BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24384_g1_i2 len=1502 path=[5973:0-337 2155:338-453 158:454-478
2294:479-654 511:655-680 2495:681-1040 2855:1041-1501]

Length=1502
                                                                      Score     E

ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                634   0.0      
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                631   0.0      
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                629   0.0      
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  627   0.0      
ref|XP_003534146.1|  PREDICTED: beta-glucosidase 44                     606   0.0      
gb|ACU24532.1|  unknown                                                 603   0.0      Glycine max [soybeans]
gb|EYU40222.1|  hypothetical protein MIMGU_mgv1a004735mg                603   0.0      
gb|KDP41124.1|  hypothetical protein JCGZ_03615                         603   0.0      
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                602   0.0      
ref|XP_011084444.1|  PREDICTED: beta-glucosidase 44-like                599   0.0      
ref|XP_007152698.1|  hypothetical protein PHAVU_004G151800g             599   0.0      
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                596   0.0      
gb|KDO62882.1|  hypothetical protein CISIN_1g010049mg                   591   0.0      
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                595   0.0      
ref|XP_004512738.1|  PREDICTED: beta-glucosidase 44-like                594   0.0      
gb|KDO62881.1|  hypothetical protein CISIN_1g010049mg                   590   0.0      
gb|KEH16707.1|  glycoside hydrolase family 1 protein                    593   0.0      
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                592   0.0      
ref|XP_006451661.1|  hypothetical protein CICLE_v10008010mg             588   0.0      
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                591   0.0      
gb|KDO62878.1|  hypothetical protein CISIN_1g010049mg                   590   0.0      
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     590   0.0      
ref|XP_004161840.1|  PREDICTED: beta-glucosidase 44-like                589   0.0      
gb|AGV54748.1|  beta-glucosidase 44-like protein                        588   0.0      
ref|XP_004137494.1|  PREDICTED: beta-glucosidase 44-like                587   0.0      
ref|XP_010032608.1|  PREDICTED: beta-glucosidase 44-like                587   0.0      
ref|XP_006451662.1|  hypothetical protein CICLE_v10008010mg             587   0.0      
ref|XP_008462973.1|  PREDICTED: beta-glucosidase 44-like                585   0.0      
gb|KEH16706.1|  glycoside hydrolase family 1 protein                    585   0.0      
gb|KCW83978.1|  hypothetical protein EUGRSUZ_B00859                     583   0.0      
ref|XP_007036679.1|  B-S glucosidase 44 isoform 1                       582   0.0      
ref|XP_007036681.1|  B-S glucosidase 44 isoform 3                       583   0.0      
gb|KCW83975.1|  hypothetical protein EUGRSUZ_B00859                     580   0.0      
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             579   0.0      
gb|KCW83977.1|  hypothetical protein EUGRSUZ_B00859                     579   0.0      
ref|XP_010097587.1|  Beta-glucosidase 44                                579   0.0      
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                578   0.0      
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                577   0.0      
ref|XP_010465882.1|  PREDICTED: beta-glucosidase 44                     577   0.0      
gb|KCW83979.1|  hypothetical protein EUGRSUZ_B00859                     577   0.0      
ref|XP_010032621.1|  PREDICTED: beta-glucosidase 44-like                577   0.0      
ref|XP_010032630.1|  PREDICTED: beta-glucosidase 44-like                577   0.0      
gb|KCW83982.1|  hypothetical protein EUGRSUZ_B00859                     577   0.0      
gb|KCW83987.1|  hypothetical protein EUGRSUZ_B00860                     576   0.0      
gb|KCW83981.1|  hypothetical protein EUGRSUZ_B00859                     577   0.0      
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                577   0.0      
ref|NP_188436.1|  beta-glucosidase 44                                   577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                577   0.0      
ref|XP_008240180.1|  PREDICTED: beta-glucosidase 44-like                576   0.0      
ref|XP_008810053.1|  PREDICTED: beta-glucosidase 1-like                 576   0.0      
ref|XP_002533126.1|  beta-glucosidase, putative                         576   0.0      Ricinus communis
gb|KEH16708.1|  glycoside hydrolase family 1 protein                    571   0.0      
gb|KDO62884.1|  hypothetical protein CISIN_1g010049mg                   570   0.0      
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                573   0.0      
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                572   0.0      
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     571   0.0      Vitis vinifera
emb|CAN74265.1|  hypothetical protein VITISV_040977                     569   0.0      Vitis vinifera
gb|EPS65829.1|  beta-mannosidase                                        567   0.0      
ref|XP_008374823.1|  PREDICTED: beta-glucosidase 44-like                568   0.0      
ref|XP_009347765.1|  PREDICTED: beta-glucosidase 44-like                567   0.0      
ref|XP_002322085.1|  glycosyl hydrolase family 1 family protein         567   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039106.1|  PREDICTED: beta-glucosidase 44-like                566   0.0      
gb|KFK39134.1|  beta-glucosidase 44                                     563   0.0      
ref|XP_002322086.2|  hypothetical protein POPTR_0015s04280g             563   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW83985.1|  hypothetical protein EUGRSUZ_B00859                     554   0.0      
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             559   0.0      
gb|KHN23728.1|  Beta-glucosidase 44                                     556   0.0      
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             555   0.0      
gb|KFK39133.1|  beta-glucosidase 44                                     553   0.0      
ref|XP_007033096.1|  B-S glucosidase 44                                 553   0.0      
ref|XP_009394432.1|  PREDICTED: beta-glucosidase 1-like                 552   0.0      
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     550   0.0      
ref|XP_002883106.1|  beta-glucosidase                                   550   0.0      
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                548   0.0      
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     547   0.0      
ref|XP_010922562.1|  PREDICTED: beta-glucosidase 1-like                 547   0.0      
emb|CDY18494.1|  BnaA01g27010D                                          548   0.0      
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                547   0.0      
emb|CDO98378.1|  unnamed protein product                                542   0.0      
ref|XP_007033088.1|  Beta-glucosidase 44                                544   0.0      
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                543   0.0      
gb|KDO63132.1|  hypothetical protein CISIN_1g046891mg                   543   0.0      
ref|XP_006430656.1|  hypothetical protein CICLE_v10013386mg             543   0.0      
ref|XP_006644213.1|  PREDICTED: beta-glucosidase 1-like                 541   0.0      
gb|ABC55716.1|  beta-mannosidase 3                                      541   0.0      
gb|ABC55717.1|  beta-mannosidase 2                                      541   0.0      
emb|CDX95557.1|  BnaC01g34490D                                          540   0.0      
emb|CDX95558.1|  BnaC01g34500D                                          539   0.0      
ref|XP_006431835.1|  hypothetical protein CICLE_v10004010mg             539   0.0      
ref|XP_010906974.1|  PREDICTED: beta-glucosidase 1-like                 539   0.0      
ref|XP_009113523.1|  PREDICTED: beta-glucosidase 44                     539   0.0      
ref|XP_006832849.1|  hypothetical protein AMTR_s00095p00053110          538   0.0      
gb|ABC55718.1|  beta-mannosidase 1                                      537   0.0      
ref|XP_006471035.1|  PREDICTED: beta-glucosidase 44-like                538   0.0      
ref|XP_010314225.1|  PREDICTED: beta-glucosidase 44-like isoform X2     536   0.0      
ref|XP_006482389.1|  PREDICTED: beta-glucosidase 44-like                536   0.0      
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                537   0.0      Vitis vinifera
gb|KCW83983.1|  hypothetical protein EUGRSUZ_B00859                     533   0.0      
ref|XP_010257433.1|  PREDICTED: beta-glucosidase 44-like isoform X1     536   0.0      
ref|XP_010257596.1|  PREDICTED: beta-glucosidase 44-like isoform X3     535   0.0      
ref|XP_010257514.1|  PREDICTED: beta-glucosidase 44-like isoform X2     536   0.0      
gb|KDO63131.1|  hypothetical protein CISIN_1g036937mg                   534   0.0      
ref|XP_007048474.1|  Beta-glucosidase 44                                536   0.0      
ref|XP_008792825.1|  PREDICTED: beta-glucosidase 1-like                 534   0.0      
ref|XP_006430653.1|  hypothetical protein CICLE_v10013421mg             533   0.0      
ref|NP_001043156.1|  Os01g0508000                                       532   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY74244.1|  hypothetical protein OsI_02124                          532   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006430655.1|  hypothetical protein CICLE_v10013521mg             532   0.0      
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       531   0.0      
ref|XP_004157213.1|  PREDICTED: beta-glucosidase 44-like                530   0.0      
ref|XP_004140826.1|  PREDICTED: beta-glucosidase 44-like                530   0.0      
ref|XP_006482390.1|  PREDICTED: beta-glucosidase 44-like                529   1e-180   
ref|XP_006376723.1|  hypothetical protein POPTR_0012s04670g             530   2e-180   
ref|XP_007036680.1|  B-S glucosidase 44 isoform 2                       526   4e-180   
gb|ABR17739.1|  unknown                                                 526   1e-179   Picea sitchensis
ref|XP_006845279.1|  hypothetical protein AMTR_s00005p00266150          525   2e-179   
ref|XP_008811965.1|  PREDICTED: beta-glucosidase 1-like isoform X1      525   5e-179   
dbj|BAB02019.1|  beta-glucosidase                                       523   2e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811966.1|  PREDICTED: beta-glucosidase 1-like isoform X2      522   8e-178   
ref|XP_008457084.1|  PREDICTED: beta-glucosidase 44-like                521   2e-177   
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                521   2e-177   
ref|XP_010916341.1|  PREDICTED: beta-glucosidase 1-like                 521   2e-177   
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             520   2e-177   
ref|NP_188435.2|  beta glucosidase 43                                   518   1e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                508   1e-172   
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                506   2e-171   
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                505   2e-171   
ref|XP_008453769.1|  PREDICTED: beta-glucosidase 44-like                504   4e-171   
gb|AEV76986.1|  beta-glucosidase 4                                      497   3e-168   
emb|CBI33559.3|  unnamed protein product                                489   7e-166   
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             490   2e-165   
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             489   2e-165   
ref|XP_008655551.1|  PREDICTED: beta-glucosidase 1-like                 489   4e-164   
ref|XP_009394053.1|  PREDICTED: beta-glucosidase 26-like                485   1e-163   
ref|XP_006845277.1|  hypothetical protein AMTR_s00005p00265710          483   5e-163   
gb|KHN44611.1|  Beta-glucosidase 44                                     480   5e-163   
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          481   3e-162   
ref|XP_003562544.1|  PREDICTED: beta-glucosidase 26                     481   6e-162   
gb|AFW79802.1|  hypothetical protein ZEAMMB73_091278                    480   4e-161   
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     476   7e-161   
gb|ACF07998.1|  beta-glucosidase                                        478   1e-160   Hordeum vulgare subsp. vulgare [barley]
gb|EMT08337.1|  Beta-glucosidase 44                                     477   2e-160   
gb|KDO62879.1|  hypothetical protein CISIN_1g010049mg                   473   4e-160   
gb|AAA87339.1|  beta-glucosidase                                        476   7e-160   Hordeum vulgare [barley]
ref|XP_004958541.1|  PREDICTED: beta-glucosidase 26-like                477   1e-159   
ref|XP_006658055.1|  PREDICTED: beta-glucosidase 26-like                474   2e-159   
emb|CDM80087.1|  unnamed protein product                                474   4e-159   
ref|NP_001142124.1|  uncharacterized protein LOC100274288 precursor     472   2e-158   Zea mays [maize]
gb|EMS60983.1|  Beta-glucosidase 26                                     473   2e-158   
ref|XP_002464026.1|  hypothetical protein SORBIDRAFT_01g010825          474   3e-158   Sorghum bicolor [broomcorn]
ref|XP_002461141.1|  hypothetical protein SORBIDRAFT_02g041550          471   5e-158   Sorghum bicolor [broomcorn]
ref|NP_001148821.1|  LOC100282438 precursor                             471   8e-158   Zea mays [maize]
ref|NP_001151026.1|  LOC100284659 precursor                             473   8e-158   Zea mays [maize]
pdb|4JIE|A  Chain A, Structural Analysis And Insights Into Glycon...    470   1e-157   
gb|ACL52625.1|  unknown                                                 470   1e-157   Zea mays [maize]
gb|ACF35791.1|  beta-mannosidase/beta-glucosidase                       469   2e-157   Oryza sativa Indica Group [Indian rice]
gb|EMT23872.1|  Beta-glucosidase 44                                     470   2e-157   
sp|A3BMZ5.1|BGL26_ORYSJ  RecName: Full=Beta-glucosidase 26; Short...    469   3e-157   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 471   4e-157   
ref|NP_001051014.1|  Os03g0703100                                       468   4e-156   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76023.1|  hypothetical protein OsI_13187                          468   5e-156   Oryza sativa Indica Group [Indian rice]
gb|ACG44181.1|  non-cyanogenic beta-glucosidase precursor               462   5e-155   Zea mays [maize]
ref|XP_006495386.1|  PREDICTED: beta-glucosidase 44-like                460   7e-155   
ref|XP_008665263.1|  PREDICTED: beta-glucosidase 7-like                 462   1e-154   
gb|ADP02192.1|  putative non-cyanogenic beta-glucosidase                462   2e-154   
ref|XP_004982055.1|  PREDICTED: beta-glucosidase 7-like isoform X1      461   6e-154   
ref|XP_003559510.1|  PREDICTED: beta-glucosidase 8-like                 463   7e-154   
ref|XP_002464027.1|  hypothetical protein SORBIDRAFT_01g010830          459   4e-153   Sorghum bicolor [broomcorn]
ref|XP_004982054.1|  PREDICTED: beta-glucosidase 8-like                 460   9e-153   
ref|XP_006651730.1|  PREDICTED: beta-glucosidase 7-like                 456   1e-152   
ref|NP_001051013.1|  Os03g0703000                                       456   2e-152   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90056.1|  predicted protein                                      456   3e-152   
pdb|3SCN|A  Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant       455   4e-152   
pdb|3SCP|A  Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant       455   4e-152   
pdb|3SCR|A  Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant       455   5e-152   
ref|XP_004982056.1|  PREDICTED: beta-glucosidase 7-like isoform X2      456   5e-152   
pdb|3SCV|A  Chain A, Crystal Structure Of Rice Bglu1 E386gS334A M...    455   5e-152   
pdb|2RGL|A  Chain A, Rice Bglu1 Beta-Glucosidase, A Plant Exogluc...    455   5e-152   
tpg|DAA50882.1|  TPA: hypothetical protein ZEAMMB73_806821              451   6e-152   
gb|AAA84906.3|  beta-glucosidase                                        455   1e-151   
gb|EEC69164.1|  hypothetical protein OsI_38122                          454   1e-151   Oryza sativa Indica Group [Indian rice]
pdb|3F4V|A  Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Pl...    454   2e-151   
pdb|3SCW|A  Chain A, Crystal Structure Of Rice Bglu1 E386gY341A M...    453   2e-151   
ref|XP_003559509.1|  PREDICTED: beta-glucosidase 7-like isoform X1      452   2e-150   
ref|XP_010237292.1|  PREDICTED: beta-glucosidase 38-like                451   2e-150   
ref|XP_006664007.1|  PREDICTED: beta-glucosidase 38-like                451   3e-150   
ref|XP_003559508.1|  PREDICTED: beta-glucosidase 7-like                 451   3e-150   
ref|NP_001066656.1|  Os12g0420100                                       449   8e-150   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95520.1|  Putative Glycosyl hydrolase family 1 protein            451   1e-148   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98426.1|  Glycosyl hydrolase family 1 protein, expressed          439   4e-147   Oryza sativa Japonica Group [Japonica rice]
emb|CDM83785.1|  unnamed protein product                                441   2e-146   
gb|EEE54664.1|  hypothetical protein OsJ_01954                          438   4e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506331.1|  PREDICTED: beta-glucosidase 43-like isoform X2     431   2e-145   
ref|XP_010506324.1|  PREDICTED: beta-glucosidase 43-like isoform X1     431   5e-145   
ref|XP_010257753.1|  PREDICTED: beta-glucosidase 44-like isoform X4     436   7e-145   
ref|XP_010257808.1|  PREDICTED: beta-glucosidase 44-like isoform X5     436   9e-145   
ref|XP_004963948.1|  PREDICTED: beta-glucosidase 38-like                427   7e-141   
gb|AFW69221.1|  hypothetical protein ZEAMMB73_365784                    427   8e-141   
ref|XP_008644990.1|  PREDICTED: beta-glucosidase 38-like                429   1e-140   
gb|EMS48652.1|  Beta-glucosidase 7                                      419   8e-138   
gb|ADP02193.1|  Glyco_hydro_1 domain-containing protein                 421   3e-137   
gb|EMS63424.1|  Beta-glucosidase 38                                     416   1e-136   
ref|XP_002438912.1|  hypothetical protein SORBIDRAFT_10g028060          414   5e-136   Sorghum bicolor [broomcorn]
ref|NP_001064347.1|  Os10g0323500                                       411   1e-134   Oryza sativa Japonica Group [Japonica rice]
gb|ABK95221.1|  unknown                                                 404   2e-134   Populus trichocarpa [western balsam poplar]
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    411   2e-134   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66726.1|  hypothetical protein OsI_33062                          410   3e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                405   4e-132   
gb|EMT31426.1|  Beta-glucosidase 1                                      403   2e-131   
gb|EMS62097.1|  Beta-glucosidase 7                                      404   2e-131   
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          402   7e-131   Sorghum bicolor [broomcorn]
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             400   2e-130   
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 400   4e-130   
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             398   1e-129   
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     398   1e-129   
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 399   2e-129   
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         397   6e-129   
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                396   9e-129   
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             396   1e-128   
tpg|DAA44055.1|  TPA: hypothetical protein ZEAMMB73_095768              392   1e-128   
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     395   1e-128   
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    394   3e-128   
ref|XP_007045908.1|  Beta glucosidase 40 isoform 2                      392   3e-128   
ref|NP_001049358.1|  Os03g0212800                                       395   5e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      394   5e-128   
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     394   7e-128   
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                393   7e-128   
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    393   8e-128   
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    393   8e-128   
gb|EEC74750.1|  hypothetical protein OsI_10506                          394   8e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 394   1e-127   
gb|EEE58575.1|  hypothetical protein OsJ_09895                          394   1e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                393   2e-127   
ref|XP_010521463.1|  PREDICTED: beta-glucosidase 40-like isoform X3     392   2e-127   
ref|XP_010109366.1|  Beta-glucosidase 40                                392   2e-127   
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     393   2e-127   
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      393   2e-127   
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     393   2e-127   
ref|XP_010910032.1|  PREDICTED: beta-glucosidase 25 isoform X4          389   3e-127   
gb|KEH16705.1|  glycoside hydrolase family 1 protein                    385   4e-127   
gb|KHN20526.1|  Beta-glucosidase 40                                     391   6e-127   
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     391   6e-127   
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           391   8e-127   Populus trichocarpa [western balsam poplar]
gb|EAZ28287.1|  hypothetical protein OsJ_12262                          388   9e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658980.1|  PREDICTED: uncharacterized protein LOC100502...    389   9e-127   
gb|EMS46293.1|  Beta-glucosidase 34                                     391   9e-127   
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             390   1e-126   
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           390   2e-126   
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          389   3e-126   
ref|XP_003607794.1|  Beta-glucosidase                                   389   4e-126   
gb|AFW89226.1|  hypothetical protein ZEAMMB73_293984                    387   5e-126   
ref|XP_003637785.1|  Beta-glucosidase                                   381   6e-126   
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             389   7e-126   
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    389   8e-126   
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           388   1e-125   
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          387   1e-125   
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          387   2e-125   
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     388   2e-125   
gb|EMT21383.1|  Beta-glucosidase 6                                      387   2e-125   
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    387   3e-125   
ref|XP_002967460.1|  hypothetical protein SELMODRAFT_267120             387   3e-125   
ref|NP_001268161.1|  beta-glucosidase precursor                         387   5e-125   
ref|XP_002316096.2|  hydroxyisourate hydrolase family protein           386   8e-125   Populus trichocarpa [western balsam poplar]
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 386   8e-125   
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                385   1e-124   
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 385   2e-124   
dbj|BAO04176.1|  hypothetical protein                                   385   2e-124   
gb|AAM61600.1|  beta-glucosidase, putative                              384   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960254.1|  hypothetical protein SELMODRAFT_163827             385   3e-124   
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                385   3e-124   
gb|AHC04401.1|  beta-glucosidase 1                                      384   3e-124   
ref|NP_173978.1|  beta glucosidase 40                                   385   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 384   3e-124   
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                385   4e-124   
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             384   4e-124   
gb|KDO74406.1|  hypothetical protein CISIN_1g015181mg                   380   4e-124   
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                384   5e-124   
emb|CBI27264.3|  unnamed protein product                                385   6e-124   
gb|KGN47642.1|  hypothetical protein Csa_6G366400                       383   7e-124   
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             382   1e-123   
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                382   2e-123   
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    382   3e-123   
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             382   3e-123   
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                382   3e-123   
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                382   3e-123   
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                382   3e-123   
ref|XP_004144181.1|  PREDICTED: beta-glucosidase 40-like                382   3e-123   
ref|XP_007021152.1|  Beta glucosidase 41 isoform 3                      377   4e-123   
ref|XP_009631811.1|  PREDICTED: beta-glucosidase 40                     382   4e-123   
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40-like isoform 2      382   4e-123   
emb|CDX85027.1|  BnaC05g20280D                                          381   5e-123   
ref|XP_010482861.1|  PREDICTED: putative beta-glucosidase 41 isof...    382   5e-123   
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                381   6e-123   
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         381   7e-123   
ref|XP_003614037.1|  Beta-glucosidase                                   379   7e-123   
ref|XP_009119981.1|  PREDICTED: putative beta-glucosidase 41            381   7e-123   
ref|XP_008445464.1|  PREDICTED: beta-glucosidase 40                     381   8e-123   
emb|CDY64930.1|  BnaCnng45520D                                          381   8e-123   
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         381   8e-123   
emb|CDY42461.1|  BnaA10g08370D                                          381   8e-123   
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    381   9e-123   
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     380   1e-122   
ref|XP_002866052.1|  glycosyl hydrolase family 1 protein                381   1e-122   
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    381   1e-122   
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    381   2e-122   
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      380   2e-122   
ref|XP_006370585.1|  linamarase family protein                          380   2e-122   
ref|XP_006475282.1|  PREDICTED: putative beta-glucosidase 41-like       380   2e-122   
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             380   2e-122   
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     380   2e-122   
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     380   2e-122   
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    380   2e-122   
ref|XP_009802933.1|  PREDICTED: beta-glucosidase 40-like                379   2e-122   
gb|EMS62098.1|  Beta-glucosidase 8                                      381   3e-122   
ref|XP_008450457.1|  PREDICTED: cyanogenic beta-glucosidase-like        379   3e-122   
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    379   3e-122   
ref|XP_007021151.1|  Beta glucosidase 41 isoform 2                      377   3e-122   
ref|XP_010443033.1|  PREDICTED: putative beta-glucosidase 41            380   4e-122   
emb|CDY61627.1|  BnaA08g19770D                                          379   5e-122   
dbj|BAJ98823.1|  predicted protein                                      379   6e-122   
ref|XP_004151252.1|  PREDICTED: beta-glucosidase 24-like                379   7e-122   
ref|XP_007133707.1|  hypothetical protein PHAVU_011G202000g             379   8e-122   
gb|AES96995.2|  beta-glucosidase                                        378   1e-121   
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            378   1e-121   
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                377   1e-121   
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            377   1e-121   
ref|XP_002437464.1|  hypothetical protein SORBIDRAFT_10g027600          378   1e-121   
ref|XP_002512097.1|  beta-glucosidase, putative                         377   2e-121   
gb|EYU28848.1|  hypothetical protein MIMGU_mgv1a004935mg                377   2e-121   
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                377   2e-121   
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     377   3e-121   
ref|NP_200268.3|  beta glucosidase 41                                   377   4e-121   
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                376   5e-121   
ref|XP_006365136.1|  PREDICTED: beta-glucosidase 40-like                376   7e-121   
ref|XP_004228406.1|  PREDICTED: beta-glucosidase 40                     376   8e-121   
ref|XP_007207081.1|  hypothetical protein PRUPE_ppa024434mg             376   8e-121   
ref|XP_011095298.1|  PREDICTED: putative beta-glucosidase 41 isof...    376   8e-121   
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      375   1e-120   
ref|XP_002512138.1|  beta-glucosidase, putative                         375   1e-120   
gb|AES76414.2|  glycoside hydrolase family 1 protein                    375   2e-120   
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    374   2e-120   
ref|XP_007133703.1|  hypothetical protein PHAVU_011G201700g             375   2e-120   
ref|XP_003620196.1|  Beta-glucosidase D2                                375   2e-120   
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         377   3e-120   
ref|XP_004154617.1|  PREDICTED: beta-glucosidase 24-like                374   4e-120   
emb|CBI20471.3|  unnamed protein product                                376   5e-120   
gb|ABF98424.1|  Glycosyl hydrolase family 1 protein, expressed          370   5e-120   
gb|KEH26885.1|  glycoside hydrolase family 1 protein                    372   5e-120   
ref|XP_002979348.1|  hypothetical protein SELMODRAFT_228612             373   5e-120   
gb|ABF98425.1|  Glycosyl hydrolase family 1 protein, expressed          366   5e-120   
emb|CDY20561.1|  BnaC07g12280D                                          374   6e-120   
ref|XP_006452124.1|  hypothetical protein CICLE_v10008012mg             374   6e-120   
emb|CBI27265.3|  unnamed protein product                                374   6e-120   
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     373   9e-120   
ref|XP_006360112.1|  PREDICTED: putative beta-glucosidase 41-like       373   1e-119   
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     373   1e-119   
ref|XP_008390041.1|  PREDICTED: beta-glucosidase 40-like                372   1e-119   
ref|XP_007014882.1|  Beta-glucosidase 17                                372   2e-119   
ref|XP_004244167.1|  PREDICTED: putative beta-glucosidase 41            372   2e-119   
ref|XP_007211440.1|  hypothetical protein PRUPE_ppa007195mg             367   3e-119   
ref|XP_010267073.1|  PREDICTED: beta-glucosidase 12-like isoform X1     372   3e-119   
ref|XP_006851185.1|  hypothetical protein AMTR_s00043p00189470          371   4e-119   
ref|XP_009347257.1|  PREDICTED: beta-glucosidase 13-like                371   5e-119   
ref|XP_004297253.1|  PREDICTED: beta-glucosidase 40-like isoform 1      374   5e-119   
ref|XP_008241169.1|  PREDICTED: beta-glucosidase 12-like                371   6e-119   
ref|XP_010062938.1|  PREDICTED: putative beta-glucosidase 41            371   6e-119   
gb|KEH30277.1|  cyanogenic beta-glucosidase, putative                   368   7e-119   
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             370   7e-119   
ref|XP_003620203.1|  Beta-glucosidase D4                                371   9e-119   
ref|XP_007150405.1|  hypothetical protein PHAVU_005G150600g             370   9e-119   
ref|XP_006659573.1|  PREDICTED: beta-glucosidase 27-like                370   1e-118   
ref|XP_008450458.1|  PREDICTED: beta-glucosidase 12-like                370   1e-118   
ref|XP_007221103.1|  hypothetical protein PRUPE_ppa017484mg             370   1e-118   
ref|XP_004154675.1|  PREDICTED: beta-glucosidase 12-like                370   1e-118   
ref|XP_002992345.1|  hypothetical protein SELMODRAFT_162259             369   1e-118   
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     370   1e-118   
ref|XP_004515054.1|  PREDICTED: beta-glucosidase 12-like isoform X2     370   1e-118   
ref|XP_008229217.1|  PREDICTED: beta-glucosidase 12-like                370   1e-118   
gb|KGN66450.1|  hypothetical protein Csa_1G611270                       370   2e-118   
ref|XP_007208264.1|  hypothetical protein PRUPE_ppa015887mg             370   2e-118   
gb|KDP20205.1|  hypothetical protein JCGZ_07925                         370   2e-118   
ref|XP_004507316.1|  PREDICTED: beta-glucosidase 12-like                369   2e-118   
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 370   2e-118   
ref|XP_002512144.1|  beta-glucosidase, putative                         365   3e-118   
ref|XP_008801184.1|  PREDICTED: beta-glucosidase 31-like                369   3e-118   
ref|XP_011027871.1|  PREDICTED: beta-glucosidase 24-like                369   4e-118   
gb|EYU19188.1|  hypothetical protein MIMGU_mgv1a004736mg                369   5e-118   
gb|EMT00720.1|  Beta-glucosidase 1                                      370   5e-118   
ref|XP_007203079.1|  hypothetical protein PRUPE_ppa023565mg             368   5e-118   
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    369   5e-118   
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                369   6e-118   
ref|XP_007219276.1|  hypothetical protein PRUPE_ppa018404mg             368   7e-118   
ref|XP_003620192.1|  Beta-glucosidase                                   368   8e-118   
gb|ABW76288.1|  beta-glucosidase G3                                     368   8e-118   
ref|XP_009615935.1|  PREDICTED: putative beta-glucosidase 41            368   8e-118   
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                368   9e-118   
gb|AFK35893.1|  unknown                                                 368   1e-117   
ref|XP_001771505.1|  predicted protein                                  369   1e-117   
gb|EYU28850.1|  hypothetical protein MIMGU_mgv1a004939mg                366   1e-117   
gb|KEH30276.1|  cyanogenic beta-glucosidase, putative                   368   1e-117   
ref|XP_008245651.1|  PREDICTED: beta-glucosidase 12-like                368   1e-117   
gb|KEH30278.1|  cyanogenic beta-glucosidase, putative                   367   1e-117   
gb|ABY48758.1|  glycosylhydrolase 1                                     367   1e-117   
ref|XP_009769966.1|  PREDICTED: putative beta-glucosidase 41            367   1e-117   
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             366   1e-117   
ref|XP_007131968.1|  hypothetical protein PHAVU_011G055700g             363   1e-117   
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     368   1e-117   
ref|XP_007133702.1|  hypothetical protein PHAVU_011G201700g             363   2e-117   
ref|XP_006844763.1|  hypothetical protein AMTR_s00016p00257720          367   2e-117   
ref|XP_007150413.1|  hypothetical protein PHAVU_005G151400g             366   2e-117   
ref|XP_007203718.1|  hypothetical protein PRUPE_ppa019137mg             366   2e-117   
dbj|BAB09336.1|  beta-glucosidase                                       367   2e-117   
dbj|BAD10730.1|  putative beta-glucosidase isozyme 2 precursor          364   3e-117   
ref|XP_008229774.1|  PREDICTED: cyanogenic beta-glucosidase-like        363   3e-117   
ref|XP_010265850.1|  PREDICTED: beta-glucosidase 12-like                367   4e-117   
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  365   4e-117   
emb|CDP00417.1|  unnamed protein product                                367   5e-117   
ref|XP_009382669.1|  PREDICTED: beta-glucosidase 32-like isoform X2     367   6e-117   
ref|XP_006660771.1|  PREDICTED: beta-glucosidase 30-like isoform X1     365   7e-117   
ref|XP_009382668.1|  PREDICTED: beta-glucosidase 32-like isoform X1     367   8e-117   
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                366   8e-117   
ref|XP_002512137.1|  beta-glucosidase, putative                         361   9e-117   
ref|XP_002285582.1|  PREDICTED: beta-glucosidase 12-like                365   9e-117   
ref|XP_004515055.1|  PREDICTED: beta-glucosidase 12-like                365   1e-116   
ref|XP_002512142.1|  beta-glucosidase, putative                         363   1e-116   
gb|EYU28849.1|  hypothetical protein MIMGU_mgv1a004939mg                365   1e-116   
dbj|BAK08154.1|  predicted protein                                      357   1e-116   
gb|KDP25142.1|  hypothetical protein JCGZ_22677                         365   1e-116   
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      365   2e-116   
ref|XP_010446113.1|  PREDICTED: putative beta-glucosidase 41            358   2e-116   
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         365   2e-116   
ref|XP_011075589.1|  PREDICTED: beta-glucosidase 6                      365   2e-116   
ref|XP_006661377.1|  PREDICTED: beta-glucosidase 30-like                364   2e-116   
ref|NP_001062201.1|  Os08g0509200                                       364   2e-116   
ref|XP_007206744.1|  hypothetical protein PRUPE_ppa025067mg             365   2e-116   
ref|XP_007208652.1|  hypothetical protein PRUPE_ppa020368mg             365   2e-116   
gb|AAF04007.1|AF163097_1  dalcochinin 8'-O-beta-glucoside beta-gl...    365   3e-116   
gb|ACD65510.1|  beta-glucosidase D2                                     364   3e-116   
ref|XP_008228992.1|  PREDICTED: beta-glucosidase 12-like                364   3e-116   
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             364   3e-116   
ref|XP_007220362.1|  hypothetical protein PRUPE_ppa015970mg             364   3e-116   
gb|KHN28382.1|  Putative beta-glucosidase 41                            363   4e-116   
gb|KEH30766.1|  glycoside hydrolase family 1 protein                    364   4e-116   
ref|XP_001765414.1|  predicted protein                                  363   4e-116   
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                363   4e-116   
ref|XP_010267075.1|  PREDICTED: beta-glucosidase 12-like isoform X3     360   5e-116   
ref|XP_002992401.1|  hypothetical protein SELMODRAFT_135249             362   5e-116   
ref|XP_009373430.1|  PREDICTED: cyanogenic beta-glucosidase-like        360   5e-116   
gb|AAK07429.1|AF321287_1  beta-glucosidase                              365   5e-116   
gb|KGN57944.1|  hypothetical protein Csa_3G402970                       358   6e-116   
gb|AEX13814.1|  beta-glucosidase                                        365   6e-116   
gb|ACD65509.2|  beta-glucosidase D4                                     363   6e-116   
ref|XP_009373432.1|  PREDICTED: beta-glucosidase 12-like                361   6e-116   
gb|AEB61486.1|  beta-glucosidase                                        363   6e-116   
ref|XP_007220127.1|  hypothetical protein PRUPE_ppa020817mg             362   7e-116   
ref|XP_004505421.1|  PREDICTED: putative beta-glucosidase 41-like       363   8e-116   
ref|XP_002438325.1|  hypothetical protein SORBIDRAFT_10g012220          360   9e-116   
gb|ACN41025.1|  unknown                                                 363   1e-115   
ref|XP_004164648.1|  PREDICTED: beta-glucosidase 12-like                362   1e-115   
ref|XP_002986009.1|  hypothetical protein SELMODRAFT_271823             362   1e-115   
ref|XP_011007095.1|  PREDICTED: vicianin hydrolase-like                 362   1e-115   
ref|XP_008450455.1|  PREDICTED: beta-glucosidase 12-like                362   1e-115   
sp|Q75W17.1|FURH_VIBFR  RecName: Full=Furcatin hydrolase; Short=F...    363   2e-115   
emb|CDP05824.1|  unnamed protein product                                362   2e-115   
ref|XP_003539378.1|  PREDICTED: beta-glucosidase 12-like                363   2e-115   
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41-like...    362   2e-115   
ref|XP_004965309.1|  PREDICTED: beta-glucosidase 30-like isoform X1     362   2e-115   
ref|XP_007206382.1|  hypothetical protein PRUPE_ppa017981mg             362   2e-115   
ref|XP_009355663.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    362   2e-115   
ref|XP_010265852.1|  PREDICTED: beta-glucosidase 12-like                362   2e-115   
ref|XP_004507318.1|  PREDICTED: non-cyanogenic beta-glucosidase-like    362   2e-115   
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                362   2e-115   
ref|XP_009355662.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    362   3e-115   
ref|XP_010044986.1|  PREDICTED: beta-glucosidase 13-like                362   3e-115   
ref|XP_010092278.1|  Putative beta-glucosidase 41                       361   3e-115   
sp|A3RF67.1|BAGBG_DALNI  RecName: Full=Isoflavonoid 7-O-beta-apio...    363   3e-115   
gb|KEH26881.1|  glycoside hydrolase family 1 protein                    357   3e-115   
ref|XP_009356955.1|  PREDICTED: beta-glucosidase 11-like isoform X2     361   4e-115   
ref|XP_002981889.1|  hypothetical protein SELMODRAFT_268527             362   5e-115   
ref|XP_009364758.1|  PREDICTED: beta-glucosidase 13-like                361   5e-115   
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          361   5e-115   
gb|AAV34606.1|  beta-glycosidase                                        362   5e-115   
ref|XP_006855558.1|  hypothetical protein AMTR_s00057p00221950          361   6e-115   
ref|XP_008347516.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    361   6e-115   
gb|AES67732.2|  glycoside hydrolase family 1 protein                    361   6e-115   
ref|XP_010267846.1|  PREDICTED: putative beta-glucosidase 41 isof...    359   7e-115   
gb|KHG13868.1|  Putative beta-glucosidase 41 -like protein              360   7e-115   
gb|KHN25274.1|  Beta-glucosidase 24                                     361   8e-115   
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    360   9e-115   
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             358   9e-115   
ref|XP_008450456.1|  PREDICTED: cyanogenic beta-glucosidase-like        361   9e-115   
ref|XP_003597509.1|  Beta-glucosidase D2                                360   9e-115   
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     360   9e-115   
ref|XP_004957196.1|  PREDICTED: beta-glucosidase 30-like                360   1e-114   
ref|XP_008241170.1|  PREDICTED: beta-glucosidase 12-like                360   1e-114   
dbj|BAK06497.1|  predicted protein                                      360   1e-114   
dbj|BAJ93012.1|  predicted protein                                      360   1e-114   
ref|XP_007205247.1|  hypothetical protein PRUPE_ppa006167mg             357   1e-114   
ref|XP_010413600.1|  PREDICTED: beta-glucosidase 16                     360   2e-114   
ref|XP_009364765.1|  PREDICTED: beta-glucosidase 13-like                360   2e-114   



>ref|XP_009757932.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=515

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/365 (81%), Positives = 326/365 (89%), Gaps = 6/365 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             D+SPE++ F+TGGLSRESFP GF+FGTA+SAYQVEGA      GRGPSIWDTF+K PG+E
Sbjct  30    DISPEKLSFDTGGLSRESFPKGFIFGTATSAYQVEGAASTD--GRGPSIWDTFIKRPGVE  87

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
             PNNA GEVAVDQYHRYK DIDL+  LNF+AYRFSISW+RIFPNGTGKVNWKGVAYYNRLI
Sbjct  88    PNNANGEVAVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLI  147

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +YMLE+GITPYANLNHYDLPQAL+DRY GWL R+VV+DYADYAEFCFK FGDRVKNWFSF
Sbjct  148   DYMLERGITPYANLNHYDLPQALQDRYNGWLSREVVKDYADYAEFCFKTFGDRVKNWFSF  207

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEPRVVAALGYDTGFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AAQRYR  YQ
Sbjct  208   NEPRVVAALGYDTGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHATAAQRYREKYQ  267

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  526
              KQKG+FGILLDFVWYEPLTR KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG R
Sbjct  268   EKQKGKFGILLDFVWYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGKR  327

Query  525   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  346
             LP+FT +EVK+VKGSID +GINQYT +Y+YDP+  TP    YQ DWNVGFAY R GVPIG
Sbjct  328   LPKFTKEEVKMVKGSIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIG  387

Query  345   PRVHS  331
             PR HS
Sbjct  388   PRAHS  392



>ref|XP_009600118.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=515

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/365 (81%), Positives = 325/365 (89%), Gaps = 6/365 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             DV PE++ F+TGGLSRESFP GF+FGTA+SAYQVEGA      GRGPSIWDTF+K PG+E
Sbjct  30    DVLPEKLSFDTGGLSRESFPKGFIFGTATSAYQVEGAASTE--GRGPSIWDTFIKRPGVE  87

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
             PNNA GEVAVDQYHRYK DIDL+  LNF+AYRFSISW+RIFPNGTGKVNWKGVAYYNRLI
Sbjct  88    PNNANGEVAVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLI  147

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +YMLE+GITPYANLNHYDLPQAL+DRY GWL R+VV+DYADYAEFCFK FGDRVKNWFSF
Sbjct  148   DYMLERGITPYANLNHYDLPQALQDRYNGWLSREVVKDYADYAEFCFKTFGDRVKNWFSF  207

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEPRVVAALGYDTGFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AA+RYR  YQ
Sbjct  208   NEPRVVAALGYDTGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHASAAKRYREKYQ  267

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  526
              KQKG+FGILLDFVWYEPLTR KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNI+G R
Sbjct  268   EKQKGKFGILLDFVWYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNILGKR  327

Query  525   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  346
             LP+FT +EVK+VKGSID +GINQYT +Y+YDP+  TP    YQ DWNVGFAY R GVPIG
Sbjct  328   LPKFTKEEVKMVKGSIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIG  387

Query  345   PRVHS  331
             PR HS
Sbjct  388   PRAHS  392



>ref|XP_006341563.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=512

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/365 (81%), Positives = 325/365 (89%), Gaps = 6/365 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             DVSPE    +TGGLSRESFP GF+FGTA+SAYQVEG+      GRGPSIWDTFLK PGLE
Sbjct  27    DVSPENTILDTGGLSRESFPKGFIFGTATSAYQVEGSASTE--GRGPSIWDTFLKIPGLE  84

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
             PNNA GE+AVDQYHRYK DIDLM KLNF+AYRFSISW+RIFPNGTG+VNWKGVAYYNRLI
Sbjct  85    PNNANGEIAVDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGEVNWKGVAYYNRLI  144

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +YML++GITPYANLNHYDLPQAL+DRY GWLGR+VV+D+ADYAEFCFK FGDRVKNWFSF
Sbjct  145   DYMLKRGITPYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFSF  204

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEPRVVAALGYD GFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AAQRYR  YQ
Sbjct  205   NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHASAAQRYREKYQ  264

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  526
              KQKG+FGILLDFVWYEPLT+ KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG R
Sbjct  265   EKQKGKFGILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTR  324

Query  525   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  346
             LP+F+ +EVK+VKGS DYVGINQYT++Y+YDP+  TP    YQ DWNVGFAY R GVPIG
Sbjct  325   LPKFSKEEVKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIG  384

