QA+L+ L G   IH++DFDIG GEQWASLMQELA  
Sbjct  331   LKLGAYKAFSEVSPVLQFAHFTCVQAVLDELAGAACIHVLDFDIGVGEQWASLMQELAQR  390

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                  +LK+TAL SP     LEL +I  NL  FA+E+ + F+F    ++ ++ +   + +
Sbjct  391   RPGAAALKVTALVSPASHHPLELQLIHENLSNFAAELGVPFQFTFFSLDAVDPAELLAIA  450

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR--TDLPFPDHIIH  2072
               + AIAV+LPVG   +    ++P +L  V++L  K+V+SVD  CDR   +LPF  H+  
Sbjct  451   GGD-AIAVHLPVG---SVHAAAVPSVLHLVRRLGAKLVISVDRSCDRGGGELPFATHLFQ  506

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL S   LLESLDA+  +PD   KIE+F+IQP IE  VT R  + +    +   WRT+F 
Sbjct  507   ALQSCMFLLESLDAMGTDPDVASKIERFLIQPKIESCVTRRHRAVT-AGDKMLPWRTMFA  565

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             S+GF P   SNFAE+QA+ +LK+ PV GF VEKR  SL+L WQR EL+S SAWRC
Sbjct  566   SAGFVPVQISNFAEAQADSLLKKVPVRGFRVEKRGGSLLLHWQRAELVSVSAWRC  620



>ref|NP_001065323.2| Os10g0551200 [Oryza sativa Japonica Group]
 dbj|BAF27160.2| Os10g0551200 [Oryza sativa Japonica Group]
Length=398

 Score =   265 bits (677),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/293 (49%), Positives = 188/293 (64%), Gaps = 5/293 (2%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G   IH++DFDIG GEQWASLMQELA   
Sbjct  110   KLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGCIHVLDFDIGMGEQWASLMQELAQLR  169

Query  2422  GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsdsy  2243
                 +LK+TAL SP     LEL +I  NL  FA+E+ + F F    ++ L+ +   +++ 
Sbjct  170   PAA-ALKVTALVSPASHHPLELQLIHENLSGFAAELGVFFHFTVFNIDTLDPAELLANAT  228

Query  2242  SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHALH  2063
             +  A+AV+LPVG        + P +L  VK+L  K+VVSVD GCDR+DLPF  H+ H+ H
Sbjct  229   AGDAVAVHLPVG---PAHAAATPAVLRLVKRLGAKVVVSVDRGCDRSDLPFAAHLFHSFH  285

Query  2062  SYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSP-EKTQTQHWRTVFLSS  1886
             S   LLES+DAV  +PD   KIE+++I P IE+ V A   + S  +K     WR  F ++
Sbjct  286   SAVYLLESIDAVGTDPDTASKIERYLIHPAIEQCVVASHRAASAMDKAPPPPWRAAFAAA  345

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   + FAESQAE +L +  V GF VEKR  SL L WQR EL+S SAWRC
Sbjct  346   GFAPVQATTFAESQAESLLSKVHVRGFRVEKRAGSLCLYWQRGELVSVSAWRC  398



>ref|XP_010544618.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Tarenaya hassleriana]
 ref|XP_010544619.1| PREDICTED: scarecrow-like protein 22 isoform X2 [Tarenaya hassleriana]
Length=614

 Score =   271 bits (693),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 199/299 (67%), Gaps = 13/299 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KI +Y++FSE SP  QF NFT NQA++++LEGFDRIHI+DFD+G+G QWASLMQEL   
Sbjct  323   LKIASYRAFSEASPFLQFVNFTANQAIIDSLEGFDRIHIIDFDVGFGSQWASLMQELVGR  382

Query  2425  NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss---s  2258
             N T   LKITA ASP    ++ EL     +L  FA E+ + FE + LG++ L + +    
Sbjct  383   NRTPLPLKITAFASPSTVSDEFELRFAEESLKSFAGEVKIPFEIQLLGLDLLLNPAFWPL  442

Query  2257  wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                S  + AIAVNLP+  + +     LPLIL F++++ P +VV  D GCDR D PFP+ +
Sbjct  443   SLRSSDKEAIAVNLPISSVISGY---LPLILRFLRQISPNVVVCSDRGCDRNDAPFPNAV  499

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             IHAL  +++LLESLDA N +PDA   IE+  +QP +++ +  R         ++  WR++
Sbjct  500   IHALQYFTSLLESLDAANPSPDAAASIERIWLQPSMQRLLVNRHR----WMERSPPWRSL  555

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ--SSLVLCWQRKELISASAWRC  1727
                 GFT  S S+ AE+QAEC+++R+ V GFHVEKRQ  SSLVLCW+RKEL+S SAWRC
Sbjct  556   LGQCGFTGASVSHAAEAQAECLVQRSGVRGFHVEKRQSSSSLVLCWERKELVSVSAWRC  614



>gb|EMT26258.1| hypothetical protein F775_27777 [Aegilops tauschii]
Length=480

 Score =   266 bits (681),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 188/299 (63%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLE--ALEGFDRIHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SPM QFANFT  QALL+  A      IHI+DFD+G G QWAS MQELA
Sbjct  190   LKLAAYKSFSDLSPMLQFANFTATQALLDEIACSAASCIHIIDFDLGVGGQWASFMQELA  249

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                GT     P LK+TA  S      LEL + + NL QFA+++ + FEF  + ++  + +
Sbjct  250   HRRGTGGVALPLLKLTAFVSDASHHPLELHLTQDNLTQFAADLGIPFEFNAVSLDAFSPA  309

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                S +  E  +AV+LPVG   + +   L +IL  VK+L PKIVV++D G DR DLPF  
Sbjct  310   ELISPTGDEI-VAVSLPVG--CSARAPPLAVILRLVKQLGPKIVVAMDYGADRADLPFSQ  366

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H +H   S   LL+SLDA  ++ D+  KIEKF+IQP +E  V  R  +D     +   WR
Sbjct  367   HFLHCFQSCMFLLDSLDAAGIDADSACKIEKFLIQPRVEDAVLGRRKTD-----KAVSWR  421

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              VF ++GFTP   SN AE+QA+C+LKR  V GFHVEKR  +L L WQR EL+S SAWRC
Sbjct  422   NVFAAAGFTPVPLSNLAEAQADCLLKRVQVRGFHVEKRGVALTLYWQRGELVSVSAWRC  480



>ref|XP_002464970.1| hypothetical protein SORBIDRAFT_01g029650 [Sorghum bicolor]
 gb|EER91968.1| hypothetical protein SORBIDRAFT_01g029650 [Sorghum bicolor]
Length=640

 Score =   271 bits (692),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/293 (48%), Positives = 191/293 (65%), Gaps = 9/293 (3%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G  RIH++DFDIG GEQWASLMQELA  
Sbjct  357   LKLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGASRIHVLDFDIGMGEQWASLMQELA-Q  415

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                  +LK+TAL +      LEL +I  NL  FA E+ +  +F    ++ L+ +   + +
Sbjct  416   RCPAATLKVTALVTSASHHPLELNLIHENLSGFARELGVFLQFAVFNIDTLDPAELVAIT  475

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +A +AV+LPVG   +    ++P +L  VK+L  K+VVSVD GCDRT+LPF  H+  A 
Sbjct  476   SGDA-VAVHLPVG---SAHVAAMPAVLRLVKRLGAKVVVSVDHGCDRTELPFATHLFQAF  531

Query  2065  HSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFLSS  1886
              S  +LL+S+DAV  + +A+ +IE+F++QP +E  V +R  + +P       WRTVF S+
Sbjct  532   QSCVSLLDSVDAVGADAEAVARIERFLVQPDVELRVVSRHRASAPPPA----WRTVFASA  587

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   S FAESQAE +LKR  + GF VEKR  +L L WQR EL+S SAWRC
Sbjct  588   GFVPVQASTFAESQAEALLKRMALMGFRVEKRGGALCLYWQRGELVSVSAWRC  640



>ref|XP_006290271.1| hypothetical protein CARUB_v10016840mg [Capsella rubella]
 gb|EOA23169.1| hypothetical protein CARUB_v10016840mg [Capsella rubella]
Length=632