Query  345   PRVHS  331
             PR HS
Sbjct  385   PRAHS  389



>ref|NP_001234620.1| beta-mannosidase enzyme precursor [Solanum lycopersicum]
 gb|AAL37714.1|AF403444_1 beta-mannosidase enzyme [Solanum lycopersicum]
 gb|AAL37719.1|AF413204_1 beta-mannosidase [Solanum lycopersicum]
Length=514

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/364 (81%), Positives = 323/364 (89%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             VSPE    +TGGLSRESFP GF FGTA+SAYQVEG+      GRGPSIWDTFLK PGLEP
Sbjct  30    VSPENTILDTGGLSRESFPKGFTFGTATSAYQVEGSASTE--GRGPSIWDTFLKIPGLEP  87

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NNA GE+AVDQYHRYK DIDLM KLNF+AYRFSISW+RIFPNGTGKVNWKGVAYYNRLI+
Sbjct  88    NNANGEIAVDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLID  147

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             YML++GITPYANLNHYDLPQAL+DRY GWLGR+VV+D+ADYAEFCFK FGDRVKNWFSFN
Sbjct  148   YMLKRGITPYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFSFN  207

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AAQRYR  YQ 
Sbjct  208   EPRVVAALGYDNGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHASAAQRYREKYQE  267

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKG+FGILLDFVWYEPLT+ KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG RL
Sbjct  268   KQKGKFGILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRL  327

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+F+ +EVK+VKGS DYVGINQYT++Y+YDP+  TP    YQ DWNVGFAY R GVPIGP
Sbjct  328   PKFSKEEVKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGP  387

Query  342   RVHS  331
             R HS
Sbjct  388   RAHS  391



>ref|XP_003534146.1| PREDICTED: beta-glucosidase 44 [Glycine max]
Length=506

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/364 (78%), Positives = 317/364 (87%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               P+ VRF+TGGLSR++FP GF+FGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  22    AEPQTVRFDTGGLSRDTFPKGFLFGTATSAYQVEGMA--HKDGRGPSIWDVFIKKPGIVA  79

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLIN
Sbjct  80    NNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLIN  139

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+LEKGITPYANL HYDLP ALE+RY G L RQVV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  140   YLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFN  199

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYRA YQ 
Sbjct  200   EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYRAKYQE  259

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RL
Sbjct  260   KQKGRIGILLDFVWYEPLTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRL  319

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  320   PKFTSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  379

Query  342   RVHS  331
             R +S
Sbjct  380   RANS  383



>gb|ACU24532.1| unknown [Glycine max]
Length=506

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/364 (78%), Positives = 316/364 (87%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               P+ VRF+TGGLSR++FP GF+FGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  22    AEPQTVRFDTGGLSRDTFPKGFLFGTATSAYQVEGMA--HKDGRGPSIWDVFIKKPGIVA  79

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLIN
Sbjct  80    NNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLIN  139

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+LEKGITPYANL HYDLP ALE+RY G L RQVV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  140   YLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFN  199

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYRA YQ 
Sbjct  200   EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYRAKYQE  259

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEP TRSKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RL
Sbjct  260   KQKGRIGILLDFVWYEPPTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRL  319

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  320   PKFTSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  379

Query  342   RVHS  331
             R +S
Sbjct  380   RANS  383



>gb|EYU40222.1| hypothetical protein MIMGU_mgv1a004735mg [Erythranthe guttata]
Length=512

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/376 (77%), Positives = 320/376 (85%), Gaps = 12/376 (3%)
 Frame = -3

Query  1428  SIVQC-----DVSPER-VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSI  1267
             S+ QC     D SPE  V  + GGLSR +FP  FVFGTA+SAYQVEG     K GRGPSI
Sbjct  16    SLSQCFTHEDDASPETAVGLDLGGLSRRTFPKNFVFGTAASAYQVEGMAS--KDGRGPSI  73

Query  1266  WDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVN  1087
             WDTF+KTPGLEPNNA+GEV+VDQYH+YK D+DLM KLNFDAYRFSISW+RIFPNGTGKVN
Sbjct  74    WDTFIKTPGLEPNNASGEVSVDQYHKYKDDLDLMAKLNFDAYRFSISWSRIFPNGTGKVN  133

Query  1086  WKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKI  907
              KGVAYYNRLINYML+KGITPY NLNHYDLPQAL+DRY GWLGR+VV+D+ADYAEFCFK 
Sbjct  134   KKGVAYYNRLINYMLKKGITPYPNLNHYDLPQALQDRYKGWLGREVVKDFADYAEFCFKT  193

Query  906   FGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHA  739
             FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT+G+S+TEPY VAHNLIL HA
Sbjct  194   FGDRVKNWQTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTEGDSSTEPYTVAHNLILSHA  253

Query  738   VAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEY  559
              AAQRYR  YQ KQKGR GILLDFVWYEPLT+SKADNYAAQRARDFHIGWF+HP+VYGEY
Sbjct  254   AAAQRYRQKYQKKQKGRIGILLDFVWYEPLTKSKADNYAAQRARDFHIGWFMHPLVYGEY  313

Query  558   PKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVG  379
             PKTMQNIVG RLP+FT DEVK+VKGS D+VGINQYT +Y+YD   + P    YQ DWN G
Sbjct  314   PKTMQNIVGKRLPKFTKDEVKMVKGSFDFVGINQYTAYYIYDAKQENPKNLGYQQDWNSG  373

Query  378   FAYARNGVPIGPRVHS  331
             FAY R+GVPIGPR HS
Sbjct  374   FAYDRHGVPIGPRAHS  389



>gb|KDP41124.1| hypothetical protein JCGZ_03615 [Jatropha curcas]
Length=516

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/363 (78%), Positives = 318/363 (88%), Gaps = 6/363 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
              PE+++F+TGGLSR+SFPAGF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  N
Sbjct  33    QPEKIKFDTGGLSRQSFPAGFLFGTATSAYQVEGMAD--KDGRGPSIWDEFVKIPGIVAN  90

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRLI+Y
Sbjct  91    NATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIDY  150

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ML+KGITPYANL HYDLP ALE +Y G LGRQVV+D+ADYA+FCFK FGDRVKNW +FNE
Sbjct  151   MLKKGITPYANLYHYDLPLALEKKYKGLLGRQVVKDFADYADFCFKTFGDRVKNWMTFNE  210

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G+FAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  YQ K
Sbjct  211   PRVVAALGYDNGYFAPGRCSKAFGNCTAGNSATEPYIVAHNLILSHAAAVQRYREKYQEK  270

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP
Sbjct  271   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLP  330

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR  340
             +FT +E+K+VKGSIDYVGINQYTT+Y+YDP+   P    YQ DWN GFAY +NGV IGPR
Sbjct  331   KFTQEEIKIVKGSIDYVGINQYTTYYMYDPHQSKPKDLGYQQDWNAGFAYEKNGVQIGPR  390

Query  339   VHS  331
              +S
Sbjct  391   ANS  393



>ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max]
Length=515

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/376 (76%), Positives = 318/376 (85%), Gaps = 12/376 (3%)
 Frame = -3

Query  1428  SIVQCDV------SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSI  1267
             S+++C         PE VRF+TGGLSRE+FP GF+FGTA+SAYQVEG    HK GRGPSI
Sbjct  19    SVIRCAAGADAAAEPETVRFDTGGLSRETFPKGFLFGTATSAYQVEGMA--HKDGRGPSI  76

Query  1266  WDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVN  1087
             WD F+K PG+  NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG+VN
Sbjct  77    WDLFIKKPGIVANNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVN  136

Query  1086  WKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKI  907
             WKGVAYYNRLINY+LEKGITPYANL HYDLP ALE+RY G L RQVV D+ADYAEFCFK 
Sbjct  137   WKGVAYYNRLINYLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVNDFADYAEFCFKT  196

Query  906   FGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHA  739
             FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA
Sbjct  197   FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHA  256

Query  738   VAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEY  559
              A QRYR  YQ KQKGR GILLDFVWYEPLTRSKADN AAQRARDFH+GWF+HP+VYGEY
Sbjct  257   AAVQRYREKYQEKQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPLVYGEY  316

Query  558   PKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVG  379
             P T+QNIVG+RLP+FT +EVK+VKGSID+VGINQYTT+Y+YDP+   P +  YQ DWN G
Sbjct  317   PTTIQNIVGNRLPKFTSEEVKIVKGSIDFVGINQYTTYYMYDPHQAKPKVPGYQMDWNAG  376

Query  378   FAYARNGVPIGPRVHS  331
             FAYA+NGVPIGPR +S
Sbjct  377   FAYAKNGVPIGPRAYS  392



>ref|XP_011084444.1| PREDICTED: beta-glucosidase 44-like [Sesamum indicum]
Length=502

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/368 (79%), Positives = 310/368 (84%), Gaps = 9/368 (2%)
 Frame = -3

Query  1422  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
              QCD   E    + GGLSR SFP  FVFGTA+SAYQVEG     K GRGPSIWDTF+K P
Sbjct  17    AQCD---EAESVDLGGLSRRSFPKDFVFGTAASAYQVEGMAS--KGGRGPSIWDTFIKQP  71

Query  1242  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1063
             G EPNNA+GEV+VDQYH+YK DIDLM KLNFDAYRFSISW RIFPNGTGKVN KGVAYYN
Sbjct  72    GREPNNASGEVSVDQYHKYKEDIDLMAKLNFDAYRFSISWPRIFPNGTGKVNKKGVAYYN  131

Query  1062  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  883
             RLINYML+KGITPY NLNHYDLPQAL+DRY GWLGRQVVED+ADYAEFCFK FGDRVKNW
Sbjct  132   RLINYMLKKGITPYPNLNHYDLPQALQDRYNGWLGRQVVEDFADYAEFCFKTFGDRVKNW  191

Query  882   FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  715
              +FNEPRVVAALGYD GFFAPGRCS    NCT+GNSATEPY+VAHNLILCHA A QRYR 
Sbjct  192   QTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTEGNSATEPYIVAHNLILCHAAAVQRYRE  251

Query  714   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  535
              YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIV
Sbjct  252   KYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFMHPLVYGEYPKTMQNIV  311

Query  534   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  355
             G RLP+FT +EVK+VKGS D+VGINQYT +Y+YD          YQ DW  GFAY R+GV
Sbjct  312   GKRLPKFTKEEVKMVKGSFDFVGINQYTAYYMYDAKQTNSKDLGYQQDWQCGFAYDRHGV  371

Query  354   PIGPRVHS  331
             PIGPR HS
Sbjct  372   PIGPRAHS  379



>ref|XP_007152698.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
 gb|ESW24692.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
Length=540

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/364 (78%), Positives = 313/364 (86%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE VRF+TGGLSRE FP GF+ GTA+SAYQVEG    H+ GRGPSIWD F++ PG+  
Sbjct  56    LHPETVRFDTGGLSREVFPKGFIIGTATSAYQVEGMA--HQDGRGPSIWDVFIQKPGIVA  113

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGEV+VDQYHRYK DIDLM KLNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLI+
Sbjct  114   NNGTGEVSVDQYHRYKDDIDLMSKLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLID  173

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+LEKGITPYANL HYDLP ALE+RY G LGRQVV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  174   YLLEKGITPYANLYHYDLPLALEERYNGLLGRQVVKDFADYAEFCFKTFGDRVKNWMTFN  233

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY VAHNLIL HA A QRYR  YQ 
Sbjct  234   EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILSHAAAVQRYREKYQE  293

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYPKT+Q IVG RL
Sbjct  294   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRL  353

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  354   PKFTSEEVKIVKGSIDFVGINQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  413

Query  342   RVHS  331
             R +S
Sbjct  414   RANS  417



>ref|XP_009799689.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=513

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/371 (75%), Positives = 317/371 (85%), Gaps = 7/371 (2%)
 Frame = -3

Query  1428  SIVQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFL  1252
             +++Q D V PE   F+TGGLSR+SFP  FVFGT++SAYQVEGA    K GRGPS+WDTF+
Sbjct  22    TLIQSDNVLPETTVFDTGGLSRDSFPKDFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFI  79

Query  1251  KTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVA  1072
             K PG EPNNA+GEV+ DQYHRYK DIDLMVKLNFDAYRFSISW+RIFPNGTGK+NWKGVA
Sbjct  80    KKPGREPNNASGEVSADQYHRYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVA  139

Query  1071  YYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRV  892
             YYNRLI+YML+KGIT Y NLNHYDLPQAL+D+Y GWL  +VV+D+ADYAEFCFK +GDRV
Sbjct  140   YYNRLIDYMLKKGITSYVNLNHYDLPQALQDKYKGWLSHEVVKDFADYAEFCFKAYGDRV  199

Query  891   KNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQR  724
             KNWFSFNEPRVVA LGY+TG+FAPGRCS    NC  G+SATEPY+VAHNLIL HA AAQR
Sbjct  200   KNWFSFNEPRVVADLGYNTGYFAPGRCSKAFGNCISGDSATEPYIVAHNLILSHAAAAQR  259

Query  723   YRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQ  544
             YR  YQ KQKG+FGI+LDFVW+EPLTRSK DNYAAQRARDF +GWFLHP+VYGEYPKTMQ
Sbjct  260   YRDKYQEKQKGKFGIILDFVWFEPLTRSKVDNYAAQRARDFELGWFLHPLVYGEYPKTMQ  319

Query  543   NIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYAR  364
             NIVG+RLP+FT +EVK+VKGSIDYVGIN YTTFY +D +   P    Y+ DWN  FAY R
Sbjct  320   NIVGNRLPKFTKEEVKMVKGSIDYVGINHYTTFYAFDRHLSKPKALGYRQDWNCAFAYDR  379

Query  363   NGVPIGPRVHS  331
              GVPIGPR HS
Sbjct  380   KGVPIGPRAHS  390



>gb|KDO62882.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62883.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=405

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/361 (77%), Positives = 311/361 (86%), Gaps = 6/361 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
              PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  N
Sbjct  36    QPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVAN  93

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LINY
Sbjct  94    NATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLINY  153

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FNE
Sbjct  154   LLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFNE  213

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ K
Sbjct  214   PRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQK  273

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP
Sbjct  274   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLP  333

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR  340
             +FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPR
Sbjct  334   KFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPR  393

Query  339   V  337
             V
Sbjct  394   V  394



>ref|XP_009624185.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=513

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/371 (75%), Positives = 317/371 (85%), Gaps = 7/371 (2%)
 Frame = -3

Query  1428  SIVQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFL  1252
             +++Q D V PE   F+TGGLSR+SFP GFVFGT++SAYQVEGA    K GRGPS+WD F+
Sbjct  22    NLIQSDNVLPETAVFDTGGLSRDSFPKGFVFGTSTSAYQVEGAAS--KDGRGPSVWDIFI  79

Query  1251  KTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVA  1072
             K PG EPNNA+GEV+ DQYHRYK DIDLMVKLNFDAYRFSISW+RIFPNGTGK+NWKGVA
Sbjct  80    KKPGREPNNASGEVSADQYHRYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVA  139

Query  1071  YYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRV  892
             YYN+LI+Y L+KGITPY NLNHYDLPQAL+D Y GWL  +VV+D+ADYAEFCFK +GDRV
Sbjct  140   YYNKLIDYTLKKGITPYVNLNHYDLPQALQDNYKGWLSHEVVKDFADYAEFCFKTYGDRV  199

Query  891   KNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQR  724
             KNWFSFNEPRVVA LGY+TG+FAPGRCS    NCT G+SATEPY+VAHNLIL HA AAQR
Sbjct  200   KNWFSFNEPRVVADLGYNTGYFAPGRCSKAFGNCTSGDSATEPYIVAHNLILSHAAAAQR  259

Query  723   YRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQ  544
             YR  YQ KQKG+FGI+LDFVW+EPLT+SKADNYAAQRARDF +GWFLHP++YGEYPKTMQ
Sbjct  260   YRDKYQEKQKGKFGIILDFVWFEPLTKSKADNYAAQRARDFELGWFLHPLIYGEYPKTMQ  319

Query  543   NIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYAR  364
             NIVG+RLP+FT +E+K+VKGSIDYVGIN YTTFY YD +   P    Y+ DWN  FAY R
Sbjct  320   NIVGNRLPKFTKEEIKMVKGSIDYVGINHYTTFYAYDRHLSKPKALGYRQDWNCAFAYDR  379

Query  363   NGVPIGPRVHS  331
              G PIGPR HS
Sbjct  380   KGAPIGPRAHS  390



>ref|XP_004512738.1| PREDICTED: beta-glucosidase 44-like [Cicer arietinum]
Length=512

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/361 (78%), Positives = 312/361 (86%), Gaps = 6/361 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E VRF+TGGLSRE FP GFVFG A+SAYQVEG    HK GRGPSIWD F++ PG+  NN 
Sbjct  32    ETVRFDTGGLSREVFPKGFVFGVATSAYQVEGMA--HKDGRGPSIWDVFIQKPGIVANNG  89

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             TG+V+VDQYHRYK DIDLM KLNFDAYRFSISW+RIFPNGTGK+NWKGVAYYNRLI+Y+L
Sbjct  90    TGDVSVDQYHRYKEDIDLMAKLNFDAYRFSISWSRIFPNGTGKLNWKGVAYYNRLIDYLL  149

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             EKGITPYANL HYDLP ALE RY G L   VV+D+ADYA+FCFK FGDRVKNW +FNEPR
Sbjct  150   EKGITPYANLYHYDLPLALELRYKGLLSYDVVKDFADYADFCFKTFGDRVKNWMTFNEPR  209

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYR  YQ KQK
Sbjct  210   VVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYREKYQEKQK  269

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYP+TMQNIVG+RLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPLVYGEYPRTMQNIVGNRLPKF  329

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             T +EVKLVKGSID+VGINQYTT+Y+YDP+   P +  YQ DWNVGFAYA+NGVP+GPR +
Sbjct  330   TKEEVKLVKGSIDFVGINQYTTYYMYDPHKSKPKVPGYQMDWNVGFAYAKNGVPVGPRAY  389

Query  333   S  331
             S
Sbjct  390   S  390



>gb|KDO62881.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=430

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/364 (76%), Positives = 312/364 (86%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  342   RVHS  331
             R +S
Sbjct  393   RANS  396



>gb|KEH16707.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/370 (76%), Positives = 313/370 (85%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             S V     PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K
Sbjct  25    SSVNGVTVPETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGMAS--KEGRGPSIWDVFIK  82

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+  NN TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAY
Sbjct  83    KPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAY  142

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVK
Sbjct  143   YNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLSRNVVKDFADYADFCFKTFGDRVK  202

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY VAHNLIL HA AAQRY
Sbjct  203   NWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILSHAAAAQRY  262

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYP+TMQN
Sbjct  263   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPRTMQN  322

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVG+RLP+FT +EVKLVKGSID+VGINQYTT+Y+YDP+ + P +  YQ+DWN GFAYA+N
Sbjct  323   IVGNRLPKFTKEEVKLVKGSIDFVGINQYTTYYMYDPHNQKPKVPGYQSDWNAGFAYAKN  382

Query  360   GVPIGPRVHS  331
             GVP+GPR +S
Sbjct  383   GVPVGPRAYS  392



>ref|XP_006353826.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=502

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/357 (78%), Positives = 308/357 (86%), Gaps = 7/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGL+RESFP  FVFGT++SAYQVEGA    K GRGPS+WDTF+K PG EPNNA+GEV
Sbjct  28    FDTGGLNRESFPKSFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFIKLPGREPNNASGEV  85

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             + DQYH YK DIDLMVKLNFDAYRFSISW+RIFPNGTGK+NWKGV YYN+LINYML+KGI
Sbjct  86    SADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVTYYNKLINYMLKKGI  145

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PY NLNHYDLPQAL++RY GWL R+VV+D+ADYAEFCFK +GDRVKNWFSFNEPRVVA 
Sbjct  146   APYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKNWFSFNEPRVVAD  205

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LGYDTGFFAPGRCS    NCT G+SATEPY+VAHNLIL HA AA RYR  YQ KQKG+FG
Sbjct  206   LGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILSHAAAAHRYRENYQEKQKGKFG  265

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             I+LDFVWYEPLTRSKADNYAAQRARDF +GWFLHP+VYGEYPKTMQNIV DRLP+FT DE
Sbjct  266   IILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVRDRLPKFTTDE  325

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             +K+VKGSIDYVGIN YTTFY YD   K   +  YQ D N GFA  RNGVPIGPR HS
Sbjct  326   IKMVKGSIDYVGINHYTTFYAYDHLSKLKAL-AYQQDQNCGFANDRNGVPIGPRAHS  381



>ref|XP_006451661.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64901.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=405

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/361 (77%), Positives = 310/361 (86%), Gaps = 6/361 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
              PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  N
Sbjct  36    QPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVAN  93

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LINY
Sbjct  94    NATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLINY  153

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FNE
Sbjct  154   LLKRGITPYANLYHYDLPEALEKKYIGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFNE  213

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHN IL HA A QRYR  Y+ K
Sbjct  214   PRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNSILSHAAAVQRYRQKYEQK  273

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP
Sbjct  274   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLP  333

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR  340
             +FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPR
Sbjct  334   KFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPR  393

Query  339   V  337
             V
Sbjct  394   V  394



>ref|XP_006490742.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=519

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/364 (76%), Positives = 312/364 (86%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKEGRGPSIWDVFAKKPGIVA  92

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKKPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  342   RVHS  331
             R +S
Sbjct  393   RANS  396



>gb|KDO62878.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=519

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/364 (76%), Positives = 312/364 (86%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  342   RVHS  331
             R +S
Sbjct  393   RANS  396



>ref|XP_004252272.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Solanum lycopersicum]
Length=526

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/369 (76%), Positives = 313/369 (85%), Gaps = 7/369 (2%)
 Frame = -3

Query  1425  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             I   +V  E   F+TGGL+RESFP GFVFGT++SAYQVEGA    K GRGPS+WDTF+K 
Sbjct  38    IESDNVLAETTVFDTGGLNRESFPKGFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFIKQ  95

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG EPNNA+GEV+ DQYH YK DIDLMVKLNFDAYRFSISW+RIFPNGT K+NWKGV YY
Sbjct  96    PGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPNGTEKINWKGVTYY  155

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             N+LINYML +GITPY NLNHYDLPQAL++RY GWL R+VV+D+ADYAEFCFK +GDRVKN
Sbjct  156   NKLINYMLFRGITPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKN  215

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  718
             WFSFNEPRVVA LGYDTGFFAPGRCS    NCT G+SATEPY+VAHNLIL HA AA RYR
Sbjct  216   WFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILSHAAAAHRYR  275

Query  717   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  538
               YQ KQKG+FGI+LDFVWYEPLTRSKADNYAAQRARDF +GWFLHP+V+GEYPKTMQNI
Sbjct  276   KNYQEKQKGKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNI  335

Query  537   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG  358
             VG+RLP+FT +E+K+VKGSIDYVGIN YTTFY YD   K   +  YQ D N GFA  RNG
Sbjct  336   VGNRLPKFTTEEIKMVKGSIDYVGINHYTTFYAYDHVSKLKAL-AYQQDQNCGFANDRNG  394

Query  357   VPIGPRVHS  331
             VPIGPR HS
Sbjct  395   VPIGPRAHS  403



>ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=503

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 312/364 (86%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE V F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  
Sbjct  19    MHPETVHFDTGGLSRDSFPKGFIFGTATSAYQVEGMAD--KEGRGPSIWDVFIKKPGIVA  76

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGE++VDQYH+Y +DID+M KLNFDAYRFSISW+RIFPNG GKVNWKGVAYYN+LIN
Sbjct  77    NNGTGEISVDQYHKYPQDIDIMAKLNFDAYRFSISWSRIFPNGRGKVNWKGVAYYNKLIN  136

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLPQALE+ Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  137   YLLKRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFN  196

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+ AH+LIL HA A QRYR  YQ 
Sbjct  197   EPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILSHAAAVQRYRQKYQE  256

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+T+QNIVG+RL
Sbjct  257   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRL  316

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID VGINQYTT+Y+YDP+ +   +  YQ DWN GFAY +NGVPIGP
Sbjct  317   PKFTKEEVKMVKGSIDLVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGP  376

Query  342   RVHS  331
             R HS
Sbjct  377   RAHS  380



>gb|AGV54748.1| beta-glucosidase 44-like protein [Phaseolus vulgaris]
Length=518

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/364 (76%), Positives = 311/364 (85%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE VRF+TGGLSRE FP GF+ GTA+SAYQVEG    H+ GRGPSIWD F++ PG+  
Sbjct  34    LHPETVRFDTGGLSREVFPKGFIIGTATSAYQVEGMA--HQDGRGPSIWDVFIQKPGIVA  91

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGEV+VDQYHRYK DIDLM KLNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLI+
Sbjct  92    NNGTGEVSVDQYHRYKDDIDLMSKLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLID  151

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+LEKGITPYANL HYDLP ALE+RY G LGRQVV+D+ADYAEFCFK FG+RVKNW +FN
Sbjct  152   YLLEKGITPYANLYHYDLPLALEERYNGLLGRQVVKDFADYAEFCFKTFGNRVKNWMTFN  211

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGY  G FAPG+CS    NCT GNS TEPY+VAHNLIL HA A QRYR  YQ 
Sbjct  212   EPRVVAALGYKKGSFAPGKCSKEYGNCTTGNSGTEPYIVAHNLILSHAAAVQRYREKYQE  271

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEP +RSKADNYAAQRARDFHIGWF+HP+VYGEYPKT+Q IVG RL
Sbjct  272   KQKGRIGILLDFVWYEPFSRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRL  331

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  332   PKFTSEEVKIVKGSIDFVGINQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  391

Query  342   RVHS  331
             R +S
Sbjct  392   RANS  395



>ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN64162.1| hypothetical protein Csa_1G042700 [Cucumis sativus]
Length=503

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/361 (76%), Positives = 310/361 (86%), Gaps = 6/361 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E V F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  NN 
Sbjct  22    ETVHFDTGGLSRDSFPKGFIFGTATSAYQVEGMAD--KEGRGPSIWDVFIKKPGIVANNG  79

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             TGE++VDQYH+Y +DID+M KLNFDAYRFSISW+RIFPNG GKVNWKGVAYYN+LINY+L
Sbjct  80    TGEISVDQYHKYPQDIDIMAKLNFDAYRFSISWSRIFPNGRGKVNWKGVAYYNKLINYLL  139

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             ++GITPYANL HYDLPQALE+ Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FNEPR
Sbjct  140   KRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFNEPR  199

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VVAALGYD GFFAPGRCS    NCT GNS TEPY+ AH+LIL HA A QRYR  YQ KQK
Sbjct  200   VVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILSHAAAVQRYRQKYQEKQK  259

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+T+QNIVG+RLP+F
Sbjct  260   GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRLPKF  319

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             T +EVK+VKGSID VGINQYTT+Y+YDP+ +   +  YQ DWN GFAY +NGVPIGPR H
Sbjct  320   TKEEVKMVKGSIDLVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGPRAH  379

Query  333   S  331
             S
Sbjct  380   S  380



>ref|XP_010032608.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/370 (75%), Positives = 310/370 (84%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V PE  RF+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIPETTRFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLINY+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_006451662.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64902.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=519

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/364 (76%), Positives = 311/364 (85%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYIGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHN IL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNSILSHAAAVQRYRQKYEQ  272

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  342   RVHS  331
             R +S
Sbjct  393   RANS  396



>ref|XP_008462973.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=507

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 311/364 (85%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             V PE V F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  
Sbjct  23    VQPETVHFDTGGLSRDSFPKGFIFGTATSAYQVEGMAD--KEGRGPSIWDVFIKKPGIVA  80

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGE++VDQYHRY +DID+M KLNFDAYRFSISW+RIFPNG  KVNWKGVAYYN+LIN
Sbjct  81    NNGTGEISVDQYHRYPQDIDIMAKLNFDAYRFSISWSRIFPNGRRKVNWKGVAYYNKLIN  140

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLPQALE+ Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  141   YLLKRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFN  200

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NC  GNS TEPY+VAH+LIL HA A QRYR  YQ 
Sbjct  201   EPRVVAALGYDNGFFAPGRCSKAYGNCRAGNSGTEPYIVAHHLILSHAAAVQRYRQKYQE  260

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+T+Q IVG+RL
Sbjct  261   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFLHPIVYGEYPRTVQEIVGNRL  320

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGSID+VGINQYTT+Y+YDP+ +   +  YQ DWN GFAY ++GVPIGP
Sbjct  321   PKFTKEEVKMVKGSIDFVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKHGVPIGP  380

Query  342   RVHS  331
             R HS
Sbjct  381   RAHS  384



>gb|KEH16706.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/370 (76%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             S V+    PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K
Sbjct  25    SSVKGVTVPETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGIAS--KEGRGPSIWDVFIK  82

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+  NN TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAY
Sbjct  83    KPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAY  142

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVK
Sbjct  143   YNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLNRNVVKDFADYADFCFKTFGDRVK  202

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRV+AALGYDTGFFAPGRCS    NCT GNS TEPY+VAHNLIL HA AAQRY
Sbjct  203   NWMTFNEPRVIAALGYDTGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAAQRY  262

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKG  GILLD VWYE LTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+TMQ 
Sbjct  263   RQKYQEKQKGSIGILLDLVWYESLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTMQT  322

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVG+RLP+FT +EV LVKGSID+VGINQYTTFYVYDP  + P +  YQ DWN  FAYA+N
Sbjct  323   IVGNRLPKFTKEEVNLVKGSIDFVGINQYTTFYVYDPRQQKPKVPGYQKDWNAEFAYAKN  382

Query  360   GVPIGPRVHS  331
             GVP+GPR +S
Sbjct  383   GVPVGPREYS  392



>gb|KCW83978.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/370 (74%), Positives = 310/370 (84%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_007036679.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
 gb|EOY21180.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
Length=513

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/366 (75%), Positives = 308/366 (84%), Gaps = 6/366 (2%)
 Frame = -3

Query  1416  CDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1237
               V PE V+ +TGGLSRESFP GFVFGTA+SAYQVEG       GRGPSIWD F+K PG+
Sbjct  27    SQVQPETVKLDTGGLSRESFPKGFVFGTATSAYQVEGMASGD--GRGPSIWDVFVKIPGI  84

Query  1236  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1057
                NATGEV+VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRL
Sbjct  85    VAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRL  144

Query  1056  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  877
             I+ +L++GITPYANL HYDLP+ALE RY G L  QVV+D+AD+A+FCFK FGDRVKNW +
Sbjct  145   IDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNWMT  204

Query  876   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL H  A QRYR  Y
Sbjct  205   FNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILAHGAAVQRYRLKY  264

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+
Sbjct  265   QPKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGN  324

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  349
             RLP+FT +EVK+VKGSID+VGINQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPI
Sbjct  325   RLPKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPI  384

Query  348   GPRVHS  331
             GPR +S
Sbjct  385   GPRANS  390



>ref|XP_007036681.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
 gb|EOY21182.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
Length=532

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/366 (75%), Positives = 308/366 (84%), Gaps = 6/366 (2%)
 Frame = -3

Query  1416  CDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1237
               V PE V+ +TGGLSRESFP GFVFGTA+SAYQVEG       GRGPSIWD F+K PG+
Sbjct  27    SQVQPETVKLDTGGLSRESFPKGFVFGTATSAYQVEGMASGD--GRGPSIWDVFVKIPGI  84

Query  1236  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1057
                NATGEV+VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRL
Sbjct  85    VAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRL  144

Query  1056  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  877
             I+ +L++GITPYANL HYDLP+ALE RY G L  QVV+D+AD+A+FCFK FGDRVKNW +
Sbjct  145   IDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNWMT  204

Query  876   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL H  A QRYR  Y
Sbjct  205   FNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILAHGAAVQRYRLKY  264

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+
Sbjct  265   QPKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGN  324

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  349
             RLP+FT +EVK+VKGSID+VGINQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPI
Sbjct  325   RLPKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPI  384

Query  348   GPRVHS  331
             GPR +S
Sbjct  385   GPRANS  390



>gb|KCW83975.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83976.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/370 (74%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLINY+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_007209912.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
 gb|EMJ11111.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
Length=513

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/364 (74%), Positives = 307/364 (84%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE +  +TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  29    LDPESLNLDTGGLSRASFPKGFVFGTATSAYQVEGMA--HKEGRGPSIWDEFIKIPGIVA  86

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGEVAVDQYHRYK+D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRLIN
Sbjct  87    NNGTGEVAVDQYHRYKQDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIN  146

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y++++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  147   YLIKRGITPYANLYHYDLPLALEKKYLGLLNDEVVKDFADYAEFCFKTFGDRVKNWMTFN  206

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAP RCS    NCT GNS+TEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVVAALGYDNGFFAPARCSKAYGNCTAGNSSTEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVGDRL
Sbjct  267   VQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRL  326

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGS+D+VGINQYT +Y+YDP+   P +  YQ DWN GFAY +NGVPIGP
Sbjct  327   PKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNGVPIGP  386

Query  342   RVHS  331
             R +S
Sbjct  387   RAYS  390



>gb|KCW83977.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_010097587.1| Beta-glucosidase 44 [Morus notabilis]
 gb|EXB69119.1| Beta-glucosidase 44 [Morus notabilis]
Length=512

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 310/369 (84%), Gaps = 6/369 (2%)
 Frame = -3

Query  1422  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
                 +SPER+  +TGGLSR SFP GFVFGTA+SAYQVEG T  H+ GRGPSIWD F+KTP
Sbjct  25    ASSSLSPERLDLDTGGLSRASFPKGFVFGTATSAYQVEGMT--HQDGRGPSIWDVFVKTP  82

Query  1242  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1063
             G+  +N T EV VDQYHRY+ D+D+M KLNFDAYRFSISW+RIFP G GKVNWKGVAYYN
Sbjct  83    GIIADNGTAEVTVDQYHRYREDVDIMKKLNFDAYRFSISWSRIFPEGAGKVNWKGVAYYN  142

Query  1062  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  883
             RLINYM+++GITPYANL HYDLP+ALE++Y G L  QVV+D+ADYA+FCFK FGDRVKNW
Sbjct  143   RLINYMIKRGITPYANLYHYDLPEALEEKYLGLLNDQVVKDFADYADFCFKTFGDRVKNW  202

Query  882   FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  715
              +FNEPRVVAALGYD G  APGRCS    NCT GNSATEPY+ AH+LIL HA A QRYR 
Sbjct  203   MTFNEPRVVAALGYDNGLHAPGRCSKEFGNCTAGNSATEPYIAAHHLILSHAAAVQRYRE  262

Query  714   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  535
              YQ  QKGR GIL DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+T+Q IV
Sbjct  263   KYQKTQKGRIGILTDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTIQEIV  322

Query  534   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  355
             G+RLP+FT ++VK+VKGSID+VGINQYT++Y+YDP+   P +  YQ DWNVGFAYA+NG 
Sbjct  323   GERLPKFTKEQVKMVKGSIDFVGINQYTSYYMYDPHASKPKVLGYQQDWNVGFAYAKNGK  382

Query  354   PIGPRVHSK  328
              IGPR +S+
Sbjct  383   LIGPRAYSE  391



>ref|XP_002883107.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59366.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 312/368 (85%), Gaps = 7/368 (2%)
 Frame = -3

Query  1419  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             +   S E+++F+TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  25    ESSPSVEKIKFDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  82

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
                 NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNR
Sbjct  83    TIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNR  142

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+Y+++KGI+PYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCFK FGDRVKNW 
Sbjct  143   LIDYLVQKGISPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWM  202

Query  879   SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +FNEPRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V+H+LIL HA A QRYR  
Sbjct  203   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILAHAAAVQRYRKY  262

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             YQAKQKGR GILLDFVWYEPLTRSKADN AAQRARDFHIGWF+HPIVYGEYPKTMQNIV 
Sbjct  263   YQAKQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVK  322

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  355
             +RLP+FT +EVK+VKGSID+VGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G 
Sbjct  323   ERLPKFTKEEVKMVKGSIDFVGINQYTTYYMSEPHPTTKPKALGYQQDWNVDFGFAKLGK  382

Query  354   PIGPRVHS  331
             PIGPR +S
Sbjct  383   PIGPRAYS  390



>ref|XP_010487722.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/368 (75%), Positives = 310/368 (84%), Gaps = 7/368 (2%)
 Frame = -3

Query  1419  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             +   S + ++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  25    ESSPSIQNIKLDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  82

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
                 NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+G+GKVNWKGVAYYNR
Sbjct  83    TIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPDGSGKVNWKGVAYYNR  142

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+Y+++KGITPYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCFK FGDRVKNW 
Sbjct  143   LIDYLVQKGITPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWM  202

Query  879   SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +FNEPRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V H+LIL HA A QRYR  
Sbjct  203   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILAHAAAVQRYRKY  262

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             YQAKQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV 
Sbjct  263   YQAKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVK  322

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  355
             DRLP+FT +EVK+VKGSIDYVGINQYTT+Y+ +P+  T P    YQ DWNV F +A+ G 
Sbjct  323   DRLPKFTAEEVKMVKGSIDYVGINQYTTYYMSEPHFTTKPKDLGYQQDWNVQFGFAKLGK  382

Query  354   PIGPRVHS  331
             PIGPR HS
Sbjct  383   PIGPRAHS  390



>ref|XP_010465882.1| PREDICTED: beta-glucosidase 44 [Camelina sativa]
Length=513

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 308/364 (85%), Gaps = 7/364 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + ++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    
Sbjct  29    SIQNIKLDTGGLSRKSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAK  86

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNRLI+Y
Sbjct  87    NATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDY  146

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +++KGITPYANL HYDLP ALE +Y G LGRQV+ D+ADYAEFCFK FGDRVKNW +FNE
Sbjct  147   LVQKGITPYANLYHYDLPLALEKKYKGLLGRQVLNDFADYAEFCFKTFGDRVKNWMTFNE  206

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V H+LIL HA A QRYR  YQAK
Sbjct  207   PRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILAHAAAVQRYRKYYQAK  266

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIV DRLP
Sbjct  267   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKDRLP  326

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGP  343
             +FT  EVK+VKGSIDYVGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G PIGP
Sbjct  327   KFTAKEVKMVKGSIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGKPIGP  386

Query  342   RVHS  331
             R HS
Sbjct  387   RAHS  390



>gb|KCW83979.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83980.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_010032621.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
 gb|KCW83984.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_010032630.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/370 (73%), Positives = 310/370 (84%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V PE +RF+TG LSR +FP GF++GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIPETMRFDTGRLSRSAFPKGFIWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG   NNATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGTVANNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLINY+L+KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCF+ FGDRVK
Sbjct  140   YNRLINYLLKKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFETFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD G FAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGIFAPGRCSLAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKGR GILLDF WYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFTWYEPLTRSKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+YDP+     +  YQ DWN G+A+ ++
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKH  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>gb|KCW83982.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=513

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>gb|KCW83987.1| hypothetical protein EUGRSUZ_B00860 [Eucalyptus grandis]
Length=490

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/369 (73%), Positives = 309/369 (84%), Gaps = 6/369 (2%)
 Frame = -3

Query  1425  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             + +  V PE +RF+TG LSR +FP GF++GTA+SAYQVEG  D  K GRGPSIWD F+K 
Sbjct  1     MAEETVIPETMRFDTGRLSRSAFPKGFIWGTATSAYQVEGMAD--KEGRGPSIWDVFVKI  58

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG   NNATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAYY
Sbjct  59    PGTVANNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYY  118

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             NRLINY+L+KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCF+ FGDRVKN
Sbjct  119   NRLINYLLKKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFETFGDRVKN  178

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  718
             W +FNEPRVVAALGYD G FAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRYR
Sbjct  179   WMTFNEPRVVAALGYDNGIFAPGRCSLAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRYR  238

Query  717   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  538
               YQ KQKGR GILLDF WYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ I
Sbjct  239   EKYQEKQKGRIGILLDFTWYEPLTRSKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQEI  298

Query  537   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG  358
             VGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+YDP+     +  YQ DWN G+A+ ++G
Sbjct  299   VGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKHG  358

Query  357   VPIGPRVHS  331
             VPIGPR HS
Sbjct  359   VPIGPRAHS  367



>gb|KCW83981.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  361
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  360   GVPIGPRVHS  331
             GVPIGPR HS
Sbjct  380   GVPIGPRAHS  389



>ref|XP_010243804.1| PREDICTED: beta-glucosidase 44-like [Nelumbo nucifera]
Length=518

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/365 (75%), Positives = 305/365 (84%), Gaps = 6/365 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             D  PE  RF+TGGLSRESFP GFVFGTA+SAYQVEG     K GRGPSIWD F++ PG+ 
Sbjct  33    DAWPETARFDTGGLSRESFPKGFVFGTATSAYQVEGMAS--KEGRGPSIWDVFVRIPGIV  90

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
               NATGE++VDQYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  91    AKNATGEMSVDQYHRYKEDVNLMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  150

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +Y+L KGITPYANL HYDLP ALE +Y G L R+VV D+A++AEFCFK FGDRVKNW +F
Sbjct  151   DYLLAKGITPYANLYHYDLPLALEKKYNGLLSREVVNDFANFAEFCFKTFGDRVKNWMTF  210

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYR  YQ
Sbjct  211   NEPRVVAALGYDNGFFAPGRCSKPYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYREKYQ  270

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  526
             A QKGR GILLDFVWYEPLTR KAD  AAQRARDFH+GWFLHPIVYGEYPKT+QNIVG R
Sbjct  271   AHQKGRIGILLDFVWYEPLTRGKADQQAAQRARDFHVGWFLHPIVYGEYPKTVQNIVGKR  330

Query  525   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  346
             LP+FT +EVK+VKGSID+VGINQYTT+Y+YDP+        YQNDWN GFAYA+ GVPIG
Sbjct  331   LPKFTDEEVKMVKGSIDFVGINQYTTYYMYDPHQTKKQPPGYQNDWNAGFAYAKKGVPIG  390

Query  345   PRVHS  331
             PR +S
Sbjct  391   PRANS  395



>ref|NP_188436.1| beta-glucosidase 44 [Arabidopsis thaliana]
 sp|Q9LV33.1|BGL44_ARATH RecName: Full=Beta-glucosidase 44; Short=AtBGLU44; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02020.1| beta-glucosidase [Arabidopsis thaliana]
 gb|AAM61427.1| beta-glucosidase, putative [Arabidopsis thaliana]
 dbj|BAH19552.1| AT3G18080 [Arabidopsis thaliana]
 dbj|BAH19607.1| AT3G18080 [Arabidopsis thaliana]
 gb|AEE76044.1| beta-glucosidase 44 [Arabidopsis thaliana]
Length=512

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 311/368 (85%), Gaps = 7/368 (2%)
 Frame = -3

Query  1419  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             +  +S E+ + +TGGLSR+SFP GFVFGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  24    ESSLSAEKNKLHTGGLSRQSFPKGFVFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  81

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
                 NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNR
Sbjct  82    KIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNR  141

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+YM++KGITPYANL HYDLP ALE++Y G LGRQVV+D+ADYAEFC+K FGDRVKNW 
Sbjct  142   LIDYMVQKGITPYANLYHYDLPLALENKYKGLLGRQVVKDFADYAEFCYKTFGDRVKNWM  201

Query  879   SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +FNEPRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V H+LIL HA A QRYR  
Sbjct  202   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILAHAAAVQRYRKY  261

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             YQAKQKGR GILLDFVWYEPLTRSKADN AAQRARDFHIGWF+HP+VYGEYPKTMQNIV 
Sbjct  262   YQAKQKGRVGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQNIVK  321

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  355
             +RLP+FT  EVK+VKGSID+VGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G 
Sbjct  322   ERLPKFTEKEVKMVKGSIDFVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGK  381

Query  354   PIGPRVHS  331
             PIGPR +S
Sbjct  382   PIGPRAYS  389



>ref|XP_010506359.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 309/364 (85%), Gaps = 7/364 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + ++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    
Sbjct  29    SIQNIKLDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAK  86

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNRLI+Y
Sbjct  87    NATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDY  146

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +++KGITPYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCFK FGDRVKNW +FNE
Sbjct  147   LVQKGITPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNE  206

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V+H+LIL HA A QRYR  YQAK
Sbjct  207   PRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILAHAAAVQRYRKYYQAK  266

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP
Sbjct  267   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLP  326

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGP  343
             +FT +EVK+VKGSIDYVGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G  IGP
Sbjct  327   KFTAEEVKMVKGSIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVQFGFAKLGKLIGP  386

Query  342   RVHS  331
             R HS
Sbjct  387   RAHS  390



>ref|XP_008240180.1| PREDICTED: beta-glucosidase 44-like [Prunus mume]
Length=513

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/364 (74%), Positives = 306/364 (84%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE +  +TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  29    LDPESLNLDTGGLSRASFPKGFVFGTATSAYQVEGMA--HKEGRGPSIWDEFIKIPGIVA  86

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN TGEVAVDQYHRYK+D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRLIN
Sbjct  87    NNGTGEVAVDQYHRYKQDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIN  146

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y++++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  147   YLIKRGITPYANLYHYDLPLALEKKYLGLLNDKVVKDFADYAEFCFKTFGDRVKNWMTFN  206

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAP RCS    NCT GNS+TEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVVAALGYDNGFFAPARCSKAYGNCTAGNSSTEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVGDRL
Sbjct  267   VQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRL  326

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGS+D+VGINQYT +Y+YDP+   P +  YQ DWN GFAY +N VPIGP
Sbjct  327   PKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNEVPIGP  386

Query  342   RVHS  331
             R +S
Sbjct  387   RAYS  390



>ref|XP_008810053.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=509

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 316/376 (84%), Gaps = 12/376 (3%)
 Frame = -3

Query  1428  SIVQCDV--------SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGP  1273
             ++V+C          +P RVRF+TGGLSRE+FPAGFVFGTA+SAYQVEG     K GRGP
Sbjct  14    AVVRCSAAADAGTTKTPSRVRFDTGGLSREAFPAGFVFGTAASAYQVEGMA--LKDGRGP  71

Query  1272  SIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGK  1093
             SIWD F+K PG   NNAT +V+VD+YHRYK D+++M K+NFDAYRFSISW+RIFPNG GK
Sbjct  72    SIWDVFVKIPGEIANNATADVSVDEYHRYKEDVEIMKKMNFDAYRFSISWSRIFPNGVGK  131

Query  1092  VNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCF  913
             VNWKGVAYYNRLINYML+KGITPYANL HYDLP+ALE +Y GWL  ++VE YADYA+FCF
Sbjct  132   VNWKGVAYYNRLINYMLKKGITPYANLYHYDLPEALEKQYNGWLSSKIVEAYADYADFCF  191

Query  912   KIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAV  736
             KIFGDRVKNWF+FNEPRVVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA 
Sbjct  192   KIFGDRVKNWFTFNEPRVVAALGYDDGKFAPGRCTNCSAGGNSATEPYIVAHNLILSHAA  251

Query  735   AAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP  556
             A +RYR  YQA+QKGR GILLDFVWYEPLT SK D+ AAQRARDFH+GWFLHPI+YGEYP
Sbjct  252   AVKRYREKYQAEQKGRIGILLDFVWYEPLTDSKDDHAAAQRARDFHLGWFLHPIIYGEYP  311

Query  555   KTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVG  379
             KTMQNIV +RLP+FT +EVK+V GSIDYVGINQYT +Y+YD +   P   T Y NDW+V 
Sbjct  312   KTMQNIVKERLPKFTVEEVKMVNGSIDYVGINQYTAYYMYDSHLSEPQKPTRYANDWHVV  371

Query  378   FAYARNGVPIGPRVHS  331
             FAYARNGVPIGPR +S
Sbjct  372   FAYARNGVPIGPRAYS  387



>ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis]
Length=517

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/364 (74%), Positives = 311/364 (85%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             V  +++ F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  
Sbjct  33    VQMDKINFDTGGLSRDSFPEGFLFGTATSAYQVEGMAD--KDGRGPSIWDVFVKVPGIIA  90

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             +N+TGEV+VDQYHRYK+D+D+M KLNFDAYRFSISW+RIFP GTGKVNWKGVAYY+RLI+
Sbjct  91    DNSTGEVSVDQYHRYKQDVDIMQKLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYHRLID  150

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             YML++GITPYANL HYDLP ALE +Y G L RQVV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  151   YMLKRGITPYANLYHYDLPLALEKKYNGLLNRQVVKDFADYADFCFKTFGDRVKNWMTFN  210

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRV+AALGYD GFFAP RCS    NCT G+SATEPY+ AHNLIL HA A QRYR  YQ 
Sbjct  211   EPRVIAALGYDNGFFAPARCSKAFGNCTAGDSATEPYIAAHNLILSHAAAVQRYREKYQE  270

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKG+ GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RL
Sbjct  271   KQKGKIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGTRL  330

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT  EV++VKGSID+VGINQYTT+Y+ DP+   P    YQ DW+ GFAY +NGVP+GP
Sbjct  331   PKFTKQEVEMVKGSIDFVGINQYTTYYISDPHQAKPKYLGYQQDWDAGFAYEKNGVPVGP  390

Query  342   RVHS  331
             + +S
Sbjct  391   KANS  394



>gb|KEH16708.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=408

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/348 (78%), Positives = 298/348 (86%), Gaps = 6/348 (2%)
 Frame = -3

Query  1404  PERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN  1225
             PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K PG+  NN
Sbjct  33    PETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGMAS--KEGRGPSIWDVFIKKPGIVANN  90

Query  1224  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1045
              TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAYYNRLI+Y+
Sbjct  91    GTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAYYNRLIDYL  150

Query  1044  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  865
             LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVKNW +FNEP
Sbjct  151   LEKGITPYANLYHYDLPLALELKYNGLLSRNVVKDFADYADFCFKTFGDRVKNWMTFNEP  210

Query  864   RVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  697
             RVVAALGYD GFFAPGRCS    NCT GNS TEPY VAHNLIL HA AAQRYR  YQ KQ
Sbjct  211   RVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILSHAAAAQRYREKYQEKQ  270

Query  696   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  517
             KGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYP+TMQNIVG+RLP+
Sbjct  271   KGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPRTMQNIVGNRLPK  330

Query  516   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFA  373
             FT +EVKLVKGSID+VGINQYTT+Y+YDP+ + P +  YQ+DWN GFA
Sbjct  331   FTKEEVKLVKGSIDFVGINQYTTYYMYDPHNQKPKVPGYQSDWNAGFA  378



>gb|KDO62884.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=411

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/350 (77%), Positives = 300/350 (86%), Gaps = 6/350 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFA  373
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFA
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFA  382



>ref|XP_010533966.1| PREDICTED: beta-glucosidase 44-like [Tarenaya hassleriana]
Length=514

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/358 (76%), Positives = 307/358 (86%), Gaps = 7/358 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR SFP+GFVFGTA+SAYQVEG T  ++ GRGPSIWDTF+K PG+  NNAT  V
Sbjct  36    FDTGGLSRRSFPSGFVFGTATSAYQVEGET--YQDGRGPSIWDTFVKIPGIVANNATANV  93

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGKVNWKGVAYYN LI+Y+L+KGI
Sbjct  94    TVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNSLIDYLLKKGI  153

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP+ALE RY G LG+QVV D+ADYAEFCFK FGDRVKNW +FNEPRVVAA
Sbjct  154   TPYANLYHYDLPEALEKRYKGLLGKQVVRDFADYAEFCFKTFGDRVKNWMTFNEPRVVAA  213

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LGYD GFFAPGRCS    NCT G+SATEPY VAH+LIL H+ A QRYR  YQ KQKGR G
Sbjct  214   LGYDNGFFAPGRCSKAFGNCTAGDSATEPYTVAHHLILAHSSAVQRYRLKYQEKQKGRIG  273

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEPLTR KADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVGDRLP+F+ +E
Sbjct  274   ILLDFVWYEPLTRGKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGDRLPKFSEEE  333

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIH-TYQNDWNVGFAYARNGVPIGPRVHS  331
             VK+VKGS+D+VGINQYTT+Y+YDP+   P  +  YQ DWN GFA+++ G PIGPR +S
Sbjct  334   VKMVKGSMDFVGINQYTTYYMYDPHLSNPPKYFGYQQDWNAGFAFSKKGKPIGPRANS  391



>ref|XP_011000474.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/362 (74%), Positives = 304/362 (84%), Gaps = 6/362 (2%)
 Frame = -3

Query  1404  PERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN  1225
             PE + F T G  R+ FP GFVFGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  NN
Sbjct  32    PETISFETAGGLRQGFPKGFVFGTATSAYQVEGMAD--KDGRGPSIWDAFVKIPGIVANN  89

Query  1224  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1045
             ATGEV+VDQYHRYK D+D+M KLNFDAYRFSISW+RIFP+G GKVNW GVAYYNRLI+Y+
Sbjct  90    ATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVNWNGVAYYNRLIDYL  149

Query  1044  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  865
             +E+GITPYANL HYDLP ALE +Y G L +QVV+D+ADYA+FCFK FGDRVKNW +FNEP
Sbjct  150   IERGITPYANLYHYDLPLALEKKYNGLLSKQVVKDFADYADFCFKTFGDRVKNWMTFNEP  209

Query  864   RVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  697
             RVVAALGYDTGFFAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ KQ
Sbjct  210   RVVAALGYDTGFFAPGRCSKAFGNCTAGNSATEPYIVAHHLILSHAAAVQRYREKYQEKQ  269

Query  696   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  517
             KGR GILLDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+
Sbjct  270   KGRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPK  329

Query  516   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRV  337
             FT +EVK+VKGS+D+VGIN YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPR 
Sbjct  330   FTEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRA  389

Query  336   HS  331
             +S
Sbjct  390   YS  391



>ref|XP_002281407.1| PREDICTED: beta-glucosidase 44 [Vitis vinifera]
 emb|CBI15543.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/375 (73%), Positives = 312/375 (83%), Gaps = 15/375 (4%)
 Frame = -3

Query  1425  IVQC-----DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWD  1261
             ++QC     + + E + FNT GLSRESFP GFVFGTA+SAYQVEG  D  K GRGPSIWD
Sbjct  15    VIQCVADAAEHNEESLIFNTHGLSRESFPKGFVFGTATSAYQVEGMAD--KDGRGPSIWD  72

Query  1260  TFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWK  1081
              F++ PG+  NN TGEVAVDQYHRYK DIDLM  LNF+AYRFSISW+RIFP GTGKVNWK
Sbjct  73    VFIRKPGIVANNGTGEVAVDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWK  132

Query  1080  GVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFG  901
             GVAYYNRLINY+L+KGITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK+FG
Sbjct  133   GVAYYNRLINYLLKKGITPYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFG  192

Query  900   DRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVA  733
             DRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A
Sbjct  193   DRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHHLILSHAAA  252

Query  732   AQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPK  553
              QRYR  YQ +QKGR GILLDFVWYEPLTRSKADN AAQR+RDFH+GWF+HPIVYGEYP+
Sbjct  253   VQRYREKYQKEQKGRIGILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPR  312

Query  552   TMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF  376
             TMQ IVGDRLP+FT  EVK+VKGS+D+VGINQYT +Y+YD P PK P    YQ DW+ GF
Sbjct  313   TMQEIVGDRLPKFTKAEVKMVKGSMDFVGINQYTAYYMYDKPKPKVP---GYQEDWHAGF  369

Query  375   AYARNGVPIGPRVHS  331
             AY ++GVPIGPR +S
Sbjct  370   AYEKHGVPIGPRAYS  384



>emb|CAN74265.1| hypothetical protein VITISV_040977 [Vitis vinifera]
Length=506

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/375 (73%), Positives = 311/375 (83%), Gaps = 15/375 (4%)
 Frame = -3

Query  1425  IVQC-----DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWD  1261
             ++QC     + + E + FNT GLSRESFP G VFGTA+SAYQVEG  D  K GRGPSIWD
Sbjct  14    VIQCVADAAEHNEESLIFNTHGLSRESFPKGLVFGTATSAYQVEGMAD--KDGRGPSIWD  71

Query  1260  TFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWK  1081
              F++ PG+  NN TGEVAVDQYHRYK DIDLM  LNF+AYRFSISW+RIFP GTGKVNWK
Sbjct  72    VFIRKPGIVANNGTGEVAVDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWK  131

Query  1080  GVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFG  901
             GVAYYNRLINY+L+KGITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK+FG
Sbjct  132   GVAYYNRLINYLLKKGITPYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFG  191

Query  900   DRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVA  733
             DRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A
Sbjct  192   DRVKNWMTFNEPRVVAALGYDNGFFAPGRCSREYGNCTAGNSGTEPYIVAHHLILSHAAA  251

Query  732   AQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPK  553
              QRYR  YQ +QKGR GILLDFVWYEPLTRSKADN AAQR+RDFH+GWF+HPIVYGEYP+
Sbjct  252   VQRYREKYQKEQKGRIGILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPR  311

Query  552   TMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF  376
             TMQ IVGDRLP+FT  EVK+VKGS+D+VGINQYT +Y+YD P PK P    YQ DW+ GF
Sbjct  312   TMQEIVGDRLPKFTKAEVKMVKGSMDFVGINQYTAYYMYDKPKPKVP---GYQEDWHAGF  368

Query  375   AYARNGVPIGPRVHS  331
             AY ++GVPIGPR +S
Sbjct  369   AYEKHGVPIGPRAYS  383



>gb|EPS65829.1| beta-mannosidase, partial [Genlisea aurea]
Length=472

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/352 (77%), Positives = 297/352 (84%), Gaps = 6/352 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR+SF  GFVFGTA+SAYQVEGA   H+ GRGPSIWDTF+KTPG+E NNATGEV+ DQY
Sbjct  1     LSRQSFRNGFVFGTAASAYQVEGA--AHEDGRGPSIWDTFIKTPGIEANNATGEVSADQY  58

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             H+YK DIDLM KLNFDAYRFS+SW RIFPNGTG VNWKGV YYNRLINYML KGITPY N
Sbjct  59    HKYKEDIDLMAKLNFDAYRFSVSWPRIFPNGTGGVNWKGVDYYNRLINYMLRKGITPYLN  118

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             LNHYDLPQAL+ RY GWL RQVV+D+ADYAEFCF+ FGDRVKNW +FNEPRVVAALGYD 
Sbjct  119   LNHYDLPQALQHRYQGWLSRQVVKDFADYAEFCFETFGDRVKNWQTFNEPRVVAALGYDN  178

Query  834   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  667
             G FAPGRCS    NCT GNSATEPY+VAHNLIL HA A  RYR  YQAKQ+GR GILLDF
Sbjct  179   GIFAPGRCSKPFGNCTSGNSATEPYIVAHNLILSHAAAVGRYRRNYQAKQQGRIGILLDF  238

Query  666   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  487
              WYEP TRSKAD+YAAQRARDFH+GWFLHP+VYGEYPKTMQNIV +RLP+FT  EVK+VK
Sbjct  239   TWYEPHTRSKADSYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVSERLPKFTSREVKMVK  298

Query  486   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             GS D+VG+NQYT +Y YD     P    YQ DWN GFAY RNG+PIGPR +S
Sbjct  299   GSFDFVGLNQYTAYYAYDAGRPNPTNKGYQQDWNCGFAYERNGIPIGPRANS  350



>ref|XP_008374823.1| PREDICTED: beta-glucosidase 44-like [Malus domestica]
Length=513

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/364 (74%), Positives = 302/364 (83%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE V+ +TGGLSR SF   FVFGTA+SAYQVEG  +  K GRGPSIWD F+K PG+  
Sbjct  29    LEPESVKLDTGGLSRASFRKDFVFGTATSAYQVEGMAN--KEGRGPSIWDAFVKIPGIIA  86

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN T +VAVDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLIN
Sbjct  87    NNGTADVAVDQYHRYKDDIDLMASLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLIN  146

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  147   YLLKRGITPYANLYHYDLPLALEKKYLGLLSDKVVKDFADYADFCFKTFGDRVKNWMTFN  206

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRV+AALGYD GF APGRCS    NCT GNSATEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVIAALGYDNGFHAPGRCSKAFGNCTAGNSATEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVGDRL
Sbjct  267   IQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRL  326

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGS+DYVGINQYTT+Y+Y P P    +  YQ DWN GFAYA+NGVPIGP
Sbjct  327   PKFTKEEVKMVKGSMDYVGINQYTTYYMYHPKPSKSNVLGYQQDWNAGFAYAKNGVPIGP  386

Query  342   RVHS  331
             R +S
Sbjct  387   RAYS  390



>ref|XP_009347765.1| PREDICTED: beta-glucosidase 44-like [Pyrus x bretschneideri]
Length=513

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/364 (74%), Positives = 302/364 (83%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             + PE V+ +TGGLSR SF  GFVFGTA+SAYQVEG  +  K GRGPSIWD F+K PG+  
Sbjct  29    LEPESVKLDTGGLSRASFRKGFVFGTATSAYQVEGMAN--KDGRGPSIWDAFVKIPGIIA  86

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             NN T +VAVDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLIN
Sbjct  87    NNGTADVAVDQYHRYKDDIDLMASLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLIN  146

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+L++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  147   YLLKRGITPYANLYHYDLPLALEKKYLGLLSDKVVKDFADYADFCFKTFGDRVKNWMTFN  206

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRV+AALGYD GF APGRCS    NCT GNSATEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVIAALGYDNGFHAPGRCSKAFGNCTAGNSATEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVGDRL
Sbjct  267   IQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRL  326

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EVK+VKGS+DYVGINQYTT+Y+Y P P       YQ DWN GFAYA+NGVPIGP
Sbjct  327   PKFTKEEVKMVKGSMDYVGINQYTTYYMYHPKPSKSNDLGYQQDWNAGFAYAKNGVPIGP  386

Query  342   RVHS  331
             R +S
Sbjct  387   RAYS  390



>ref|XP_002322085.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEF06212.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=514

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/361 (74%), Positives = 301/361 (83%), Gaps = 6/361 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E + F T G  R+ FP GFVFGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  NNA
Sbjct  33    ETISFGTAGGLRQGFPEGFVFGTATSAYQVEGMAD--KDGRGPSIWDAFVKIPGIVANNA  90

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             TGEV+VDQYHRYK D+D+M KLNFDAYRFSISW+RIFP+G GKVNW GVAYYNRLI+YM+
Sbjct  91    TGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVNWNGVAYYNRLIDYMI  150

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             E+GITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+FCFK FGDRVKNW +FNEPR
Sbjct  151   ERGITPYANLYHYDLPLALEKKYNGLLSNQVVKDFADYADFCFKTFGDRVKNWMTFNEPR  210

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VVAALGYD GFFAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ KQK
Sbjct  211   VVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHHLILSHAAAVQRYREKYQEKQK  270

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+F
Sbjct  271   GRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKF  330

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             T +EVK+VKGS+D+VGIN YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPR +
Sbjct  331   TEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRAN  390

Query  333   S  331
             S
Sbjct  391   S  391



>ref|XP_011039106.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/380 (72%), Positives = 307/380 (81%), Gaps = 16/380 (4%)
 Frame = -3

Query  1428  SIVQC----------DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGR  1279
             SIVQC             PE V     G  R SFP GFVFGTA+SAYQVEG  +  K GR
Sbjct  14    SIVQCISHAAESNGASEKPETVGLEAAGGLRHSFPKGFVFGTATSAYQVEGMAE--KDGR  71

Query  1278  GPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGT  1099
             GPSIWD F+K PG+  NNATGEVAVDQYH YK D+D+M  LNFDAYRFSISW+RIFP+GT
Sbjct  72    GPSIWDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGT  131

Query  1098  GKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEF  919
             GKVNW GVAYYNRLI+YM+EKGITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+F
Sbjct  132   GKVNWLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADF  191

Query  918   CFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLI  751
             CFK FGDRVKNW +FNEPRVVAALGYD G FAPGRCS    NCT G+SATEPY+VAH+LI
Sbjct  192   CFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLI  251

Query  750   LCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIV  571
             L HA A QRYR  YQ KQKGR GILLDFV+YEPLT SKADN AAQRARDFHIGWF+HPIV
Sbjct  252   LSHAAAVQRYRDKYQEKQKGRIGILLDFVYYEPLTSSKADNLAAQRARDFHIGWFIHPIV  311

Query  570   YGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND  391
             YGEYPKTM+NIVG+RLP+FT +EV++VKGS+D+VGINQYTTFY+YDP+   P    YQ D
Sbjct  312   YGEYPKTMKNIVGNRLPQFTKEEVRMVKGSMDFVGINQYTTFYMYDPHQPKPKYLGYQQD  371

Query  390   WNVGFAYARNGVPIGPRVHS  331
             WNVGFAY +NGVPIGPR +S
Sbjct  372   WNVGFAYKKNGVPIGPRANS  391



>gb|KFK39134.1| beta-glucosidase 44 [Arabis alpina]
Length=514

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/362 (73%), Positives = 305/362 (84%), Gaps = 7/362 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E+++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NA
Sbjct  32    EKIKLDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNA  89

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+NWKGVAYYNRLI+Y++
Sbjct  90    TAELTVDQYHRYKEDVDLMKNLNFDAYRFSISWSRIFPEGTGKINWKGVAYYNRLIDYLI  149

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             +KGITPYANL HYDLP ALE +Y G LGR+VVED+ADYA+FCF +FGDRVKNW +FNEPR
Sbjct  150   QKGITPYANLYHYDLPLALEKKYKGLLGREVVEDFADYAQFCFNLFGDRVKNWMTFNEPR  209

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VV+ALGYD G FAPGRCS    NCTQGNSATEPY+V H+LIL HA A QRYR  YQAKQK
Sbjct  210   VVSALGYDNGIFAPGRCSKAFGNCTQGNSATEPYIVTHHLILAHAAAVQRYRKYYQAKQK  269

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFVWYEPLTRSKADN AAQRARDFHIGWF+HP+VYGEYPKTMQ IV +RLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQYIVKERLPKF  329

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRV  337
             T +EVK+VKGSID+VGINQYTT+++ D + P  P    YQ DWN  F++A+ G PIGPR 
Sbjct  330   TEEEVKMVKGSIDFVGINQYTTYFMSDTHNPTIPKDLGYQQDWNATFSFAKLGKPIGPRA  389

Query  336   HS  331
             +S
Sbjct  390   YS  391



>ref|XP_002322086.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
 gb|EEF06213.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
Length=515

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/362 (74%), Positives = 301/362 (83%), Gaps = 7/362 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP-GLEPNN  1225
             E + F T G  R+ FP GFVFGTA+SAYQVEG  D  K GRGPSIWD F+K P G+  NN
Sbjct  33    ETISFGTAGGLRQGFPEGFVFGTATSAYQVEGMAD--KDGRGPSIWDAFVKIPAGIVANN  90

Query  1224  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1045
             ATGEV+VDQYHRYK D+D+M KLNFDAYRFSISW+RIFP+G GKVNW GVAYYNRLI+YM
Sbjct  91    ATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVNWNGVAYYNRLIDYM  150

Query  1044  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  865
             +E+GITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+FCFK FGDRVKNW +FNEP
Sbjct  151   IERGITPYANLYHYDLPLALEKKYNGLLSNQVVKDFADYADFCFKTFGDRVKNWMTFNEP  210

Query  864   RVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  697
             RVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ KQ
Sbjct  211   RVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHHLILSHAAAVQRYREKYQEKQ  270

Query  696   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  517
             KGR GILLDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+
Sbjct  271   KGRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPK  330

Query  516   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRV  337
             FT +EVK+VKGS+D+VGIN YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPR 
Sbjct  331   FTEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRA  390

Query  336   HS  331
             +S
Sbjct  391   NS  392



>gb|KCW83985.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83986.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=386

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 296/356 (83%), Gaps = 6/356 (2%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  721
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFA  373
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFA
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFA  375



>ref|XP_006297463.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
 gb|EOA30361.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
Length=511

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/360 (77%), Positives = 308/360 (86%), Gaps = 7/360 (2%)
 Frame = -3

Query  1392  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1213
             R +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NAT E
Sbjct  32    RLDTGGLSRQSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNATAE  89

Query  1212  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1033
             + VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGKVNWKGVAYYNRLI+Y+++KG
Sbjct  90    ITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNRLIDYLVQKG  149

Query  1032  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  853
             ITPYANL HYDLP ALE +Y G LGRQVVED+ADYAEFCFK FGDRVKNW +FNEPRVVA
Sbjct  150   ITPYANLYHYDLPLALEKKYKGLLGRQVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVA  209

Query  852   ALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             ALGYD G FAPGRCS    NCT+GNSATEPY+V+H+LIL HA AAQRYR  YQAKQKGR 
Sbjct  210   ALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILAHAAAAQRYRKYYQAKQKGRI  269

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP+FT D
Sbjct  270   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTAD  329

Query  504   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRVHSK  328
             EVK+VKGSID+VGINQYTT+Y+ +P+P T      YQ DWNV F +A+ G PIG R +SK
Sbjct  330   EVKMVKGSIDFVGINQYTTYYMSEPHPTTKSKDLGYQQDWNVEFGFAKLGKPIGSRAYSK  389



>gb|KHN23728.1| Beta-glucosidase 44 [Glycine soja]
Length=450

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/326 (80%), Positives = 286/326 (88%), Gaps = 4/326 (1%)
 Frame = -3

Query  1296  VHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTR  1117
              HK GRGPSIWD F+K PG+  NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+R
Sbjct  2     AHKDGRGPSIWDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSR  61

Query  1116  IFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDY  937
             IFPNGTG+VNWKGVAYYNRLINY+LEKGITPYANL HYDLP ALE+RY G L RQVV+D+
Sbjct  62    IFPNGTGQVNWKGVAYYNRLINYLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDF  121

Query  936   ADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYV  769
             ADYAEFCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+
Sbjct  122   ADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYI  181

Query  768   VAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGW  589
             VAHNLIL HA A QRYRA YQ KQKGR GILLDFVWYEPLTRSKADN+AAQRARDFHIGW
Sbjct  182   VAHNLILSHAAAVQRYRAKYQEKQKGRIGILLDFVWYEPLTRSKADNFAAQRARDFHIGW  241

Query  588   FLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYI  409
             F+HP+VYGEYPKT+QNIVG+RLP+FT +EVK+VKGSID+VGINQYTTF++YDP+   P +
Sbjct  242   FIHPLVYGEYPKTIQNIVGNRLPKFTSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKV  301

Query  408   HTYQNDWNVGFAYARNGVPIGPRVHS  331
               YQ DWN GFAYA+NGVPIGPR +S
Sbjct  302   PGYQMDWNAGFAYAKNGVPIGPRANS  327



>ref|XP_006406654.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 ref|XP_006406658.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
 gb|ESQ48107.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 gb|ESQ48111.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
Length=512

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/361 (73%), Positives = 303/361 (84%), Gaps = 7/361 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             + +F+TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   NNAT
Sbjct  31    KFKFDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIANNAT  88

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP G GK+NWKGVAYYNRLI+Y+++
Sbjct  89    AEITVDQYHRYKEDVDLMKNLNFDAYRFSISWSRIFPEGAGKINWKGVAYYNRLIDYLIQ  148

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GITPYANL HYDLP ALE +Y G LGRQVVED+A+YAEFCFK FGDRVKNW +FNEPRV
Sbjct  149   RGITPYANLYHYDLPLALEKKYKGLLGRQVVEDFANYAEFCFKTFGDRVKNWMTFNEPRV  208

Query  858   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             VAALGYD G FAPGRCS    NCTQGNSATEPY+V+H+LIL HA A QRYR  YQAKQKG
Sbjct  209   VAALGYDNGIFAPGRCSKTYGNCTQGNSATEPYIVSHHLILAHAAAVQRYRKNYQAKQKG  268

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             R GILLDFVWYEPL +SKAD  AAQRARDFHIGWF+HP+VYGEYPKTMQ IV +RLP+FT
Sbjct  269   RIGILLDFVWYEPLQKSKADYLAAQRARDFHIGWFIHPLVYGEYPKTMQLIVKERLPKFT  328

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRVH  334
              +EVK+VKGSID+VGINQYTT+++ D +  T P    YQ DWNV F +++ G PIGPR +
Sbjct  329   EEEVKMVKGSIDFVGINQYTTYFMSDTHNSTIPKDLGYQQDWNVTFGFSKLGKPIGPRAN  388

Query  333   S  331
             S
Sbjct  389   S  389



>gb|KFK39133.1| beta-glucosidase 44 [Arabis alpina]
Length=497

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/368 (72%), Positives = 303/368 (82%), Gaps = 9/368 (2%)
 Frame = -3

Query  1410  VSPER--VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1237
              SP R  V  +TGGLSR+SFP GF+FGTA+SAYQVEG T  ++ GRGPSIWD F+K PG 
Sbjct  10    ASPPRDSVPLDTGGLSRKSFPEGFLFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGK  67

Query  1236  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1057
               NNAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+N KGVAYYNRL
Sbjct  68    IANNATAEITVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINLKGVAYYNRL  127

Query  1056  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  877
             I+Y+++KGITPYANL HYDLP ALE +Y G L +QVV D+ADYAEFCFK FGDRVKNW +
Sbjct  128   IDYLIQKGITPYANLYHYDLPLALEQKYQGLLSKQVVVDFADYAEFCFKTFGDRVKNWMT  187

Query  876   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             FNEPRVVAALGYD G FAP RCS    NCT+GNSA EPY+VAH+LIL HA A QRYR  Y
Sbjct  188   FNEPRVVAALGYDNGIFAPARCSKAFGNCTEGNSAIEPYIVAHHLILAHATAVQRYRQNY  247

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q KQKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HP+VYGEYPKTMQNIV +
Sbjct  248   QEKQKGRIGILLDFVWFEPLTSSEADNDAAQRARDFHVGWFIHPVVYGEYPKTMQNIVKE  307

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVP  352
             RLPRFT +EVK+VKGSID+VGINQYTT+++ DP+  TP     YQ DWNV F +A+NG P
Sbjct  308   RLPRFTEEEVKMVKGSIDFVGINQYTTYFMSDPHLSTPPKDLGYQQDWNVAFNFAKNGTP  367

Query  351   IGPRVHSK  328
             IG R HS+
Sbjct  368   IGSRAHSE  375



>ref|XP_007033096.1| B-S glucosidase 44 [Theobroma cacao]
 gb|EOY04022.1| B-S glucosidase 44 [Theobroma cacao]
Length=514

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/357 (73%), Positives = 294/357 (82%), Gaps = 6/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
              +TGGLSRESFP GFVFGTA+SAYQVEG  +  K GRGPSIWD ++K PG   NN T +V
Sbjct  38    LDTGGLSRESFPKGFVFGTATSAYQVEGMAN--KDGRGPSIWDAYVKVPGHIANNDTADV  95

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYH YK DIDLM K NFDAYRFSISW+RIFP GTG+VNWKGVAYYNRLI+Y+++KGI
Sbjct  96    AVDQYHHYKEDIDLMAKFNFDAYRFSISWSRIFPEGTGRVNWKGVAYYNRLIDYLIKKGI  155

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPY NL HYDLP AL+++Y GWL RQ VEDYA+YAEFCFK FGDRVKNWF+FNEPR+VAA
Sbjct  156   TPYGNLYHYDLPLALQEKYNGWLNRQAVEDYANYAEFCFKTFGDRVKNWFTFNEPRIVAA  215

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNSATEPY+VAHNLIL HA A +RYR  YQ KQKGR G
Sbjct  216   LGFDNGINPPSRCSKEFGNCTAGNSATEPYIVAHNLILSHATAVKRYREKYQDKQKGRIG  275

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDF WYEPLTRSKAD YAAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLP+FT DE
Sbjct  276   ILLDFNWYEPLTRSKADEYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGERLPKFTKDE  335

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             +K+V GS+DYVGIN YT+ Y+YDP    P +  YQ DWN GFA A+NGV IGP+ +S
Sbjct  336   IKMVNGSMDYVGINHYTSTYIYDPKQPKPNVTGYQADWNAGFANAKNGVQIGPKANS  392



>ref|XP_009394432.1| PREDICTED: beta-glucosidase 1-like [Musa acuminata subsp. malaccensis]
Length=511

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 299/355 (84%), Gaps = 3/355 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
              +TGGLSR +FPAGF FGTA+SAYQVEG     + GRGPSIWD F+K PG   NNAT +V
Sbjct  36    LDTGGLSRGAFPAGFTFGTAASAYQVEGM--ALQDGRGPSIWDAFVKIPGEIANNATADV  93

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             +VD+YHRYK D+D+M K+NFDAYRFSISW+RIFP G G+VNWKGVAYYNRLINYML +GI
Sbjct  94    SVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPEGEGRVNWKGVAYYNRLINYMLLRGI  153

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP+ALE +Y G L R++V+ YA+YAEFCFK FGDRVKNW +FNEPRVVAA
Sbjct  154   TPYANLYHYDLPEALEKKYNGLLSRRIVDAYANYAEFCFKTFGDRVKNWMTFNEPRVVAA  213

Query  849   LGYDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             LGYD G FAPGRC+NC+ GNSATEPY+VAHN+IL HA A +RYR  YQAKQKGR GILLD
Sbjct  214   LGYDDGKFAPGRCTNCSAGNSATEPYIVAHNMILSHAAAVKRYRDKYQAKQKGRIGILLD  273

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
             FVWYEPLT SK D  AAQR+RDFH+GWFLHPI+YGEYPK+MQ IV  RLP+FT +E+K+V
Sbjct  274   FVWYEPLTDSKDDQDAAQRSRDFHLGWFLHPIIYGEYPKSMQEIVQARLPKFTEEEIKMV  333

Query  489   KGSIDYVGINQYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             KGSIDYVGINQYT +Y++DP+ PK      YQ+DWN GFA+ RNGVPIGPR HS+
Sbjct  334   KGSIDYVGINQYTAYYMFDPHLPKQEKPTRYQSDWNAGFAFERNGVPIGPRAHSE  388



>ref|XP_010487721.1| PREDICTED: beta-glucosidase 43 [Camelina sativa]
Length=504

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/365 (72%), Positives = 299/365 (82%), Gaps = 7/365 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + V  +T  L+RESFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  20    SGDGVPMDTSDLNRESFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  77

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+NW GVAYYNRLI+Y
Sbjct  78    NATAELTVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLIDY  137

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ++ KGI PYANL HYDLP ALE +Y G L +QVVED+ DYAEFCFK FGDRVKNW +FNE
Sbjct  138   LILKGIKPYANLYHYDLPLALEQKYQGLLSKQVVEDFVDYAEFCFKTFGDRVKNWMTFNE  197

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL H+ A QRYR IYQ K
Sbjct  198   PRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHSAAVQRYRQIYQEK  257

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYG+YP TMQNIV +RLP
Sbjct  258   QKGRIGILLDFVWFEPLTSSEADNDAAQRARDFHVGWFIHPIVYGKYPNTMQNIVKERLP  317

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGP  343
             +FT +EVK+VKGSID++GINQYTT+++ DP   T P    YQ DWNV F +A+NG PIGP
Sbjct  318   KFTEEEVKMVKGSIDFIGINQYTTYFMSDPKISTPPKALGYQQDWNVAFNFAKNGTPIGP  377

Query  342   RVHSK  328
             R HS+
Sbjct  378   RAHSE  382



>ref|XP_002883106.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59365.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/369 (71%), Positives = 302/369 (82%), Gaps = 9/369 (2%)
 Frame = -3

Query  1413  DVSP--ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             D SP  + V  +TG L+R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  15    DSSPSGDAVPLDTGDLNRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  72

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
                NNAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP G+GK+NW GVAYYNR
Sbjct  73    KIANNATAEITVDQYHRYKEDVDLMENLNFDAYRFSISWSRIFPEGSGKINWNGVAYYNR  132

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+Y+++KGITPYANL HYDLP  LE +Y G L +QVV+D+ADYAEFCFK FGDRVKNW 
Sbjct  133   LIDYLIQKGITPYANLYHYDLPLVLERKYQGLLSKQVVDDFADYAEFCFKTFGDRVKNWM  192

Query  879   SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +FNEPRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  
Sbjct  193   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHAAAVQRYRQN  252

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             Y+ KQKGR GILLDFVW+EPLT SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV 
Sbjct  253   YKEKQKGRIGILLDFVWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPYTMQNIVK  312

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  355
             +RLP+F  +EVK+VKGSID+VGINQYTT+++ DP   T P    YQ DWNV F +A+NG 
Sbjct  313   ERLPKFAEEEVKMVKGSIDFVGINQYTTYFMSDPKISTIPKDLGYQQDWNVTFNFAKNGT  372

Query  354   PIGPRVHSK  328
             PIGPR HS+
Sbjct  373   PIGPRAHSE  381



>ref|XP_004299545.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 299/356 (84%), Gaps = 9/356 (3%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL R SFP GFVFGTA+SAYQVEG  +  K GRGPSIWDTF+K PG+  NNATG+V VD
Sbjct  37    GGL-RASFPKGFVFGTATSAYQVEGMAN--KEGRGPSIWDTFVKIPGIVANNATGDVTVD  93

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK DIDL+  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYNRLI+Y+L++GITPY
Sbjct  94    QYHRYKEDIDLLANLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNRLIDYLLKRGITPY  153

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
             ANL HYDLP ALE +Y G L  +VV+D+AD+A+FCFK +GDRVKNW +FNEPRVVAALGY
Sbjct  154   ANLYHYDLPLALEKKYLGLLSDRVVKDFADFADFCFKTYGDRVKNWMTFNEPRVVAALGY  213

Query  840   DTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             DTGFFAPGRCS    NCT GNS TEPY+ AH+LIL HA A QRYR  YQ  QKG+ GILL
Sbjct  214   DTGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILSHAAAVQRYREKYQKTQKGKIGILL  273

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEPLTRSKAD YAAQRARDFH+GWF+HPIVYGEYPKT+QNIVG+RLP+FT +EVK+
Sbjct  274   DFVWYEPLTRSKADRYAAQRARDFHVGWFIHPIVYGEYPKTIQNIVGNRLPKFTKEEVKM  333

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHT--YQNDWNVGFAYARNGVPIGPRVHS  331
             VKGS+D+VGIN+YT +Y+Y P       +   YQNDWN GFAY +NGVPIGPR +S
Sbjct  334   VKGSMDFVGINEYTAYYIYAPDKNQTKSNALGYQNDWNAGFAYEKNGVPIGPRAYS  389



>ref|XP_009113531.1| PREDICTED: beta-glucosidase 43 [Brassica rapa]
Length=498

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/357 (73%), Positives = 298/357 (83%), Gaps = 7/357 (2%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TG L+R+SFP GFVFGTA+SAYQVEG T  ++ GRGPSIWD F+K PG   NNAT E+ V
Sbjct  23    TGDLNRKSFPEGFVFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGKIANNATAELTV  80

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYH YK D+DLM  LNFDAYRFSISW+RIFP+GTGK+NW GVAYYNRLI+Y+++KGITP
Sbjct  81    DQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQKGITP  140

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             YANL HYDLP ALE +Y G LGR VVED+ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  141   YANLYHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  200

Query  843   YDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             YD G FAP RCS    NCT+GNSATEPY+VAH+LI+ HA A QRYR  YQ KQKGR GIL
Sbjct  201   YDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLIVAHASAVQRYRQHYQEKQKGRIGIL  260

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
             LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLP FT +EVK
Sbjct  261   LDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVK  320

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             +VKGSID+VGINQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPR HS+
Sbjct  321   MVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSE  377



>ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=509

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/361 (75%), Positives = 308/361 (85%), Gaps = 4/361 (1%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             +  RVRF+TGGLSRE+FPAGFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   N
Sbjct  29    TASRVRFDTGGLSREAFPAGFVFGTAASAYQVEGM--ALKDGRGPSIWDVFVKIPGEIAN  86

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT +V+VD+YHRYK D+D+M K+NFDAYRFSISW+RIFPNG GKVNW+GV+YYNRLINY
Sbjct  87    NATADVSVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPNGAGKVNWEGVSYYNRLINY  146

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ML+KG+TPYANL HYDLP+ALE +Y G L  +VVE YADYA+FCFK FGDRVKNWF+FNE
Sbjct  147   MLKKGVTPYANLYHYDLPEALEKQYNGLLSPKVVEAYADYADFCFKTFGDRVKNWFTFNE  206