 Score =   269 bits (688),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 198/305 (65%), Gaps = 21/305 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             F+I AY++FSE SP  QF NFT NQ +LE+L+GFDRIHIVDFDIGYG QWA+L+QELA  
Sbjct  337   FRIAAYRAFSETSPFLQFVNFTANQTILESLQGFDRIHIVDFDIGYGGQWATLIQELAGK  396

Query  2425  NGTT---PSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
                +   PSLKITA ASP    ++ EL     NL  FA E  +  E E L VE L + + 
Sbjct  397   RNRSPSLPSLKITAFASPSTVSDEFELRFTEENLRNFAGETGVSLEMELLNVEILLNPTY  456

Query  2260  ---swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR-TDLP  2093
                S   S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D  CDR  D P
Sbjct  457   WPLSLFRSSEKEAIAVNLPISSIVSGY---LPLILRFLKQISPNVVVCSDRSCDRDNDAP  513

Query  2092  FPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQ  1913
             FP+ +I+AL  Y+ LLESLD+ N   +A   IE+F +QP I+K +T R+        ++ 
Sbjct  514   FPNGVINALQYYTTLLESLDSSNA--EAASSIERFCVQPSIQKLLTNRYR----WMERSP  567

Query  1912  HWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ---SSLVLCWQRKELISA  1742
              WR++F   GF+P + S  AE+QAE +L+R P+ GFH+EKRQ   SSLVLCWQRKEL++ 
Sbjct  568   PWRSLFGQCGFSPVTLSQTAETQAEYLLQRNPMRGFHLEKRQSSSSSLVLCWQRKELVAV  627

Query  1741  SAWRC  1727
             SAW+C
Sbjct  628   SAWKC  632



>ref|XP_006295629.1| hypothetical protein CARUB_v10024743mg [Capsella rubella]
 gb|EOA28527.1| hypothetical protein CARUB_v10024743mg [Capsella rubella]
Length=638

 Score =   268 bits (685),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 191/305 (63%), Gaps = 21/305 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE--GFDRIHIVDFDIGYGEQWASLMQELA  2432
              +I AY+SFSE SP  QF NFT NQ++LE+    GFDRIHI+DFD+GYG QW+SLMQELA
Sbjct  343   LRIAAYRSFSETSPFLQFVNFTANQSILESCNDSGFDRIHIIDFDVGYGGQWSSLMQELA  402

Query  2431  -----LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHL  2273
                         SLK+T  A P     ++ EL     NL  FA E+ + FE E L +E L
Sbjct  403   SGGGGRRRNRASSLKLTVFAPPPSTVSDEFELRFTEENLKTFAGEVKIPFEVELLSIELL  462

Query  2272  Nssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRT  2102
              + +       S  + AIAVNLP+  +       LPLIL F+K++ P +VV  D GCDR 
Sbjct  463   LNPAYWPLSLRSSEKEAIAVNLPINSVVPGY---LPLILRFLKQISPNVVVCSDRGCDRN  519

Query  2101  DLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKT  1922
             D PFP+ +IHAL  ++ LLESLDA N N D    IE+F +QP IEK +  R         
Sbjct  520   DAPFPNAVIHALQYHTTLLESLDA-NQNQDD-SSIERFWVQPSIEKLLMKRHR----WIE  573

Query  1921  QTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISA  1742
             ++  WR++    GF+P S S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKEL++ 
Sbjct  574   RSHPWRSLITQCGFSPASLSQTAEAQAECLLQRNPVRGFHVEKRQSSLVMCWQRKELVTV  633

Query  1741  SAWRC  1727
             SAW+C
Sbjct  634   SAWKC  638



>ref|XP_010469159.1| PREDICTED: scarecrow-like protein 22 [Camelina sativa]
Length=619

 Score =   267 bits (683),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 201/305 (66%), Gaps = 21/305 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
             F+I AY++FSE SP  QF NFT NQ +LE+LEG DRIHIVDFDIGYG QWASL+QELA  
Sbjct  324   FRIAAYRAFSESSPFLQFVNFTANQTILESLEGSDRIHIVDFDIGYGGQWASLIQELAGK  383

Query  2425  ---NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
                + + PSLKITA ASP    ++ EL     NL  FA+E  + F  E L +E L + + 
Sbjct  384   RNRSSSPPSLKITAFASPSTVSDEFELRFTEENLRNFAAETGVSFGIELLNMEILLNPTC  443

Query  2260  ---swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR-TDLP  2093
                S   S  + AI+VNLP+  + +     LPLIL F+K++ P +VV  D  CDR  D P
Sbjct  444   WPLSLFRSSEKEAISVNLPISSVVSGY---LPLILRFLKQISPNVVVCSDRSCDRNNDTP  500

Query  2092  FPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQ  1913
             FP+ +I+AL  Y+ LLESLD+ N   +A+ ++E+F +QP I+K +T R+        +T 
Sbjct  501   FPNGVINALQYYTTLLESLDSSNA--EAVTRVERFCVQPSIQKLLTNRYR----WMERTP  554

Query  1912  HWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ---SSLVLCWQRKELISA  1742
              WR++F   GF+P + S  AE+QAE +L+R P+ GFH+EKRQ   SSLVLCWQRKEL++ 
Sbjct  555   PWRSLFGQCGFSPVTLSQAAETQAEYLLQRNPMRGFHLEKRQSSLSSLVLCWQRKELVAV  614

Query  1741  SAWRC  1727
             SAW+C
Sbjct  615   SAWKC  619



>dbj|BAK03144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=703

 Score =   267 bits (683),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 188/299 (63%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLE--ALEGFDRIHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SPM QFANFT  QALL+  A      IH++DFD+G G QWAS +QELA
Sbjct  413   LKLAAYKSFSDLSPMLQFANFTATQALLDEIACSAASCIHVIDFDLGVGGQWASFLQELA  472

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                GT     P LK+TA  S      LEL + R NL QFA+++ + FEF  + ++  + +
Sbjct  473   HRRGTGGVALPLLKLTAFVSDASHHPLELHLTRDNLTQFAADLGIPFEFNAVSLDAFSPA  532

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                S +  E  +AV+LPVG   + +   L LIL  VK+L PKIVV++D G DR DLPF  
Sbjct  533   ELISPTGDEI-VAVSLPVG--CSARAPPLALILQLVKQLVPKIVVAMDYGADRADLPFSQ  589

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H +H   S   LL+SLDA  ++ D+  KIEKF+IQP +E  V  R  +D     +   WR
Sbjct  590   HFLHCFQSCMFLLDSLDAAGIDADSACKIEKFLIQPRVEDAVLGRRKTD-----KAMSWR  644

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              VF ++GFTP   SN AE+QA+C+LKR  V GFHVEKR  +L L WQR EL+S SAWRC
Sbjct  645   NVFAAAGFTPVPLSNLAEAQADCLLKRVQVRGFHVEKRGVALTLYWQRGELVSVSAWRC  703



>ref|XP_010413536.1| PREDICTED: scarecrow-like protein 22 [Camelina sativa]
Length=629

 Score =   265 bits (676),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 202/306 (66%), Gaps = 22/306 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGF-DRIHIVDFDIGYGEQWASLMQELAL  2429
             F+I AY++FSE SP  QF NFT NQ +LE+LEG  DRIHIVDFDIGYG QWASL+QELA 
Sbjct  333   FRIAAYRAFSESSPFLQFVNFTANQTILESLEGSSDRIHIVDFDIGYGGQWASLIQELAG  392

Query  2428  N---NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
                 + + PSLKITA ASP    ++ EL     NL  FA+E  + FE E L +E L + +
Sbjct  393   KRNRSSSPPSLKITAFASPSTVSDEFELRFTEENLRSFAAETGVSFEIELLSMEILLNPT  452

Query  2260  ----swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRT-DL  2096
                 S   S  + AI+VNLP+  + +     LPLIL F+K++ P +VV  D  CDR  D 
Sbjct  453   CWPLSLFRSSEKEAISVNLPISSVVSGY---LPLILRFLKQISPNVVVCSDRTCDRNNDA  509

Query  2095  PFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQT  1916
             PFP+ +I+AL  Y+ LLESLD+ N   +A+ ++E+F +QP I+K +T R+        +T
Sbjct  510   PFPNGVINALQYYTTLLESLDSSNA--EAVTRVERFCVQPSIQKLLTNRYR----WMERT  563

Query  1915  QHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ---SSLVLCWQRKELIS  1745
               WR++F   GF+P + S  AE+QAE +L+R P+ GFH+EKRQ   SSLVLCWQRKEL++
Sbjct  564   PPWRSLFGQCGFSPVTLSQTAETQAEYLLQRNPMRGFHLEKRQSSLSSLVLCWQRKELVA  623

Query  1744  ASAWRC  1727
              SAW+C
Sbjct  624   VSAWKC  629



>gb|AAG13473.1|AC026758_10 putative Scl1 protein [Oryza sativa Japonica Group]
Length=582

 Score =   263 bits (673),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/293 (49%), Positives = 188/293 (64%), Gaps = 5/293 (2%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G   IH++DFDIG GEQWASLMQELA   
Sbjct  294   KLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGCIHVLDFDIGMGEQWASLMQELAQLR  353

Query  2422  GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsdsy  2243
                 +LK+TAL SP     LEL +I  NL  FA+E+ + F F    ++ L+ +   +++ 
Sbjct  354   PAA-ALKVTALVSPASHHPLELQLIHENLSGFAAELGVFFHFTVFNIDTLDPAELLANAT  412

Query  2242  SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHALH  2063
             +  A+AV+LPVG        + P +L  VK+L  K+VVSVD GCDR+DLPF  H+ H+ H
Sbjct  413   AGDAVAVHLPVG---PAHAAATPAVLRLVKRLGAKVVVSVDRGCDRSDLPFAAHLFHSFH  469

Query  2062  SYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSP-EKTQTQHWRTVFLSS  1886
             S   LLES+DAV  +PD   KIE+++I P IE+ V A   + S  +K     WR  F ++
Sbjct  470   SAVYLLESIDAVGTDPDTASKIERYLIHPAIEQCVVASHRAASAMDKAPPPPWRAAFAAA  529

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   + FAESQAE +L +  V GF VEKR  SL L WQR EL+S SAWRC
Sbjct  530   GFAPVQATTFAESQAESLLSKVHVRGFRVEKRAGSLCLYWQRGELVSVSAWRC  582



>ref|XP_006402563.1| hypothetical protein EUTSA_v10006506mg [Eutrema salsugineum]
 gb|ESQ44016.1| hypothetical protein EUTSA_v10006506mg [Eutrema salsugineum]
Length=634

 Score =   264 bits (674),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/306 (49%), Positives = 197/306 (64%), Gaps = 20/306 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              +I AY++FSE SP  QF NFT +Q +LE+LEGFDRIHIVDFDIGYG QW+SL+QELA  
Sbjct  336   LRIAAYRAFSETSPFLQFVNFTASQTILESLEGFDRIHIVDFDIGYGGQWSSLIQELAGK  395

Query  2425  ---NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss-  2261
                + + PSLKITA ASP    ++ EL     NL  FA+E  + FE E L +E L + + 
Sbjct  396   RNRSSSAPSLKITAFASPSTVSDEFELRFTEENLRNFAAETEVSFEIELLNMETLLNPTC  455

Query  2260  ---swsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR-TDLP  2093
                S   S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D  CDR  D P
Sbjct  456   WPLSLLRSSDKEAIAVNLPISSVVSGY---LPLILRFLKQISPNVVVCSDRSCDRNNDAP  512

Query  2092  FPDHIIHALHSYSNLLESLDAVNMNPD--ALQKIEKFMIQPGIEKTVTARFDSDSPEKTQ  1919
             FP+ +IHAL  Y++LLESLDA     D  A   IE+F +QP I++ +  R+        +
Sbjct  513   FPNGVIHALQYYTSLLESLDASGNQNDEEAATSIERFCVQPSIKRLLENRYR----WMER  568

Query  1918  TQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQ--SSLVLCWQRKELIS  1745
             +  WR +F   GF+P + S  AE+QAE +L+R P+ GFH+EKR   SSLVLCWQRKEL++
Sbjct  569   SPPWRGLFGQCGFSPVTLSQSAETQAEYLLQRNPLRGFHLEKRHSSSSLVLCWQRKELVA  628

Query  1744  ASAWRC  1727
              SAW+C
Sbjct  629   VSAWKC  634



>tpg|DAA46213.1| TPA: hypothetical protein ZEAMMB73_837661 [Zea mays]
 gb|AIB05248.1| GRAS transcription factor, partial [Zea mays]
Length=645

 Score =   264 bits (674),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 191/295 (65%), Gaps = 7/295 (2%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+GAYK+FSEVSP+ QFA+ T  QA+L+ L    RIH++D DIG GEQWASLMQELA  
Sbjct  356   LKLGAYKAFSEVSPVLQFAHLTCVQAVLDELGAAGRIHVLDLDIGMGEQWASLMQELA-Q  414

Query  2425  NGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsds  2246
                  +LK+TAL SP     LEL +I  NL  FA E+ +  +F    V+ L+ +   + +
Sbjct  415   RSPAATLKVTALVSPASHHPLELNLIHENLSGFARELGVFLQFAAYNVDALDPAELVAIT  474

Query  2245  ySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHAL  2066
               +A +AV+LPVG   +    ++P +L  VK+L  K+VVSVD GCDRT+L F  H++ A 
Sbjct  475   SGDA-VAVHLPVG---SAHVAAMPAVLRLVKRLGAKVVVSVDRGCDRTELSFSTHLLQAF  530

Query  2065  HSYSNLLESLDAVN-MNPDALQKIEKFMIQPGIEKTVTARFDSD-SPEKTQTQHWRTVFL  1892
              S  +LL+S+DAV   + +A+ +IE+FM+QP +E+ V +R  +  + +K     WRTV  
Sbjct  531   QSCVSLLDSIDAVGGADAEAVGRIERFMVQPDVERRVVSRHRAAVAVDKPPPLPWRTVLA  590

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             S+GF P   S FAESQAE +LKR  + GF VEKR  +L L WQR EL+S SAWRC
Sbjct  591   SAGFVPVQASTFAESQAEALLKRMALMGFRVEKRGGALCLYWQRGELVSVSAWRC  645



>gb|ACN36344.1| unknown [Zea mays]
 tpg|DAA36515.1| TPA: hypothetical protein ZEAMMB73_442357 [Zea mays]
 gb|AIB04366.1| GRAS transcription factor, partial [Zea mays]
Length=485

 Score =   259 bits (662),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 183/299 (61%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDR--IHIVDFDIGYGEQWASLMQELA  2432
              K+GAYKSFS++SP+ QFANFT  QALL+ +       I I+DFD+G G QWAS +QELA
Sbjct  195   LKLGAYKSFSDLSPVLQFANFTATQALLDEIASTTSSCIRIIDFDLGVGGQWASFLQELA  254

Query  2431  L----NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                   NG  P LK+TA  S      LEL + R NL QFA ++ + FEF  + ++  + +
Sbjct  255   YRRGTGNGPLPMLKLTAFVSSASHHPLELHLTRENLSQFAVDLGIPFEFTAINLDAFDPA  314

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                + S  E  +AV LPVG   + +   LP++L  VK+L PKIVV++D G DR DLPF  
Sbjct  315   ELIAPSADEV-VAVCLPVG--CSARTPPLPMLLQLVKQLAPKIVVAIDHGSDRGDLPFSQ  371

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H ++   S   LL+SLDA   N DA  KIE+F+IQP +E  V  R  ++     +   WR
Sbjct  372   HFMNCFQSCMFLLDSLDAAGTNADAASKIERFLIQPRVEDAVLGRRKAE-----KAMAWR  426

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              VF S+GF P   SN AE+QA+C+LKR  V GFHVEK    L L WQR EL+S SAWRC
Sbjct  427   AVFTSAGFAPVPLSNLAEAQADCLLKRVQVRGFHVEKCGMGLALYWQRGELVSVSAWRC  485



>ref|XP_008794809.1| PREDICTED: scarecrow-like protein 6 [Phoenix dactylifera]
Length=616