Query  867   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             PRVVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA A +RYR  YQAKQKG
Sbjct  207   PRVVAALGYDDGTFAPGRCTNCSAGGNSATEPYIVAHNLILSHAAAVKRYREKYQAKQKG  266

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             R GILLDFVWYE LT S AD  AAQRARDFH+GWFLHPI+YGEYPKT+Q IV +RLP+FT
Sbjct  267   RIGILLDFVWYEALTSSTADQAAAQRARDFHVGWFLHPIIYGEYPKTIQEIVKERLPKFT  326

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRVH  334
              +EVK+VKGSIDYVGINQYTT+Y+YDP+   P   T Y NDW+VG+AY R+GVPIGPR H
Sbjct  327   EEEVKMVKGSIDYVGINQYTTYYMYDPHQPEPQKPTSYANDWHVGYAYERDGVPIGPRAH  386

Query  333   S  331
             S
Sbjct  387   S  387



>emb|CDY18494.1| BnaA01g27010D [Brassica napus]
Length=524

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/357 (73%), Positives = 298/357 (83%), Gaps = 7/357 (2%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TG L+R+SFP GFVFGTA+SAYQVEG T  ++ GRGPSIWD F+K PG   NNAT E+ V
Sbjct  49    TGDLNRKSFPEGFVFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGKIANNATAELTV  106

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYH YK D+DLM  LNFDAYRFSISW+RIFP+GTGK+NW GVAYYNRLI+Y+++KGITP
Sbjct  107   DQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQKGITP  166

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             YANL HYDLP ALE +Y G LGR VVED+ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  167   YANLYHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  226

Query  843   YDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             YD G FAP RCS    NCT+GNSATEPY+VAH+LI+ HA A QRYR  YQ KQKGR GIL
Sbjct  227   YDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLIVAHASAVQRYRQHYQEKQKGRIGIL  286

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
             LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLP FT +EVK
Sbjct  287   LDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVK  346

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             +VKGSID+VGINQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPR HS+
Sbjct  347   MVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSE  403



>ref|XP_010686092.1| PREDICTED: beta-glucosidase 44-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/367 (70%), Positives = 300/367 (82%), Gaps = 6/367 (2%)
 Frame = -3

Query  1419  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             QC       +F++GGLSR+SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG
Sbjct  29    QCKALALATKFHSGGLSRKSFPKGFVFGTATSAYQVEGM--AHKDGRGPSIWDEFVKKPG  86

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
             +  NNAT EV+VDQYHRYK D+D+M  LN DAYRFSISW+RIFP G G+VNWKGVAYYNR
Sbjct  87    IIANNATAEVSVDQYHRYKEDVDIMANLNMDAYRFSISWSRIFPKGAGEVNWKGVAYYNR  146

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+Y++E+GITPYANL HYDLP ALE +Y G L  +VV+D+ DYAEFCFK +GDRVKNW 
Sbjct  147   LIDYLIERGITPYANLYHYDLPLALERKYKGLLSPRVVKDFGDYAEFCFKTYGDRVKNWM  206

Query  879   SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +FNEPRV+AALGY+ GF APGRCS    NCT+GNS TEPY+ AH+LIL HA A QRYR  
Sbjct  207   TFNEPRVIAALGYNDGFHAPGRCSKEYGNCTEGNSGTEPYIAAHHLILSHAEAVQRYRQK  266

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             Y AKQKGR GILLDFVWYEPLTR K DNYAAQRARDFHIGWF+HPIVYGEYPKTMQ+IV 
Sbjct  267   YLAKQKGRIGILLDFVWYEPLTRGKKDNYAAQRARDFHIGWFIHPIVYGEYPKTMQDIVK  326

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP  352
             DRLP+FT +EVK+VKGS+D+VGINQYTT+Y+Y+    T     YQ DW+ GF +++NGV 
Sbjct  327   DRLPKFTTEEVKMVKGSMDFVGINQYTTYYMYNQQINTTKPPGYQQDWHAGFNFSKNGVQ  386

Query  351   IGPRVHS  331
             IGPR +S
Sbjct  387   IGPRANS  393



>emb|CDO98378.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/324 (77%), Positives = 281/324 (87%), Gaps = 4/324 (1%)
 Frame = -3

Query  1290  KYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIF  1111
             K GRGPSIWDTF+K PG EPNNATGEV VD+YHRYK+D+DLM +LNFDAYRFSISW+RIF
Sbjct  4     KDGRGPSIWDTFIKAPGREPNNATGEVTVDEYHRYKKDVDLMKRLNFDAYRFSISWSRIF  63

Query  1110  PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYAD  931
             PNGTGKVNWKGVAYYNRLI+YM+++GITPYANLNHYDLPQ L+DRY GWLGR+V +D+AD
Sbjct  64    PNGTGKVNWKGVAYYNRLIDYMIKQGITPYANLNHYDLPQELQDRYNGWLGREVAKDFAD  123

Query  930   YAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVA  763
             YAEFCFK FGDRVKNWF+FNEPRV+AALGYD G+FAPGRCS    NCT GNSATEPY+ A
Sbjct  124   YAEFCFKTFGDRVKNWFTFNEPRVIAALGYDNGYFAPGRCSKAFGNCTAGNSATEPYIAA  183

Query  762   HNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  583
             HNLILCHA A QRYR  +Q +QKG+ GILLDFVWYEP T SK D+ AAQRARDFHIGWF+
Sbjct  184   HNLILCHASAVQRYREKHQEQQKGKIGILLDFVWYEPHTYSKEDSDAAQRARDFHIGWFM  243

Query  582   HPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT  403
             HP+VYGEYPK +QNIV DRLP+FT +EVK+VKGS DYVG+NQYT +Y+YDP+        
Sbjct  244   HPLVYGEYPKNLQNIVADRLPKFTKEEVKIVKGSFDYVGVNQYTAYYMYDPHRGQQKDLG  303

Query  402   YQNDWNVGFAYARNGVPIGPRVHS  331
             YQ DWN GFAY RNGVPIGPR HS
Sbjct  304   YQQDWNCGFAYDRNGVPIGPRAHS  327



>ref|XP_007033088.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOY04014.1| Beta-glucosidase 44 [Theobroma cacao]
Length=511

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/358 (73%), Positives = 294/358 (82%), Gaps = 6/358 (2%)
 Frame = -3

Query  1392  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1213
             R +TGGLSRE FP GFVFGTA+SAYQVEG     K GRG SIWD F+  PG   +NATGE
Sbjct  33    RLDTGGLSREIFPEGFVFGTATSAYQVEGMAS--KEGRGRSIWDVFVNIPGNIVDNATGE  90

Query  1212  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1033
             V+VDQYH YK D++LM  LNFDAYRFSISW RIFPNGTGKVNWKGVAYYNRLIN +LEKG
Sbjct  91    VSVDQYHHYKEDVNLMHMLNFDAYRFSISWPRIFPNGTGKVNWKGVAYYNRLINALLEKG  150

Query  1032  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  853
             ITPYANL HYDLP AL+++YGG LG QVV+D+ADYA+FCFK FGDRVKNW +FNEPRV+A
Sbjct  151   ITPYANLYHYDLPLALQEKYGGLLGDQVVKDFADYADFCFKAFGDRVKNWMTFNEPRVIA  210

Query  852   ALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             ALG+D G   P RCS    NCT G+SATEPY+ AHNLIL HA AA+RYR  YQ KQKGR 
Sbjct  211   ALGFDNGINPPCRCSKPFGNCTAGDSATEPYIAAHNLILSHAEAAKRYREKYQTKQKGRI  270

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GILLDFVWYEPLTR KADNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIVG+RLP+F+  
Sbjct  271   GILLDFVWYEPLTRGKADNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKFSKS  330

Query  504   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             +V+ VK S D++GIN YT+FY+YDP+   P +  YQ DWNVGFA+ R G PIG R HS
Sbjct  331   DVETVKNSFDFIGINHYTSFYMYDPHQPKPNVTGYQQDWNVGFAFERWGEPIGRRAHS  388



>ref|XP_006482391.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/357 (71%), Positives = 297/357 (83%), Gaps = 6/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+T GL+R+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++ TPG   NNAT +V
Sbjct  44    FDTAGLTRKSFPDGFVFGTATSAYQVEGMAN--KDGRGPCIWDVYVHTPGNIANNATADV  101

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM KLNFDAYRFSISW+RIFP G G+VNWKGVAYYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL +RYGG LGRQVV+DYAD+AEFCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D+G   P RCS    NCT+G+S TEPY  AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDSGINPPSRCSKEVNNCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIG  281

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP +RSKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+E
Sbjct  282   ILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEE  341

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +VKGS DY+G+NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG R +S
Sbjct  342   VAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANS  398



>gb|KDO63132.1| hypothetical protein CISIN_1g046891mg [Citrus sinensis]
Length=520

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/357 (71%), Positives = 297/357 (83%), Gaps = 6/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+T GL+R+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++ TPG   NNAT +V
Sbjct  44    FDTAGLTRKSFPDGFVFGTATSAYQVEGMAN--KDGRGPCIWDVYVHTPGNIANNATADV  101

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM KLNFDAYRFSISW+RIFP G G+VNWKGVAYYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL +RYGG LGRQVV+DYAD+AEFCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D+G   P RCS    NCT+G+S TEPY  AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDSGINPPSRCSKEVNNCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIG  281

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP +RSKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+E
Sbjct  282   ILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEE  341

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +VKGS DY+G+NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG R +S
Sbjct  342   VAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANS  398



>ref|XP_006430656.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
 gb|ESR43896.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
Length=520

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/358 (71%), Positives = 298/358 (83%), Gaps = 6/358 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+T GL+R+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++ TPG   NNAT +V
Sbjct  44    FDTAGLTRKSFPDGFVFGTATSAYQVEGMAN--KDGRGPCIWDVYVHTPGNIANNATADV  101

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM KLNFDAYRFSISW+RIFP G G+VNWKGVAYYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL +RYGG LGRQVV+DYAD+AEFCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D+G   P RCS    NCT+G+S TEPY  AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDSGTNPPSRCSKEVNNCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIG  281

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP +RSKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+E
Sbjct  282   ILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEE  341

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             V +VKGS DY+G+NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG R +S+
Sbjct  342   VAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSE  399



>ref|XP_006644213.1| PREDICTED: beta-glucosidase 1-like [Oryza brachyantha]
Length=511

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/351 (73%), Positives = 290/351 (83%), Gaps = 2/351 (1%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TGGLSR SFPAGFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   NNAT +V V
Sbjct  41    TGGLSRRSFPAGFVFGTAASAYQVEGMA--LKDGRGPSIWDAFVKIPGEIANNATADVTV  98

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             D+YHRYK D+D+M ++ FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITP
Sbjct  99    DEYHRYKEDVDIMKRMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITP  158

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             YANL HYDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  159   YANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  218

Query  843   YDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             YD G FAPGRC+ C  GNSATEPY+VAH+LIL HA AAQ YR  YQ  QKGR GILLDFV
Sbjct  219   YDDGAFAPGRCTKCKAGNSATEPYIVAHHLILSHAAAAQIYRHKYQHVQKGRIGILLDFV  278

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLPRFT DE+++VKG
Sbjct  279   WYEGLTNSTADQDAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPRFTADEIQMVKG  338

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             SIDYVGINQYT +YV D  P    I +Y +DW+  FAY RNGVPIGPR +S
Sbjct  339   SIDYVGINQYTAYYVRDQQPNATTIPSYSSDWHAAFAYERNGVPIGPRANS  389



>gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar]
Length=491

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/356 (72%), Positives = 292/356 (82%), Gaps = 3/356 (1%)
 Frame = -3

Query  1392  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1213
             R + GGL+R+ FP GF FGTA+SAYQVEG     K GRGPSIWD F+K PG   NNAT  
Sbjct  17    RTDAGGLNRDKFPVGFTFGTAASAYQVEGM--ALKDGRGPSIWDDFVKIPGEIKNNATAA  74

Query  1212  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1033
             V VD+YHRYK DI++M  +NFDAYRFSISW+RIFPNG+GKVNWKGVAYYNRLI+YML++G
Sbjct  75    VTVDEYHRYKVDINIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQG  134

Query  1032  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  853
             ITP+ANL HYDLP ALE  Y G L R VV+DYADYAEFCFK FGDRVKNWF+FNEPRVVA
Sbjct  135   ITPFANLYHYDLPDALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVA  194

Query  852   ALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             ALGYD G FAPGRC+ CT  GNS TEPY+VAHNLIL HA A +RYR  YQ  QKGR GIL
Sbjct  195   ALGYDNGIFAPGRCTGCTAGGNSTTEPYIVAHNLILSHAAALKRYRDKYQVSQKGRIGIL  254

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
             LDFVWYEPLT S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RLP FT +E+ 
Sbjct  255   LDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLPTFTAEEIS  314

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             LVKGS+DY+G+NQYT++Y++DP+  T     YQ DWNVGFAY RNGVPIGPR +S+
Sbjct  315   LVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRANSE  370



>gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar]
Length=501

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/391 (66%), Positives = 304/391 (78%), Gaps = 16/391 (4%)
 Frame = -3

Query  1500  FFLVLFLMARRAPllllllvlttVSIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSA  1321
             FFL++FL  R +             +    V+  R   + GGL+R++FP GF FGTA+SA
Sbjct  4     FFLLIFLFPRTS-----------QPVAAAPVAGSRT--DAGGLNRDNFPVGFTFGTAASA  50

Query  1320  YQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAY  1141
             YQVEG     K GRGPSIWD F+K PG   NNAT  V VD+YHRYK DID+M  +NFDAY
Sbjct  51    YQVEGM--ALKDGRGPSIWDEFIKIPGEIKNNATAAVTVDEYHRYKVDIDIMKNMNFDAY  108

Query  1140  RFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWL  961
             RFSISW+RIFPNG+GKVNWKGVAYYNRLI+YML++GITP+ANL HYDLP+ALE  Y G L
Sbjct  109   RFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQGITPFANLYHYDLPEALEKSYNGLL  168

Query  960   GRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSA  784
              R VV+DYADYAEFCFK FGDRVKNWF+FNEPRVVAALGYD G FAPGRC+ CT  GNS 
Sbjct  169   SRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVAALGYDNGIFAPGRCTGCTAGGNST  228

Query  783   TEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARD  604
             TEPY+VAHNLIL HA A +RYR  Y   QKGR GILLDFVWYEPLT S  D  AAQRARD
Sbjct  229   TEPYIVAHNLILSHAAAVKRYRDKYHVSQKGRIGILLDFVWYEPLTNSTDDEAAAQRARD  288

Query  603   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  424
             FHIGWFLHPI+YGEYPK++Q+IV +RLP FT +E+ +VKGS+DY+G+NQYT++Y++DP+ 
Sbjct  289   FHIGWFLHPIIYGEYPKSVQDIVKERLPTFTAEEISIVKGSVDYLGVNQYTSYYMFDPHL  348

Query  423   KTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
              T     YQ DWNVGFAY R+GVPIGPR +S
Sbjct  349   PTQTSTGYQTDWNVGFAYERDGVPIGPRANS  379



>emb|CDX95557.1| BnaC01g34490D [Brassica napus]
Length=514

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/362 (74%), Positives = 302/362 (83%), Gaps = 7/362 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E+++ +TGGLSR+SFP  F+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NA
Sbjct  32    EKIKLDTGGLSRQSFPKDFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNA  89

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGK+NWKGV YYNRLINY++
Sbjct  90    TAELTVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLINYLI  149

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             +KGITPYANL HYDLP ALE +Y G L RQVV D+ADYAEFCF IFGDRVKNW +FNEPR
Sbjct  150   QKGITPYANLYHYDLPLALEKKYKGLLDRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPR  209

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VVAALGYD G FAPGRCS    NCTQGNS TEPY+V+H+LIL HA AAQRYR  YQAKQK
Sbjct  210   VVAALGYDNGIFAPGRCSKSYGNCTQGNSGTEPYIVSHHLILAHAAAAQRYRKYYQAKQK  269

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFVWYEPLTRSKAD  AAQRARDFHIGWF+HPIVYGEYP+TMQNIV DRLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQNIVKDRLPKF  329

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRV  337
             T +EVK+VKGSID+VGINQYTT+++ D +  T P    YQ DWN  F +A+ G PIGPR 
Sbjct  330   TEEEVKMVKGSIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGFAKLGKPIGPRA  389

Query  336   HS  331
             +S
Sbjct  390   YS  391



>emb|CDX95558.1| BnaC01g34500D [Brassica napus]
Length=493

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/357 (73%), Positives = 296/357 (83%), Gaps = 8/357 (2%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             +G  +R+SFP GFVFGTA+SAYQVEG T  ++ GRGPSIWD F+K PG   NNAT E+ V
Sbjct  19    SGDANRKSFPEGFVFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGKIANNATAELTV  76

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYH YK D+DLM  LNFDAYRFSISW+RIFP G GK+NW GVAYYNRLI+Y+++KGITP
Sbjct  77    DQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPEGAGKINWNGVAYYNRLIDYLVQKGITP  136

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             YANL HYDLP ALE +Y G LGRQV ED+ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  137   YANLYHYDLPLALEKKYKGLLGRQV-EDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  195

Query  843   YDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             YD G FAP RCS    NCT+GNSATEPY+VAH+LIL HA A QRYR  YQ KQKGR GIL
Sbjct  196   YDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLILAHASAVQRYRQHYQEKQKGRIGIL  255

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
             LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQ+IV +RLP+FT +EVK
Sbjct  256   LDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQDIVKERLPKFTEEEVK  315

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             LVKGSID+VGINQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPR HS+
Sbjct  316   LVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSE  372



>ref|XP_006431835.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
 gb|ESR45075.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
Length=506

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/368 (71%), Positives = 300/368 (82%), Gaps = 9/368 (2%)
 Frame = -3

Query  1422  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
             V  DV P+ +  +T G+SR+SFP GF+FGTA+SAYQVEG TD  K GRGP IWD ++K  
Sbjct  22    VDLDVRPDGL--DTAGMSRKSFPEGFIFGTATSAYQVEGMTD--KDGRGPCIWDPYVKA-  76

Query  1242  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1063
             G   NNAT ++ VDQYH YK DID+M KLNFDAYRFSISW+RIFPNGTG+VN  GVAYYN
Sbjct  77    GNIANNATADLTVDQYHHYKEDIDIMAKLNFDAYRFSISWSRIFPNGTGEVNPLGVAYYN  136

Query  1062  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  883
             RLI+YML+KGITPYANL HYDLP AL+D+Y G L   +V+DYADYA+FCFK FGDRVKNW
Sbjct  137   RLIDYMLKKGITPYANLYHYDLPLALQDKYNGLLSCDIVKDYADYADFCFKTFGDRVKNW  196

Query  882   FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  715
             F+FNEPRV+AALG+D G   P RCS    NCT GNSATEPY+ AHN+IL HA A +R+R 
Sbjct  197   FTFNEPRVIAALGFDNGINPPSRCSKGMGNCTAGNSATEPYIAAHNMILSHAAAVERFRE  256

Query  714   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  535
              YQ  QKG+ GILLDFVWYEPLTRSKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IV
Sbjct  257   KYQETQKGKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIV  316

Query  534   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  355
             G+RLP+FT  EV++VKGSIDY+G+NQYTTFY++DP    P I  YQNDWNVGFAY R GV
Sbjct  317   GERLPKFTDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGV  376

Query  354   PIGPRVHS  331
             P+GPR +S
Sbjct  377   PVGPRANS  384



>ref|XP_010906974.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=510

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/360 (74%), Positives = 304/360 (84%), Gaps = 4/360 (1%)
 Frame = -3

Query  1404  PERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN  1225
             P R RF+TGGLSR +FPAGFVFGTA+SAYQVEG     K GRGP IWD F+K PG   NN
Sbjct  31    PSRARFDTGGLSRAAFPAGFVFGTAASAYQVEGMA--LKDGRGPCIWDVFVKIPGNIANN  88

Query  1224  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1045
             AT +V+VD+YHRYK D+D+M K+NFD YRFSISW+RIFPNG GKVNWKGVAYYNRLI+YM
Sbjct  89    ATADVSVDEYHRYKEDVDIMKKMNFDGYRFSISWSRIFPNGVGKVNWKGVAYYNRLIDYM  148

Query  1044  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  865
             L++GITPYANL HYDLPQALE +Y G L  ++VE YADYA+FCFK FGDRVKNWF+FNEP
Sbjct  149   LKQGITPYANLYHYDLPQALEVQYKGLLSAKIVEAYADYADFCFKTFGDRVKNWFTFNEP  208

Query  864   RVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGR  688
             RVVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA A +RYR  YQA QKGR
Sbjct  209   RVVAALGYDDGMFAPGRCTNCSAGGNSATEPYIVAHNLILSHAAAVKRYRDKYQATQKGR  268

Query  687   FGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  508
              GILLDFVWYEPLT S+AD  AAQRARDFH+GWFLHPIVYGEYPKT+Q+IV DRLP+FT 
Sbjct  269   IGILLDFVWYEPLTNSEADQAAAQRARDFHLGWFLHPIVYGEYPKTLQDIVKDRLPKFTV  328

Query  507   DEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRVHS  331
             +E+K+VKGSIDYVGIN YT++Y+YDP+   P   T Y NDWN GFA+ RNGVPIGPR +S
Sbjct  329   EEIKMVKGSIDYVGINHYTSYYMYDPHLPEPQKPTRYANDWNCGFAFERNGVPIGPRAYS  388



>ref|XP_009113523.1| PREDICTED: beta-glucosidase 44 [Brassica rapa]
 emb|CDY18495.1| BnaA01g27000D [Brassica napus]
Length=514

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/362 (74%), Positives = 302/362 (83%), Gaps = 7/362 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E+++ +TGGLSR+SFP  F+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NA
Sbjct  32    EKIKLDTGGLSRQSFPKDFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNA  89

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGK+NWKGV YYNRLI+Y++
Sbjct  90    TAELTVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLIDYLI  149

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             +KGITPYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCF IFGDRVKNW +FNEPR
Sbjct  150   QKGITPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPR  209

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VVAALGYD G FAPGRCS    NCTQGNS TEPY+V+H+LIL HA AAQRYR  YQAKQK
Sbjct  210   VVAALGYDNGIFAPGRCSKSYGNCTQGNSGTEPYIVSHHLILAHAAAAQRYRKYYQAKQK  269

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFVWYEPLTRSKAD  AAQRARDFHIGWF+HPIVYGEYP+TMQ IV DRLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQYIVKDRLPKF  329

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRV  337
             T +EVK+VKGSID+VGINQYTT+++ D +  T P    YQ DWN  F YA+ G PIGPR 
Sbjct  330   TEEEVKMVKGSIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGYAKLGKPIGPRA  389

Query  336   HS  331
             +S
Sbjct  390   YS  391



>ref|XP_006832849.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
 gb|ERM98127.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
Length=509

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/364 (70%), Positives = 300/364 (82%), Gaps = 6/364 (2%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             V P+    +TGGLSRE FP GFVFGTA+SAYQVEGA D  K GRGPSIWD F++ PG+  
Sbjct  25    VWPDAGDMSTGGLSREGFPPGFVFGTATSAYQVEGAAD--KDGRGPSIWDVFIRKPGVVA  82

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             +N+TGEV+VD+YHRYK D+D+M  +N DAYRFSISW+RIFP G G+VN KGV YYNRLI+
Sbjct  83    DNSTGEVSVDEYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGVGRVNQKGVDYYNRLID  142

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             Y+LE+G+TPYANL HYDLP+ALE+ Y G L R+VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  143   YLLERGVTPYANLYHYDLPEALEESYNGLLNRRVVDDFADYAEFCFKTFGDRVKNWMTFN  202

Query  870   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             EPRVVAALGYD G FAPGRCS    NCT GNS TEPY+VAHNLIL HA A +RYR  YQA
Sbjct  203   EPRVVAALGYDNGIFAPGRCSAPFGNCTAGNSTTEPYIVAHNLILSHASAVKRYREKYQA  262

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEPLT +KAD  AAQR+RDFH+GWFLHPIVYG YP++M  IVGDRL
Sbjct  263   TQKGRIGILLDFVWYEPLTAAKADVRAAQRSRDFHVGWFLHPIVYGTYPRSMVRIVGDRL  322

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P+FT +EV++VKGSID+VGIN YTT+Y+YD + +   +  YQ +W+ GFA+AR+G PIGP
Sbjct  323   PKFTNEEVEMVKGSIDFVGINHYTTYYMYDQHIRKGTVMDYQMEWHAGFAFARDGKPIGP  382

Query  342   RVHS  331
             R +S
Sbjct  383   RAYS  386



>gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar]
Length=491

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/356 (71%), Positives = 291/356 (82%), Gaps = 3/356 (1%)
 Frame = -3

Query  1392  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1213
             R + GGL+R+ FP GF FGTA+SAYQVEG     K GRGPSIWD F+K PG   NNAT  
Sbjct  17    RTDAGGLNRDKFPVGFTFGTAASAYQVEGM--ALKDGRGPSIWDDFVKIPGEIKNNATAA  74

Query  1212  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1033
             V VD+YHRYK DI++M  +NFDAYRFSISW+RIFPNG+GKVNWKGVAYYNRLI+YML++G
Sbjct  75    VTVDEYHRYKVDINIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQG  134

Query  1032  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  853
             ITP+ANL HYDLP ALE  Y G L R VV+DYADYAEFCFK FGDRVKNWF+FNEPRVVA
Sbjct  135   ITPFANLYHYDLPDALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVA  194

Query  852   ALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             ALGYD G FAPGRC+ CT  GNS TEPY+VAHNLIL HA A +RYR  YQ  QKGR GIL
Sbjct  195   ALGYDNGIFAPGRCTGCTAGGNSTTEPYIVAHNLILSHAAAVKRYRDKYQVSQKGRIGIL  254

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
             LDFVWYEPLT S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RL  FT +E+ 
Sbjct  255   LDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLLTFTAEEIS  314

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             LVKGS+DY+G+NQYT++Y++DP+  T     YQ DWNVGFAY RNGVPIGPR +S+
Sbjct  315   LVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRANSE  370



>ref|XP_006471035.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=507

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/368 (70%), Positives = 299/368 (81%), Gaps = 8/368 (2%)
 Frame = -3

Query  1422  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
             V  DV P+ +  +T G+SR+SFP GF+FGTA+SAYQVEG TD  K GRGP IWD ++K  
Sbjct  22    VDLDVRPDGL--DTAGMSRKSFPEGFIFGTATSAYQVEGMTD--KDGRGPCIWDPYVKAG  77

Query  1242  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1063
                 +NAT ++ VDQYH YK DID+M KLNFDAYRFSISW+RIFPNGTG+VN  GVAYYN
Sbjct  78    RNIASNATADLTVDQYHHYKEDIDIMAKLNFDAYRFSISWSRIFPNGTGEVNPLGVAYYN  137

Query  1062  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  883
             RLI+YMLEKGITPYANL HYDLP AL+D+Y G L   +V+DYADYA+FCFK FGDRVKNW
Sbjct  138   RLIDYMLEKGITPYANLYHYDLPLALQDKYNGLLSCDIVKDYADYADFCFKTFGDRVKNW  197

Query  882   FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  715
             F+FNEPRV+AALG+D G   P RCS    NCT GNS+TEPY+ AHN+IL HA A +R+R 
Sbjct  198   FTFNEPRVIAALGFDNGINPPSRCSKGMGNCTAGNSSTEPYIAAHNMILSHAAAVERFRE  257

Query  714   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  535
              YQ  QKG+ GILLDFVWYEPLTRSKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IV
Sbjct  258   KYQETQKGKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIV  317

Query  534   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  355
             G+RLP+FT  EV++VKGSIDY+G+NQYTTFY++DP    P I  YQNDWNVGFAY R GV
Sbjct  318   GERLPKFTDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGV  377

Query  354   PIGPRVHS  331
             P+GPR +S
Sbjct  378   PVGPRANS  385



>ref|XP_010314225.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Solanum lycopersicum]
Length=502

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/369 (71%), Positives = 292/369 (79%), Gaps = 31/369 (8%)
 Frame = -3

Query  1425  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             I   +V  E   F+TGGL+RESFP GFVFGT++SAYQVEGA    K GRGPS+WDTF+K 
Sbjct  38    IESDNVLAETTVFDTGGLNRESFPKGFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFIKQ  95

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG EPNNA+GEV+ DQYH YK DIDLMVKLNFDAYRFSISW+RIFP+             
Sbjct  96    PGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPS-------------  142

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
                        ITPY NLNHYDLPQAL++RY GWL R+VV+D+ADYAEFCFK +GDRVKN
Sbjct  143   -----------ITPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKN  191

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  718
             WFSFNEPRVVA LGYDTGFFAPGRCS    NCT G+SATEPY+VAHNLIL HA AA RYR
Sbjct  192   WFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILSHAAAAHRYR  251

Query  717   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  538
               YQ KQKG+FGI+LDFVWYEPLTRSKADNYAAQRARDF +GWFLHP+V+GEYPKTMQNI
Sbjct  252   KNYQEKQKGKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNI  311

Query  537   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG  358
             VG+RLP+FT +E+K+VKGSIDYVGIN YTTFY YD   K   +  YQ D N GFA  RNG
Sbjct  312   VGNRLPKFTTEEIKMVKGSIDYVGINHYTTFYAYDHVSKLKAL-AYQQDQNCGFANDRNG  370

Query  357   VPIGPRVHS  331
             VPIGPR HS
Sbjct  371   VPIGPRAHS  379



>ref|XP_006482389.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/358 (72%), Positives = 295/358 (82%), Gaps = 8/358 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  44    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  101

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIG  281

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  282   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  341

Query  501   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPR +S
Sbjct  342   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANS  398



>ref|XP_002272413.2| PREDICTED: beta-glucosidase 44-like [Vitis vinifera]
Length=552

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/361 (70%), Positives = 296/361 (82%), Gaps = 6/361 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E +   TGGLSRESFP GF+FGTASSAYQVEG TD  K GRGP IWD ++K PG    N 
Sbjct  69    EGLGLETGGLSRESFPKGFLFGTASSAYQVEGMTD--KAGRGPCIWDPYVKIPGNIAENG  126

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T +VAVDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNW+GVAYYNRLINYML
Sbjct  127   TADVAVDQYHRYKEDLDIMKILNFDAYRFSISWSRIFPEGTGKVNWEGVAYYNRLINYML  186

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             +KGI PYANL HYDLP  L+++Y G L R++VED+A+YAEFCFK FGDRVK+W +FNEPR
Sbjct  187   KKGIIPYANLYHYDLPLVLQEKYNGLLSRRIVEDFANYAEFCFKTFGDRVKHWTTFNEPR  246

Query  861   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             V+AALG+D G   P RCS    NCT GNS+TEPY+ AHN++L HA AAQRYR  YQ KQK
Sbjct  247   VIAALGFDNGINPPSRCSKAFGNCTAGNSSTEPYIAAHNMLLSHAAAAQRYREKYQEKQK  306

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             G+ GILLD VWYEPLTRSK D  AAQRA DFH+GWFLHPI++G+YPK MQ+IVG+RLP+F
Sbjct  307   GKIGILLDTVWYEPLTRSKDDQQAAQRAIDFHLGWFLHPIIWGKYPKNMQDIVGERLPKF  366

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             + +E+KLVKGS+D+VGINQYT+FY++DP+   P +  YQ +WN GFAY RNGVPIGPR +
Sbjct  367   SEEEIKLVKGSVDFVGINQYTSFYMFDPHKPKPKVTGYQEEWNAGFAYDRNGVPIGPRAN  426

Query  333   S  331
             S
Sbjct  427   S  427



>gb|KCW83983.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=450

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/324 (77%), Positives = 276/324 (85%), Gaps = 4/324 (1%)
 Frame = -3

Query  1290  KYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIF  1111
             K GRGPSIWD F+K PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIF
Sbjct  4     KEGRGPSIWDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIF  63

Query  1110  PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYAD  931
             P+GTGKVNWKGVAYYNRLINY+L KGITPYANL HYDLP+ALE +Y G L   VV+D+AD
Sbjct  64    PDGTGKVNWKGVAYYNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFAD  123

Query  930   YAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVA  763
             YA+FCFK FGDRVKNW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VA
Sbjct  124   YADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVA  183

Query  762   HNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  583
             H+LIL HA A QRYR  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+
Sbjct  184   HHLILSHAAAVQRYREKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFI  243

Query  582   HPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT  403
             HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  
Sbjct  244   HPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPG  303

Query  402   YQNDWNVGFAYARNGVPIGPRVHS  331
             YQ DWN GFAYA+ GVPIGPR HS
Sbjct  304   YQQDWNAGFAYAKLGVPIGPRAHS  327



>ref|XP_010257433.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Nelumbo nucifera]
Length=539

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/364 (70%), Positives = 290/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1416  CDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1237
              D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+
Sbjct  48    LDARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGI  105

Query  1236  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1057
               +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRL
Sbjct  106   VASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRL  165

Query  1056  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  877
             I+YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW +
Sbjct  166   IDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMT  225

Query  876   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
              NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  Y
Sbjct  226   LNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKY  285

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             QA QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG 
Sbjct  286   QAHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGK  345

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  349
             RLP+FT + +K+VKGSID++GINQYT  Y Y  +    +   Y+ D NVGFA+A++GVPI
Sbjct  346   RLPKFTKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPI  405

Query  348   GPRV  337
             GPRV
Sbjct  406   GPRV  409



>ref|XP_010257596.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257682.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/363 (70%), Positives = 290/363 (80%), Gaps = 6/363 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+ 
Sbjct  28    DARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGIV  85

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
              +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  86    ASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  145

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW + 
Sbjct  146   DYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMTL  205

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  YQ
Sbjct  206   NEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKYQ  265

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  526
             A QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG R
Sbjct  266   AHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKR  325

Query  525   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  346
             LP+FT + +K+VKGSID++GINQYT  Y Y  +    +   Y+ D NVGFA+A++GVPIG
Sbjct  326   LPKFTKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIG  385

Query  345   PRV  337
             PRV
Sbjct  386   PRV  388



>ref|XP_010257514.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Nelumbo nucifera]
Length=534

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/366 (69%), Positives = 291/366 (80%), Gaps = 6/366 (2%)
 Frame = -3

Query  1416  CDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1237
              D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+
Sbjct  48    LDARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGI  105

Query  1236  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1057
               +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRL
Sbjct  106   VASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRL  165

Query  1056  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  877
             I+YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW +
Sbjct  166   IDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMT  225

Query  876   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
              NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  Y
Sbjct  226   LNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKY  285

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             QA QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG 
Sbjct  286   QAHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGK  345

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  349
             RLP+FT + +K+VKGSID++GINQYT  Y Y  +    +   Y+ D NVGFA+A++GVPI
Sbjct  346   RLPKFTKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPI  405

Query  348   GPRVHS  331
             GPR +S
Sbjct  406   GPRANS  411



>gb|KDO63131.1| hypothetical protein CISIN_1g036937mg, partial [Citrus sinensis]
Length=497

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/358 (72%), Positives = 294/358 (82%), Gaps = 8/358 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  21    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  78

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  79    TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  138

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  139   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  198

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG  G
Sbjct  199   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILSHAAAVQRYREKYQETQKGNIG  258

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  259   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  318

Query  501   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPR +S
Sbjct  319   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANS  375



>ref|XP_007048474.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOX92631.1| Beta-glucosidase 44 [Theobroma cacao]
Length=562

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/405 (66%), Positives = 301/405 (74%), Gaps = 50/405 (12%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E+ R +TGGLSR+SFP GFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   NNA
Sbjct  37    EKQRLDTGGLSRDSFPEGFVFGTAASAYQVEGMAS--KEGRGPSIWDVFVKVPGNIVNNA  94

Query  1221  TGEVAVDQYHRYKR--------------------------------------------DI  1174
             TGEV+VDQYHRYK+                                            D+
Sbjct  95    TGEVSVDQYHRYKKSQAIRSSLVYGLSPCYVSLISASHESWDNSKDSKTICHSSCLQEDV  154

Query  1173  DLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLP  994
             DLM KLNFDAYRFSISW+RIFPNGTGKVN KGVAYYNRLI+ MLEKGITPYANL HYDLP
Sbjct  155   DLMHKLNFDAYRFSISWSRIFPNGTGKVNRKGVAYYNRLIDSMLEKGITPYANLYHYDLP  214

Query  993   QALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGR  814
              AL+++YGG LG QVV+D+ADYA+FCFK FGDRVKNW +FNEPRVVAALG+D G   P R
Sbjct  215   LALQEKYGGLLGDQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGFDNGINPPNR  274

Query  813   CS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLT  646
             CS    NCT GNSATEPY+ AHNLIL HA AA+RYR  YQ KQKGR GILLDFVWYEPLT
Sbjct  275   CSKPFGNCTAGNSATEPYIAAHNLILSHAEAAKRYREKYQPKQKGRIGILLDFVWYEPLT  334

Query  645   RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVG  466
             R KADNYAAQRARDFH+GWFLHP+VYGEYP+TMQ IVG+RLP+F+  +VK VK S D++G
Sbjct  335   RGKADNYAAQRARDFHVGWFLHPLVYGEYPRTMQEIVGERLPKFSKSDVKTVKNSFDFIG  394

Query  465   INQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             INQYT++Y+YDP    P +  YQ DWNVGFA+ R G PIG R +S
Sbjct  395   INQYTSYYMYDPDQPKPNVTGYQQDWNVGFAHERTGNPIGRRAYS  439



>ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=512

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/359 (74%), Positives = 300/359 (84%), Gaps = 4/359 (1%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
              R R +TGGL R +FPAGFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   NNA
Sbjct  34    SRARLDTGGLGRAAFPAGFVFGTAASAYQVEGMA--LKDGRGPSIWDAFVKIPGEIANNA  91

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T +++VD+YHRYK D+D+M K+NFD YRFSISW+RIFPNG G+VNWKGVAYYNRLI+YML
Sbjct  92    TADISVDEYHRYKEDVDIMKKMNFDGYRFSISWSRIFPNGVGRVNWKGVAYYNRLIDYML  151

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             ++G+TPYANL HYDLP+ALE +Y G L  ++VE YAD+A+FCFK FGDRVKNWF+FNEPR
Sbjct  152   KQGVTPYANLYHYDLPEALEVQYNGLLSPKIVEAYADFADFCFKTFGDRVKNWFTFNEPR  211

Query  861   VVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             VVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA A +RYR  YQA QKGR 
Sbjct  212   VVAALGYDEGKFAPGRCTNCSAGGNSATEPYIVAHNLILSHAAAVKRYREKYQATQKGRI  271

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GILLDFVWYEPLT SKAD  AAQRARDFH+GWFLHPIVYGEYPKTMQ IV +RLP+FT +
Sbjct  272   GILLDFVWYEPLTISKADQAAAQRARDFHLGWFLHPIVYGEYPKTMQEIVKERLPKFTVE  331

Query  504   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRVHS  331
             E+K+VKGSIDYVGINQYTT+Y+Y P    P   T Y NDWN GFAY RNGVPIGPR HS
Sbjct  332   EIKMVKGSIDYVGINQYTTYYMYHPLLPAPQKPTRYANDWNCGFAYERNGVPIGPRAHS  390



>ref|XP_006430653.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
 gb|ESR43893.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
Length=528

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/358 (71%), Positives = 294/358 (82%), Gaps = 8/358 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  52    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  109

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  110   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  169

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  170   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  229

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  230   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIG  289

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  290   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  349

Query  501   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIG R +S
Sbjct  350   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGQRANS  406



>ref|NP_001043156.1| Os01g0508000 [Oryza sativa Japonica Group]
 sp|Q5QMT0.1|BGL01_ORYSJ RecName: Full=Beta-glucosidase 1; Short=Os1bglu1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD73293.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF05070.1| Os01g0508000 [Oryza sativa Japonica Group]
Length=516

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/351 (72%), Positives = 288/351 (82%), Gaps = 2/351 (1%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TGGLSR SFPAGFVFGTA+SAYQVEG     K GRGPSIWD F+KTPG   NNAT +V V
Sbjct  46    TGGLSRRSFPAGFVFGTAASAYQVEGM--ALKDGRGPSIWDAFVKTPGEIANNATADVTV  103

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             D+YHRYK D+++M  + FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITP
Sbjct  104   DEYHRYKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITP  163

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             YANL HYDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  164   YANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  223

Query  843   YDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             YD G FAPGRC+ CT GNSATEPY+VAH+LIL HA A QRYR  YQ  QKG+ GILLDFV
Sbjct  224   YDDGNFAPGRCTKCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFV  283

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKG
Sbjct  284   WYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKG  343

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             SIDYVGINQYT +YV D  P    + +Y +DW+    Y R+GVPIGPR +S
Sbjct  344   SIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANS  394



>gb|EAY74244.1| hypothetical protein OsI_02124 [Oryza sativa Indica Group]
Length=516

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/351 (72%), Positives = 288/351 (82%), Gaps = 2/351 (1%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TGGLSR SFPAGFVFGTA+SAYQVEG     K GRGPSIWD F+KTPG   NNAT +V V
Sbjct  46    TGGLSRRSFPAGFVFGTAASAYQVEGM--ALKDGRGPSIWDAFVKTPGEIANNATADVTV  103

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             D+YHRYK D+++M  + FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITP
Sbjct  104   DEYHRYKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITP  163

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             YANL HYDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  164   YANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  223

Query  843   YDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             YD G FAPGRC+ CT GNSATEPY+VAH+LIL HA A QRYR  YQ  QKG+ GILLDFV
Sbjct  224   YDDGNFAPGRCTKCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFV  283

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKG
Sbjct  284   WYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKG  343

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             SIDYVGINQYT +YV D  P    + +Y +DW+    Y R+GVPIGPR +S
Sbjct  344   SIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANS  394



>ref|XP_006430655.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
 gb|ESR43895.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
Length=520

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/358 (71%), Positives = 294/358 (82%), Gaps = 8/358 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  44    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  101

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QR+R  YQ  QKG+ G
Sbjct  222   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRFREKYQETQKGKIG  281

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  282   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  341

Query  501   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIG R +S
Sbjct  342   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGQRANS  398



>gb|KHG12317.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=497

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/357 (71%), Positives = 290/357 (81%), Gaps = 7/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
              +TGGLSR+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++K PG   NN T +V
Sbjct  22    MDTGGLSRDSFPKGFVFGTATSAYQVEGMAN--KGGRGPCIWDVYVKQPGHIANNDTADV  79

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYH YK D+DL+   NFDAYRFSISW+RIFP G G+VNW+GV YYNRLINY+++KGI
Sbjct  80    AVDQYHHYKEDVDLLANFNFDAYRFSISWSRIFPEGVGRVNWEGVDYYNRLINYLVKKGI  139

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPY NL HYDLPQAL+++Y G+L RQ+VEDYADYAEFCFK FGDRVKNWF+FNEPR+VAA
Sbjct  140   TPYGNLYHYDLPQALQEKYNGFLNRQIVEDYADYAEFCFKTFGDRVKNWFTFNEPRIVAA  199

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNSA EPY+V HNLIL HA A +RYR  YQAKQKG  G
Sbjct  200   LGFDNGINPPSRCSKEVGNCTDGNSAIEPYIVGHNLILSHAEAVKRYREKYQAKQKGSIG  259

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDF WYEPLTRSKADNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG RLP+FT +E
Sbjct  260   ILLDFNWYEPLTRSKADNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGKRLPKFTEEE  319

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK+V GS DYVGINQYTT Y+ +P   +  + +YQ+DWN  FA A+NGV IGPR +S
Sbjct  320   VKMVNGSFDYVGINQYTTSYISNPTSPSN-VTSYQSDWNAAFANAKNGVQIGPRANS  375



>ref|XP_004157213.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=515

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/360 (69%), Positives = 294/360 (82%), Gaps = 6/360 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             +++F+TGGLSR +FP  F+FGTA+SAYQVEG  D  K GRG SIWD +++ PG    NAT
Sbjct  36    KIKFDTGGLSRNAFPKEFIFGTATSAYQVEGMAD--KDGRGQSIWDPYVQIPGNIAGNAT  93

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
             GEVAVDQYH+YK D+D+M +LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLI+YM++
Sbjct  94    GEVAVDQYHKYKEDVDIMKRLNFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMVD  153

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GITPYANL HYDLP  L++RYGG LG Q+V+D+A YAEFCF+ FGDRVKNW +FNEPRV
Sbjct  154   QGITPYANLYHYDLPLTLQERYGGLLGMQIVKDFAKYAEFCFEHFGDRVKNWMTFNEPRV  213

Query  858   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             +AALG+D G   P RCS    NCT GNS TEPY+ AH++IL HA A   YR  YQ  Q+G
Sbjct  214   IAALGFDNGINPPSRCSKEYGNCTNGNSGTEPYIAAHHIILSHAAAVDIYRNNYQKAQEG  273

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             R GILLDF +YEPLTR K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLP+F+
Sbjct  274   RIGILLDFAYYEPLTRGKQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKFS  333

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
              +EV LVKGSID++GINQYTTFY+++P         YQNDWNVGFA+ +NGVPIGPR HS
Sbjct  334   EEEVSLVKGSIDFLGINQYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAHS  393



>ref|XP_004140826.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN57432.1| hypothetical protein Csa_3G185120 [Cucumis sativus]
Length=515

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/360 (69%), Positives = 294/360 (82%), Gaps = 6/360 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             +++F+TGGLSR +FP  F+FGTA+SAYQVEG  D  K GRG SIWD +++ PG    NAT
Sbjct  36    KIKFDTGGLSRNAFPKEFIFGTATSAYQVEGMAD--KDGRGQSIWDPYVQIPGNIAGNAT  93

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
             GEVAVDQYH+YK D+D+M +LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLI+YM++
Sbjct  94    GEVAVDQYHKYKEDVDIMKRLNFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMVD  153

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GITPYANL HYDLP  L++RYGG LG Q+V+D+A YAEFCF+ FGDRVKNW +FNEPRV
Sbjct  154   QGITPYANLYHYDLPLTLQERYGGLLGMQIVKDFAKYAEFCFEHFGDRVKNWMTFNEPRV  213

Query  858   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             +AALG+D G   P RCS    NCT GNS TEPY+ AH++IL HA A   YR  YQ  Q+G
Sbjct  214   IAALGFDNGINPPSRCSKEYGNCTNGNSGTEPYIAAHHIILSHAAAVDIYRNNYQKAQEG  273

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             R GILLDF +YEPLTR K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLP+F+
Sbjct  274   RIGILLDFAYYEPLTRGKQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKFS  333

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
              +EV LVKGSID++GINQYTTFY+++P         YQNDWNVGFA+ +NGVPIGPR HS
Sbjct  334   EEEVSLVKGSIDFLGINQYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAHS  393



>ref|XP_006482390.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=518

 Score =   529 bits (1363),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 255/358 (71%), Positives = 293/358 (82%), Gaps = 10/358 (3%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  44    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  101

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYD+P AL+++YGG L  QV  DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALQEKYGGLLDCQV--DYADYADFCFKTFGDRVKNWYTFNEPRVIAA  219

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  220   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIG  279

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  280   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  339

Query  501   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPR +S
Sbjct  340   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANS  396



>ref|XP_006376723.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
 gb|ERP54520.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
Length=546

 Score =   530 bits (1364),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 268/412 (65%), Positives = 298/412 (72%), Gaps = 48/412 (12%)
 Frame = -3

Query  1428  SIVQC----------DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGR  1279
             SIVQC             PE V F T G  R SFP GFVFGTA+SAYQVEG  +  K GR
Sbjct  14    SIVQCISHAAESNGASEKPETVSFETAGGLRHSFPKGFVFGTATSAYQVEGMAE--KDGR  71

Query  1278  GPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGT  1099
             GPSIWD F+K PG+  NNATGEVAVDQYH YK D+D+M  LNFDAYRFSISW+RIFP+GT
Sbjct  72    GPSIWDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGT  131

Query  1098  GKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEF  919
             GKVNW GVAYYNRLI+YM+EKGITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+F
Sbjct  132   GKVNWLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADF  191

Query  918   CFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLI  751
             CFK FGDRVKNW +FNEPRVVAALGYD G FAPGRCS    NCT G+SATEPY+VAH+LI
Sbjct  192   CFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLI  251

Query  750   LCHAVAAQRYRAIYQ--------------------------------AKQKGRFGILLDF  667
             L HA A QRYR  YQ                                 K KG+    L F
Sbjct  252   LSHAAAVQRYREKYQVSICSSVFELDAIHIFNGEECYIPYSFSFYIAGKTKGKDWDSLGF  311

Query  666   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  487
                   T SKADN AAQRARDFHIGWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VK
Sbjct  312   CLLRTFTSSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVGNRLPQFTKEEVKMVK  371

Query  486   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             GS+D+VGINQYTTFY+YDP+   P    YQ DWNVGFAY +NGVPIGPR +S
Sbjct  372   GSMDFVGINQYTTFYMYDPHQPKPKYLGYQQDWNVGFAYKKNGVPIGPRANS  423



>ref|XP_007036680.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
 gb|EOY21181.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
Length=469

 Score =   526 bits (1355),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 245/325 (75%), Positives = 277/325 (85%), Gaps = 4/325 (1%)
 Frame = -3

Query  1293  HKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRI  1114
             H  GRGPSI D F+K PG+   NATGEV+VDQYHRYK D+DLM  LNFDAYRFSISW+RI
Sbjct  3     HCDGRGPSICDVFVKIPGIVAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRI  62

Query  1113  FPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYA  934
             FP+GTGKVNWKGVAYYNRLI+ +L++GITPYANL HYDLP+ALE RY G L  QVV+D+A
Sbjct  63    FPDGTGKVNWKGVAYYNRLIDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFA  122

Query  933   DYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVV  766
             D+A+FCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+V
Sbjct  123   DFADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIV  182

Query  765   AHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWF  586
             AH+LIL H  A QRYR  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF
Sbjct  183   AHHLILAHGAAVQRYRLKYQPKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWF  242

Query  585   LHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIH  406
             +HPIVYGEYP+TMQ IVG+RLP+FT +EVK+VKGSID+VGINQYT +Y+YDP+   P + 
Sbjct  243   IHPIVYGEYPRTMQEIVGNRLPKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVL  302

Query  405   TYQNDWNVGFAYARNGVPIGPRVHS  331
              YQ DWN GFAYA+ GVPIGPR +S
Sbjct  303   GYQQDWNAGFAYAKRGVPIGPRANS  327



>gb|ABR17739.1| unknown [Picea sitchensis]
Length=505

 Score =   526 bits (1356),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 288/358 (80%), Gaps = 6/358 (2%)
 Frame = -3

Query  1392  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1213
               +TGGLSR SFP GFVFGTA+SAYQVEGA      GRGPSIWDTF+  PG+  NNAT +
Sbjct  29    EIDTGGLSRASFPKGFVFGTATSAYQVEGAAKTD--GRGPSIWDTFILQPGIIANNATAD  86

Query  1212  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1033
             V+VD+YHRYK D++LMVK+N DAYRFSISW+RIFP G G++N+KGV YYN LINY+L++G
Sbjct  87    VSVDEYHRYKTDVELMVKMNMDAYRFSISWSRIFPKGAGQINYKGVQYYNNLINYLLKRG  146

Query  1032  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  853
             ITPYANL HYDLPQ LE  YGG L  +VV+DYA +AEFCFK FGDRVK W +FNEPRVVA
Sbjct  147   ITPYANLYHYDLPQGLETAYGGLLNSKVVDDYAKFAEFCFKTFGDRVKYWMTFNEPRVVA  206

Query  852   ALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             ALGYD G FAPGRCS    NCT GNSATEPY+VAHNL+L HA A + YR  YQ  QKG+ 
Sbjct  207   ALGYDNGIFAPGRCSAPFGNCTAGNSATEPYIVAHNLLLSHATAVKIYREKYQPIQKGKI  266

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GILLDFVWYEPLT S  D  AAQR+RDFHIGWFLHPIVYG+YP +M  IVG RLP+FT +
Sbjct  267   GILLDFVWYEPLTNSSEDQAAAQRSRDFHIGWFLHPIVYGKYPDSMVEIVGKRLPKFTKE  326

Query  504   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             + ++VKGSIDY+G+NQYT +Y+YDP      +  YQ DWNVGFAYARNGVPIGP+ +S
Sbjct  327   QYQMVKGSIDYLGVNQYTAYYMYDPKQPKQNVTGYQMDWNVGFAYARNGVPIGPKANS  384



>ref|XP_006845279.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
 gb|ERN06954.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
Length=482

 Score =   525 bits (1352),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 246/361 (68%), Positives = 293/361 (81%), Gaps = 10/361 (3%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
              +TGGLSRE FP GFVFGTA+SAYQVEGA   H+ GRGPSIWD F++ PG+ PN ATGEV
Sbjct  1     MSTGGLSRERFPPGFVFGTATSAYQVEGA--AHEDGRGPSIWDVFIQQPGIIPNGATGEV  58

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             + D+YHRYK D+D+M  +N DAYRFSISW+RIFP G G+VN KGV YYNRLI+Y+LEKGI
Sbjct  59    SADEYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGAGRVNQKGVDYYNRLIDYLLEKGI  118

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLPQALED Y G L R+VV+D+A YA+FCFK FGDRVKNW +FNEPRV+AA
Sbjct  119   TPYANLYHYDLPQALEDSYNGLLNRRVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAA  178

Query  849   LGYDTGFFAPGRCS--------NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             LGYD GF APGRCS        NCT G+S+TEPY+VAHNLIL HA A +RYR  YQA QK
Sbjct  179   LGYDNGFHAPGRCSNPFGNDGMNCTAGDSSTEPYIVAHNLILSHASAVKRYREKYQATQK  238

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             GR GILLDFVWYEP + +KAD  AAQR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+F
Sbjct  239   GRIGILLDFVWYEPFSNAKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKF  298

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             T +EV++VKGSID+VGINQYT++Y+ D + K   +  YQ DW+ GF Y+R+G  IGP+ +
Sbjct  299   TNEEVEMVKGSIDFVGINQYTSYYITDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQAN  358

Query  333   S  331
             S
Sbjct  359   S  359



>ref|XP_008811965.1| PREDICTED: beta-glucosidase 1-like isoform X1 [Phoenix dactylifera]
Length=505

 Score =   525 bits (1351),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 252/352 (72%), Positives = 291/352 (83%), Gaps = 7/352 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR SFP GFVFGTA+SAYQVEG     K GRGP IWDTF+K PG    NAT +V VD+Y
Sbjct  34    LSRSSFPEGFVFGTAASAYQVEGM--ALKEGRGPCIWDTFVKIPGNIAGNATADVTVDEY  91

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRYK D+D+M K+NFDAYRFSISW+RIFP GTGKVNW+GV YYNRLINYML++GITPYAN
Sbjct  92    HRYKEDVDIMKKMNFDAYRFSISWSRIFPKGTGKVNWRGVFYYNRLINYMLKQGITPYAN  151

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQAL+D Y GWL  ++VE YA++A+FCFK+FGDRVKNWF+FNEPRVVAALGYD 
Sbjct  152   LYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKMFGDRVKNWFTFNEPRVVAALGYDD  211

Query  834   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             G  APGRC+NC+  GNSATEPY+VAH+LIL HA A +RYR  YQA QKG+ GIL DFVWY
Sbjct  212   GTHAPGRCTNCSAGGNSATEPYIVAHHLILSHAAAVKRYREKYQAHQKGKIGILCDFVWY  271

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT S  D  AAQRARDFHIGWFLHPI+YGEYPKTMQ IV +RLP+FT +EV++VKGSI
Sbjct  272   EPLTNSIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKFTREEVEMVKGSI  331

Query  477   DYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             DYVGINQYT++Y+ D   Y +TP   +Y  DW+  FAY R+GVPIGPR HS+
Sbjct  332   DYVGINQYTSYYMEDQPTYSQTPV--SYSADWHTQFAYDRDGVPIGPRAHSE  381



>dbj|BAB02019.1| beta-glucosidase [Arabidopsis thaliana]
Length=495

 Score =   523 bits (1346),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 253/365 (69%), Positives = 290/365 (79%), Gaps = 15/365 (4%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + V   TGGL+R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  19    SGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  76

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM  LN DAYRFSISW+RIFP G+GK+N  GVAYYNRLI+Y
Sbjct  77    NATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDY  136

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ++EKGITPYANL HYDLP ALE +Y G L +QVV          F+ FGDRVKNW +FNE
Sbjct  137   LIEKGITPYANLYHYDLPLALEQKYQGLLSKQVV--------VLFQTFGDRVKNWMTFNE  188

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ K
Sbjct  189   PRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAHAAAVQRYRQNYQEK  248

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP
Sbjct  249   QKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLP  308

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             +FT +EVK+VKGSID+VGINQYTT+++ DP    TP    YQ DWNV F +A+NG PIGP
Sbjct  309   KFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGP  368

Query  342   RVHSK  328
             R HS+
Sbjct  369   RAHSE  373



>ref|XP_008811966.1| PREDICTED: beta-glucosidase 1-like isoform X2 [Phoenix dactylifera]
Length=525

 Score =   522 bits (1345),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 254/361 (70%), Positives = 293/361 (81%), Gaps = 7/361 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR SFP GFVFGTA+SAYQVEG     K GRGP IWDTF+K PG    NAT +V VD+Y
Sbjct  34    LSRSSFPEGFVFGTAASAYQVEGMA--LKEGRGPCIWDTFVKIPGNIAGNATADVTVDEY  91

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRYK D+D+M K+NFDAYRFSISW+RIFP GTGKVNW+GV YYNRLINYML++GITPYAN
Sbjct  92    HRYKEDVDIMKKMNFDAYRFSISWSRIFPKGTGKVNWRGVFYYNRLINYMLKQGITPYAN  151

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQAL+D Y GWL  ++VE YA++A+FCFK+FGDRVKNWF+FNEPRVVAALGYD 
Sbjct  152   LYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKMFGDRVKNWFTFNEPRVVAALGYDD  211

Query  834   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             G  APGRC+NC+  GNSATEPY+VAH+LIL HA A +RYR  YQA QKG+ GIL DFVWY
Sbjct  212   GTHAPGRCTNCSAGGNSATEPYIVAHHLILSHAAAVKRYREKYQAHQKGKIGILCDFVWY  271

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT S  D  AAQRARDFHIGWFLHPI+YGEYPKTMQ IV +RLP+FT +EV++VKGSI
Sbjct  272   EPLTNSIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKFTREEVEMVKGSI  331

Query  477   DYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSKISQFFTLA  304
             DYVGINQYT++Y+ D   Y +TP   +Y  DW+  FAY R+GVPIGPRV+  I     L 
Sbjct  332   DYVGINQYTSYYMEDQPTYSQTPV--SYSADWHTQFAYDRDGVPIGPRVNFCIFSVEELI  389

Query  303   L  301
             L
Sbjct  390   L  390



>ref|XP_008457084.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=517

 Score =   521 bits (1342),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 243/360 (68%), Positives = 291/360 (81%), Gaps = 6/360 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             ++  +TG LSR +FP GF+FGTA+SAYQVEG     + GRG SIWD +++ PG    NAT
Sbjct  38    KIELDTGELSRNAFPKGFIFGTATSAYQVEGMA--KEDGRGQSIWDPYVQIPGNIAGNAT  95

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
             GEVAVDQYHRYK D+D+M +LNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM++
Sbjct  96    GEVAVDQYHRYKEDVDIMKRLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMID  155

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GITPYANL HYDLP  L++RYGG LG+Q+V+D+A YA+FCF+ FGDRVKNW +FNEPRV
Sbjct  156   QGITPYANLYHYDLPLTLQERYGGLLGKQIVKDFAKYAKFCFEHFGDRVKNWMTFNEPRV  215

Query  858   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             +AALG+D G   P RCS    NCT GNS TEPY+ AH+++L HA A   YR  YQ +Q G
Sbjct  216   IAALGFDNGINPPSRCSKEYGNCTNGNSGTEPYLAAHHILLSHAAAVDIYRNNYQKEQGG  275

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             R GILLDFV+YEPLTR K DNYAAQRARDFHIGWFLHPI YGEYP+TMQ IV +RLP+F+
Sbjct  276   RIGILLDFVYYEPLTRGKQDNYAAQRARDFHIGWFLHPITYGEYPRTMQEIVKERLPKFS  335

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
              +E+ LVKGSID++GINQYTTFY+++P         YQNDWNVGFA+ + GVPIGPR HS
Sbjct  336   EEEISLVKGSIDFLGINQYTTFYMFNPQSTQLDAPGYQNDWNVGFAFEKKGVPIGPRAHS  395



>ref|XP_010034459.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=507

 Score =   521 bits (1341),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 290/368 (79%), Gaps = 6/368 (2%)
 Frame = -3

Query  1422  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
             VQ       V+F+ GGLSR SFP GF+FGTA+SAYQVEG       GRGPSIWD F++ P
Sbjct  21    VQSSDVKSEVKFDMGGLSRASFPKGFLFGTATSAYQVEGMASGD--GRGPSIWDAFVQVP  78

Query  1242  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1063
             G      +GE+AVDQYH+YK DIDLM KLNFDAYRFSISW+RIFPNGTG VNW+GV YYN
Sbjct  79    GNIKELDSGEMAVDQYHKYKEDIDLMHKLNFDAYRFSISWSRIFPNGTGYVNWRGVNYYN  138

Query  1062  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  883
             RLI+ ++ KGITPYANL HYD+P AL+ RY G L   VV+D+ADYAEFCFK FGDRVKNW
Sbjct  139   RLIDALIAKGITPYANLYHYDMPLALQLRYEGLLSINVVKDFADYAEFCFKTFGDRVKNW  198

Query  882   FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  715
              +FNEPRV+AALG+D+G   P RCS    NCT GNSATEPY+ AH+LIL HA A +RYR 
Sbjct  199   MTFNEPRVIAALGFDSGSNPPNRCSKPYGNCTAGNSATEPYIAAHHLILSHAAAVKRYRK  258

Query  714   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  535
              YQAKQ+GR GILLDFVWYEPLT S  DNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIV
Sbjct  259   RYQAKQQGRIGILLDFVWYEPLTSSLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIV  318

Query  534   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  355
             G+RLP+FT  EV +VKG  D+VG+N YT++Y+Y+P         YQ DWNVGFA+ +NGV
Sbjct  319   GERLPKFTKREVNIVKGGFDFVGVNHYTSYYMYNPNWTETSPPGYQADWNVGFAFEKNGV  378

Query  354   PIGPRVHS  331
             PIGPR +S
Sbjct  379   PIGPRANS  386



>ref|XP_010916341.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=503

 Score =   521 bits (1341),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 246/353 (70%), Positives = 289/353 (82%), Gaps = 3/353 (1%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             + G LSR SFP GFVFGTA+SAYQVEG     K GRGP IWDTF++ PG    NAT +V 
Sbjct  30    HAGFLSRGSFPEGFVFGTAASAYQVEGM--ALKAGRGPCIWDTFVRIPGNIAGNATADVT  87

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
             VD+YHRYK D+D+M K+NFDAYRFSISW+RIFPNGTG VNW+GV YYNRLINYML++GIT
Sbjct  88    VDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPNGTGTVNWRGVHYYNRLINYMLKQGIT  147

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PYANL HYDLPQAL+D Y GWL  ++VE YA++A+FCFK +GDRVKNWF+FNEPRVVAAL
Sbjct  148   PYANLYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKTYGDRVKNWFTFNEPRVVAAL  207

Query  846   GYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             GYD G  APGRC+NC+  GNS+TEPY+VAH+LILCHA A +RYR  YQ  Q+GR GILLD
Sbjct  208   GYDDGTHAPGRCTNCSAGGNSSTEPYIVAHHLILCHAAAVKRYREKYQVHQQGRIGILLD  267

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
             FVWYEPLT S +D  AA R+RDFHIGWFLHPI YGEYPKTMQ IV +RLP+FT +EV++V
Sbjct  268   FVWYEPLTNSISDQEAAHRSRDFHIGWFLHPITYGEYPKTMQEIVKERLPKFTREEVEMV  327

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             KGSIDYVG+NQYT++Y+ D    +    +Y  DW+V FAY R+GVPIGPR HS
Sbjct  328   KGSIDYVGVNQYTSYYIKDHPTTSQTPVSYSADWHVTFAYDRDGVPIGPRAHS  380



>ref|XP_006299658.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
 gb|EOA32556.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
Length=491

 Score =   520 bits (1339),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 251/365 (69%), Positives = 288/365 (79%), Gaps = 19/365 (5%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + V  +TG L R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  19    SGDGVSLDTGDLKRQSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  76

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTGK+NW GVAYYN LI+Y
Sbjct  77    NATAEITVDQYHRYKEDIDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNSLIDY  136

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +++KGI PYANL HYDLP ALE +Y G L            +FCFK FGDRVKNW +FNE
Sbjct  137   LIQKGIKPYANLYHYDLPLALEQKYQGLL------------KFCFKTFGDRVKNWMTFNE  184

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL H+ A QRYR  YQ K
Sbjct  185   PRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHSAAVQRYRQNYQEK  244

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKG  GILLDFVW+EPLT SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV +RLP
Sbjct  245   QKGMIGILLDFVWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPNTMQNIVKERLP  304

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGP  343
             +FT +EV+++KGSID+VGINQYTT+++ DP   TP  +  YQ DWNV F YA+NG PIGP
Sbjct  305   KFTEEEVRMMKGSIDFVGINQYTTYFMSDPKITTPPKNLGYQQDWNVAFNYAKNGTPIGP  364

Query  342   RVHSK  328
             R +S+
Sbjct  365   RAYSE  369



>ref|NP_188435.2| beta glucosidase 43 [Arabidopsis thaliana]
 sp|Q9LV34.2|BGL43_ARATH RecName: Full=Beta-glucosidase 43; Short=AtBGLU43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE76042.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=501

 Score =   518 bits (1335),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 251/365 (69%), Positives = 289/365 (79%), Gaps = 9/365 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + V   TGGL+R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  19    SGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  76

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM  LN DAYRFSISW+RIFP G+GK+N  GVAYYNRLI+Y
Sbjct  77    NATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDY  136

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ++EKGITPYANL HYDLP ALE +Y G L +Q    +       F+ FGDRVKNW +FNE
Sbjct  137   LIEKGITPYANLYHYDLPLALEQKYQGLLSKQ--GRFCGLRRVLFQTFGDRVKNWMTFNE  194

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ K
Sbjct  195   PRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAHAAAVQRYRQNYQEK  254

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  520
             QKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP
Sbjct  255   QKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLP  314

Query  519   RFTPDEVKLVKGSIDYVGINQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             +FT +EVK+VKGSID+VGINQYTT+++ DP    TP    YQ DWNV F +A+NG PIGP
Sbjct  315   KFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGP  374

Query  342   RVHSK  328
             R HS+
Sbjct  375   RAHSE  379



>ref|XP_004299546.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=513

 Score =   508 bits (1309),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/356 (70%), Positives = 282/356 (79%), Gaps = 9/356 (3%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL R  FP GFVFGTA+SAYQVEG  +  K GRGPSIWD F+K PG   NN T +V  D
Sbjct  38    GGL-RTGFPKGFVFGTATSAYQVEGMAN--KEGRGPSIWDAFVKIPGNIANNDTADVTAD  94

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             +YHRYK DID+M  LNFD YRFSISW+RIFP+GTGKVN KGVAYYNRLINY+LE+GITPY
Sbjct  95    EYHRYKEDIDIMQDLNFDVYRFSISWSRIFPDGTGKVNLKGVAYYNRLINYLLERGITPY  154

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
             ANL+HYDLP ALE  Y G+L  +VV+D+ADYAEFCFK +GDRVK W +FNEPRVVAALGY
Sbjct  155   ANLHHYDLPLALEQEYLGFLSDRVVKDFADYAEFCFKTYGDRVKYWTTFNEPRVVAALGY  214

Query  840   DTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             D     P RCS    NCT GNS TEPY+VAH+L+L HA A  RYR  YQ  QKG  GILL
Sbjct  215   DNALNPPARCSKAYGNCTVGNSGTEPYIVAHHLLLSHAAAVHRYREKYQKTQKGSVGILL  274

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DF WYEPLT SK D  AAQRARDFHIGWF+HPIVYGEYPKTMQ+IVGDRLP+FT +EVK+
Sbjct  275   DFNWYEPLTSSKDDRDAAQRARDFHIGWFIHPIVYGEYPKTMQHIVGDRLPKFTKEEVKM  334

Query  492   VKGSIDYVGINQYTTFYVYDPYPK--TPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VKGSID+VGINQYT +Y+YDP+     P    YQNDWN GFA+ +NGV IGP+ +S
Sbjct  335   VKGSIDFVGINQYTAYYMYDPHQNKTKPNALGYQNDWNAGFAFEKNGVLIGPQAYS  390



>ref|XP_004149144.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN53236.1| hypothetical protein Csa_4G031070 [Cucumis sativus]
Length=506

 Score =   506 bits (1302),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/357 (68%), Positives = 284/357 (80%), Gaps = 6/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR +FP GFVFGTA+SAYQVEG  D  K GRG SIWD F+K PG   +NATG+V
Sbjct  31    FDTGGLSRAAFPEGFVFGTATSAYQVEGMAD--KDGRGQSIWDPFVKLPGKIVDNATGDV  88

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYHRYK DID M KLNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM+++GI
Sbjct  89    AVDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGI  148

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP AL++RY G L +Q+V D+ +YAEFCF+ FGDRVKNW +FNEPRV+A 
Sbjct  149   TPYANLYHYDLPLALQERYRGLLDKQIVIDFTNYAEFCFEEFGDRVKNWMTFNEPRVIAD  208

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             +G+++G   P RCS    NCT GNS TEPY+VAHN+IL HA     YR  +Q KQ GR G
Sbjct  209   VGFNSGIMPPSRCSKEYGNCTDGNSGTEPYIVAHNIILSHANVVDTYRKKFQEKQGGRVG  268

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDF +YEPLT  K D  AAQRARDFHIGWFLHP  YGEYP+ MQ IV +RLP+F+ +E
Sbjct  269   ILLDFTYYEPLTNEKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEE  328

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK VKGS+D+VGINQYTTFY+++P    P    YQ+DW+VG+AY +NG PIG R H+
Sbjct  329   VKKVKGSVDFVGINQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGQRAHT  385



>ref|XP_004163493.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=506

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/357 (68%), Positives = 283/357 (79%), Gaps = 6/357 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             F+TGGLSR +FP GFVFGTA+SAYQVEG  D  K GRG SIWD F+K PG   +NATG+V
Sbjct  31    FDTGGLSRAAFPEGFVFGTATSAYQVEGMAD--KDGRGQSIWDPFVKLPGKIVDNATGDV  88

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYHRYK DID M KLNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM+++GI
Sbjct  89    AVDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGI  148

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP AL++RY G L +Q+V D+ +YAEFCF+ FGDRVKNW +FNEPRV+A 
Sbjct  149   TPYANLYHYDLPLALQERYRGLLDKQIVIDFTNYAEFCFEEFGDRVKNWMTFNEPRVIAD  208

Query  849   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             +G+++G   P RCS    NCT GNS TEPY+VAHN+IL HA     YR  +Q KQ GR G
Sbjct  209   VGFNSGIMPPSRCSKEYGNCTDGNSGTEPYIVAHNIILSHANVVDTYRKKFQEKQGGRVG  268

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             ILLDF +YEPLT  K D  AAQRARDFHIGWFLHP  YGEYP+ MQ IV +RLP+F+ +E
Sbjct  269   ILLDFTYYEPLTNEKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEE  328

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK VKGS+D+VGINQYTTFY+ +P    P    YQ+DW+VG+AY +NG PIG R H+
Sbjct  329   VKKVKGSVDFVGINQYTTFYMLNPTWPKPTTPDYQSDWHVGYAYEKNGKPIGQRAHT  385



>ref|XP_008453769.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=506

 Score =   504 bits (1299),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 240/359 (67%), Positives = 283/359 (79%), Gaps = 6/359 (2%)
 Frame = -3

Query  1395  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1216
             + F+TGGLSR +FP GFVFGTA+SAYQVEG  D  K GRG SIWD F+K PG    NATG
Sbjct  29    IIFDTGGLSRAAFPEGFVFGTATSAYQVEGMAD--KDGRGQSIWDPFVKLPGKIAGNATG  86

Query  1215  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1036
             +VAVDQYHRYK DID M KLNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM+++
Sbjct  87    DVAVDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQ  146

Query  1035  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  856
             GITPYANL HYDLP AL++RYGG L +Q+V D+  YAEFCF+ FGDRVKNW +FNEPRV+
Sbjct  147   GITPYANLYHYDLPLALQERYGGLLDKQIVADFTSYAEFCFEEFGDRVKNWMTFNEPRVI  206

Query  855   AALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGR  688
             A +G+++G   P RCS    NCT GNS TEPY+VAHN+IL HA     YR  +Q KQ GR
Sbjct  207   ADVGFNSGIMPPSRCSKEYGNCTNGNSGTEPYIVAHNIILSHANVVDTYRRKFQEKQGGR  266

Query  687   FGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  508
              GILLDF +YEPLT  K D  AAQRARDF IGWFLHP  YGEYP+ MQ IV +RLP+F+ 
Sbjct  267   VGILLDFTYYEPLTNGKEDRDAAQRARDFTIGWFLHPFTYGEYPRRMQEIVKERLPKFSE  326

Query  507   DEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             +EV +VKGS+D+VGINQYTTFY+++P    P    YQ+DW+VG+AY +NG PIG R H+
Sbjct  327   EEVTMVKGSVDFVGINQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGKRAHT  385



>gb|AEV76986.1| beta-glucosidase 4, partial [Triticum aestivum]
Length=501

 Score =   497 bits (1279),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 241/364 (66%), Positives = 280/364 (77%), Gaps = 4/364 (1%)
 Frame = -3

Query  1419  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             QCD     +R NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGPSIWD F   PG
Sbjct  17    QCDGPNPEIR-NTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPSIWDAFAAIPG  73

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
                 N + +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNR
Sbjct  74    TIAGNGSADVTVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNR  133

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKNWF
Sbjct  134   LIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWF  193

Query  879   SFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             +FNEPRVVAALGYD G  APGRCS C   G+S TEPY+V HN+IL HA A QRYR  YQ 
Sbjct  194   TFNEPRVVAALGYDNGLHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKYQP  253

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+RL
Sbjct  254   HQKGRIGILLDFVWYEPHSNSNADQGAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRL  313

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             P F+ +E ++VKGSIDYVGINQYT++Y+ DP        +YQ+DW+VGF Y RNGVPIGP
Sbjct  314   PGFSTNESRMVKGSIDYVGINQYTSYYMKDPGAWNLTPVSYQDDWHVGFVYERNGVPIGP  373

Query  342   RVHS  331
             R +S
Sbjct  374   RANS  377



>emb|CBI33559.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   489 bits (1259),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 224/324 (69%), Positives = 267/324 (82%), Gaps = 4/324 (1%)
 Frame = -3

Query  1290  KYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIF  1111
             K GRGP IWD ++K PG    N T +VAVDQYHRYK D+D+M  LNFDAYRFSISW+RIF
Sbjct  4     KAGRGPCIWDPYVKIPGNIAENGTADVAVDQYHRYKEDLDIMKILNFDAYRFSISWSRIF  63

Query  1110  PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYAD  931
             P GTGKVNW+GVAYYNRLINYML+KGI PYANL HYDLP  L+++Y G L R++VED+A+
Sbjct  64    PEGTGKVNWEGVAYYNRLINYMLKKGIIPYANLYHYDLPLVLQEKYNGLLSRRIVEDFAN  123

Query  930   YAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVA  763
             YAEFCFK FGDRVK+W +FNEPRV+AALG+D G   P RCS    NCT GNS+TEPY+ A
Sbjct  124   YAEFCFKTFGDRVKHWTTFNEPRVIAALGFDNGINPPSRCSKAFGNCTAGNSSTEPYIAA  183

Query  762   HNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  583
             HN++L HA AAQRYR  YQ KQKG+ GILLD VWYEPLTRSK D  AAQRA DFH+GWFL
Sbjct  184   HNMLLSHAAAAQRYREKYQEKQKGKIGILLDTVWYEPLTRSKDDQQAAQRAIDFHLGWFL  243

Query  582   HPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT  403
             HPI++G+YPK MQ+IVG+RLP+F+ +E+KLVKGS+D+VGINQYT+FY++DP+   P +  
Sbjct  244   HPIIWGKYPKNMQDIVGERLPKFSEEEIKLVKGSVDFVGINQYTSFYMFDPHKPKPKVTG  303

Query  402   YQNDWNVGFAYARNGVPIGPRVHS  331
             YQ +WN GFAY RNGVPIGPR +S
Sbjct  304   YQEEWNAGFAYDRNGVPIGPRANS  327



>ref|XP_002974513.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
 gb|EFJ24735.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
Length=494

 Score =   490 bits (1261),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 234/352 (66%), Positives = 271/352 (77%), Gaps = 6/352 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR SFP GF FGTA+SAYQVEGA    KYGRGPSIWD F++TPG    NATG+VAVD+Y
Sbjct  22    LSRASFPKGFTFGTATSAYQVEGA--AKKYGRGPSIWDVFIRTPGRVQENATGDVAVDEY  79

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRYK DIDLM  LN DAYRFSISW+RIFP G G+VN  GVAYYNRLI+Y+L KGI PYAN
Sbjct  80    HRYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYAN  139

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             LNHYDLP++LE  Y GWL R+VV+D+ ++AEFCFK FGDRVK W +FNEPRVVA LGYD 
Sbjct  140   LNHYDLPESLEKDYEGWLSREVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDN  199

Query  834   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  667
             G FAPGRCS    NCT+GNSATEPY+VAHNL+L H  AAQ YR  YQ KQKG  GILLDF
Sbjct  200   GQFAPGRCSTPYGNCTEGNSATEPYIVAHNLLLSHGSAAQVYRKNYQEKQKGSIGILLDF  259

Query  666   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  487
             V+YEP + S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLP+F+ D++++VK
Sbjct  260   VYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVK  319

Query  486   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             GS+D+VGIN YTT+Y  D   +      Y  D N+   + R+GV IGPR HS
Sbjct  320   GSVDFVGINHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHS  371



>ref|XP_002990785.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
 gb|EFJ08058.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
Length=495

 Score =   489 bits (1260),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 234/352 (66%), Positives = 271/352 (77%), Gaps = 6/352 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR SFP GF FGTA+SAYQVEGA    KYGRGPSIWD F++TPG    NATG+VAVD+Y
Sbjct  23    LSRASFPKGFTFGTATSAYQVEGA--AKKYGRGPSIWDVFIRTPGRVQENATGDVAVDEY  80

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRYK DIDLM  LN DAYRFSISW+RIFP G G+VN  GVAYYNRLI+Y+L KGI PYAN
Sbjct  81    HRYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYAN  140

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             LNHYDLP++LE  Y GWL R+VV+D+ ++AEFCFK FGDRVK W +FNEPRVVA LGYD 
Sbjct  141   LNHYDLPESLEKDYEGWLSRKVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDN  200

Query  834   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  667
             G FAPGRCS    NCT+GNSATEPY+VAHNL+L H  AAQ YR  YQ KQKG  GILLDF
Sbjct  201   GQFAPGRCSAPYGNCTEGNSATEPYIVAHNLLLSHGSAAQVYRKKYQEKQKGSIGILLDF  260

Query  666   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  487
             V+YEP + S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLP+F+ D++++VK
Sbjct  261   VYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVK  320

Query  486   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             GS+D+VGIN YTT+Y  D   +      Y  D N+   + R+GV IGPR HS
Sbjct  321   GSVDFVGINHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHS  372



>ref|XP_008655551.1| PREDICTED: beta-glucosidase 1-like [Zea mays]
Length=570

 Score =   489 bits (1258),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 290/376 (77%), Gaps = 5/376 (1%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E+    TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG   NNA
Sbjct  91    EKAAAWTGGLSRRSFPKGFVFGTAASAYQVEGMA--HKDGRGPSIWDAFIKIPGEIANNA  148

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T +V VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLINYM+
Sbjct  149   TADVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLINYMV  208

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             +KGITPYANL HYDLP+ALE RYGG L R+VV  +ADYA+FCF  FGDRVKNW +FNEPR
Sbjct  209   KKGITPYANLYHYDLPEALEVRYGGLLSREVVRSFADYADFCFGAFGDRVKNWLTFNEPR  268

Query  861   VVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             VVAALGYD G FAPGRC+ C   G+S TEPYVVAH+LIL HA A QRYR  +Q  Q+GR 
Sbjct  269   VVAALGYDDGRFAPGRCTGCEAGGDSGTEPYVVAHHLILSHAAAVQRYRRRHQPTQRGRV  328

Query  684   GILLDFVWYEPLT-RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  508
             GILLDFVWYEPLT  S AD  AAQR+RDFH+GWFLHPIVYGEYPK+++  V  RLP+FT 
Sbjct  329   GILLDFVWYEPLTADSAADRAAAQRSRDFHVGWFLHPIVYGEYPKSVRRSVKGRLPKFTA  388

Query  507   DEVKLVKGSIDYVGINQYTTFYVYDPYPK-TPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             +E  LV+GSIDYVG+NQYT +YV D  P  T    +Y +DW+  F Y R+GVPIGPR +S
Sbjct  389   EEAGLVRGSIDYVGVNQYTAYYVRDRRPNATAAPPSYSSDWHAEFVYERDGVPIGPRANS  448

Query  330   KISQFFTLALFSNIAH  283
                      L+  + +
Sbjct  449   DWLYIVPWGLYKAVTY  464



>ref|XP_009394053.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 226/357 (63%), Positives = 282/357 (79%), Gaps = 5/357 (1%)
 Frame = -3

Query  1392  RFNTGG--LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             RF  G   L+R++FP GFVFGTA+SAYQVEG     + GRGP IWD F++ PG+ PNNAT
Sbjct  26    RFAVGANQLNRDAFPEGFVFGTAASAYQVEGMA--LEGGRGPCIWDAFVRVPGIIPNNAT  83

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +V+VD+YH YK D+D+M K NFDAYRFSISW+RIFPNGTG++NW+GV YY+RLI+Y++ 
Sbjct  84    ADVSVDEYHHYKEDVDIMKKFNFDAYRFSISWSRIFPNGTGEINWQGVDYYDRLIDYLIL  143

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GITPYANL HYDLP AL   Y GW+  ++V+ +A+YA+FCF+ +GDRVKNWF+FNEPRV
Sbjct  144   QGITPYANLYHYDLPLALHKEYLGWVSPKIVDAFANYADFCFERYGDRVKNWFTFNEPRV  203

Query  858   VAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             V+ALGYD G  APGRC++C   GNS TEPY+V HN+IL HA A +RYR  YQ  QKG+ G
Sbjct  204   VSALGYDNGLHAPGRCTDCKVGGNSTTEPYIVTHNIILSHAAAVKRYREKYQVDQKGKIG  263

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             I+LDFVWYEP T S  D  AAQRARDFH+GWFLHP+ YG YPK++Q IV DRLP+FT D+
Sbjct  264   IILDFVWYEPHTHSANDEAAAQRARDFHLGWFLHPLTYGYYPKSIQEIVKDRLPKFTDDQ  323

Query  501   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK+VKGS DYVG+NQYT +Y+ D     P   +YQ+DW+V F Y ++GVPIGPR +S
Sbjct  324   VKMVKGSYDYVGVNQYTAYYMKDNGVTNPKPVSYQDDWHVEFKYDQDGVPIGPRANS  380



>ref|XP_006845277.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
 gb|ERN06952.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
Length=479

 Score =   483 bits (1243),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 225/336 (67%), Positives = 271/336 (81%), Gaps = 10/336 (3%)
 Frame = -3

Query  1314  VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRF  1135
             VEGA   H+ GRGPSIWD F++ PG+ PN ATGEV+ D+YHRYK D+D+M  +N DAYRF
Sbjct  23    VEGAA--HEDGRGPSIWDVFVQYPGIIPNGATGEVSADEYHRYKEDVDIMADMNMDAYRF  80