 Score =   263 bits (672),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 186/300 (62%), Gaps = 14/300 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+G  K+FS+VSP+ QF NFT+ QALLE L    RIH+VDFDIG G QW++ MQEL+  
Sbjct  324   LKLGTVKAFSDVSPVLQFTNFTSVQALLEELGTAPRIHVVDFDIGVGGQWSAFMQELSQR  383

Query  2425  NGT-----TPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss  2261
               T     +P LKITA AS      LEL +   NL  FA+ +N+ FEF  L ++  + S 
Sbjct  384   RCTAAGASSPFLKITAFASCRSHHPLELHLTCENLSHFAANLNIPFEFNVLSLDPFDPSL  443

Query  2260  swsdsy--SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFP  2087
               S S    + AIAVNLP+    +      P +L  V++L PKIV+SVD G DR+DLPF 
Sbjct  444   LLSLSSSSVDEAIAVNLPI---DSAVHPPAPTLLRLVRQLSPKIVISVDHGGDRSDLPFA  500

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
              H  HA  S + LL+S+DA   + +   KIE+F++QP IE  V  R  +      +   W
Sbjct  501   HHFAHAFQSCTILLDSIDAAGTDLEVANKIERFLVQPRIENAVLGRHRT----ADKMLPW  556

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             R +F S+ F P  FSNF E+QAEC+LKR  V GFHVEKRQ+SL LCWQR EL+S SAWRC
Sbjct  557   RALFASASFVPVQFSNFTETQAECLLKRVQVRGFHVEKRQASLSLCWQRGELVSVSAWRC  616



>gb|EEC67412.1| hypothetical protein OsI_34582 [Oryza sativa Indica Group]
Length=805

 Score =   266 bits (681),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 188/293 (64%), Gaps = 5/293 (2%)
 Frame = -2

Query  2602  KIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALNN  2423
             K+GAYK+FSEVSP+ QFA+ T  QA+L+ L G   IH++DFDIG GEQWASLMQELA   
Sbjct  517   KLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGCIHVLDFDIGMGEQWASLMQELAQLR  576

Query  2422  GTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsssswsdsy  2243
                 +LK+TAL SP     LEL +I  NL  FA+E+ + F F    ++ L+ +   + + 
Sbjct  577   PAA-ALKVTALVSPASHHPLELQLIHENLSGFAAELGVFFHFTVFNIDTLDPAELLAIAT  635

Query  2242  SEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIHALH  2063
             +  A+AV+LPVG        + P +L  VK+L  K+VVSVD GCDR+DLPF  H+ H+ H
Sbjct  636   AGDAVAVHLPVG---PAHAAATPAVLRLVKRLGAKVVVSVDRGCDRSDLPFAAHLFHSFH  692

Query  2062  SYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSP-EKTQTQHWRTVFLSS  1886
             S   LLES+DAV  +PD   KIE+++I P IE+ V AR  + S  +K     WR  F ++
Sbjct  693   SAVYLLESIDAVGTDPDTASKIERYLIHPAIEQCVVARHRAASAMDKAPPPPWRAAFAAA  752

Query  1885  GFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             GF P   + FAESQAE +L +  V GF VEKR  SL L WQR EL+S SAWRC
Sbjct  753   GFAPVQATTFAESQAESLLSKVHVRGFRVEKRAGSLCLYWQRGELVSVSAWRC  805



>ref|XP_003570043.1| PREDICTED: scarecrow-like protein 27 [Brachypodium distachyon]
Length=724

 Score =   265 bits (677),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 188/299 (63%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLE--ALEGFDRIHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SPM QFANFT  QALL+  A      IH++DFD+G G QWAS +QELA
Sbjct  434   LKLAAYKSFSDLSPMLQFANFTATQALLDEIACSAASCIHVIDFDLGVGGQWASFLQELA  493

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                G      P LK+TA  S      LEL + + NL QFA+++ + FEF  + ++  + +
Sbjct  494   HRRGAGGVALPLLKLTAFVSAASHHPLELHLTQDNLSQFAADLGIPFEFNAVSIDAFSPA  553

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                S +  E  +AV+LPVG   + +   LP+IL  VK+L PKIVV++D G DR DLPF  
Sbjct  554   ELISPTGDEI-VAVSLPVG--CSARAPPLPVILRLVKQLGPKIVVAMDYGADRADLPFSQ  610

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H +H   S   LL+SLDA  ++ D+  KIE+F+IQP +E  V  R  +D     ++  WR
Sbjct  611   HFLHCFQSCMFLLDSLDAAGIDSDSACKIERFLIQPRVEDAVLGRRKAD-----KSMAWR  665

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              VF ++GFTP   SN AE+QA+C+LKR  V GFHVEKR   L L WQR EL+S SAWRC
Sbjct  666   NVFAAAGFTPVPLSNLAEAQADCLLKRVQVRGFHVEKRGVGLTLFWQRGELVSVSAWRC  724



>emb|CDX95633.1| BnaC03g25140D [Brassica napus]
Length=554

 Score =   260 bits (665),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 192/300 (64%), Gaps = 22/300 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              +I AY++FSE SP  QF NFT NQ++LE   GF+RIHI+DFD+GYG QW+SLMQELA  
Sbjct  270   LRIAAYRTFSETSPFLQFVNFTANQSILEL--GFERIHIIDFDVGYGGQWSSLMQELARK  327

Query  2425  NGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss--  2258
              G+   LK+T  A P     ++ EL     NL  FA E+ + FE E L +E L + +   
Sbjct  328   RGSC--LKVTVFAPPPSTVSDEFELRFTEENLRSFAGELKIPFEMELLSLELLLNPAYWP  385

Query  2257  -wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  + A+AVNLPV  + +     LPLIL F+K++ P +VV  D GCDR D PFP+ 
Sbjct  386   LSLRSSQKEAVAVNLPVSSVVSGY---LPLILRFLKQISPNVVVCSDRGCDRNDAPFPNA  442

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD--SDSPEKTQTQHW  1907
             +IHAL  ++ LLESLDA     D+   +E+F ++P IEK +  R      SP       W
Sbjct  443   VIHALQYHTTLLESLDANQSQEDS--SVERFWVRPSIEKLLVKRHRWIERSPP------W  494

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             R++F   GFTP S S  AE+QAEC+++R PV GFHVEKRQSSLV+CWQRKEL++ SAW+C
Sbjct  495   RSLFTQCGFTPASLSQTAETQAECLMQRNPVRGFHVEKRQSSLVMCWQRKELVTVSAWKC  554



>emb|CDY56248.1| BnaA07g37990D [Brassica napus]
Length=601

 Score =   261 bits (667),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 194/306 (63%), Gaps = 26/306 (8%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE---GFDRIHIVDFDIGYGEQWASLMQEL  2435
             F+I AY++FSE SP  QF NFT NQ++LE+     GFDRIHI+DFD+GYG QW+SLMQEL
Sbjct  309   FRIAAYRTFSETSPFLQFVNFTANQSILESCNDELGFDRIHIIDFDVGYGGQWSSLMQEL  368

Query  2434  A-LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
             A        SLKIT  A P     ++ EL     NL  FA E+ + FE E L +E L + 
Sbjct  369   ASRRRNRASSLKITVFAPPPSTVSDEFELRFTEENLRSFAGEVKIPFEIELLSLELLLNP  428

Query  2263  ss---wsdsySEAAIAVNLPVGWLSTNQQVS--LPLILSFVKKLQPKIVVSVDTGCDRTD  2099
             +       S  + A+AVNLPV     N  VS  LPLIL F+K++ P +VV  D GCDR D
Sbjct  429   AYWPVSLRSSEKEAVAVNLPV-----NSVVSGYLPLILRFLKQISPNVVVCSDRGCDRND  483

Query  2098  LPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD--SDSPEK  1925
              PFP+ +IHAL  ++ LLESLDA   + D  + +E+F +QP IEK +  R      SP  
Sbjct  484   APFPNAVIHALQYHTTLLESLDANQGHED--ESVERFWVQPSIEKLLMKRHRWIERSPP-  540

Query  1924  TQTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELIS  1745
                  WR++F   GF+P S S  AE+QAEC+L+R+PV GFHVEKRQ SLV+CWQRKEL++
Sbjct  541   -----WRSLFAQCGFSPASLSQTAEAQAECLLQRSPVRGFHVEKRQGSLVMCWQRKELVT  595