Query  1134  SISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGR  955
             SISW+RIFP G G+VN KGV YYNRLI+Y+LEKGITPYANL HYDLPQ+LED Y G L R
Sbjct  81    SISWSRIFPEGVGRVNQKGVDYYNRLIDYLLEKGITPYANLYHYDLPQSLEDSYNGLLNR  140

Query  954   QVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS--------NCT  799
             +VV+D+A YA+FCFK FGDRVKNW +FNEPRV+AALGYD GF APGRCS        NCT
Sbjct  141   RVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGFHAPGRCSNPFGNDGMNCT  200

Query  798   QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAA  619
              G+S+TEPY+VAHNLIL HA A +RYR  YQA QKGR GILLDFVWYEP + +KAD  AA
Sbjct  201   AGDSSTEPYIVAHNLILSHASAVKRYREKYQATQKGRIGILLDFVWYEPFSNAKADVRAA  260

Query  618   QRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYV  439
             QR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGINQYT++Y+
Sbjct  261   QRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGINQYTSYYI  320

Query  438   YDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
              D + K   +  YQ DW+ GF Y+R+G  IGP+ +S
Sbjct  321   KDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANS  356



>gb|KHN44611.1| Beta-glucosidase 44 [Glycine soja]
Length=406

 Score =   480 bits (1236),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 225/283 (80%), Positives = 247/283 (87%), Gaps = 4/283 (1%)
 Frame = -3

Query  1167  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  988
             M  LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLINY+LEKGITPYANL HYDLP A
Sbjct  1     MASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLINYLLEKGITPYANLYHYDLPLA  60

Query  987   LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  808
             LE+RY G L RQVV D+ADYAEFCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS
Sbjct  61    LEERYNGLLSRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCS  120

Query  807   ----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRS  640
                 NCT GNS TEPY+VAHNLIL HA A QRYR  YQ KQKGR GILLDFVWYEPLTRS
Sbjct  121   KEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYREKYQEKQKGRIGILLDFVWYEPLTRS  180

Query  639   KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  460
             KADN AAQRARDFH+GWF+HP+VYGEYP T+QNIVG+RLP+FT +EVK+VKGSID+VGIN
Sbjct  181   KADNLAAQRARDFHVGWFIHPLVYGEYPTTIQNIVGNRLPKFTSEEVKIVKGSIDFVGIN  240

Query  459   QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             QYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGPR +S
Sbjct  241   QYTTYYMYDPHQAKPKVPGYQMDWNAGFAYAKNGVPIGPRAYS  283



>ref|XP_006845278.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
 gb|ERN06953.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
Length=479

 Score =   481 bits (1237),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 224/336 (67%), Positives = 270/336 (80%), Gaps = 10/336 (3%)
 Frame = -3

Query  1314  VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRF  1135
             VEGA   H+ GRGPSIWD F++ PG+ PN ATGEV+ D+YHRYK D+D+M  +N DAYRF
Sbjct  23    VEGAA--HEDGRGPSIWDVFVQYPGIIPNGATGEVSADEYHRYKEDVDIMADMNMDAYRF  80

Query  1134  SISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGR  955
             SISW+RIFP G G+VN KGV YYNRLI+Y+LEKGITPYANL HYDLPQ+LED Y G L R
Sbjct  81    SISWSRIFPEGVGRVNQKGVDYYNRLIDYLLEKGITPYANLYHYDLPQSLEDSYNGLLNR  140

Query  954   QVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS--------NCT  799
             +VV+D+A YA+FCFK FGDRVKNW +FNEPRV+AALGYD GF APGRCS        NCT
Sbjct  141   RVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGFHAPGRCSNPFGNDGMNCT  200

Query  798   QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAA  619
              G+S+TEPY+VAHNLIL HA A +RYR  YQA QKGR GILLDFVWYEP + +KAD  AA
Sbjct  201   AGDSSTEPYIVAHNLILSHASAVKRYREKYQATQKGRIGILLDFVWYEPFSNAKADVRAA  260

Query  618   QRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYV  439
             QR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGIN YT++Y+
Sbjct  261   QRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGINHYTSYYI  320

Query  438   YDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
              D + K   +  YQ DW+ GF Y+R+G  IGP+ +S
Sbjct  321   KDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANS  356



>ref|XP_003562544.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
 ref|XP_010234616.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
Length=500

 Score =   481 bits (1238),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 292/368 (79%), Gaps = 10/368 (3%)
 Frame = -3

Query  1425  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             + QC   PE    +TGGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ 
Sbjct  17    LAQCH-RPEI--HDTGGLSRGAFPEGFVFGTAASAYQVEGMAK--RGGRGPSIWDAFIEI  71

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG+   N T +VAVD+YHRYK D+D+M  + FDAYRFSISW+RIFPNG GKVN +GV YY
Sbjct  72    PGMISGNGTADVAVDEYHRYKEDVDIMKSMGFDAYRFSISWSRIFPNGAGKVNQEGVDYY  131

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++VE +ADYA+FCFK+FGDRVKN
Sbjct  132   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVEAFADYADFCFKVFGDRVKN  191

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             WF+FNEPR VAALGYD G+ APGRCS CT  GNS TEPY+VAH+LIL HA A +RYR  Y
Sbjct  192   WFTFNEPRCVAALGYDNGYHAPGRCSQCTAGGNSMTEPYLVAHHLILSHAAAVKRYREKY  251

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q  QKG+ GILLDFVWYEPL++SKAD  AAQRARDFH+GWFL PIV+G+YP++M  IV  
Sbjct  252   QHHQKGKIGILLDFVWYEPLSKSKADQAAAQRARDFHLGWFLDPIVHGQYPESMLKIVEG  311

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  355
             RLP F+ +E ++VKGS+DYVGIN YT++Y+ DP  +  TP   +YQ+DW+VGF Y RNGV
Sbjct  312   RLPTFSHEESRMVKGSMDYVGINHYTSYYMKDPGAWNLTPV--SYQDDWHVGFVYERNGV  369

Query  354   PIGPRVHS  331
             PIG R +S
Sbjct  370   PIGARANS  377



>gb|AFW79802.1| hypothetical protein ZEAMMB73_091278 [Zea mays]
Length=539

 Score =   480 bits (1236),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 248/372 (67%), Positives = 286/372 (77%), Gaps = 17/372 (5%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             E+    TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG   NNA
Sbjct  48    EKAAAWTGGLSRRSFPKGFVFGTAASAYQVEGMA--HKDGRGPSIWDAFIKIPGEIANNA  105

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
             T +V VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLINYM+
Sbjct  106   TADVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLINYMV  165

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
             +KGITPYANL HYDLP+ALE RYGG L R+VV  +ADYA+FCF  FGDRVKNW +FNEPR
Sbjct  166   KKGITPYANLYHYDLPEALEVRYGGLLSREVVRSFADYADFCFGAFGDRVKNWLTFNEPR  225

Query  861   VVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             VVAALGYD G FAPGRC+ C   G+S TEPYVVAH+LIL HA A QRYR  +Q  Q+GR 
Sbjct  226   VVAALGYDDGRFAPGRCTGCEAGGDSGTEPYVVAHHLILSHAAAVQRYRRRHQPTQRGRV  285

Query  684   GILLDFVWYEPLT-RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  508
             GILLDFVWYEPLT  S AD  AAQR+RDFH+GWFLHPIVYGEYPK+++  V  RLP+FT 
Sbjct  286   GILLDFVWYEPLTADSAADRAAAQRSRDFHVGWFLHPIVYGEYPKSVRRSVKGRLPKFTA  345

Query  507   DEVKLVKGSIDYVGINQYTTFYVYDPYPK-TPYIHTYQNDWNVGF------------AYA  367
             +E  LV+GSIDYVG+NQYT +YV D  P  T    +Y +DW+  F            A  
Sbjct  346   EEAGLVRGSIDYVGVNQYTAYYVRDRRPNATAAPPSYSSDWHAEFVSSLTPIHATLHADE  405

Query  366   RNGVPIGPRVHS  331
             R+GVPIGPR +S
Sbjct  406   RDGVPIGPRANS  417



>gb|KCW52109.1| hypothetical protein EUGRSUZ_J01543 [Eucalyptus grandis]
Length=448

 Score =   476 bits (1226),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 261/322 (81%), Gaps = 4/322 (1%)
 Frame = -3

Query  1284  GRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPN  1105
             GRGPSIWD F++ PG      +GE+AVDQYH+YK DIDLM KLNFDAYRFSISW+RIFPN
Sbjct  6     GRGPSIWDAFVQVPGNIKELDSGEMAVDQYHKYKEDIDLMHKLNFDAYRFSISWSRIFPN  65

Query  1104  GTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYA  925
             GTG VNW+GV YYNRLI+ ++ KGITPYANL HYD+P AL+ RY G L   VV+D+ADYA
Sbjct  66    GTGYVNWRGVNYYNRLIDALIAKGITPYANLYHYDMPLALQLRYEGLLSINVVKDFADYA  125

Query  924   EFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHN  757
             EFCFK FGDRVKNW +FNEPRV+AALG+D+G   P RCS    NCT GNSATEPY+ AH+
Sbjct  126   EFCFKTFGDRVKNWMTFNEPRVIAALGFDSGSNPPNRCSKPYGNCTAGNSATEPYIAAHH  185

Query  756   LILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHP  577
             LIL HA A +RYR  YQAKQ+GR GILLDFVWYEPLT S  DNYAAQRARDFHIGWFLHP
Sbjct  186   LILSHAAAVKRYRKRYQAKQQGRIGILLDFVWYEPLTSSLEDNYAAQRARDFHIGWFLHP  245

Query  576   IVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQ  397
             +VYGEYPKTMQNIVG+RLP+FT  EV +VKG  D+VG+N YT++Y+Y+P         YQ
Sbjct  246   LVYGEYPKTMQNIVGERLPKFTKREVNIVKGGFDFVGVNHYTSYYMYNPNWTETSPPGYQ  305

Query  396   NDWNVGFAYARNGVPIGPRVHS  331
              DWNVGFA+ +NGVPIGPR +S
Sbjct  306   ADWNVGFAFEKNGVPIGPRANS  327



>gb|ACF07998.1| beta-glucosidase [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   478 bits (1230),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 286/368 (78%), Gaps = 8/368 (2%)
 Frame = -3

Query  1422  VQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             ++CD  +P     NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGP IWD F+  
Sbjct  22    LECDGPNPNPEIGNTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPCIWDAFVAI  79

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG+   N T +V VD+YHRYK D+ +M  + FDAYRFSI W+RIFP+GTGKVN +GV YY
Sbjct  80    PGMIAGNGTADVTVDEYHRYKEDVGIMKNMGFDAYRFSIIWSRIFPDGTGKVNQEGVDYY  139

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKN
Sbjct  140   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKN  199

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             WF+FNEPRVVAALGYD GF APGRCS C   G+S TEPY+V HN+IL HA A QRYR  Y
Sbjct  200   WFTFNEPRVVAALGYDNGFHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKY  259

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q  QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+
Sbjct  260   QPHQKGRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVGN  319

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  355
             RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGV
Sbjct  320   RLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGV  377

Query  354   PIGPRVHS  331
             PIGPR +S
Sbjct  378   PIGPRANS  385



>gb|EMT08337.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=507

 Score =   477 bits (1228),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 243/366 (66%), Positives = 283/366 (77%), Gaps = 8/366 (2%)
 Frame = -3

Query  1419  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1240
             QCD     +R NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGPSIWD F   PG
Sbjct  23    QCDGPNPEIR-NTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPSIWDAFAAIPG  79

Query  1239  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1060
                 N + +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNR
Sbjct  80    TIAGNGSADVTVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNR  139

Query  1059  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  880
             LI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKNWF
Sbjct  140   LIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWF  199

Query  879   SFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  703
             +FNEPRVVAALGYD G  APGRCS C   G+S TEPY+V HN+IL HA A QRYR  YQ 
Sbjct  200   TFNEPRVVAALGYDNGLHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKYQP  259

Query  702   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  523
              QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IV +RL
Sbjct  260   HQKGRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVSNRL  319

Query  522   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPI  349
             P F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGVPI
Sbjct  320   PGFSADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGVPI  377

Query  348   GPRVHS  331
             GPR +S
Sbjct  378   GPRANS  383



>gb|KDO62879.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62880.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=406

 Score =   473 bits (1217),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 248/283 (88%), Gaps = 4/283 (1%)
 Frame = -3

Query  1167  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  988
             M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LINY+L++GITPYANL HYDLP+A
Sbjct  1     MANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLINYLLKRGITPYANLYHYDLPEA  60

Query  987   LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  808
             LE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS
Sbjct  61    LEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCS  120

Query  807   ----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRS  640
                 NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ KQKGR GILLDFVWYEPLTRS
Sbjct  121   KAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQKQKGRIGILLDFVWYEPLTRS  180

Query  639   KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  460
             KADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGIN
Sbjct  181   KADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGIN  240

Query  459   QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             QYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPR +S
Sbjct  241   QYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRANS  283



>gb|AAA87339.1| beta-glucosidase [Hordeum vulgare]
Length=509

 Score =   476 bits (1225),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 286/368 (78%), Gaps = 8/368 (2%)
 Frame = -3

Query  1422  VQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             ++CD  +P     NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGP IWD F+  
Sbjct  22    LECDGPNPNPEIGNTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPCIWDAFVAI  79

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
              G+   N T +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YY
Sbjct  80    QGMIAGNGTADVTVDEYHRYKEDVGIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYY  139

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKN
Sbjct  140   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKN  199

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             WF+FNEPRVVAALGYD GF APGRCS C   G+S TEPY+V HN+IL HA A QRYR  Y
Sbjct  200   WFTFNEPRVVAALGYDNGFHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKY  259

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q  QKGR GILLDFVWYEP + + AD  AAQRARDFHIGWFL PI  G YP +M  IVG+
Sbjct  260   QPHQKGRIGILLDFVWYEPHSDTDADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVGN  319

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  355
             RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGV
Sbjct  320   RLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGV  377

Query  354   PIGPRVHS  331
             PIGPR +S
Sbjct  378   PIGPRANS  385



>ref|XP_004958541.1| PREDICTED: beta-glucosidase 26-like [Setaria italica]
Length=539

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 238/354 (67%), Positives = 280/354 (79%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             +NTGGLSR +FPAGFVFGTA+SAYQVEG     + GRGPSIWD F+K PG  P+NAT +V
Sbjct  65    YNTGGLSRRAFPAGFVFGTAASAYQVEGMAK--QGGRGPSIWDAFIKVPGTIPDNATADV  122

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG+VN +GV YYNRLI+YM+++GI
Sbjct  123   AVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNQEGVDYYNRLIDYMIQQGI  182

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF++FGDRVKNWF+FNEPR VAA
Sbjct  183   TPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFQMFGDRVKNWFTFNEPRCVAA  242

Query  849   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD G  APGRCS C   GNS TEPY+VAH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  243   LGYDNGLHAPGRCSGCAAGGNSTTEPYLVAHHLILSHAAAVKRYRDKYQLYQKGRIGILL  302

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PIV G YP +MQ IV DRLP F+ +E ++
Sbjct  303   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIVNGRYPYSMQEIVEDRLPLFSDEESRM  362

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VKGSIDYVGIN YT+FY+ DP        +YQ DW+  F Y RNGVPIG   +S
Sbjct  363   VKGSIDYVGINHYTSFYMKDPGTWNLMPISYQYDWHASFVYERNGVPIGAHANS  416



>ref|XP_006658055.1| PREDICTED: beta-glucosidase 26-like [Oryza brachyantha]
Length=511

 Score =   474 bits (1221),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 235/354 (66%), Positives = 280/354 (79%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  36    YDAGGLSRRAFPKGFVFGTAASAYQVEGMA--KQGGRGPSIWDAFIEKPGTIPNNATADV  93

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNRLI+YM++KGI
Sbjct  94    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMIKKGI  153

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF  FGDRVK+WF+FNEPR VAA
Sbjct  154   TPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFLTFGDRVKDWFTFNEPRCVAA  213

Query  849   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD G  APGRCS+C   GNS TEPY+VAH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  214   LGYDNGLHAPGRCSDCDAGGNSTTEPYLVAHHLILSHAAAVKRYREKYQLYQKGRIGILL  273

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DRLP F+ +E ++
Sbjct  274   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRLPTFSDEESRM  333

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VKGSIDYVGIN YT+FY+ DP P      +YQ+DW+VGF Y RNGVPIG   +S
Sbjct  334   VKGSIDYVGINHYTSFYMKDPGPWNLTPVSYQDDWHVGFVYERNGVPIGAHANS  387



>emb|CDM80087.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   474 bits (1220),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 286/368 (78%), Gaps = 10/368 (3%)
 Frame = -3

Query  1422  VQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
              QC  ++PE    + GGLSR+ FP GFVFGTA+SAYQVEG  +  + GRGPSIWD F+K 
Sbjct  22    AQCHRLNPEI--HDAGGLSRQGFPEGFVFGTAASAYQVEGMAE--QGGRGPSIWDAFIKI  77

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG    N T +VAVD+YHRYK D+D+M  + FDAYRFSISW+RIFP+GTGKVNW+GV YY
Sbjct  78    PGTIAGNGTADVAVDEYHRYKEDVDIMKNMGFDAYRFSISWSRIFPDGTGKVNWEGVDYY  137

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYA+FCFK+FGDRVKN
Sbjct  138   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPRIVGAFADYADFCFKVFGDRVKN  197

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             WF+FNEPR VAALGYD G  APGRCS C+  G+S TEPY+ AH+LIL HA A +RYR  Y
Sbjct  198   WFTFNEPRCVAALGYDNGLHAPGRCSQCSAGGDSTTEPYLAAHHLILSHAAAVRRYRDKY  257

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q  QKGR GILLDFVWYEPL+ S AD  AAQRARDFH+GWFL PI++G YP TM  IV D
Sbjct  258   QHHQKGRIGILLDFVWYEPLSNSNADQAAAQRARDFHLGWFLDPIIHGRYPFTMLEIVKD  317

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGV  355
             RLPRF+ DE  +VKGSIDYVGINQYT+FY+ D   +  TP   +YQ+DW+V F Y RNGV
Sbjct  318   RLPRFSADESTMVKGSIDYVGINQYTSFYMKDNGTWNLTPI--SYQDDWHVEFVYERNGV  375

Query  354   PIGPRVHS  331
             PIG   +S
Sbjct  376   PIGAHANS  383



>ref|NP_001142124.1| uncharacterized protein LOC100274288 precursor [Zea mays]
 gb|ACF87697.1| unknown [Zea mays]
 gb|ACF87698.1| unknown [Zea mays]
 gb|ACR38603.1| unknown [Zea mays]
 tpg|DAA50881.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=502

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 224/352 (64%), Positives = 269/352 (76%), Gaps = 3/352 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD+F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDSFAHVPGNIAGNQNGDVAVD  90

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L++G+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNPEGVAYYNNLINYLLQQGMTPY  150

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + DYA+FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEKKYGGWLSAKMADLFTDYADFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             DTG   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  211   DTGSNPPQRCTRCAAGGNSATEPYIVAHNFLLAHATAVARYRTKYQAAQKGKVGIVLDFN  270

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEALTNSPDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             S DY+GIN+YT+ Y+           +Y  DW V + +ARNG PIGP+ +SK
Sbjct  331   SADYIGINEYTSSYMKGQKLVQLAPSSYSADWQVQYVFARNGKPIGPQANSK  382



>gb|EMS60983.1| Beta-glucosidase 26 [Triticum urartu]
Length=525

 Score =   473 bits (1216),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/368 (65%), Positives = 282/368 (77%), Gaps = 8/368 (2%)
 Frame = -3

Query  1425  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             + QCD     +R NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGPSIWD F   
Sbjct  23    LAQCDGPNPEIR-NTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPSIWDAFAAI  79

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG    N + +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YY
Sbjct  80    PGTIAGNGSADVTVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYY  139

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             NRLI+YML++GI PYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKN
Sbjct  140   NRLIDYMLQQGIAPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKN  199

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIY  709
             WF+FNEPRVVAALGYD G  APGRC+ C   G+S TEPY+  HN+IL HA A Q YR  Y
Sbjct  200   WFTFNEPRVVAALGYDNGLHAPGRCTKCPAGGDSRTEPYIATHNIILSHAAAVQLYREKY  259

Query  708   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  529
             Q  QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+
Sbjct  260   QPHQKGRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGCYPSSMLKIVGN  319

Query  528   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  355
             RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGV
Sbjct  320   RLPGFSADEARMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGV  377

Query  354   PIGPRVHS  331
             PIGPR +S
Sbjct  378   PIGPRANS  385



>ref|XP_002464026.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
 gb|EER91024.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
Length=567

 Score =   474 bits (1219),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 270/356 (76%), Gaps = 3/356 (1%)
 Frame = -3

Query  1395  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1216
             V  +TGGLSR++FP GF+FGTA+SA+QVEGA      GRGP IWD F+ TPG    +   
Sbjct  43    VGADTGGLSRDAFPKGFIFGTATSAFQVEGA--ATSGGRGPCIWDPFVHTPGKIAEDGNA  100

Query  1215  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1036
             +V  D+YHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI+YM+++
Sbjct  101   DVTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNEEGVQYYNDLIDYMIKQ  160

Query  1035  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  856
             G+TPYANLNHYDLP AL+ +Y GWLG ++V+ +ADYA+FCFK FGDRVKNWF+ NEPR+V
Sbjct  161   GLTPYANLNHYDLPLALQKKYQGWLGPKIVDIFADYADFCFKTFGDRVKNWFTLNEPRIV  220

Query  855   AALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
             + LGYD G   P RC+ CT  GNS+TEPY+V HN++L HA A  RYR  YQA QKG+ GI
Sbjct  221   SFLGYDKGIDPPNRCTQCTAGGNSSTEPYIVVHNILLSHATAVARYRNKYQATQKGKVGI  280

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
             +LDF WYEPLT S  D  AAQRARDFHIGWFL P++ G+YPKTMQ+IV DRLP FTP++ 
Sbjct  281   VLDFNWYEPLTNSTEDQAAAQRARDFHIGWFLDPLINGQYPKTMQDIVKDRLPSFTPEQA  340

Query  498   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             KLVKGS DY GINQYTT Y+ +         +Y +DW V + + RNGV IG   HS
Sbjct  341   KLVKGSSDYFGINQYTTNYISNQQTTQQGPPSYSSDWGVQYNFERNGVQIGQLAHS  396



>ref|XP_002461141.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
 gb|EER97662.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
Length=512

 Score =   471 bits (1213),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 234/354 (66%), Positives = 276/354 (78%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F++ PG  PNNAT +V
Sbjct  38    YDAGGLSRRAFPEGFVFGTAASAYQVEGMAK--HGGRGPSIWDAFIEVPGTIPNNATADV  95

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTGKVN +GV YYNRLI+YML++GI
Sbjct  96    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGKVNQEGVDYYNRLIDYMLQQGI  155

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
             TPYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF+ FGDRVKNWF+FNEPR VAA
Sbjct  156   TPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFQTFGDRVKNWFTFNEPRCVAA  215

Query  849   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD G  APGRCS C   GNS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  216   LGYDNGLHAPGRCSECAAGGNSTTEPYLAAHHLILSHAAAVRRYRDKYQLYQKGRIGILL  275

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PI+ G YP +MQ IV DRLP F+ +E ++
Sbjct  276   DFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIINGRYPYSMQEIVKDRLPLFSDEESRM  335

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VKGSIDYVGIN YT+FY+ DP        +YQ+DW+VGF Y RN +PIG   +S
Sbjct  336   VKGSIDYVGINHYTSFYMKDPGTWNLTPVSYQDDWHVGFVYERNSIPIGAHANS  389



>ref|NP_001148821.1| LOC100282438 precursor [Zea mays]
 gb|ACG33023.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=512

 Score =   471 bits (1211),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 236/356 (66%), Positives = 279/356 (78%), Gaps = 7/356 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F++ PG  PNNAT +V
Sbjct  38    YDAGGLSRRAFPDGFVFGTAASAYQVEGMAK--HGGRGPSIWDAFIEVPGTIPNNATADV  95

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNRLI+YML++GI
Sbjct  96    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGI  155

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF  FGDRVKNWF+FNEPR VAA
Sbjct  156   APYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFHAFGDRVKNWFTFNEPRCVAA  215

Query  849   LGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD G  APGRCS C   GNS TEPY+VAH+LIL HA A +RYR  YQ  QKG+ GILL
Sbjct  216   LGYDNGLHAPGRCSGCPAGGNSTTEPYLVAHHLILSHAAAVRRYRDKYQLHQKGKIGILL  275

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PIV+G YP +MQ I  DRLP F+ +E ++
Sbjct  276   DFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIVHGRYPYSMQEIAKDRLPLFSDEEARM  335

Query  492   VKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VKGSIDYVGIN YT+FY+ DP  +  TP   +YQ+DW+VGF Y RNGVPIG   +S
Sbjct  336   VKGSIDYVGINHYTSFYMKDPGTWNLTPV--SYQDDWHVGFVYERNGVPIGAHANS  389



>ref|NP_001151026.1| LOC100284659 precursor [Zea mays]
 gb|ACG41348.1| beta-glucosidase precursor [Zea mays]
 tpg|DAA50884.1| TPA: hypothetical protein ZEAMMB73_397657 [Zea mays]
Length=564

 Score =   473 bits (1216),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 222/353 (63%), Positives = 269/353 (76%), Gaps = 3/353 (1%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             +TGGLSR++FP GFVFGTA+SAYQVEGA      GRGP IWD F+ TPG    +A  +V 
Sbjct  44    DTGGLSRDAFPKGFVFGTATSAYQVEGAATSG--GRGPCIWDPFVHTPGKIAEDANADVT  101

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
              D+YHRYK D+DLM  LNFDAYRFSISW+RIFP+G GK+N +GV YYN LI+YM+++G+T
Sbjct  102   TDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKINEEGVQYYNNLIDYMIKQGLT  161

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PYANLNHYDLP AL+ +Y GWLG ++V+ +ADYA+FCFK FG+RVKNWF+ NEPR+VA L
Sbjct  162   PYANLNHYDLPLALQKKYQGWLGPKIVDIFADYADFCFKTFGNRVKNWFTLNEPRIVAFL  221

Query  846   GYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             GYD G   P RC+ CT  GNS+TEPY+V HN++L HA A  RYR  YQA QKG+ GI+LD
Sbjct  222   GYDKGLNPPNRCTQCTAGGNSSTEPYIVVHNILLSHATAVARYRNKYQATQKGKVGIVLD  281

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
             F WYEP T S  D  AAQRARDFHIGWFL P++ G+YPK MQ+IV DRLP FTP++ KLV
Sbjct  282   FNWYEPFTNSTEDQKAAQRARDFHIGWFLDPLINGQYPKIMQDIVKDRLPSFTPEQAKLV  341

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             KGS DY GINQYTT+Y+ D         +Y +DW V + + RNGV IG   HS
Sbjct  342   KGSSDYFGINQYTTYYIADQQTPPQGPPSYSSDWGVQYYFQRNGVQIGQMAHS  394



>pdb|4JIE|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
 pdb|4JHO|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
Length=503

 Score =   470 bits (1210),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 232/354 (66%), Positives = 278/354 (79%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  28    YDAGGLSRRAFPEGFVFGTAASAYQVEGM--AKQGGRGPSIWDAFIEKPGTIPNNATADV  85

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG VN +GV YYNRLI+YM++KGI
Sbjct  86    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKKGI  145

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PYANL HYDLP AL ++Y GWL   +VE +ADYA+FCF+ FGDRVK+WF+FNEPR VAA
Sbjct  146   KPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAA  205

Query  849   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD GF APGRCS C   GNS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  206   LGYDNGFHAPGRCSGCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQKGRIGILL  265

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DR+P F+ +E ++
Sbjct  266   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRM  325

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK SIDYVGIN YT+FY+ DP P      +YQ+DW+VGFAY RNGVPIG + +S
Sbjct  326   VKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQANS  379



>gb|ACL52625.1| unknown [Zea mays]
 tpg|DAA63940.1| TPA: non-cyanogenic beta-glucosidase [Zea mays]
Length=512

 Score =   470 bits (1210),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/354 (66%), Positives = 276/354 (78%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F++ PG  PNNAT +V
Sbjct  38    YDAGGLSRRAFPDGFVFGTAASAYQVEGMAK--HGGRGPSIWDAFIEVPGTIPNNATADV  95

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNRLI+YML++GI
Sbjct  96    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGI  155

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF  FGDRVKNWF+FNEPR VAA
Sbjct  156   APYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFHAFGDRVKNWFTFNEPRCVAA  215

Query  849   LGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD G  APGRCS C   GNS TEPY+VAH+LIL HA A +RYR  YQ  QKG+ GILL
Sbjct  216   LGYDNGLHAPGRCSGCPAGGNSTTEPYLVAHHLILSHAAAVRRYRDKYQLHQKGKIGILL  275

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PIV+G YP +MQ I  DRLP F+ +E ++
Sbjct  276   DFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIVHGRYPYSMQEIAKDRLPLFSDEEARM  335

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VKGSIDYVGIN YT+FY+ DP        +YQ+DW+VGF Y RNGVPIG   +S
Sbjct  336   VKGSIDYVGINHYTSFYMKDPGTWNLTPVSYQDDWHVGFVYERNGVPIGAHANS  389



>gb|ACF35791.1| beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group]
Length=483

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/354 (66%), Positives = 278/354 (79%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  8     YDAGGLSRRAFPEGFVFGTAASAYQVEGM--AKQGGRGPSIWDAFIEKPGTIPNNATADV  65

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG VN +GV YYNRLI+YM++KGI
Sbjct  66    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKKGI  125

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PYANL HYDLP AL ++Y GWL   +VE +ADYA+FCF+ FGDRVK+WF+FNEPR VAA
Sbjct  126   KPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAA  185

Query  849   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD GF APGRCS C   GNS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  186   LGYDNGFHAPGRCSGCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQKGRIGILL  245

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DR+P F+ +E ++
Sbjct  246   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRM  305

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK SIDYVGIN YT+FY+ DP P      +YQ+DW+VGFAY RNGVPIG + +S
Sbjct  306   VKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQANS  359



>gb|EMT23872.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=537

 Score =   470 bits (1210),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/353 (67%), Positives = 278/353 (79%), Gaps = 7/353 (2%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             + GG SR+ FP GFVFGTA+SAYQVEG  +  + GRGPSIWD F+K PG  P N T +VA
Sbjct  43    DAGGRSRQGFPEGFVFGTATSAYQVEGMAE--QGGRGPSIWDAFIKIPGTIPGNGTADVA  100

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
             VD+YHRYK D+D+M  + FDAYRFSISW+RIFP+GTGKVNW+GV YYNRLI+YML++GIT
Sbjct  101   VDEYHRYKEDVDIMKNMGFDAYRFSISWSRIFPDGTGKVNWEGVDYYNRLIDYMLQQGIT  160

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PYANL HYDLP AL  RY GWL   +V  +ADYA+FCFK+FGDRVKNWF+FNEPR VAAL
Sbjct  161   PYANLYHYDLPLALHQRYLGWLSPNIVGAFADYADFCFKVFGDRVKNWFTFNEPRCVAAL  220

Query  846   GYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             GYD G  APGRCS C+  G+S TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILLD
Sbjct  221   GYDIGLHAPGRCSQCSAGGDSTTEPYLAAHHLILSHAAAVRRYRDKYQHHQKGRIGILLD  280

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
             FVWYEPL+ S AD  AAQRARDFH+GWFL PI++G YP TM  IV DRLPRF+ DE ++V
Sbjct  281   FVWYEPLSNSNADQAAAQRARDFHLGWFLDPIIHGHYPFTMLEIVKDRLPRFSDDESRMV  340

Query  489   KGSIDYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRV  337
             KGSIDYVGINQYT+FY+ D   +  TP   +YQ+DW+V F + RNGV IG  +
Sbjct  341   KGSIDYVGINQYTSFYMKDNGTWNLTPV--SYQDDWHVEFVFKRNGVLIGAHM  391



>sp|A3BMZ5.1|BGL26_ORYSJ RecName: Full=Beta-glucosidase 26; Short=Os7bglu26; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|EAZ04982.1| hypothetical protein OsI_27163 [Oryza sativa Indica Group]
 gb|EAZ40934.1| hypothetical protein OsJ_25416 [Oryza sativa Japonica Group]
Length=510

 Score =   469 bits (1207),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 232/354 (66%), Positives = 278/354 (79%), Gaps = 3/354 (1%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  35    YDAGGLSRRAFPEGFVFGTAASAYQVEGMA--KQGGRGPSIWDAFIEKPGTIPNNATADV  92

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG VN +GV YYNRLI+YM++KGI
Sbjct  93    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKKGI  152

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PYANL HYDLP AL ++Y GWL   +VE +ADYA+FCF+ FGDRVK+WF+FNEPR VAA
Sbjct  153   KPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAA  212

Query  849   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             LGYD GF APGRCS C   GNS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  213   LGYDNGFHAPGRCSGCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQKGRIGILL  272

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DR+P F+ +E ++
Sbjct  273   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRM  332

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             VK SIDYVGIN YT+FY+ DP P      +YQ+DW+VGFAY RNGVPIG + +S
Sbjct  333   VKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQANS  386



>ref|XP_006650460.1| PREDICTED: beta-glucosidase 8-like [Oryza brachyantha]
Length=568

 Score =   471 bits (1212),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 272/360 (76%), Gaps = 5/360 (1%)
 Frame = -3

Query  1401  ERVRF--NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             +RVR   + GGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TPG    
Sbjct  34    DRVRAADDAGGLSRAAFPKGFVFGTATSAFQVEGM--AASAGRGPSIWDPFVHTPGNIAG  91

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NA  +V  D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G G++N +GVAYYN LI+Y
Sbjct  92    NANADVTTDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGRINTEGVAYYNNLIDY  151

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +L++G+ PY NLNHYDLP AL+ +Y GWL  ++V  +ADYAEFCFK +GDRVKNWF+FNE
Sbjct  152   VLKQGLIPYVNLNHYDLPLALQKKYEGWLSSKIVGVFADYAEFCFKTYGDRVKNWFTFNE  211

Query  867   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             PR+VAALG+D G   P RC+ C   GNSATEPY+VAHN+IL HA A  RYR  YQA QKG
Sbjct  212   PRIVAALGHDAGTDPPNRCTKCAAGGNSATEPYIVAHNIILSHATAVDRYRNKYQASQKG  271

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             + GI+LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FT
Sbjct  272   KIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFT  331

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             P++ KLVKGS DY GINQYT  Y+ D         +Y +DW+V F + RNG+PIG + +S
Sbjct  332   PEQAKLVKGSADYFGINQYTASYMSDQPAPQQAPTSYSSDWHVSFIFQRNGIPIGQQANS  391



>ref|NP_001051014.1| Os03g0703100 [Oryza sativa Japonica Group]
 sp|Q75I94.1|BGL08_ORYSJ RecName: Full=Beta-glucosidase 8; Short=Os3bglu8; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07251.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF98427.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12928.1| Os03g0703100 [Oryza sativa Japonica Group]
 dbj|BAH00173.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59768.1| hypothetical protein OsJ_12263 [Oryza sativa Japonica Group]
Length=568

 Score =   468 bits (1205),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 223/365 (61%), Positives = 274/365 (75%), Gaps = 6/365 (2%)
 Frame = -3

Query  1413  DVSPERVRF---NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
             D +  RVR    +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TP
Sbjct  29    DRAGARVRAADDDTGGLSRAAFPKGFVFGTATSAFQVEGM--AASGGRGPSIWDPFVHTP  86

Query  1242  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1063
             G    N   +V  D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN
Sbjct  87    GNIAGNGNADVTTDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYN  146

Query  1062  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  883
              LI+Y++++G+ PY NLNHYDLP AL+ +Y GWL  ++V  ++DYAEFCFK +GDRVKNW
Sbjct  147   NLIDYVIKQGLIPYVNLNHYDLPLALQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNW  206

Query  882   FSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             F+FNEPR+VAALG+DTG   P RC+ C   GNSATEPY+VAHN+IL HA A  RYR  +Q
Sbjct  207   FTFNEPRIVAALGHDTGTDPPNRCTKCAAGGNSATEPYIVAHNIILSHATAVDRYRNKFQ  266

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  526
             A QKG+ GI+LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +R
Sbjct  267   ASQKGKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKER  326

Query  525   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  346
             LP FTP++ KLVKGS DY GINQYT  Y+ D         +Y +DW+V F + RNGVPIG
Sbjct  327   LPTFTPEQAKLVKGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIG  386

Query  345   PRVHS  331
              + +S
Sbjct  387   QQANS  391



>gb|EEC76023.1| hypothetical protein OsI_13187 [Oryza sativa Indica Group]
Length=568

 Score =   468 bits (1205),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 269/353 (76%), Gaps = 3/353 (1%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TPG    N   +V 
Sbjct  41    DTGGLSRAAFPKGFVFGTATSAFQVEGM--AASGGRGPSIWDPFVHTPGNIAGNGNADVT  98

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
              D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LI+Y++++G+ 
Sbjct  99    TDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYNNLIDYVIKQGLI  158

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PY NLNHYDLP AL+ +Y GWL  ++V  ++DYAEFCFK +GDRVKNWF+FNEPR+VAAL
Sbjct  159   PYVNLNHYDLPLALQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNWFTFNEPRIVAAL  218

Query  846   GYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G+DTG   P RC+ C   GNSATEPY+VAHN+IL HA A  RYR  +QA QKG+ GI+LD
Sbjct  219   GHDTGTDPPNRCTKCAAGGNSATEPYIVAHNIILSHATAVDRYRNKFQASQKGKIGIVLD  278

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
             F WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLV
Sbjct  279   FNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLV  338

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             KGS DY GINQYT  Y+ D         +Y +DW+V F + RNGVPIG + +S
Sbjct  339   KGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANS  391



>gb|ACG44181.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=466

 Score =   462 bits (1189),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 221/352 (63%), Positives = 264/352 (75%), Gaps = 3/352 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGTA+SAYQVEGA   +  GRGPS WD F+ TPG    N T +VAVD
Sbjct  34    GGLSRAAFPKDFVFGTATSAYQVEGAASTN--GRGPSTWDAFVHTPGNIVYNQTADVAVD  91

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRY+ D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L KGITPY
Sbjct  92    QYHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLRKGITPY  151

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
             ANL H DLP AL+++YGGWL  ++ + + DYA+FCFK FGDRVK+WF+FNEPR+VA LGY
Sbjct  152   ANLYHSDLPLALQNKYGGWLNAKMAKLFTDYADFCFKTFGDRVKHWFTFNEPRIVALLGY  211

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C+  GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  212   DAGSIPPQRCTKCSAGGNSATEPYIVAHNFLLSHAAAVSRYRNKYQAAQKGKVGIVLDFN  271

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLP+FTP++ KLVKG
Sbjct  272   WYEALTNSTEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKFTPEQAKLVKG  331

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             S DY+GINQYT  YV           +Y  DW V +   RNG PIGP+ +SK
Sbjct  332   SADYIGINQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQANSK  383



>ref|XP_006495386.1| PREDICTED: beta-glucosidase 44-like, partial [Citrus sinensis]
Length=422

 Score =   460 bits (1183),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 216/301 (72%), Positives = 251/301 (83%), Gaps = 6/301 (2%)
 Frame = -3

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +V VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE
Sbjct  1     ADVTVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLE  60

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GITPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV
Sbjct  61    QGITPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRV  120

Query  858   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             +AALG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG
Sbjct  121   IAALGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKG  180

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             + GILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FT
Sbjct  181   KIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFT  240

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             P+EV +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPR +
Sbjct  241   PEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRAN  299

Query  333   S  331
             S
Sbjct  300   S  300



>ref|XP_008665263.1| PREDICTED: beta-glucosidase 7-like [Zea mays]
 tpg|DAA50883.1| TPA: hypothetical protein ZEAMMB73_196159 [Zea mays]
Length=506

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 221/352 (63%), Positives = 264/352 (75%), Gaps = 3/352 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGTA+SAYQVEGA   +  GRGPS WD F+ TPG    N T +VAVD
Sbjct  34    GGLSRAAFPKDFVFGTATSAYQVEGAASTN--GRGPSTWDAFVHTPGNIVYNQTADVAVD  91

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRY+ D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L KGITPY
Sbjct  92    QYHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLRKGITPY  151

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
             ANL H DLP AL+++YGGWL  ++ + + DYA+FCFK FGDRVK+WF+FNEPR+VA LGY
Sbjct  152   ANLYHSDLPLALQNKYGGWLNAKMAKLFTDYADFCFKTFGDRVKHWFTFNEPRIVALLGY  211

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C+  GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  212   DAGSIPPQRCTKCSAGGNSATEPYIVAHNFLLSHAAAVSRYRNKYQAAQKGKVGIVLDFN  271

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLP+FTP++ KLVKG
Sbjct  272   WYEALTNSTEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKFTPEQAKLVKG  331

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSK  328
             S DY+GINQYT  YV           +Y  DW V +   RNG PIGP+ +SK
Sbjct  332   SADYIGINQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQANSK  383



>gb|ADP02192.1| putative non-cyanogenic beta-glucosidase [Triticum aestivum]
Length=507

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/360 (63%), Positives = 262/360 (73%), Gaps = 4/360 (1%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             SP R  +  GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F   PG    
Sbjct  29    SPRRPNW-LGGLSRASFPKGFVFGTATSAYQVEGM--AAGGGRGPSIWDAFAHVPGNIAG  85

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             N   +V  DQYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY
Sbjct  86    NQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNKEGVAYYNNLINY  145

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +L+KGITPY NL HYDLP ALE +YGGWL  + V  +ADYA+FCFK FGDRVK+WF+FNE
Sbjct  146   LLQKGITPYINLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNE  205

Query  867   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             PR+VA LGYD G   P RCS C   GNSATEPY+VAHN +L H  A  RYR  YQA QKG
Sbjct  206   PRIVALLGYDVGSNPPQRCSKCAAGGNSATEPYIVAHNFLLAHGYAVARYRTKYQAAQKG  265

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             + GI+LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT
Sbjct  266   KVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFT  325

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             PDE KLVKGS DY+GINQYT   +           +Y  DW V +A+ RNG PIGP+ +S
Sbjct  326   PDEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANS  385



>ref|XP_004982055.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Setaria italica]
Length=503

 Score =   461 bits (1185),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 223/351 (64%), Positives = 265/351 (75%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDAFAHIPGKVAGNQNGDVAVD  90

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KG+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLQKGMTPY  150

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +Y +FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEQKYGGWLSSKMADLFTEYVDFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA AA RYR  YQA QKG+ GI+LDF 
Sbjct  211   DAGSNPPQRCTKCAAGGNSATEPYIVAHNFLLAHAAAAARYRTKYQAAQKGKIGIVLDFN  270

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYEPLT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEPLTNSTDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V +  ARNG PIGP+ +S
Sbjct  331   SADYIGINQYTASYMKGQKLLQQTPTSYSADWQVQYVLARNGKPIGPQANS  381



>ref|XP_003559510.1| PREDICTED: beta-glucosidase 8-like [Brachypodium distachyon]
Length=570

 Score =   463 bits (1191),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 265/353 (75%), Gaps = 3/353 (1%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TPG    N   +V 
Sbjct  39    DTGGLSRAAFPKGFVFGTAASAFQVEGM--AASGGRGPSIWDPFVHTPGNIAGNGNADVT  96

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
              D+YH YK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LI+Y+++KG+ 
Sbjct  97    TDEYHHYKEDVELMKSLNFDAYRFSISWSRIFPDGEGRVNEEGVAYYNNLIDYVIKKGLI  156

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PY NLNHYD+P AL+ +Y GWL  ++V  ++DYAEFCFK +GDRV+NWF+FNEPR+VAAL
Sbjct  157   PYVNLNHYDIPLALQKKYDGWLSPKIVNIFSDYAEFCFKTYGDRVQNWFTFNEPRIVAAL  216

Query  846   GYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G+DTG   P RC+ C   GNSATEPY V HN++L HA A  RYR  YQA QKG+ GI+LD
Sbjct  217   GFDTGIDPPNRCTKCAAGGNSATEPYTVVHNILLSHATAVARYRNKYQASQKGKIGIVLD  276

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
             F WYEPLT S  D  AAQRARDFH+GWFL P+V G+YPKTMQ+IV +RLP FT ++ KLV
Sbjct  277   FNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLVNGQYPKTMQDIVKERLPSFTSEQSKLV  336

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             KGS DY GINQYT  Y+ D         +Y +DW+V F + RNG PIGP  +S
Sbjct  337   KGSADYFGINQYTASYMADQPTPQQAPTSYSSDWHVSFIFQRNGKPIGPLANS  389



>ref|XP_002464027.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
 gb|EER91025.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
Length=514

 Score =   459 bits (1180),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 219/351 (62%), Positives = 264/351 (75%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP GFVFGTA+SAYQVEGA   +  GRGPS WD F+ TPG    N T +VAVD
Sbjct  43    GGLSRPAFPRGFVFGTATSAYQVEGAASTN--GRGPSTWDPFVHTPGNIVGNQTADVAVD  100

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRY+ D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYY  LI+Y+L+KGITPY
Sbjct  101   QYHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYKNLISYLLQKGITPY  160

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
             ANL H DLP AL+++YGGWL  ++ + + DYA+FCFK FGD VK+WF+FNEPR+VA LGY
Sbjct  161   ANLYHSDLPLALQNKYGGWLNPKMAKLFTDYADFCFKSFGDHVKHWFTFNEPRIVALLGY  220

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  221   DGGSIPPQRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRNKYQAAQKGKVGIVLDFN  280

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYEPLT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ+IV +RLP+FTP + KLVKG
Sbjct  281   WYEPLTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQMMQDIVKERLPKFTPGQAKLVKG  340

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V +A  RNG PIGP+ +S
Sbjct  341   SADYIGINQYTASYIKGQKLLQQKPTSYSADWQVQYALERNGKPIGPQANS  391



>ref|XP_004982054.1| PREDICTED: beta-glucosidase 8-like [Setaria italica]
Length=566

 Score =   460 bits (1183),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 223/356 (63%), Positives = 274/356 (77%), Gaps = 3/356 (1%)
 Frame = -3

Query  1395  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1216
             V  +TGGLSR++FP GFVFGTA+SA+QVEGA   +  GRGPSIWD F+ TPG    +A  
Sbjct  40    VGADTGGLSRDAFPKGFVFGTATSAFQVEGAASTN--GRGPSIWDPFVHTPGKIAGDANA  97

Query  1215  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1036
             +V  D+YHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI++ML++
Sbjct  98    DVTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNEEGVQYYNNLIDHMLKQ  157

Query  1035  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  856
             G+TPYANLNHYDLP AL+ +Y GWLG ++V+ +ADYA+FCFK FGDRVKNWF+ NEPR+V
Sbjct  158   GLTPYANLNHYDLPLALQKKYKGWLGPKIVDIFADYADFCFKTFGDRVKNWFTLNEPRIV  217

Query  855   AALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
             + LGYD G   P RC+ C   GNSATEPY+V HN++L HA A  RYR  YQA QKG+ GI
Sbjct  218   SFLGYDKGLNPPNRCTQCAAGGNSATEPYIVVHNILLSHATAVARYRNKYQATQKGKVGI  277

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
             +LDF WYEPLT S AD  AAQRARDFH+GWF+ P++ G+YPKTMQ+IV DRLP FTP++ 
Sbjct  278   VLDFNWYEPLTNSTADQAAAQRARDFHVGWFMDPLINGQYPKTMQDIVKDRLPSFTPEQA  337

Query  498   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             KLVKGS D  GINQYTT+Y+ D         +Y +DW V + + RNG+PIG   +S
Sbjct  338   KLVKGSSDCFGINQYTTYYISDEQTPQQATPSYSSDWGVQYNFERNGLPIGQLANS  393



>ref|XP_006651730.1| PREDICTED: beta-glucosidase 7-like, partial [Oryza brachyantha]
Length=467

 Score =   456 bits (1172),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 260/349 (74%), Gaps = 3/349 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F  TPG    N  G+VA DQY
Sbjct  1     LSRAAFPKGFVFGTATSAYQVEGMAASG--GRGPSIWDDFAHTPGNVAGNQNGDVATDQY  58

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L KGITPY N
Sbjct  59    HRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLLKGITPYVN  118

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLP ALE +YGGWL  ++ + + +YA+FCFK FGDRVK+WF+FNEPR+VA LGYD 
Sbjct  119   LYHYDLPLALEKKYGGWLSTKMADLFTEYADFCFKTFGDRVKHWFTFNEPRIVALLGYDQ  178

Query  834   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF WY
Sbjct  179   GTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQRGKVGIVLDFNWY  238

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             E L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS 
Sbjct  239   EALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSA  298

Query  477   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  299   DYIGINQYTASYMKGQQLIQQTPTSYSADWQVSYVFAKNGKPIGPQANS  347



>ref|NP_001051013.1| Os03g0703000 [Oryza sativa Japonica Group]
 sp|Q75I93.1|BGL07_ORYSJ RecName: Full=Beta-glucosidase 7; Short=Os3bglu7; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07254.1| beta-glucosidase (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|AAX95519.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
 gb|ABF98423.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12927.1| Os03g0703000 [Oryza sativa Japonica Group]
 dbj|BAG94472.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30396.1| beta-glucosidase [Oryza sativa]
Length=504

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 262/351 (75%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGTA+SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  36    GGLSRAAFPKRFVFGTATSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  93

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  94    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  153

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  154   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  213

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  214   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  273

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  274   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  333

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  334   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  384



>dbj|BAJ90056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 220/351 (63%), Positives = 257/351 (73%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F   PG    N   +V  D
Sbjct  31    GGLSRASFPKGFVFGTATSAYQVEGMATGG--GRGPSIWDAFAHVPGNIAGNQNADVTTD  88

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L+KGITPY
Sbjct  89    QYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNQEGVAYYNNLINYLLQKGITPY  148

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  + V  +ADYA+FCFK FGDRVK+WF+FNEPR+VA LGY
Sbjct  149   INLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNEPRIVALLGY  208

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RCS CT  GNSATEPY+VAHN +L H  A  RYR  YQA QKG+ GI+LDF 
Sbjct  209   DVGSNPPQRCSKCTAGGNSATEPYIVAHNFLLAHGYAVARYRTKYQAAQKGKVGIVLDFN  268

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+FTP E K+V G
Sbjct  269   WYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPKFTPAEAKMVMG  328

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT   +           +Y  DW V +A+ RNG PIGP+ +S
Sbjct  329   SADYIGINQYTASLMKGQKLLQQTPTSYSADWQVTYAFERNGKPIGPKANS  379



>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCN|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCO|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCO|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCT|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCT|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCU|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
 pdb|3SCU|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
Length=481

 Score =   455 bits (1171),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  361



>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCP|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCQ|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCQ|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   455 bits (1171),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  361



>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCR|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCS|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCS|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  361



>ref|XP_004982056.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Setaria italica]
Length=502

 Score =   456 bits (1172),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 265/351 (75%), Gaps = 4/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDAFAHIPGKVAGNQNGDVAVD  90

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KG+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLQKGMTPY  150

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +Y +FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEQKYGGWLSSKMADLFTEYVDFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA AA RYR  YQA QKG+ GI+LDF 
Sbjct  211   DAGSNPPQRCTKCAAGGNSATEPYIVAHNFLLAHAAAAARYRTKYQAAQKGKIGIVLDFN  270

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYEPLT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEPLTNSTDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V +  +RNG PIGP+ +S
Sbjct  331   SADYIGINQYTASYMKGQKLLQQTPTSYSADWQVQYV-SRNGKPIGPQANS  380



>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCV|B Chain B, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYAADWQVTYVFAKNGKPIGPQANS  361



>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGL|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Length=481

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  361



>tpg|DAA50882.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=390

 Score =   451 bits (1161),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 213/334 (64%), Positives = 255/334 (76%), Gaps = 3/334 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD+F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDSFAHVPGNIAGNQNGDVAVD  90

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L++G+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNPEGVAYYNNLINYLLQQGMTPY  150

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + DYA+FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEKKYGGWLSAKMADLFTDYADFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             DTG   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  211   DTGSNPPQRCTRCAAGGNSATEPYIVAHNFLLAHATAVARYRTKYQAAQKGKVGIVLDFN  270

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEALTNSPDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNV  382
             S DY+GIN+YT+ Y+           +Y  DW +
Sbjct  331   SADYIGINEYTSSYMKGQKLVQLAPSSYSADWQL  364



>gb|AAA84906.3| beta-glucosidase [Oryza sativa Japonica Group]
Length=504

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  36    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  93

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  94    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  153

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  154   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  213

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  214   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  273

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  274   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  333

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  334   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  384



>gb|EEC69164.1| hypothetical protein OsI_38122 [Oryza sativa Indica Group]
Length=492

 Score =   454 bits (1168),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/377 (58%), Positives = 272/377 (72%), Gaps = 5/377 (1%)
 Frame = -3

Query  1410  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1231
             VS  R       L+RE+FPAGFVFGTASSAYQVEG  +  KYGRGP IWDTFL  PG+ P
Sbjct  14    VSLSRGNGEQTDLTRETFPAGFVFGTASSAYQVEG--NALKYGRGPCIWDTFLMQPGVTP  71

Query  1230  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1051
             +N+T  V VD+YHRY  D+D MV++ FDAYRFSISW+RIFP+G GK+N  GV YY+RLI+
Sbjct  72    DNSTANVTVDEYHRYMDDVDNMVRVGFDAYRFSISWSRIFPSGLGKINKDGVDYYHRLID  131

Query  1050  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  871
             YML   I PY  L HYDLPQ L D+Y GWL  ++V D+  YA+FCFK +G +VKNWF+ N
Sbjct  132   YMLANNIIPYVVLYHYDLPQVLHDQYKGWLHPRIVRDFVRYADFCFKTYGHKVKNWFTIN  191

Query  870   EPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             EPR++A  GY  GFF PGRC++C   GNSATEPY+ AHNL+L HA A + YR  YQA QK
Sbjct  192   EPRMMANHGYGDGFFPPGRCTSCQPGGNSATEPYIAAHNLLLSHAAAVRTYRDKYQAIQK  251

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             G+ GILLDFVWYEPLT  + D+ AA RAR+F +GW+LHPI+YG YP+TMQN V +RLP F
Sbjct  252   GKIGILLDFVWYEPLTDKEEDHAAAHRAREFTLGWYLHPIIYGHYPETMQNAVKERLPNF  311

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVH  334
             T ++ +++KGS DY+ IN YTT+YV     KT    +Y NDW+V  +Y RNGVPIG + +
Sbjct  312   TREQSEMIKGSADYIAINHYTTYYVSHHVNKTSI--SYLNDWDVKISYERNGVPIGKQAY  369

Query  333   SKISQFFTLALFSNIAH  283
             S         ++  + H
Sbjct  370   SNWLYVVPWGIYKAVMH  386



>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F4V|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3AHT|A Chain A, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHT|B Chain B, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHV|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
 pdb|3AHV|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
Length=481

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 261/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FN+PR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNQPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANS  361



>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCW|B Chain B, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   453 bits (1166),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 260/351 (74%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V   +A+NG PIGP+ +S
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTAVFAKNGKPIGPQANS  361



>ref|XP_003559509.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Brachypodium distachyon]
 ref|XP_010230912.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Brachypodium distachyon]
Length=510

 Score =   452 bits (1162),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 217/351 (62%), Positives = 255/351 (73%), Gaps = 3/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F   PG    N   +V  D
Sbjct  40    GGLSRASFPKGFVFGTATSAYQVEGMAASG--GRGPSIWDAFSHIPGNVVGNTNADVTTD  97

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L+KGITPY
Sbjct  98    QYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGEGKVNEEGVAYYNNLINYLLQKGITPY  157

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL H DLP ALE +YGGWL  + VE +ADYA+FCFK FG+RVK+WF+ NEPR+   LGY
Sbjct  158   INLYHADLPLALEKKYGGWLSAKTVELFADYADFCFKTFGNRVKHWFTLNEPRIACLLGY  217

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L H  A  RYR  YQA Q+G+ GI+LDF 
Sbjct  218   DVGSTPPQRCTKCAAGGNSATEPYIVAHNFLLAHGYAVARYRNKYQAAQQGKIGIVLDFN  277

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT DEVK+VKG
Sbjct  278   WYEALTNSAEDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTSDEVKIVKG  337

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+           +Y  DW V +A  RNG PIGP+ +S
Sbjct  338   SADYIGINQYTASYIKGQKLVQQAPTSYSADWQVTYASLRNGKPIGPKANS  388



>ref|XP_010237292.1| PREDICTED: beta-glucosidase 38-like [Brachypodium distachyon]
Length=494

 Score =   451 bits (1160),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 216/351 (62%), Positives = 264/351 (75%), Gaps = 5/351 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             G L+R+SFP GFVFGTASSAYQVEG  +  KYGRGP IWDTFLK PG  P+NAT  V VD
Sbjct  26    GDLNRDSFPKGFVFGTASSAYQVEG--NALKYGRGPCIWDTFLKFPGATPDNATANVTVD  83

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             +YHRY  D+D MV++ FDAYRFSISW+RIFP+G G++N  GV YY+RLINYML   ITPY
Sbjct  84    EYHRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLINYMLANKITPY  143

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L HYDLP+ L ++Y GWL  +VV D+ ++A+FCFK +GDRVKNWF+ NEPR++A+ GY
Sbjct  144   VVLYHYDLPEVLNNQYNGWLSPRVVSDFGNFADFCFKTYGDRVKNWFTINEPRMMASHGY  203

Query  840   DTGFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
               GFFAPGRC+ C   GNSATEPY+  H+L+L HA A + YR  YQA QKG+ GILLDFV
Sbjct  204   GDGFFAPGRCTGCRFGGNSATEPYITGHHLLLSHAAAVKIYRDKYQAAQKGKIGILLDFV  263

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYEP   +  D YAA RAR+F +GWFLHPI YG YP+TMQ IVGDRLP F+P++  LV+G
Sbjct  264   WYEPYNYTIEDEYAAHRAREFTLGWFLHPITYGHYPETMQKIVGDRLPSFSPEQTALVQG  323

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GIN YT++YV   Y    ++ +Y NDW    +Y RNGV IG +  S
Sbjct  324   SADYIGINHYTSYYV-KHYVNLTHM-SYANDWQAKISYDRNGVLIGKQAFS  372



>ref|XP_006664007.1| PREDICTED: beta-glucosidase 38-like [Oryza brachyantha]
Length=498

 Score =   451 bits (1160),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/365 (59%), Positives = 266/365 (73%), Gaps = 5/365 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R SFP GFVFGTASSAYQVEG  +  KYGRGP IWDTFL  PG  P+NAT  V VD+Y
Sbjct  32    LTRASFPLGFVFGTASSAYQVEG--NALKYGRGPCIWDTFLLHPGKTPDNATANVTVDEY  89

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  D+D MV++ FDAYRFSISW+RIFP+G G++N  GV YY+RLI+YML   ITPY  
Sbjct  90    HRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLIDYMLAHSITPYVA  149

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQ L D+Y GWL  +VV D+  +A+FCFK +G +VKNWF+ NEPR++A  GY  
Sbjct  150   LYHYDLPQVLHDQYNGWLHTRVVRDFVRFADFCFKTYGHKVKNWFTINEPRMMANHGYGD  209

Query  834   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             G+FAPGRC+ C   GNSATEPY+ AHNL+L HA A + YR  YQA QKG+ GILLDFVWY
Sbjct  210   GYFAPGRCTGCQFGGNSATEPYITAHNLLLSHAAAVKIYRDKYQATQKGKIGILLDFVWY  269

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT  + D  AA RAR+F +GWFLHPI YG YP+TMQNIV  RLP FT ++ +++KGS 
Sbjct  270   EPLTDREEDRAAAHRAREFTLGWFLHPITYGHYPETMQNIVMRRLPNFTREQSEMIKGSA  329

Query  477   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSKISQFFTLALF  298
             DY+GIN YTT+YV     KT    +Y NDW+V  +Y R+GVPIG + +S         ++
Sbjct  330   DYIGINHYTTYYVSHHVNKT--FMSYLNDWDVKISYERDGVPIGKQAYSNWLYVVPWGIY  387

Query  297   SNIAH  283
               + H
Sbjct  388   KAVMH  392



>ref|XP_003559508.1| PREDICTED: beta-glucosidase 7-like [Brachypodium distachyon]
Length=511

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 260/353 (74%), Gaps = 7/353 (2%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTA+SAYQVEG       GRGPS+WD F  TPG    N   +V  D
Sbjct  41    GGLSRASFPKGFVFGTATSAYQVEGM--AFSGGRGPSVWDAFAHTPGNIVGNQNADVTTD  98

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYH YK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LI+Y+L+KGITPY
Sbjct  99    QYHHYKEDVNLMKGLNFDAYRFSISWSRIFPDGEGKVNEEGVAYYNNLIDYLLQKGITPY  158

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  + VE +ADYA+FCFK FG+RVK+WF+FNEPR+V   GY
Sbjct  159   INLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGNRVKHWFTFNEPRIVVLGGY  218

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN IL H  A  RYR  Y+A Q+G+ GI+LDF 
Sbjct  219   DVGSNPPQRCTKCAAGGNSATEPYIVAHNFILAHGYAVARYRNKYKAAQQGKVGIVLDFN  278

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFTPDE KLV G
Sbjct  279   WYEALTNSTDDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTPDETKLVNG  338

Query  483   SIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+GINQYT  Y+      P+ P   +Y  DW V +A  RNG+PIGP+ +S
Sbjct  339   SADYIGINQYTANYIKGQKLVPQKP--TSYSADWQVTYASDRNGIPIGPKANS  389



>ref|NP_001066656.1| Os12g0420100 [Oryza sativa Japonica Group]
 sp|Q2QSR8.2|BGL38_ORYSJ RecName: Full=Beta-glucosidase 38; Short=Os12bglu38; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA97621.2| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29675.1| Os12g0420100 [Oryza sativa Japonica Group]
 dbj|BAG92285.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53109.1| hypothetical protein OsJ_35886 [Oryza sativa Japonica Group]
Length=492

 Score =   449 bits (1156),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 267/365 (73%), Gaps = 5/365 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+RE+FPAGFVFGTASSAYQVEG  +  +YGRGP IWDTFL  PG+ P+N+T  V VD+Y
Sbjct  26    LTRETFPAGFVFGTASSAYQVEG--NALQYGRGPCIWDTFLMQPGVTPDNSTANVTVDEY  83

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  D+D MV++ FDAYRFSISW+RIFP+G GK+N  GV YY+RLI+YML   I PY  
Sbjct  84    HRYMDDVDNMVRVGFDAYRFSISWSRIFPSGLGKINKDGVDYYHRLIDYMLANNIIPYVV  143

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQ L D+Y GWL  ++V D+  +A+FCFK +G +VKNWF+ NEPR++A  GY  
Sbjct  144   LYHYDLPQVLHDQYKGWLHPRIVRDFVRFADFCFKTYGHKVKNWFTINEPRMMANHGYGD  203

Query  834   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             GFF PGRC+ C   GNSATEPY+ AHNL+L HA A + YR  YQA QKG+ GILLDFVWY
Sbjct  204   GFFPPGRCTGCQPGGNSATEPYIAAHNLLLSHAAAVRTYRDKYQAIQKGKIGILLDFVWY  263

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT  + D+ AA RAR+F +GW+LHPI YG YP+TMQN V +RLP FT ++ +++KGS 
Sbjct  264   EPLTDKEEDHAAAHRAREFTLGWYLHPITYGHYPETMQNAVKERLPNFTREQSEMIKGSA  323

Query  477   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSKISQFFTLALF  298
             DY+ IN YTT+YV     KT    +Y NDW+V  +Y RNGVPIG + +S         ++
Sbjct  324   DYIAINHYTTYYVSHHVNKTSI--SYLNDWDVKISYERNGVPIGKQAYSNWLYVVPWGIY  381

Query  297   SNIAH  283
               + H
Sbjct  382   KAVMH  386



>gb|AAX95520.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
Length=603

 Score =   451 bits (1159),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/400 (56%), Positives = 274/400 (69%), Gaps = 41/400 (10%)
 Frame = -3

Query  1413  DVSPERVRF---NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1243
             D +  RVR    +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TP
Sbjct  29    DRAGARVRAADDDTGGLSRAAFPKGFVFGTATSAFQVEGM--AASGGRGPSIWDPFVHTP  86

Query  1242  GLEPNNATGEVAVDQYHRYK-----------------------------------RDIDL  1168
             G    N   +V  D+YHRYK                                    D+DL
Sbjct  87    GNIAGNGNADVTTDEYHRYKLISIFVFNLKQAQPYSVFILYWAKIITYIVFLLAQEDVDL  146

Query  1167  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  988
             +  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LI+Y++++G+ PY NLNHYDLP A
Sbjct  147   LKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYNNLIDYVIKQGLIPYVNLNHYDLPLA  206

Query  987   LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  808
             L+ +Y GWL  ++V  ++DYAEFCFK +GDRVKNWF+FNEPR+VAALG+DTG   P RC+
Sbjct  207   LQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNWFTFNEPRIVAALGHDTGTDPPNRCT  266

Query  807   NCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKAD  631
              C  G NSATEPY+VAHN+IL HA A  RYR  +QA QKG+ GI+LDF WYEPLT S  D
Sbjct  267   KCAAGGNSATEPYIVAHNIILSHATAVDRYRNKFQASQKGKIGIVLDFNWYEPLTNSTED  326

Query  630   NYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYT  451
               AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLVKGS DY GINQYT
Sbjct  327   QAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLVKGSADYFGINQYT  386

Query  450   TFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
               Y+ D         +Y +DW+V F + RNGVPIG + +S
Sbjct  387   ANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANS  426



>gb|ABF98426.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
Length=387

 Score =   439 bits (1128),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 207/336 (62%), Positives = 250/336 (74%), Gaps = 3/336 (1%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGTA+SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  36    GGLSRAAFPKRFVFGTATSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  93

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  94    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  153

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  154   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  213

Query  840   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  214   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  273

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  274   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  333

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGF  376
             S DY+GINQYT  Y+           +Y  DW V +
Sbjct  334   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTY  369



>emb|CDM83785.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   441 bits (1135),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 262/368 (71%), Gaps = 4/368 (1%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             + V+    P R+R+  GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F  
Sbjct  18    ACVRATKEPGRLRW-LGGLSRASFPKGFVFGTATSAYQVEGMATGG--GRGPSIWDAFAH  74

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
             TPG    N   +V  DQYHRYK D++LM  LNF+AYRFSISW+RIFP+G GKVN +GVAY
Sbjct  75    TPGKVVGNQNADVTTDQYHRYKEDVNLMKGLNFEAYRFSISWSRIFPDGEGKVNEEGVAY  134

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YN LI+Y+L+KGITPY NL HYDLP ALE +YGGWL  + VE +ADYA+FCFK FGDRV 
Sbjct  135   YNNLIDYLLQKGITPYVNLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGDRVT  194

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +WF+FNEP  VA  GYD     P RC+ C+  GNSATEPYVV HN +L H  A  RYR  
Sbjct  195   HWFTFNEPSRVAIGGYDIATTPPQRCTKCSAGGNSATEPYVVGHNFLLAHGYAVARYRNK  254

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             YQA Q+G+ GI+LD  WYE L+ S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V 
Sbjct  255   YQAAQQGKVGIVLDVSWYEALSNSTEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVK  314

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP  352
             +RLPRFTPDE K+VKGS D++G+NQYTT +V           +Y  D  V +++ RNG P
Sbjct  315   ERLPRFTPDEAKVVKGSADWIGVNQYTTEFVKGQKLVLQRPTSYSADLQVTYSFERNGKP  374

Query  351   IGPRVHSK  328
             IGPR  SK
Sbjct  375   IGPRASSK  382



>gb|EEE54664.1| hypothetical protein OsJ_01954 [Oryza sativa Japonica Group]
Length=427

 Score =   438 bits (1126),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 204/285 (72%), Positives = 235/285 (82%), Gaps = 0/285 (0%)
 Frame = -3

Query  1185  KRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNH  1006
             K D+++M  + FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITPYANL H
Sbjct  21    KEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPYANLYH  80

Query  1005  YDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFF  826
             YDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALGYD G F
Sbjct  81    YDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDDGNF  140

Query  825   APGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLT  646
             APGRC+ CT GNSATEPY+VAH+LIL HA A QRYR  YQ  QKG+ GILLDFVWYE LT
Sbjct  141   APGRCTKCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFVWYEGLT  200

Query  645   RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVG  466
              S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKGSIDYVG
Sbjct  201   NSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKGSIDYVG  260

Query  465   INQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             INQYT +YV D  P    + +Y +DW+    Y R+GVPIGPR +S
Sbjct  261   INQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANS  305



>ref|XP_010506331.1| PREDICTED: beta-glucosidase 43-like isoform X2 [Camelina sativa]
Length=300

 Score =   431 bits (1108),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/277 (74%), Positives = 229/277 (83%), Gaps = 6/277 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + V  +TG L+RESFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  26    SGDGVPMDTGDLNRESFPGGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  83

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+NW GVAYYNRLI+Y
Sbjct  84    NATAELTVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLIDY  143

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ++ KGI PYANL HYDLP ALE +Y G L +QVVED+ADYAEFCFK FGDRVKNW +FNE
Sbjct  144   LILKGIKPYANLYHYDLPLALEQKYQGLLSKQVVEDFADYAEFCFKTFGDRVKNWMTFNE  203

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL H+ A QRYR IYQ K
Sbjct  204   PRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHSAAVQRYRQIYQEK  263

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGW  589
             +KGR GILLDFVW+EPLT S+ DN AAQRARDFH+GW
Sbjct  264   KKGRIGILLDFVWFEPLTSSEVDNDAAQRARDFHVGW  300



>ref|XP_010506324.1| PREDICTED: beta-glucosidase 43-like isoform X1 [Camelina sativa]
Length=316

 Score =   431 bits (1108),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 230/279 (82%), Gaps = 6/279 (2%)
 Frame = -3

Query  1407  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1228
             S + V  +TG L+RESFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  26    SGDGVPMDTGDLNRESFPGGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  83

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             NAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+NW GVAYYNRLI+Y
Sbjct  84    NATAELTVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLIDY  143

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             ++ KGI PYANL HYDLP ALE +Y G L +QVVED+ADYAEFCFK FGDRVKNW +FNE
Sbjct  144   LILKGIKPYANLYHYDLPLALEQKYQGLLSKQVVEDFADYAEFCFKTFGDRVKNWMTFNE  203

Query  867   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  700
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL H+ A QRYR IYQ K
Sbjct  204   PRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHSAAVQRYRQIYQEK  263

Query  699   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  583
             +KGR GILLDFVW+EPLT S+ DN AAQRARDFH+GW +
Sbjct  264   KKGRIGILLDFVWFEPLTSSEVDNDAAQRARDFHVGWHI  302



>ref|XP_010257753.1| PREDICTED: beta-glucosidase 44-like isoform X4 [Nelumbo nucifera]
Length=474

 Score =   436 bits (1122),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 231/286 (81%), Gaps = 6/286 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+ 
Sbjct  49    DARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGIV  106

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
              +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  107   ASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  166

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW + 
Sbjct  167   DYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMTL  226

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  YQ
Sbjct  227   NEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKYQ  286

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVY  568
             A QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVY
Sbjct  287   AHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVY  332



>ref|XP_010257808.1| PREDICTED: beta-glucosidase 44-like isoform X5 [Nelumbo nucifera]
Length=469

 Score =   436 bits (1121),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 231/286 (81%), Gaps = 6/286 (2%)
 Frame = -3

Query  1413  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1234
             D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+ 
Sbjct  49    DARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGIV  106

Query  1233  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1054
              +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  107   ASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  166

Query  1053  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  874
             +YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW + 
Sbjct  167   DYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMTL  226

Query  873   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  706
             NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  YQ
Sbjct  227   NEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKYQ  286

Query  705   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVY  568
             A QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVY
Sbjct  287   AHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVY  332



>ref|XP_004963948.1| PREDICTED: beta-glucosidase 38-like [Setaria italica]
Length=499

 Score =   427 bits (1097),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 266/352 (76%), Gaps = 7/352 (2%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             G L+R++FP GFVFGTASSAYQVEG T   KYGRGP IWDTFLK PG  P+N+T  V VD
Sbjct  32    GNLTRQAFPPGFVFGTASSAYQVEGNT--LKYGRGPCIWDTFLKYPGTTPDNSTANVTVD  89

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             +Y+RY  D+D MV++ FDAYRFSISW+RIFP+G G++N  GV YY+RLINY++E  ITPY
Sbjct  90    EYNRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLINYLIESHITPY  149

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L HYDLPQ L+D+Y GWL  ++VED+  +A+FCFK +GDRVKNWF+ NEPR++AA GY
Sbjct  150   VVLYHYDLPQVLQDQYNGWLSPRIVEDFTKFADFCFKTYGDRVKNWFTINEPRMMAAHGY  209

Query  840   DTGFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
               GFF P RC+ C   GNSATEPY+ AH+L+L HA A + YR  YQA+Q G+ GILLDFV
Sbjct  210   GDGFFPPARCTGCHFGGNSATEPYIAAHHLLLAHASAVKLYREKYQAQQTGKIGILLDFV  269

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYEPLT S  D +AA RAR F +GWFLHPI +G YP+TM+ IV  RLP FT ++  +VKG
Sbjct  270   WYEPLTPSMDDEFAAHRARMFTLGWFLHPITFGHYPETMEKIVMGRLPNFTFEQSAMVKG  329

Query  483   SIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRVHS  331
             S DY+ IN YTT+Y  +   +T   HT Y NDW+V  +Y RNGVPIG + +S
Sbjct  330   SADYIAINHYTTYYASNFANET---HTSYVNDWHVKLSYERNGVPIGKKGYS  378



>gb|AFW69221.1| hypothetical protein ZEAMMB73_365784 [Zea mays]
Length=502

 Score =   427 bits (1097),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 261/349 (75%), Gaps = 5/349 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R+SFP GFVFGTASSAYQVEG T  H+YGRGP IWDTFLK PG  P+NAT +V VD+Y
Sbjct  36    LNRQSFPPGFVFGTASSAYQVEGNT--HRYGRGPCIWDTFLKYPGTTPDNATADVTVDEY  93

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             +RY  D+D MV++ FDAYRFSISW+RIFP+G G+VN  GV YY+RLINY+L   ITPY  
Sbjct  94    NRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLINYLLANHITPYVV  153

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQ L+D+Y GWL  +++ D+  +A+FCFK +GDRVKNWF+ NEPR++A  GY  
Sbjct  154   LYHYDLPQVLQDQYNGWLSPRILGDFTAFADFCFKTYGDRVKNWFTINEPRMMAQHGYGD  213

Query  834   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             GFF P RC+ C   GNSATEPY+  H+L+L HA A + YR+ Y+ +Q G+ GILLDFVWY
Sbjct  214   GFFPPARCTGCQFGGNSATEPYIAGHHLLLAHAAAVKLYRSKYKVRQAGKIGILLDFVWY  273

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT+S  D YAA RAR F +GWFLHPI YG YP+TMQ IV  RLP FT ++  +VKGS 
Sbjct  274   EPLTKSVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNFTFEQSAMVKGSA  333

Query  477   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             DYV IN YTT+Y  +    T     Y+NDWN   +Y R+GVPIG R +S
Sbjct  334   DYVAINHYTTYYASNFVNATE--TNYRNDWNAKISYERDGVPIGKRAYS  380



>ref|XP_008644990.1| PREDICTED: beta-glucosidase 38-like [Zea mays]
Length=552

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 261/349 (75%), Gaps = 5/349 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R+SFP GFVFGTASSAYQVEG T  H+YGRGP IWDTFLK PG  P+NAT +V VD+Y
Sbjct  86    LNRQSFPPGFVFGTASSAYQVEGNT--HRYGRGPCIWDTFLKYPGTTPDNATADVTVDEY  143

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             +RY  D+D MV++ FDAYRFSISW+RIFP+G G+VN  GV YY+RLINY+L   ITPY  
Sbjct  144   NRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLINYLLANHITPYVV  203

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQ L+D+Y GWL  +++ D+  +A+FCFK +GDRVKNWF+ NEPR++A  GY  
Sbjct  204   LYHYDLPQVLQDQYNGWLSPRILGDFTAFADFCFKTYGDRVKNWFTINEPRMMAQHGYGD  263

Query  834   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             GFF P RC+ C   GNSATEPY+  H+L+L HA A + YR+ Y+ +Q G+ GILLDFVWY
Sbjct  264   GFFPPARCTGCQFGGNSATEPYIAGHHLLLAHAAAVKLYRSKYKVRQAGKIGILLDFVWY  323

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT+S  D YAA RAR F +GWFLHPI YG YP+TMQ IV  RLP FT ++  +VKGS 
Sbjct  324   EPLTKSVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNFTFEQSAMVKGSA  383

Query  477   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             DYV IN YTT+Y  +    T     Y+NDWN   +Y R+GVPIG R +S
Sbjct  384   DYVAINHYTTYYASNFVNATE--TNYRNDWNAKISYERDGVPIGKRAYS  430



>gb|EMS48652.1| Beta-glucosidase 7 [Triticum urartu]
Length=498

 Score =   419 bits (1077),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 203/331 (61%), Positives = 243/331 (73%), Gaps = 4/331 (1%)
 Frame = -3

Query  1428  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1249
             + V+   +P R R+  GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F  
Sbjct  28    ACVRATKAPGRPRW-LGGLSRASFPKGFVFGTATSAYQVEGMATGG--GRGPSIWDAFAH  84

Query  1248  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1069
             TPG    N   +V  DQYHRYK D++LM  LNFDAYRFSISW+RIFP+  GKVN +GVAY
Sbjct  85    TPGKVVGNQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDSEGKVNEEGVAY  144

Query  1068  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  889
             YN LI+Y+L KGITPY NL HYDLP ALE +YGGWL  + VE +ADYA+FCFK FGDRV 
Sbjct  145   YNNLIDYLLHKGITPYVNLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGDRVT  204

Query  888   NWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAI  712
             +WF+FNEP  VA  GYD     P RC+ C+  GNSATEPY+V HN +L H  A  RYR  
Sbjct  205   HWFTFNEPSRVAIGGYDIATTPPQRCTKCSAGGNSATEPYIVGHNFLLAHGYAVARYRNN  264

Query  711   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  532
             YQA Q+G+ GI+LD  WYE L+ S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V 
Sbjct  265   YQAAQQGKVGIVLDVSWYEALSNSTEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVK  324

Query  531   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYV  439
             +RLPRFTPDE K+VKGS D++G+NQYTT +V
Sbjct  325   ERLPRFTPDEAKVVKGSADWIGVNQYTTEFV  355



>gb|ADP02193.1| Glyco_hydro_1 domain-containing protein [Triticum aestivum]
Length=587

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 223/386 (58%), Positives = 274/386 (71%), Gaps = 37/386 (10%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             +TGGLSR SFP GFVFGTA+SA+QVEGA       RGPSIWD F+ TPG    NA  +VA
Sbjct  25    DTGGLSRASFPKGFVFGTATSAFQVEGAAAAGG--RGPSIWDPFVHTPGNIAENANADVA  82

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
              D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI+Y+L++G+T
Sbjct  83    TDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNKEGVTYYNNLIDYVLKQGLT  142

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVV-----------------EDYADYAEFCFKIFGD  898
             PY NLNHYD+P AL+ +Y G+L  ++                    +ADYAEFCFK +GD
Sbjct  143   PYVNLNHYDIPLALQKKYDGFLSPKIAFYKGQGALKHFSVFFCRNIFADYAEFCFKTYGD  202

Query  897   RVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRY  721
             R+KNWF+FNEPR+VAALG+DTG   P RC+ C  G NSATEPY V HN++L HA A  RY
Sbjct  203   RIKNWFTFNEPRIVAALGFDTGTNPPNRCTKCAAGGNSATEPYTVVHNILLSHATAVARY  262

Query  720   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  541
             R  YQA QKG+ GI+LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+
Sbjct  263   RNKYQASQKGKVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQYPKTMQD  322

Query  540   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF----  376
             IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D P P+ P   +Y +DW+V +    
Sbjct  323   IVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPT-SYSSDWHVQYIFTQ  381

Query  375   -----------AYARNGVPIGPRVHS  331
                        A  RNGVPIG + +S
Sbjct  382   DTSLLTLSFKRAVQRNGVPIGQKANS  407



>gb|EMS63424.1| Beta-glucosidase 38 [Triticum urartu]
Length=490

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/365 (57%), Positives = 260/365 (71%), Gaps = 5/365 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR+SFP GFVFGTASSAYQVEG +   KYGRGP IWDTFLK PG  P+NAT  V VD+Y
Sbjct  23    LSRDSFPKGFVFGTASSAYQVEGNS--LKYGRGPCIWDTFLKYPGATPDNATANVTVDEY  80

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  D+D MV++ FDAYRFSISW+RIFPNG G++N  GV YY+RLI+YML   ITPY  
Sbjct  81    HRYMDDVDNMVRVGFDAYRFSISWSRIFPNGIGRINKDGVDYYHRLIDYMLANNITPYVV  140

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLP+ L ++Y GWL  +VV D+  +A+FCFK +GDRVKNWF+ NEPR++A  GY  
Sbjct  141   LYHYDLPEVLNNQYNGWLSPRVVPDFTAFADFCFKTYGDRVKNWFTINEPRMMAWHGYGD  200

Query  834   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
             GFFAPGRC+ C   GNSATEPY+  H+L+L HA A + YR  YQ +Q G  GILLDFVWY
Sbjct  201   GFFAPGRCTGCRFGGNSATEPYIAGHHLLLAHAAAVKVYRDKYQRRQNGTIGILLDFVWY  260

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT ++ D YAA RAR+F +GW++HPI +G YP+TMQ +VG RLP FT ++ KL++GS 
Sbjct  261   EPLTYTEEDEYAAHRAREFTLGWYMHPITFGHYPETMQKLVGTRLPNFTAEQSKLLQGSA  320

Query  477   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHSKISQFFTLALF  298
             D +GIN YTT+YV   + +     +   DW     + RNGVP+  +  SK         +
Sbjct  321   DIIGINHYTTYYV--RHQENLTRMSSATDWQAELLFERNGVPLRRQAFSKWLYVVPWGFY  378

Query  297   SNIAH  283
               + H
Sbjct  379   KAVMH  383



>ref|XP_002438912.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
 gb|EER90279.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
Length=480

 Score =   414 bits (1064),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 239/312 (77%), Gaps = 3/312 (1%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSRE+FP GFVFGTASSAYQVEG T   K+GRGPSIWDTFLK PG  P+NAT +V+VD+Y
Sbjct  42    LSRETFPPGFVFGTASSAYQVEGNT--RKFGRGPSIWDTFLKYPGTTPDNATADVSVDEY  99

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
              RY  D+D MV++ FDAYRFSISW+RIFP+G G+VN  GV YY+RLI+YML   ITPY  
Sbjct  100   DRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLIDYMLANHITPYVV  159

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L HYDLPQ L+D+Y GWL  ++V D+  +A+FCFK +GDRVK WF+ NEP++VA+ GY  
Sbjct  160   LYHYDLPQVLQDQYNGWLSPRIVPDFTAFADFCFKTYGDRVKFWFTINEPQMVASHGYGD  219

Query  834   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  658
              FF PGRC+ C   GNSATEPY+  H+L+L HA A + YR  Y+  Q G+ GILLDFVWY
Sbjct  220   AFFPPGRCTGCYFGGNSATEPYIAGHHLLLSHAAAVKLYREKYKVHQGGKIGILLDFVWY  279