Query  1744  ASAWRC  1727
              S W+C
Sbjct  596   VSTWKC  601



>gb|EAZ31587.1| hypothetical protein OsJ_15728 [Oryza sativa Japonica Group]
Length=558

 Score =   259 bits (663),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 187/299 (63%), Gaps = 15/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDR--IHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SP+ QFANFT  QALL+ +       I ++DFD+G G QWAS +QELA
Sbjct  269   LKLTAYKSFSDLSPVLQFANFTVTQALLDEIASTTASCIRVIDFDLGVGGQWASFLQELA  328

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                G+     P LK+TA  S      LEL + + NL QFA+++ + FEF  + ++  +  
Sbjct  329   HRCGSGGVSLPMLKLTAFVSAASHHPLELHLTQDNLSQFAADLGIPFEFNAINLDAFDPM  388

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                + +  E  +AV+LPVG    + +  LP +L  VK+L PKIVV++D G DR+DLPF  
Sbjct  389   ELIAPTADEV-VAVSLPVG---CSARTPLPAMLQLVKQLAPKIVVAIDYGSDRSDLPFSQ  444

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H ++ L S   LLESLDA   + DA+ KIE+F+IQP +E  V  R  +D     +   WR
Sbjct  445   HFLNCLQSCLCLLESLDAAGTDADAVSKIERFLIQPRVEDAVLGRRRAD-----KAIAWR  499

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             TV  S+GF P   SN AE+QA+C+LKR  V GFHVEKR + L L WQR EL+S SAWRC
Sbjct  500   TVLTSAGFAPQPLSNLAEAQADCLLKRVQVRGFHVEKRGAGLALYWQRGELVSVSAWRC  558



>ref|XP_010524396.1| PREDICTED: scarecrow-like protein 22 [Tarenaya hassleriana]
Length=611

 Score =   261 bits (666),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 189/299 (63%), Gaps = 13/299 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              +I AY++FSE SP  QF NFT NQA+L++LEGFD+IHI+DFD+G+G QWASLMQEL   
Sbjct  318   LRIAAYRAFSETSPFLQFVNFTANQAILDSLEGFDQIHIIDFDVGFGSQWASLMQELVGR  377

Query  2425  NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNsss---s  2258
             N   P LKITA ASP    ++LEL      L  FA E+ +  + E L ++ L        
Sbjct  378   NRAAPPLKITAFASPSTFSDELELRFAEECLRTFAEEVEIPVKIELLCLDLLLDPIHWPL  437

Query  2257  wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHI  2078
                S  + AIAVNLP+   S+     LPLIL F++++ P +VV  D GCDR D PFP+ +
Sbjct  438   RLRSSEKEAIAVNLPI---SSVISGCLPLILRFLRQISPNVVVCSDRGCDRNDAPFPNAV  494

Query  2077  IHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTV  1898
             IHAL  Y++LLESLDA   + D    IE+  +QP +++ +  R         +   WR++
Sbjct  495   IHALQYYTSLLESLDAAKPSSDVADSIERLWLQPSMQRLLVNRHH----WTERAPPWRSL  550

Query  1897  FLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKR--QSSLVLCWQRKELISASAWRC  1727
             F   GFT  S S+ AE+QAEC+++R+P  G HVEKR   SSLVLCWQR EL+S SAW+C
Sbjct  551   FGQGGFTASSVSHAAEAQAECLVQRSPGRGIHVEKRLSSSSLVLCWQRTELVSVSAWKC  609



>emb|CDX89065.1| BnaA04g01210D [Brassica napus]
Length=550

 Score =   259 bits (661),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 195/295 (66%), Gaps = 13/295 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KI AY++FSE SP  QF NFT NQ +LE+L+ FDRIHIVDFD+GYG QW+SL+QELA N
Sbjct  267   LKIAAYRAFSETSPFLQFVNFTANQTILESLDRFDRIHIVDFDVGYGGQWSSLIQELA-N  325

Query  2425  NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEH-LNssssws  2252
               +  SLKIT+ +SP    ++ EL     NL  FA E  + FE E L +E  LN   S  
Sbjct  326   RSSLSSLKITSFSSPSTVSDEFELRFTEENLRAFAGETGVTFEMEMLNMETLLNPPLSLI  385

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  DT     D PFP+ ++ 
Sbjct  386   RSSEKEAIAVNLPISSVISGY---LPLILRFLKQISPNVVVCSDT---IPDAPFPNAVVD  439

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL  Y++LLESL++ N + +A+  IE+F +QP +++ +T R+        ++  WR++F 
Sbjct  440   ALQYYTSLLESLESPNSSQEAVTSIERFCVQPWMQRLLTNRYR----WMEKSPPWRSLFG  495

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
               GFT  + S  AE+QAE +L+R P+ GFH+EKRQSSLVLCWQ++EL++ SAW+C
Sbjct  496   QCGFTAVAMSQTAETQAEYLLQRNPMRGFHLEKRQSSLVLCWQKRELVAVSAWKC  550



>emb|CDX83398.1| BnaA03g21080D [Brassica napus]
Length=590

 Score =   260 bits (664),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 192/300 (64%), Gaps = 22/300 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              +I AY++FSE SP  QF NFT NQ++LE   GF+RIH++DFD+GYG QW+SLMQELA  
Sbjct  306   LRIAAYRTFSETSPFLQFVNFTANQSILEL--GFERIHVIDFDVGYGGQWSSLMQELARK  363

Query  2425  NGTTPSLKITALASPLKQ--EQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss--  2258
              G+   LK+T  A P     ++ EL     NL  FA E+ + FE E L +E L + +   
Sbjct  364   RGSC--LKVTVFAPPPSSVSDEFELRFTEENLRSFAGELKVPFEMELLSLELLLNPAYWP  421

Query  2257  -wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  + A+AVNLPV  + +     LPLIL F+K++ P +VV  D GCDR D PFP+ 
Sbjct  422   LSLRSSEKEAVAVNLPVSSVDSGY---LPLILRFLKQISPNVVVCSDRGCDRNDAPFPNA  478

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD--SDSPEKTQTQHW  1907
             +IHAL  ++ LLESLDA     D+   +E+F ++P IEK +  R      SP       W
Sbjct  479   VIHALQYHTTLLESLDANQSQEDS--SVERFWVRPSIEKLLVKRHRWIERSPP------W  530

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             R++F   GFTP S S  AE+QAEC+++R PV GFHVEKRQSSLV+CWQRKEL++ SAW+C
Sbjct  531   RSLFTQCGFTPASLSQTAETQAECLMQRNPVRGFHVEKRQSSLVMCWQRKELVTVSAWKC  590



>ref|XP_006838154.1| hypothetical protein AMTR_s00106p00100050 [Amborella trichopoda]
 gb|ERN00723.1| hypothetical protein AMTR_s00106p00100050 [Amborella trichopoda]
Length=1509

 Score =   271 bits (692),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 160/212 (75%), Gaps = 6/212 (3%)
 Frame = +1

Query  1     LVVEVPRDFITLSSS----HSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGK--  162
             LV EVPRD    ++S    HS       +++ +   AD   S S  S      N  G   
Sbjct  1289  LVAEVPRDLDNDNTSNCLLHSSKDGTHQLTDDHGMAADVYKSGSECSVPNCTENRPGDAG  1348

Query  163   DVKSVRLDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLS  342
             D KSVR+DISF+S SHTGLQT+ELV+ELT QFPAA PLA+VLKQFLA RSLD SYSGGLS
Sbjct  1349  DRKSVRVDISFESSSHTGLQTTELVRELTGQFPAAIPLAMVLKQFLACRSLDHSYSGGLS  1408

Query  343   SYCLVLLITRFLQHEHHHGRSTIQNYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLYINRE  522
             SYCLVLLI RFLQHEHH GR   QN GS LMDFLYFFG+VFDPRQMR+SIQGSG+Y++RE
Sbjct  1409  SYCLVLLIIRFLQHEHHLGRLLNQNLGSFLMDFLYFFGSVFDPRQMRISIQGSGVYLSRE  1468

Query  523   RGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIK  618
             RG SIDP++IDDPL+PTNN+GRNCFRI QCIK
Sbjct  1469  RGPSIDPLHIDDPLYPTNNIGRNCFRILQCIK  1500



>ref|XP_006397697.1| hypothetical protein EUTSA_v10001784mg [Eutrema salsugineum]
 gb|ESQ39150.1| hypothetical protein EUTSA_v10001784mg [Eutrema salsugineum]
Length=643

 Score =   261 bits (666),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 193/305 (63%), Gaps = 21/305 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE---GFDRIHIVDFDIGYGEQWASLMQEL  2435
              +I AY+SFSE SP  QF NFT NQ++LEA     GF+RIHI+DFD+GYG QW+SLMQEL
Sbjct  348   LRIAAYRSFSETSPFLQFVNFTANQSILEACNDELGFERIHIIDFDVGYGGQWSSLMQEL  407

Query  2434  A----LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHL  2273
             A           SLKIT  A P     ++ EL     NL  FA E+ + FE E L +E L
Sbjct  408   ASGGGGRRRNRASLKITVFAPPPSTVSDEFELRFTEENLRSFAGEVKIPFEIELLSLELL  467

Query  2272  Nssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRT  2102
              + +       S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D GCDR 
Sbjct  468   LNPAYWPISLRSSDKEAIAVNLPIKSVVSGY---LPLILRFIKQISPNVVVCSDRGCDRN  524

Query  2101  DLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKT  1922
             D PFP+ +IHAL  ++ LLESLDA N N D    IE+F +QP IEK +  R         
Sbjct  525   DAPFPNAVIHALQYHTTLLESLDA-NQNQDD-SSIERFWVQPSIEKLLVKRHR----WIE  578

Query  1921  QTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISA  1742
             ++  WR++F   GF+P S S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKEL++ 
Sbjct  579   RSPPWRSLFTQCGFSPASLSQTAEAQAECLLQRNPVRGFHVEKRQSSLVMCWQRKELVTV  638

Query  1741  SAWRC  1727
             SAW+C
Sbjct  639   SAWKC  643



>emb|CDY67934.1| BnaCnng57010D [Brassica napus]
Length=598

 Score =   259 bits (661),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 192/304 (63%), Gaps = 22/304 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE---GFDRIHIVDFDIGYGEQWASLMQEL  2435
              +I AY++FSE SP  QF NFT NQ++LE+     GFDRIHI+DFD+GYG QW+SLMQEL
Sbjct  306   LRIAAYRTFSETSPFLQFVNFTANQSILESCNDELGFDRIHIIDFDVGYGGQWSSLMQEL  365

Query  2434  A-LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
             A        SLKIT  A P     ++ EL     NL  FA E+ + FE E L +E L + 
Sbjct  366   ASRRRNRASSLKITVFAPPPSTVSDEFELRFTEENLRSFAGEVKIPFEIELLSLELLLNP  425

Query  2263  ss---wsdsySEAAIAVNLPVGWLSTNQQVS--LPLILSFVKKLQPKIVVSVDTGCDRTD  2099
             +       S  + A+AVNLPV     N  VS  LP IL F+K++ P +VV  D GCDR D
Sbjct  426   AYWPVSLRSLEKEAVAVNLPV-----NSVVSGYLPFILRFLKQISPNVVVCSDRGCDRND  480

Query  2098  LPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQ  1919
              PFP+ +IHAL  ++ LLESLDA     D  + +E+F +QP IEK +  R         +
Sbjct  481   APFPNAVIHALQYHTTLLESLDANQSQED--ESVERFWVQPSIEKLLMKRHR----WIER  534

Query  1918  TQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISAS  1739
             +Q WR++F   GF+P S S  AE+QAEC+L+R+PV GFHVEKR  SLV+CWQRKEL++ S
Sbjct  535   SQPWRSLFTQCGFSPASLSQTAEAQAECLLQRSPVRGFHVEKRHGSLVMCWQRKELVTVS  594

Query  1738  AWRC  1727
             AW+C
Sbjct  595   AWKC  598



>ref|XP_010506453.1| PREDICTED: scarecrow-like protein 27 [Camelina sativa]
Length=647

 Score =   260 bits (664),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 195/308 (63%), Gaps = 26/308 (8%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE--GFDRIHIVDFDIGYGEQWASLMQELA  2432
              +I AY+SFSE SP  QF NFT NQ++LE+    GFDRIHI+DFD+GYG QW+SLMQELA
Sbjct  351   LRIAAYRSFSETSPFLQFVNFTANQSILESCNDSGFDRIHIIDFDVGYGGQWSSLMQELA  410

Query  2431  ------LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEH  2276
                          SLK+T  A P     ++ EL     NL  FA E+ + FE E L +E 
Sbjct  411   SGGGGGRRRNRASSLKLTVFAPPPSTVSDEFELRFTEENLKTFAGEVKVPFEIELLSIEL  470

Query  2275  LNssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDR  2105
             L + +       S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D GCDR
Sbjct  471   LLNPAYWPLSLRSSEKEAIAVNLPINSVVSGY---LPLILRFLKQISPNVVVCSDRGCDR  527

Query  2104  TDLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTAR--FDSDSP  1931
              D PFP+ +IHAL  +++LLESLDA N N D    +E+F +QP IEK +  R  +   SP
Sbjct  528   NDAPFPNAVIHALQYHTSLLESLDA-NQNQDD-SSVERFWVQPSIEKLLMKRQRWIERSP  585

Query  1930  EKTQTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKEL  1751
                    WR++F   GF+P S S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKEL
Sbjct  586   P------WRSLFTQCGFSPASLSQTAEAQAECLLQRNPVRGFHVEKRQSSLVMCWQRKEL  639

Query  1750  ISASAWRC  1727
             ++ SAW+C
Sbjct  640   VTVSAWKC  647



>gb|EPS65873.1| hypothetical protein M569_08904, partial [Genlisea aurea]
Length=1438

 Score =   268 bits (685),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 152/219 (69%), Gaps = 44/219 (20%)
 Frame = +1

Query  1     LVVEVPRDFITLSSSHSQTPEAQTISEGNPFQADGTSSESSTSPKWPKMNDSGKDVKSVR  180
             LVVEVP D I+  SS   T              DG                     KSVR
Sbjct  1253  LVVEVPHDVISAVSSFETT--------------DG--------------------FKSVR  1278

Query  181   LDISFKSPSHTGLQTSELVKELTEQFPAAKPLALVLKQFLADRSLDQSYSGGLSSYCLVL  360
             LDISFKSP+H+GLQT+ LVK+LTEQ PA  PLALVLKQFLADR LDQSYSGGL+SYCL+L
Sbjct  1279  LDISFKSPTHSGLQTTGLVKDLTEQLPALTPLALVLKQFLADRGLDQSYSGGLNSYCLIL  1338

Query  361   LITRFLQHEHHHGRSTIQ----------NYGSLLMDFLYFFGNVFDPRQMRVSIQGSGLY  510
             LITRFLQHEHHHGR   Q          +YGSLLMDFLYFFGNVFDPRQMR+S+QGSGLY
Sbjct  1339  LITRFLQHEHHHGRPIHQARIRLARRFVSYGSLLMDFLYFFGNVFDPRQMRISVQGSGLY  1398

Query  511   INRERGYSIDPIYIDDPLFPTNNVGRNCFRIHQCIKAFA  627
             +NRERG SIDP+ IDDPL   NNVGRNCFRIHQCIK + 
Sbjct  1399  LNRERGCSIDPLCIDDPLLLANNVGRNCFRIHQCIKVYG  1437



>ref|NP_001047654.1| Os02g0662700 [Oryza sativa Japonica Group]
 dbj|BAD25637.1| Scl1 protein [Oryza sativa Japonica Group]
 dbj|BAD27680.1| Scl1 protein [Oryza sativa Japonica Group]
 dbj|BAF09568.1| Os02g0662700 [Oryza sativa Japonica Group]
Length=531

 Score =   256 bits (654),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 187/299 (63%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDR--IHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SP+ QF NFT  QALL+ + G     IH++DFD+G G QWAS +QELA
Sbjct  241   LKLAAYKSFSDLSPVLQFTNFTATQALLDEIGGMATSCIHVIDFDLGVGGQWASFLQELA  300

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                G      P LK+TA  S      LEL + + NL QFA+E+ + FEF  + ++  N +
Sbjct  301   HRRGAGGMALPLLKLTAFMSTASHHPLELHLTQDNLSQFAAELRIPFEFNAVSLDAFNPA  360

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                S S  E  +AV+LPVG   + +   LP IL  VK+L PK+VV++D G DR DLPF  
Sbjct  361   ELISSSGDEV-VAVSLPVG--CSARAPPLPAILRLVKQLCPKVVVAIDHGGDRADLPFSQ  417

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H ++   S   LL+SLDA  ++ D+  KIE+F+IQP +E  V  R  +      +   WR
Sbjct  418   HFLNCFQSCVFLLDSLDAAGIDADSACKIERFLIQPRVEDAVIGRHKAQ-----KAIAWR  472

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +VF ++GF P   SN AE+QA+C+LKR  V GFHVEKR ++L L WQR EL+S S+WRC
Sbjct  473   SVFAATGFKPVQLSNLAEAQADCLLKRVQVRGFHVEKRGAALTLYWQRGELVSISSWRC  531



>ref|XP_010518129.1| PREDICTED: scarecrow-like protein 27 [Camelina sativa]
Length=647

 Score =   259 bits (662),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 195/307 (64%), Gaps = 25/307 (8%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALE--GFDRIHIVDFDIGYGEQWASLMQELA  2432
              +I AY+SFSE SP  QF NFT NQ++LE+    GFDRIHI+DFD+GYG QW+SLMQELA
Sbjct  352   LRIAAYRSFSETSPFLQFVNFTANQSILESCNDSGFDRIHIIDFDVGYGGQWSSLMQELA  411

Query  2431  -----LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVEHL  2273
                         SLK+T  A P     ++ EL   + NL  FA E+ + FE E L +E L
Sbjct  412   SGGGGRRRNRASSLKLTVFAPPPSTVSDEFELRFTQENLKTFAGEVKVPFEIELLSIELL  471

Query  2272  Nssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRT  2102
              + +       S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D GCDR 
Sbjct  472   LNPAYWPLSLRSSEKEAIAVNLPINSVVSGY---LPLILRFLKQISPNVVVCSDRGCDRN  528

Query  2101  DLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTAR--FDSDSPE  1928
             D PFP+ +IHAL  ++ LLESLDA N N D    +E+F +QP IEK +  R  +   SP 
Sbjct  529   DAPFPNAVIHALQYHTTLLESLDA-NQNQDD-SSVERFWVQPSIEKLLMKRQRWIERSPP  586

Query  1927  KTQTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELI  1748
                   WR++F   GF+P S S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKEL+
Sbjct  587   ------WRSLFTQCGFSPASLSQTAEAQAECLLQRHPVRGFHVEKRQSSLVMCWQRKELV  640

Query  1747  SASAWRC  1727
             + SAW+C
Sbjct  641   TVSAWKC  647



>ref|XP_009138823.1| PREDICTED: scarecrow-like protein 22 [Brassica rapa]
Length=550

 Score =   256 bits (654),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 194/295 (66%), Gaps = 13/295 (4%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              KI AY++FSE SP  QF NFT NQ +LE+L+ FDRIHIVDFD+GYG QW+SL+QELA N
Sbjct  267   LKIAAYRAFSETSPFLQFVNFTANQTILESLDRFDRIHIVDFDVGYGGQWSSLIQELA-N  325

Query  2425  NGTTPSLKITALASPLK-QEQLELGIIRHNLIQFASEINMGFEFETLGVEH-LNssssws  2252
               +  SLKIT+ +SP    ++ EL     NL  FA E  + FE E L +E  LN   S  
Sbjct  326   RSSLSSLKITSFSSPSTVSDEFELRFTEENLRAFAGETGVTFEMEMLNMETLLNPPLSLI  385

Query  2251  dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDHIIH  2072
              S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  DT     D PFP+ ++ 
Sbjct  386   RSSEKEAIAVNLPISSVISGY---LPLILRFLKQISPNVVVCSDT---IPDAPFPNAVVD  439

Query  2071  ALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWRTVFL  1892
             AL  Y++ LESL++ N + +A+  IE+F +QP +++ +T R+        ++  WR++F 
Sbjct  440   ALQYYTSFLESLESPNSSQEAVTSIERFCVQPWMQRLLTNRYR----WMEKSPPWRSLFG  495

Query  1891  SSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
               GFT  + S  AE+QAE +L+R P+ GFH++KRQSSLVLCWQ++EL++ SAW+C
Sbjct  496   QCGFTAVAMSQTAETQAEYLLQRNPMRGFHLDKRQSSLVLCWQKRELVAVSAWKC  550



>ref|XP_009133708.1| PREDICTED: scarecrow-like protein 27 [Brassica rapa]
Length=607

 Score =   257 bits (657),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 191/300 (64%), Gaps = 22/300 (7%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              +I AY++FSE SP  QF NF  NQ++LE   GF+RIH++DFD+GYG QW+SLMQELA  
Sbjct  323   LRIAAYRTFSETSPFLQFVNFPANQSILEL--GFERIHVIDFDVGYGGQWSSLMQELARK  380

Query  2425  NGTTPSLKITALASPLKQ--EQLELGIIRHNLIQFASEINMGFEFETLGVEHLNssss--  2258
              G+   LK+T  A P     ++ EL     NL  FA E+ + FE E L +E L + +   
Sbjct  381   RGSC--LKVTVFAPPPSSVSDEFELRFTEENLRSFAGELKIPFEMELLSLELLLNPAYWP  438

Query  2257  -wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPDH  2081
                 S  + A+AVNLP   LS+     LPLIL F+K++ P +VV  D GCDR D PFP+ 
Sbjct  439   LSLRSSEKEAVAVNLP---LSSVDSGYLPLILRFLKQISPNVVVCSDRGCDRNDAPFPNA  495

Query  2080  IIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFD--SDSPEKTQTQHW  1907
             +IHAL  ++ LLESLDA     D+   +E+F ++P IEK +  R      SP       W
Sbjct  496   VIHALQYHTTLLESLDANQSQEDS--SVERFWVRPSIEKLLVKRHRWIERSPP------W  547

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             R++F   GFTP S S  AE+QAEC+++R PV GFHVEKRQSSLV+CWQRKEL++ SAW+C
Sbjct  548   RSLFTQCGFTPASLSQTAETQAECLMQRNPVRGFHVEKRQSSLVMCWQRKELVTVSAWKC  607



>ref|NP_001053514.1| Os04g0555000 [Oryza sativa Japonica Group]
 emb|CAE01700.2| OSJNBa0010H02.25 [Oryza sativa Japonica Group]
 emb|CAD41636.2| OSJNBb0012E24.1 [Oryza sativa Japonica Group]
 dbj|BAF15428.1| Os04g0555000 [Oryza sativa Japonica Group]
Length=711

 Score =   259 bits (663),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 187/299 (63%), Gaps = 15/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDR--IHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SP+ QFANFT  QALL+ +       I ++DFD+G G QWAS +QELA
Sbjct  422   LKLTAYKSFSDLSPVLQFANFTVTQALLDEIASTTASCIRVIDFDLGVGGQWASFLQELA  481

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                G+     P LK+TA  S      LEL + + NL QFA+++ + FEF  + ++  +  
Sbjct  482   HRCGSGGVSLPMLKLTAFVSAASHHPLELHLTQDNLSQFAADLGIPFEFNAINLDAFDPM  541

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                + +  E  +AV+LPVG    + +  LP +L  VK+L PKIVV++D G DR+DLPF  
Sbjct  542   ELIAPTADEV-VAVSLPVG---CSARTPLPAMLQLVKQLAPKIVVAIDYGSDRSDLPFSQ  597

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H ++ L S   LLESLDA   + DA+ KIE+F+IQP +E  V  R  +D     +   WR
Sbjct  598   HFLNCLQSCLCLLESLDAAGTDADAVSKIERFLIQPRVEDAVLGRRRAD-----KAIAWR  652

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             TV  S+GF P   SN AE+QA+C+LKR  V GFHVEKR + L L WQR EL+S SAWRC
Sbjct  653   TVLTSAGFAPQPLSNLAEAQADCLLKRVQVRGFHVEKRGAGLALYWQRGELVSVSAWRC  711



>ref|NP_001168417.1| hypothetical protein [Zea mays]
 gb|ACN28147.1| unknown [Zea mays]
 tpg|DAA36514.1| TPA: hypothetical protein ZEAMMB73_442357 [Zea mays]
Length=721

 Score =   259 bits (661),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 183/299 (61%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDR--IHIVDFDIGYGEQWASLMQELA  2432
              K+GAYKSFS++SP+ QFANFT  QALL+ +       I I+DFD+G G QWAS +QELA
Sbjct  431   LKLGAYKSFSDLSPVLQFANFTATQALLDEIASTTSSCIRIIDFDLGVGGQWASFLQELA  490

Query  2431  L----NNGTTPSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                   NG  P LK+TA  S      LEL + R NL QFA ++ + FEF  + ++  + +
Sbjct  491   YRRGTGNGPLPMLKLTAFVSSASHHPLELHLTRENLSQFAVDLGIPFEFTAINLDAFDPA  550

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                + S  E  +AV LPVG   + +   LP++L  VK+L PKIVV++D G DR DLPF  
Sbjct  551   ELIAPSADEV-VAVCLPVG--CSARTPPLPMLLQLVKQLAPKIVVAIDHGSDRGDLPFSQ  607

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H ++   S   LL+SLDA   N DA  KIE+F+IQP +E  V  R  ++     +   WR
Sbjct  608   HFMNCFQSCMFLLDSLDAAGTNADAASKIERFLIQPRVEDAVLGRRKAE-----KAMAWR  662

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              VF S+GF P   SN AE+QA+C+LKR  V GFHVEK    L L WQR EL+S SAWRC
Sbjct  663   AVFTSAGFAPVPLSNLAEAQADCLLKRVQVRGFHVEKCGMGLALYWQRGELVSVSAWRC  721



>gb|AGK28600.1| scarecrow-like 6 protein [Dendrocalamus latiflorus]
Length=536

 Score =   253 bits (647),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/300 (46%), Positives = 186/300 (62%), Gaps = 19/300 (6%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDRIHIVDFDIGYGEQWASLMQELALN  2426
              K+ A+K+ S+ SP  QFA+FTT QA L+AL G  R+H+VDFD+G+G QW  LMQELA  
Sbjct  249   LKLAAHKALSDASPTVQFASFTTTQAFLDALGGARRVHVVDFDVGFGGQWPPLMQELAHQ  308

Query  2425  NGTT------PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                T      PSLK+TAL S   +  LEL +   +L +FA+E+ + FEF  +  +    S
Sbjct  309   WRRTAAPLPPPSLKVTALVSLGSRHPLELHLTHESLTRFAAELGIPFEFNAIVFDPFGPS  368

Query  2263  ssws-dsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFP  2087
                   +  + A+AV+LP+G   +      P  L  VK+L+P IVV VD GCDR DLP P
Sbjct  369   PPMGLSATPDEAVAVHLPIG---SGTFSPAPASLRVVKQLRPAIVVCVDHGCDRGDLPLP  425

Query  2086  DHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHW  1907
              H +  L S + LLESLDA   +PD + K+E+F+++P +E+ V    D   P       W
Sbjct  426   RHALSLLRSCAALLESLDAAGASPDVVTKVEQFVLRPRVERLVLG--DKLPP-------W  476

Query  1906  RTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
              ++F S+GF P   SN AE+QAEC+L+RT   GFHVEKRQ++LVL WQ+ EL+S SAWRC
Sbjct  477   ESMFSSTGFVPLQLSNAAEAQAECLLRRTANHGFHVEKRQAALVLWWQQSELVSVSAWRC  536



>ref|XP_010508207.1| PREDICTED: scarecrow-like protein 27 [Camelina sativa]
Length=652

 Score =   255 bits (652),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 150/309 (49%), Positives = 192/309 (62%), Gaps = 27/309 (9%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEAL----EGFDRIHIVDFDIGYGEQWASLMQE  2438
              +I AY+SFSE SP  QF NFT NQ++LE       GFDRIHI+DFD+GYG QW+SLMQE
Sbjct  355   LRIAAYRSFSETSPFLQFVNFTANQSILEESCNNDSGFDRIHIIDFDVGYGGQWSSLMQE  414

Query  2437  LA-----LNNGTTPSLKITALASPLK--QEQLELGIIRHNLIQFASEINMGFEFETLGVE  2279
             LA            SLK+T  A P     ++ EL     NL  FA E+ + FE E L +E
Sbjct  415   LASGGGGRRRNRASSLKLTVFAPPPSTVSDEFELRFTEENLKTFAGELKVPFEIELLSIE  474

Query  2278  HLNssss---wsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCD  2108
              L + +       S  + AIAVNLP+  + +     LPLIL F+K++ P +VV  D GCD
Sbjct  475   LLLNPAYWPLSLRSSEKEAIAVNLPINSVVSGY---LPLILRFLKQISPNVVVCSDRGCD  531

Query  2107  RTDLPFPDHIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTAR--FDSDS  1934
             R D PFP+ +IHAL  ++ LLESLDA N N D    +E+F +QP IEK +  R  +   S
Sbjct  532   RNDAPFPNAVIHALQYHTTLLESLDA-NQNQDD-SSVERFWVQPSIEKLLMKRQRWIERS  589

Query  1933  PEKTQTQHWRTVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKE  1754
             P       WR++F   GF+P   S  AE+QAEC+L+R PV GFHVEKRQSSLV+CWQRKE
Sbjct  590   PP------WRSLFTQCGFSPAGLSQTAEAQAECLLQRNPVRGFHVEKRQSSLVMCWQRKE  643

Query  1753  LISASAWRC  1727
             L++ SAW+C
Sbjct  644   LVTVSAWKC  652



>gb|EEE57522.1| hypothetical protein OsJ_07831 [Oryza sativa Japonica Group]
Length=691

 Score =   256 bits (654),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 187/299 (63%), Gaps = 14/299 (5%)
 Frame = -2

Query  2605  FKIGAYKSFSEVSPMPQFANFTTNQALLEALEGFDR--IHIVDFDIGYGEQWASLMQELA  2432
              K+ AYKSFS++SP+ QF NFT  QALL+ + G     IH++DFD+G G QWAS +QELA
Sbjct  401   LKLAAYKSFSDLSPVLQFTNFTATQALLDEIGGMATSCIHVIDFDLGVGGQWASFLQELA  460

Query  2431  LNNGTT----PSLKITALASPLKQEQLELGIIRHNLIQFASEINMGFEFETLGVEHLNss  2264
                G      P LK+TA  S      LEL + + NL QFA+E+ + FEF  + ++  N +
Sbjct  461   HRRGAGGMALPLLKLTAFMSTASHHPLELHLTQDNLSQFAAELRIPFEFNAVSLDAFNPA  520

Query  2263  sswsdsySEAAIAVNLPVGWLSTNQQVSLPLILSFVKKLQPKIVVSVDTGCDRTDLPFPD  2084
                S S  E  +AV+LPVG   + +   LP IL  VK+L PK+VV++D G DR DLPF  
Sbjct  521   ELISSSGDEV-VAVSLPVG--CSARAPPLPAILRLVKQLCPKVVVAIDHGGDRADLPFSQ  577

Query  2083  HIIHALHSYSNLLESLDAVNMNPDALQKIEKFMIQPGIEKTVTARFDSDSPEKTQTQHWR  1904
             H ++   S   LL+SLDA  ++ D+  KIE+F+IQP +E  V  R  +      +   WR
Sbjct  578   HFLNCFQSCVFLLDSLDAAGIDADSACKIERFLIQPRVEDAVIGRHKAQ-----KAIAWR  632

Query  1903  TVFLSSGFTPFSFSNFAESQAECVLKRTPVGGFHVEKRQSSLVLCWQRKELISASAWRC  1727
             +VF ++GF P   SN AE+QA+C+LKR  V GFHVEKR ++L L WQR EL+S S+WRC
Sbjct  633   SVFAATGFKPVQLSNLAEAQADCLLKRVQVRGFHVEKRGAALTLYWQRGELVSISSWRC  691



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8235674524640