Query  657   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  478
             EPLT+S  D +AA RAR F +GWFLHPI YG YP+TM+ IV  RLP FT ++  +VKGS 
Sbjct  280   EPLTKSIEDEFAAHRARMFTLGWFLHPITYGHYPETMEKIVMGRLPNFTFEQSAMVKGSA  339

Query  477   DYVGINQYTTFY  442
             DY+ IN YTT+Y
Sbjct  340   DYIAINHYTTYY  351



>ref|NP_001064347.1| Os10g0323500 [Oryza sativa Japonica Group]
 sp|Q339X2.1|BGL34_ORYSJ RecName: Full=Beta-glucosidase 34; Short=Os10bglu34; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABB47155.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26261.1| Os10g0323500 [Oryza sativa Japonica Group]
 dbj|BAG92457.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50740.1| hypothetical protein OsJ_31060 [Oryza sativa Japonica Group]
Length=510

 Score =   411 bits (1057),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 250/360 (69%), Gaps = 13/360 (4%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TGGL+R+SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAV
Sbjct  30    TGGLTRKSFPNGFVFGTASSAYQYEGA--VKEDGRGPTIWDKFAHTFGKIIDFSNADVAV  87

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYHR++ DI LM  +  DAYRFSISW+RIFPNGTG+VN  G+ +YN+LIN +L KGI P
Sbjct  88    DQYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  147

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             Y  L H+DLPQALED+Y GWL RQ++ DYA YAE CF+ FGDRVK+W +FNEP  VA   
Sbjct  148   YVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQA  207

Query  843   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
             YD+G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI
Sbjct  208   YDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGELGI  267

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
               D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E 
Sbjct  268   SFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTEKEA  327

Query  498   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRVHS  331
              LV GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG R +S
Sbjct  328   ALVNGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDRANS  385



>gb|ABK95221.1| unknown [Populus trichocarpa]
Length=315

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/292 (68%), Positives = 221/292 (76%), Gaps = 16/292 (5%)
 Frame = -3

Query  1428  SIVQC----------DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGR  1279
             SIVQC             PE V F T G  R SFP GFVFGTA+SAYQVEG  +  K GR
Sbjct  14    SIVQCISHAAESNGASEKPETVSFETAGGLRHSFPKGFVFGTATSAYQVEGMAE--KDGR  71

Query  1278  GPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGT  1099
             GPSIWD F+K PG+  NNATGEVAVDQYH YK D+D+M  LNFDAYRFSISW+RIFP+GT
Sbjct  72    GPSIWDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGT  131

Query  1098  GKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEF  919
             GKVNW GVAYYNRLI+YM+EKGITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+F
Sbjct  132   GKVNWLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADF  191

Query  918   CFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLI  751
             CFK FGDRVKNW +FNEPRVVAALGYD G FAPGRCS    NCT G+SATEPY+VAH+LI
Sbjct  192   CFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLI  251

Query  750   LCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHI  595
             L HA A QRYR  YQ KQKGR GILLDFV+YEPL   K   +  +    F +
Sbjct  252   LSHAAAVQRYREKYQEKQKGRIGILLDFVYYEPLPAQKLTTWQLKEQETFTL  303



>gb|AAK92581.1|AC074354_15 Putative beta-glucosidase [Oryza sativa Japonica Group]
Length=515

 Score =   411 bits (1056),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 250/360 (69%), Gaps = 13/360 (4%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TGGL+R+SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAV
Sbjct  30    TGGLTRKSFPNGFVFGTASSAYQYEGA--VKEDGRGPTIWDKFAHTFGKIIDFSNADVAV  87

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYHR++ DI LM  +  DAYRFSISW+RIFPNGTG+VN  G+ +YN+LIN +L KGI P
Sbjct  88    DQYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  147

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             Y  L H+DLPQALED+Y GWL RQ++ DYA YAE CF+ FGDRVK+W +FNEP  VA   
Sbjct  148   YVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQA  207

Query  843   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
             YD+G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI
Sbjct  208   YDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGELGI  267

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
               D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E 
Sbjct  268   SFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTEKEA  327

Query  498   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRVHS  331
              LV GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG R +S
Sbjct  328   ALVNGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDRANS  385



>gb|EEC66726.1| hypothetical protein OsI_33062 [Oryza sativa Indica Group]
Length=510

 Score =   410 bits (1054),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/360 (56%), Positives = 250/360 (69%), Gaps = 13/360 (4%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             TGGL+R+SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAV
Sbjct  30    TGGLTRKSFPNGFVFGTASSAYQYEGA--VKEDGRGPTIWDKFAHTFGKIIDFSNADVAV  87

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYHR++ DI LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L KGI P
Sbjct  88    DQYHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  147

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             Y  L H+DLPQALED+Y GWL RQ++ DYA YAE CF+ FGDRVK+W +FNEP  VA   
Sbjct  148   YVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQA  207

Query  843   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
             YD+G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI
Sbjct  208   YDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGELGI  267

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
               D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E 
Sbjct  268   SFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTEKEA  327

Query  498   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRVHS  331
              LV GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG R +S
Sbjct  328   ALVNGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDRANS  385



>ref|XP_006661692.1| PREDICTED: beta-glucosidase 34-like [Oryza brachyantha]
Length=509

 Score =   405 bits (1040),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 247/358 (69%), Gaps = 13/358 (4%)
 Frame = -3

Query  1377  GLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQ  1198
             GL+R SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAVDQ
Sbjct  31    GLTRGSFPKGFVFGTASSAYQYEGA--VKEDGRGPAIWDKFAHTFGKIIDFSNADVAVDQ  88

Query  1197  YHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYA  1018
             YHR++ DI LM  +  DAYRFSI+W+RIFPNGTG++N  G+ +YN+LIN +L KGI PY 
Sbjct  89    YHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGQINQAGIDHYNKLINALLAKGIEPYV  148

Query  1017  NLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYD  838
              L H+DLPQALED+Y GWL RQ++ DYA YAE CFK FGDRVK+W +FNEP  VA   YD
Sbjct  149   TLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFKAFGDRVKHWITFNEPHTVAVQAYD  208

Query  837   TGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
             +G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI  
Sbjct  209   SGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGSLGISF  268

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E  L
Sbjct  269   DVIWYEPMSNSTADVEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTTTEAAL  328

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRVHS  331
             V GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG + +S
Sbjct  329   VTGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDKANS  384



>gb|EMT31426.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=509

 Score =   403 bits (1036),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/322 (60%), Positives = 229/322 (71%), Gaps = 5/322 (2%)
 Frame = -3

Query  1281  RGPSIWDTFLKTPGLEPNNATG----EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRI  1114
             +G   W      P   P N  G    +V  DQYHRYK D++LM  LNFDAYRFSISW+RI
Sbjct  66    KGKEPWQLTTTAPPDFPRNIAGNQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRI  125

Query  1113  FPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYA  934
             FP+G GKVN +GVAYYN LINY+L+KGITPY NL HYDLP ALE +YGGWL  + V  +A
Sbjct  126   FPDGDGKVNQEGVAYYNNLINYLLQKGITPYINLYHYDLPLALEKKYGGWLNAKTVGLFA  185

Query  933   DYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHN  757
             DYA+FCFK FGDRVK+WF+FNEPR+VA LGYD G   P RCS C   GNSATEPY+VAHN
Sbjct  186   DYADFCFKTFGDRVKHWFTFNEPRIVALLGYDVGSNPPQRCSKCAAGGNSATEPYIVAHN  245

Query  756   LILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHP  577
              +L H  A  RYR  YQA QKG+ GI+LDF WYE LT S  D  AAQRARDFH+GWF+ P
Sbjct  246   FLLAHGYAVARYRNKYQAAQKGKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDP  305

Query  576   IVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQ  397
             ++ G YP+ MQ++V +RLPRFTP E KLVKGS DY+GINQYT   +           +Y 
Sbjct  306   LINGHYPQIMQDLVKERLPRFTPSEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYS  365

Query  396   NDWNVGFAYARNGVPIGPRVHS  331
              DW V +A+ RNG PIGP+ +S
Sbjct  366   ADWQVTYAFERNGKPIGPKANS  387



>gb|EMS62097.1| Beta-glucosidase 7 [Triticum urartu]
Length=531

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 224/300 (75%), Gaps = 1/300 (0%)
 Frame = -3

Query  1227  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1048
             N   +V  DQYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY
Sbjct  110   NQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNQEGVAYYNNLINY  169

Query  1047  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  868
             +L+KGITPY NL HYDLP ALE +YGGWL  + V  +ADYA+FCFK FGDRVK+WF+FNE
Sbjct  170   LLQKGITPYINLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNE  229

Query  867   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  691
             PR+VA LGYD G   P RCS C   GNSATEPY+VAHN +L H  A  RYR  YQA QKG
Sbjct  230   PRIVALLGYDVGSNPPQRCSKCAAGGNSATEPYIVAHNFLLAHGYAVARYRTKYQAAQKG  289

Query  690   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  511
             + GI+LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT
Sbjct  290   KVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFT  349

Query  510   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRVHS  331
             PDE KLVKGS DY+GINQYT   +           +Y  DW V +A+ RNG PIGP+ +S
Sbjct  350   PDEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANS  409



>ref|XP_002465651.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
 gb|EER92649.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
Length=508

 Score =   402 bits (1032),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 244/360 (68%), Gaps = 14/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVD
Sbjct  28    GGLTRGSFPKGFVFGTAAAAYQYEGA--VTTDGRGRTIWDTFAHTFGKISDFSNADVAVD  85

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ D+ LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN +L KGI PY
Sbjct  86    QYHRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPY  145

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GY
Sbjct  146   VTLYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAIQGY  205

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G  GI 
Sbjct  206   DAGLHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSDIYRRKYKAAQNGELGIA  265

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  VG+RLP+FT DE  
Sbjct  266   FDVIWYEPMTNSTIDIEATKRAQEFQLGWFAEPFFFGDYPATMRTRVGERLPKFTADEAT  325

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             LVKG++D++GIN YTTFY    + +T  I    ND       +   + +NG PIG R +S
Sbjct  326   LVKGALDFMGINHYTTFYT--RHNETNIIGRLLNDTLADTGTISLPFDKNGKPIGDRANS  383



>ref|XP_002979705.1| hypothetical protein SELMODRAFT_153534 [Selaginella moellendorffii]
 gb|EFJ19107.1| hypothetical protein SELMODRAFT_153534 [Selaginella moellendorffii]
Length=501

 Score =   400 bits (1028),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 246/356 (69%), Gaps = 11/356 (3%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             LSR SFP GFVFGTAS+AYQ EGA    + GRGPSIWD +  TPG   +  TG+VAVDQY
Sbjct  26    LSRRSFPKGFVFGTASAAYQYEGAA--KEGGRGPSIWDVYAHTPGKIMDGTTGDVAVDQY  83

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRYK D+ LMV +  DAYRFSISW+RIFP G GK+N +GV YYN LIN +L+KGI PY  
Sbjct  84    HRYKEDVGLMVDMGVDAYRFSISWSRIFPEGRGKINQEGVDYYNNLINELLKKGIQPYVT  143

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+D PQALED Y  WL  ++V+DYA YAE CF+ FGDRVK+W +FNEP VV   GY+ 
Sbjct  144   LFHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPHVVCNFGYNF  203

Query  834   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  667
             G  APGRCS    NC+ GNS+ EPY+V H+++L HA A + YR  YQ KQ G  GI LD 
Sbjct  204   GMLAPGRCSSEVGNCSAGNSSVEPYIVGHHILLSHASAVKIYREKYQEKQAGIIGITLDA  263

Query  666   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  487
              W+EP +RS  D  AA+RA DF++GW L PIV+G+YP TM++ V DRLP+FT ++ K +K
Sbjct  264   QWHEPFSRSSKDKAAARRALDFNLGWMLDPIVFGDYPATMRSRVRDRLPKFTKEQSKRLK  323

Query  486   GSIDYVGINQYTTFYVYDP----YPKTPYI-HTYQNDWNVGFAYARNGVPIGPRVH  334
             GS D++GIN YT+FY  D     +P+  +    Y  D  V     RNG  IG  V+
Sbjct  324   GSHDFIGINHYTSFYDADASNSNHPQAAFSQQAYFKDTGVFSTDTRNGRLIGQNVN  379



>ref|XP_004985214.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   400 bits (1027),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 237/324 (73%), Gaps = 7/324 (2%)
 Frame = -3

Query  1389  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             +  G L+R SFP GFVFGTA+SAYQ EGA  V + GRG +IWDTF  T G   + +  +V
Sbjct  27    YGGGELTRGSFPEGFVFGTAASAYQYEGA--VKEDGRGQTIWDTFAHTLGKISDFSNADV  84

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYHR++ DI+LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LI+ +L K I
Sbjct  85    AVDQYHRFEDDIELMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKLIDALLSKEI  144

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PY  L H+DLPQALEDRY GWL R +VED+A YAE CFK FGDRVK+W + NEP  VA 
Sbjct  145   EPYVTLYHWDLPQALEDRYKGWLNRTIVEDFAVYAETCFKAFGDRVKHWITLNEPHTVAT  204

Query  849   LGYDTGFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
             +GYDTG  APGRCS     +C  G+S TEPY+V HN IL HA  A  YR  Y+A Q+G+ 
Sbjct  205   MGYDTGLEAPGRCSVLLHLHCRSGDSHTEPYIVGHNFILAHATVADIYRRKYKATQRGQL  264

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GI L+ VWYEP+T ++ D  AA+RA++F +GWF  P  +G+YP++M+  +GDRLP+FT D
Sbjct  265   GIALNVVWYEPMTNTRTDIEAAKRAQEFQLGWFADPFFFGDYPESMRARIGDRLPKFTAD  324

Query  504   EVKLVKGSIDYVGINQYTTFYVYD  433
             E  LVKGS+D+VGIN YTT Y  D
Sbjct  325   EAALVKGSLDFVGINHYTTHYTMD  348



>ref|XP_002988358.1| hypothetical protein SELMODRAFT_183841 [Selaginella moellendorffii]
 gb|EFJ10448.1| hypothetical protein SELMODRAFT_183841 [Selaginella moellendorffii]
Length=496

 Score =   398 bits (1023),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 251/373 (67%), Gaps = 17/373 (5%)
 Frame = -3

Query  1425  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1246
             +V C V    +      LSR SFP GFVFGTAS+AYQ EGA    + GRGPSIWD +  T
Sbjct  10    LVVCAVEGHEI------LSRRSFPKGFVFGTASAAYQYEGAA--REGGRGPSIWDVYAHT  61

Query  1245  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1066
             PG   +  TG+VAVDQYHRYK D+ LMV +  DAYRFSISW+RIFP G GK+N +GV YY
Sbjct  62    PGKIMDGTTGDVAVDQYHRYKEDVGLMVDMGVDAYRFSISWSRIFPEGRGKINQEGVDYY  121

Query  1065  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  886
             N LIN +L+KGI PY  L H+D PQALED Y  WL  ++V+DYA YAE CF+ FGDRVK+
Sbjct  122   NNLINELLKKGIQPYVTLFHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKH  181

Query  885   WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  718
             W +FNEP VV   GY+ G  APGRCS    NC+ GNS+ EPY+V H+++L HA A + YR
Sbjct  182   WITFNEPHVVCNFGYNFGMLAPGRCSSEVGNCSAGNSSVEPYIVGHHILLSHASAVKIYR  241

Query  717   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  538
               YQ KQ G  GI LD  W+EP +RS  D  AA+RA DF++GW L PI++G+YP TM++ 
Sbjct  242   EKYQEKQAGIIGITLDAQWHEPFSRSSKDKAAARRALDFNLGWMLDPIMFGDYPATMRSR  301

Query  537   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP----YPKTPYI-HTYQNDWNVGFA  373
             V DRLP+FT ++ K +KGS D++GIN YT+FY  D     +P+  +    Y  D  V   
Sbjct  302   VRDRLPKFTKEQSKRLKGSHDFIGINHYTSFYDADASNSNHPQAAFSQQAYFKDTGVFST  361

Query  372   YARNGVPIGPRVH  334
               RNG  IG  V+
Sbjct  362   DMRNGRLIGQNVN  374



>ref|XP_010521462.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   398 bits (1023),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 239/333 (72%), Gaps = 9/333 (3%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             ++R SFP GFVFGTAS+A+Q EGA  V + GRGPS+WDTF  T G   + +  +VAVDQY
Sbjct  28    INRASFPNGFVFGTASAAFQYEGA--VKEDGRGPSVWDTFSHTLGKIADFSNADVAVDQY  85

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY+ DI LM  +  DAYRFSISWTRIFPNGTG++N  G+ +YN+LIN +L +GI PY  
Sbjct  86    HRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGIQPYVT  145

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQAL DRY GWL  Q++ DYA YAE CF+ FGDRVK+W +FNEP   A  GYD 
Sbjct  146   LYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAIQGYDV  205

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+AKQ G  GI  D
Sbjct  206   GLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWLGIAFD  265

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP T ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG RLPRFT  E  +V
Sbjct  266   VIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTASEAAMV  325

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND  391
             KGS+D+VGIN YTT+Y  +   KT  I T  ND
Sbjct  326   KGSLDFVGINHYTTYYARN--NKTNLIGTLLND  356



>ref|XP_004985213.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=520

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/358 (54%), Positives = 242/358 (68%), Gaps = 14/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQY
Sbjct  42    LTRGSFPKGFVFGTAAAAYQYEGAVKVD--GRGQTIWDTFAHTFGKISDFSNADVAVDQY  99

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HR++ D+ LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN++IN +L KGI PY  
Sbjct  100   HRFQEDVQLMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKVINALLSKGIQPYVT  159

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GYD 
Sbjct  160   LYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITINEPHTVAVQGYDA  219

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G+ GI  D
Sbjct  220   GLHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSDIYRRKYKATQNGQLGIAFD  279

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  V +RLP+FT +E  LV
Sbjct  280   VIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRTRVAERLPKFTAEEAALV  339

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             KG++D+VGIN YTTFY    +  T  I    ND       +   + +NG PIG R +S
Sbjct  340   KGALDFVGINHYTTFYT--RHNDTNIIGVLLNDTLADTGTISLPFDKNGKPIGDRANS  395



>ref|XP_008644530.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=523

 Score =   397 bits (1020),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/358 (54%), Positives = 241/358 (67%), Gaps = 14/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQY
Sbjct  45    LTRGSFPKGFVFGTAAAAYQYEGA--VKTDGRGQTIWDTFAHTFGKISDFSNADVAVDQY  102

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HR++ D+ LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN +L KGI PY  
Sbjct  103   HRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVT  162

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GYD 
Sbjct  163   LYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDA  222

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G  GI  D
Sbjct  223   GLHAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILAHATVSDMYRRKYKAAQNGELGIAFD  282

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  VG+RLP+FT DE  LV
Sbjct  283   VIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKFTADEAALV  342

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             KG++D++GIN YTTFY    +  T  I    ND       +   + +NG PIG R +S
Sbjct  343   KGALDFMGINHYTTFYT--RHNDTNIIGRLLNDTLADTGTISLPFDKNGKPIGDRANS  398



>ref|XP_006484173.1| PREDICTED: beta-glucosidase 40-like [Citrus sinensis]
Length=506

 Score =   396 bits (1018),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 245/358 (68%), Gaps = 15/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             ++R SFP GFVFGTASSA+Q EGA  V + GRGP++WDTF  T G   +N+  +VAVDQY
Sbjct  28    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPTVWDTFSHTFGKILDNSNADVAVDQY  85

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  D+ LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN+LI+ +L KGI PY  
Sbjct  86    HRYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVT  145

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQAL+D+Y GWL RQ++ D+A YAE CF+ FGDRVK+W +FNEP      GYD 
Sbjct  146   LYHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDV  205

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNSATEPY+VAHN +L HA  A  YR  Y+AKQ G  GI  D
Sbjct  206   GLQAPGRCSILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGGSLGIAFD  265

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYE  + S  D  A QRA+DF +GWFL P+++G+YP +M+N VG RLPRFT  E  L+
Sbjct  266   VIWYESASNSTEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFTSSEAALL  325

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIGPRVHS  331
             KGS+D+VGIN YTTFY       T  I    ND ++  A A     +NG PI  R +S
Sbjct  326   KGSLDFVGINHYTTFYA--QRNATNLIGVVLND-SLADAGALTIPFKNGKPIADRANS  380



>ref|XP_006437961.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
 gb|ESR51201.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
Length=506

 Score =   396 bits (1017),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 245/358 (68%), Gaps = 15/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             ++R SFP GFVFGTASSA+Q EGA  V + GRGP++WDTF  T G   +N+  +VAVDQY
Sbjct  28    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPTVWDTFSHTFGKILDNSNADVAVDQY  85

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  D+ LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN+LI+ +L KGI PY  
Sbjct  86    HRYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVT  145

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQAL+D+Y GWL RQ++ D+A YAE CF+ FGDRVK+W +FNEP      GYD 
Sbjct  146   LYHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDV  205

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNSATEPY+VAHN +L HA  A  YR  Y+AKQ G  GI  D
Sbjct  206   GLQAPGRCSILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGGSLGIAFD  265

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYE  + S  D  A QRA+DF +GWFL P+++G+YP +M+N VG RLPRFT  E  L+
Sbjct  266   VIWYESASNSTEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFTSSEAALL  325

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIGPRVHS  331
             KGS+D+VGIN YTTFY       T  I    ND ++  A A     +NG PI  R +S
Sbjct  326   KGSLDFVGINHYTTFYA--QRNATNLIGVVLND-SLADAGALTIPFKNGKPIADRANS  380



>tpg|DAA44055.1| TPA: hypothetical protein ZEAMMB73_095768 [Zea mays]
Length=404

 Score =   392 bits (1007),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 225/317 (71%), Gaps = 7/317 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQY
Sbjct  45    LTRGSFPKGFVFGTAAAAYQYEGA--VKTDGRGQTIWDTFAHTFGKISDFSNADVAVDQY  102

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HR++ D+ LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN +L KGI PY  
Sbjct  103   HRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVT  162

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GYD 
Sbjct  163   LYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDA  222

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G  GI  D
Sbjct  223   GLHAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILAHATVSDMYRRKYKAAQNGELGIAFD  282

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  VG+RLP+FT DE  LV
Sbjct  283   VIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKFTADEAALV  342

Query  489   KGSIDYVGINQYTTFYV  439
             KG++D++GIN YTTFY 
Sbjct  343   KGALDFMGINHYTTFYT  359



>ref|XP_011012221.1| PREDICTED: beta-glucosidase 40 [Populus euphratica]
Length=508

 Score =   395 bits (1016),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 234/324 (72%), Gaps = 7/324 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
              ++ +   ++R SFP GFVFGTASSA+Q EGA  V   GRGPS+WD F  T G   + + 
Sbjct  19    EIQTSLSQINRASFPEGFVFGTASSAFQYEGA--VKADGRGPSVWDAFSHTFGKIIDFSN  76

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +VAVDQYH +  DI LM  +  DAYRFSISW+RI+PNGTGK+N  GV +YN+ IN +L 
Sbjct  77    ADVAVDQYHLFDEDIKLMKDMGMDAYRFSISWSRIYPNGTGKINQAGVDHYNKFINALLA  136

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             +GI PY  L H+DLPQAL+DRY GWL  Q+++D+A +AE CF+I+GDRVK+W +FNEP  
Sbjct  137   QGIEPYVTLYHWDLPQALQDRYNGWLSPQIIKDFATFAETCFEIYGDRVKHWITFNEPHT  196

Query  858   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
             VA  GYD G  APGRCS      C  GNSATEPY+VAHN++L H  AA  YR  Y+AKQ+
Sbjct  197   VAIQGYDVGLQAPGRCSIFLHIFCRAGNSATEPYIVAHNILLSHGTAADIYRKKYKAKQR  256

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             G  GI LD +W+EP T +  D  AAQRA+DF +GWF+ P++ G YP TM+N VGDRLP F
Sbjct  257   GSLGISLDVIWFEPATNTTNDTEAAQRAQDFQLGWFIEPLILGNYPITMRNRVGDRLPNF  316

Query  513   TPDEVKLVKGSIDYVGINQYTTFY  442
             T ++V LVKGS D+VGIN YTTFY
Sbjct  317   TENDVALVKGSFDFVGINHYTTFY  340



>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
 pdb|3GNP|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-Glucosidase 
With Octyl-Beta- D-Thio-Glucoside
 pdb|3GNR|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase 
With Covalently Bound 2-deoxy-2-fluoroglucoside To The Catalytic 
Nucleophile E396
Length=488

 Score =   394 bits (1013),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 249/360 (69%), Gaps = 15/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  10    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  67

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  68    QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  127

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  128   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  187

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  188   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  247

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  248   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  307

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG R +S
Sbjct  308   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  364



>ref|XP_007045908.1| Beta glucosidase 40 isoform 2 [Theobroma cacao]
 gb|EOY01740.1| Beta glucosidase 40 isoform 2 [Theobroma cacao]
Length=413

 Score =   392 bits (1006),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/317 (58%), Positives = 230/317 (73%), Gaps = 7/317 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             +SR SFP GFVFGTASS++Q EGA  V + GRGP+IWD F  T G   + +  +VAVDQY
Sbjct  29    ISRASFPKGFVFGTASSSFQYEGA--VKEDGRGPTIWDKFSHTFGKIIDGSNADVAVDQY  86

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  DI LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN LIN +L KGI PY  
Sbjct  87    HRYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIEPYVT  146

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL  Q+++D+A +AE CF+IFGDRVK+W +FNEP      GYD 
Sbjct  147   LYHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQGYDV  206

Query  834   GFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+AKQ G  G+  D
Sbjct  207   GLQAPGRCSIILRLICKAGNSATEPYIVAHNVLLSHATVADIYRKKYKAKQHGSVGVSFD  266

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP T S  +  AAQRA+DF +GWFL P+++G+YP +M + VG+RLPRF+  E  L+
Sbjct  267   VMWYEPETNSTENTEAAQRAQDFQLGWFLDPLIFGDYPSSMISRVGNRLPRFSKAESALL  326

Query  489   KGSIDYVGINQYTTFYV  439
             KGS+D+VGIN YTT+Y 
Sbjct  327   KGSLDFVGINHYTTYYA  343



>ref|NP_001049358.1| Os03g0212800 [Oryza sativa Japonica Group]
 sp|Q8L7J2.1|BGL06_ORYSJ RecName: Full=Beta-glucosidase 6; Short=Os3bglu6; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAN01354.1| beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF94615.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11272.1| Os03g0212800 [Oryza sativa Japonica Group]
 dbj|BAG99682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   395 bits (1014),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 249/360 (69%), Gaps = 15/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  43    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  100

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  101   QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  160

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  161   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  220

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  221   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  280

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  281   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  340

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG R +S
Sbjct  341   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  397



>ref|XP_007045907.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
 gb|EOY01739.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
Length=506

 Score =   394 bits (1012),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/358 (55%), Positives = 248/358 (69%), Gaps = 15/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             +SR SFP GFVFGTASS++Q EGA  V + GRGP+IWD F  T G   + +  +VAVDQY
Sbjct  29    ISRASFPKGFVFGTASSSFQYEGA--VKEDGRGPTIWDKFSHTFGKIIDGSNADVAVDQY  86

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY  DI LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN LIN +L KGI PY  
Sbjct  87    HRYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIEPYVT  146

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL  Q+++D+A +AE CF+IFGDRVK+W +FNEP      GYD 
Sbjct  147   LYHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQGYDV  206

Query  834   GFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+AKQ G  G+  D
Sbjct  207   GLQAPGRCSIILRLICKAGNSATEPYIVAHNVLLSHATVADIYRKKYKAKQHGSVGVSFD  266

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP T S  +  AAQRA+DF +GWFL P+++G+YP +M + VG+RLPRF+  E  L+
Sbjct  267   VMWYEPETNSTENTEAAQRAQDFQLGWFLDPLIFGDYPSSMISRVGNRLPRFSKAESALL  326

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIGPRVHS  331
             KGS+D+VGIN YTT+Y       T  + T  ND ++  + A     +NG PIG + +S
Sbjct  327   KGSLDFVGINHYTTYYA--RANATNALGTILND-SIADSGAFTAPFKNGKPIGDKANS  381



>ref|XP_010551390.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
 ref|XP_010551391.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
Length=515

 Score =   394 bits (1013),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 241/349 (69%), Gaps = 14/349 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             + R SFP GFVFGTASSA+Q EGA  V + GRGPS+WDTF    G   +++  +VAVDQY
Sbjct  35    IGRGSFPEGFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHAFGKIVDSSNADVAVDQY  92

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY+ D+ LM  +  DAYRFSISW+RIFPNGTG++N  G+ +YN+LIN +L KGI PY  
Sbjct  93    HRYEEDVQLMKNMGMDAYRFSISWSRIFPNGTGQINQAGIDHYNKLINALLAKGIQPYVT  152

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL  Q++ D+A YAE CFK FGDRVK+W +FNEP   A  GYD 
Sbjct  153   LYHWDLPQALEDRYNGWLSPQIINDFAIYAEVCFKNFGDRVKHWITFNEPHNFAIQGYDV  212

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNS+TEPY+VAHN++L HA  +  YR  Y+  Q G  GI LD
Sbjct  213   GLQAPGRCSILLKLFCRVGNSSTEPYIVAHNVLLSHATVSDIYRKKYKGNQGGSLGIALD  272

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              VWYEP T +  D  AAQRA+DF +GWFL P+++G+YP +M+  VG RLP+FT  +  L+
Sbjct  273   VVWYEPETNTTEDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRTRVGKRLPKFTQSQTDLL  332

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  343
             KGS+D+VGIN YTT Y  +   KT  I T  ND     A A +G   GP
Sbjct  333   KGSLDFVGINHYTTNYARN--NKTNLIGTLLND-----AIADSGTSTGP  374



>ref|XP_003517829.1| PREDICTED: beta-glucosidase 40-like [Glycine max]
Length=495

 Score =   393 bits (1010),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 253/357 (71%), Gaps = 6/357 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             +++     ++R+SFP GFVFGTA+SA+Q EGA  V + GRG S+WDTF  + G   + + 
Sbjct  19    QIQICLSEINRQSFPKGFVFGTAASAFQYEGA--VKEGGRGLSVWDTFSHSFGKIQDGSN  76

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +VAV+QYHRY  D+ LM ++  DAYRFSISW+RIFPNGT  +N +G+ +YN+LIN +L 
Sbjct  77    ADVAVNQYHRYDEDVQLMKEMGMDAYRFSISWSRIFPNGTRDINQEGIDHYNKLINALLA  136

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             KGI PY  L H+DLPQALED+Y GWL   +++D+A YAE CF+ FGDRVK+W +FNEP  
Sbjct  137   KGIEPYVTLYHWDLPQALEDKYNGWLSSLIIKDFATYAEICFQKFGDRVKHWITFNEPHT  196

Query  858   VAALGYDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
              A +GYD G  APGRCS C  GNSATEPY+VAHN+++ HA+ A  YR  Y+  Q G  G+
Sbjct  197   FAMMGYDLGLEAPGRCSVCGNGNSATEPYIVAHNVLISHAIVADVYRKKYKKIQGGSIGM  256

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
              LD +W+EP T SK D  A  RA DF +GWFL P+++G+YP +M++ VG+RLP+F+  + 
Sbjct  257   SLDVMWFEPATSSKEDIEATHRALDFQLGWFLDPLIFGDYPTSMRSRVGNRLPKFSKSQA  316

Query  498   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP-IGPRVHS  331
              L+KGS+D+VGIN YTTFY ++  P++ Y H Y  D  V F +  NG   IG + +S
Sbjct  317   SLLKGSLDFVGINHYTTFYAFN-IPRSSY-HDYIADSGV-FTFPFNGTNFIGEKANS  370



>pdb|3WBE|A Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant In A Covalent 
Complex With Glc From Ga4ge.
Length=489

 Score =   393 bits (1010),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 249/360 (69%), Gaps = 15/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  11    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  68

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  69    QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  128

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + N+P  VA  GY
Sbjct  129   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGY  188

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  189   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  248

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  249   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  308

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG R +S
Sbjct  309   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  365



>pdb|3WBA|A Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl Moiety From 
P-nitrophenyl Glucopyranoside.
Length=489

 Score =   393 bits (1010),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 249/360 (69%), Gaps = 15/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  11    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  68

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  69    QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  128

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + N+P  VA  GY
Sbjct  129   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGY  188

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  189   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  248

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  249   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  308

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG R +S
Sbjct  309   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  365



>gb|EEC74750.1| hypothetical protein OsI_10506 [Oryza sativa Indica Group]
Length=521

 Score =   394 bits (1012),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 249/360 (69%), Gaps = 15/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  43    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  100

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  101   QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  160

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  161   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  220

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  221   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  280

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  281   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  340

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             +VKG++D+VG+N YTT+Y    +  T  I T  N+       V   + +NG PIG R +S
Sbjct  341   VVKGALDFVGVNHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  397



>ref|XP_009406318.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=506

 Score =   394 bits (1011),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 242/359 (67%), Gaps = 13/359 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR SFP GFVFGTASS+YQ EGA  V + G+G ++WD F  T G   + +  +VAVD
Sbjct  27    GGLSRSSFPEGFVFGTASSSYQYEGA--VEEDGKGRTVWDVFAHTFGKVIDFSNADVAVD  84

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR+  DI LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L  GI PY
Sbjct  85    QYHRFDEDILLMKDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLANGIEPY  144

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALEDRY GW+  ++++DYADYAE CFK FGDRVK+W +FNEP   A  GY
Sbjct  145   VTLYHWDLPQALEDRYDGWIDPRIIQDYADYAETCFKAFGDRVKHWMTFNEPHTFAIQGY  204

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+ KQ+G  GI 
Sbjct  205   DVGLQAPGRCSAFLRLLCRAGNSATEPYIVAHNVLLSHATVSDIYRRKYKQKQQGSLGIA  264

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +WYEP+T S  D  A QRA+DF  GWF+ P+ +G+YP +M+  VG+RLPRFT  E  
Sbjct  265   FDVMWYEPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRKRVGNRLPRFTTAEAA  324

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRVHS  331
             LVKGS+D+VG+N YTT+Y    +  T  I    ND            +NG  IG R  S
Sbjct  325   LVKGSLDFVGVNHYTTYYA--KHNSTNIIGILLNDTLADSGAMTLPFKNGKAIGDRASS  381



>gb|EEE58575.1| hypothetical protein OsJ_09895 [Oryza sativa Japonica Group]
Length=521

 Score =   394 bits (1011),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 249/360 (69%), Gaps = 15/360 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  43    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  100

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  101   QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  160

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  161   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  220

Query  840   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  221   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  280

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  +G+RLPRFT DE  
Sbjct  281   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARLGERLPRFTADEAA  340

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG R +S
Sbjct  341   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  397



>ref|XP_003574944.1| PREDICTED: beta-glucosidase 34-like [Brachypodium distachyon]
Length=515

 Score =   393 bits (1010),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 247/358 (69%), Gaps = 15/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R SFP GFVFGTA+SAYQ EGA  V + GRGP+IWD F  T G   + +  +VAVD Y
Sbjct  38    LTRGSFPKGFVFGTAASAYQYEGA--VKEDGRGPAIWDKFAHTFGKILDFSNADVAVDHY  95

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HR++ DI+LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN ++ KGI PY  
Sbjct  96    HRFEEDIELMADMGLDAYRFSIAWSRILPNGTGEVNQAGIDHYNKVINALIAKGIEPYVT  155

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALED+Y G L RQ++ DY  YAE CF+ FGDRVK+W +FNEP  V   GYD+
Sbjct  156   LYHWDLPQALEDKYMGLLDRQIINDYLAYAETCFEAFGDRVKHWITFNEPHTVTVQGYDS  215

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C QG+S TEPY+VAHN+IL HA  +  YR  Y+AKQ G  G+ LD
Sbjct  216   GIHAPGRCSVLRHLYCKQGSSGTEPYIVAHNIILAHATVSDMYRTKYKAKQNGELGMSLD  275

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +WYEP + S AD  A +RA++F +GWF  P  +G+YP TM++ VG RLPRFT  E  LV
Sbjct  276   VIWYEPASNSTADVEATKRAQEFQLGWFADPFFFGDYPVTMRSRVGVRLPRFTTKEADLV  335

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRVHS  331
             KGS+D++GIN YTTFY  D    + YI  + ND      ++   + R+G PIG + +S
Sbjct  336   KGSLDFMGINHYTTFYTKD--DNSTYIKKFLNDTLADSGSISLPF-RDGKPIGDKANS  390



>ref|XP_010521463.1| PREDICTED: beta-glucosidase 40-like isoform X3 [Tarenaya hassleriana]
Length=498

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 239/338 (71%), Gaps = 14/338 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQ-----VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++R SFP GFVFGTAS+A+Q      EGA  V + GRGPS+WDTF  T G   + +  +V
Sbjct  28    INRASFPNGFVFGTASAAFQGNLLQYEGA--VKEDGRGPSVWDTFSHTLGKIADFSNADV  85

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYHRY+ DI LM  +  DAYRFSISWTRIFPNGTG++N  G+ +YN+LIN +L +GI
Sbjct  86    AVDQYHRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGI  145

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PY  L H+DLPQAL DRY GWL  Q++ DYA YAE CF+ FGDRVK+W +FNEP   A 
Sbjct  146   QPYVTLYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAI  205

Query  849   LGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
              GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+AKQ G  
Sbjct  206   QGYDVGLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWL  265

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GI  D +WYEP T ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG RLPRFT  
Sbjct  266   GIAFDVIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTAS  325

Query  504   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND  391
             E  +VKGS+D+VGIN YTT+Y  +   KT  I T  ND
Sbjct  326   EAAMVKGSLDFVGINHYTTYYARN--NKTNLIGTLLND  361



>ref|XP_010109366.1| Beta-glucosidase 40 [Morus notabilis]
 gb|EXC22071.1| Beta-glucosidase 40 [Morus notabilis]
Length=500

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 234/319 (73%), Gaps = 7/319 (2%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             ++R SFP GFVFGTASSAYQ EGA  V + GRGPS+WDTF  T G   + +  +VAVDQY
Sbjct  27    INRGSFPKGFVFGTASSAYQYEGA--VKEDGRGPSVWDTFAHTFGKIIDLSNADVAVDQY  84

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HRY+ D+ LM  +  DAYRFSISW+RIFPNGTG++N  GV YYN+LIN +L KGI PY  
Sbjct  85    HRYEEDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDYYNKLINALLAKGIEPYVT  144

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALED+Y GWL RQV++D+A +AE CF+ FGDRVK+W +FNE   VA  GYD 
Sbjct  145   LYHWDLPQALEDKYKGWLDRQVIKDFALFAETCFQQFGDRVKHWITFNEAYTVAVQGYDV  204

Query  834   GFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNS+TEPY+V HN++L HAVA   YR  Y++KQKG  G+   
Sbjct  205   GLQAPGRCSILLHLLCRAGNSSTEPYIVGHNILLSHAVAVDIYRKKYKSKQKGSIGMSQS  264

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +W+ P + S AD  AAQRA+DF +GWFL P+++G+YP  M+ +VG+RLP F+  E  L+
Sbjct  265   VIWFIPASNSTADIEAAQRAQDFQLGWFLDPLMFGDYPSAMRKLVGNRLPTFSKSESALL  324

Query  489   KGSIDYVGINQYTTFYVYD  433
             KGS D+VGIN YTTFY ++
Sbjct  325   KGSFDFVGINHYTTFYAFN  343



>ref|XP_011018305.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Populus euphratica]
Length=507

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 244/359 (68%), Gaps = 13/359 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPS+WD F  T G   + +  +VAVDQ+
Sbjct  26    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPSVWDKFSHTFGKIIDFSNADVAVDQF  83

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             H +  DI LM  +  DAYRFSISWTRI+PNGTGK+N  GV +Y + IN +L +GI PY  
Sbjct  84    HHFDEDIKLMKDMGMDAYRFSISWTRIYPNGTGKINQAGVDHYKKFINALLAQGIEPYVT  143

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQAL DRY GWL  Q+++D+A +AE CF+ +GDRVKNW +FNEP  V+  GYD 
Sbjct  144   LFHWDLPQALHDRYSGWLSPQIIKDFATFAETCFQNYGDRVKNWITFNEPHTVSIQGYDV  203

Query  834   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  GNSATEPY+VAHN++L H  AA  YR  Y+AKQ+G  GI LD
Sbjct  204   GLQAPGRCSILLHLFCRAGNSATEPYIVAHNMLLSHGAAADIYRKKYKAKQQGSVGISLD  263

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +W+EP T S  D  AAQRA+DF +GWF+ P++ G+YP +M+N VGDRLP+FT ++  LV
Sbjct  264   VIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNRVGDRLPKFTKNDAALV  323

Query  489   KGSIDYVGINQYTTFYV-YDPYPKTPYIHTYQND-----WNVGFAYARNGVPIGPRVHS  331
             KGS+D+VGIN YTTFY   +       I    ND       +   +  N  PIG R +S
Sbjct  324   KGSLDFVGINHYTTFYARSNDSLLGDVIDKVLNDSVADSGAITLPFGENKKPIGDRANS  382



>ref|XP_003561900.1| PREDICTED: beta-glucosidase 6 [Brachypodium distachyon]
Length=519

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/368 (54%), Positives = 246/368 (67%), Gaps = 33/368 (9%)
 Frame = -3

Query  1377  GLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQ  1198
             GL+R SFP GFVFGTAS+AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQ
Sbjct  41    GLTRGSFPKGFVFGTASAAYQYEGA--VKADGRGQTIWDTFAHTFGKITDFSNADVAVDQ  98

Query  1197  YHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYA  1018
             YHR++ DI LM  +  DAYRFSI+W RI PNG G+VN  G+ +YN+LIN +L KGI PY 
Sbjct  99    YHRFEEDIQLMADMGMDAYRFSIAWARILPNGVGQVNQAGIDHYNKLINALLAKGIQPYV  158

Query  1017  NLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYD  838
              L H+DLPQALED+Y GWL RQ+V+D+A YAE CF  FGDRVK+W + NEP  V+  GYD
Sbjct  159   TLYHWDLPQALEDKYNGWLNRQIVDDFAGYAETCFAAFGDRVKHWITVNEPHTVSVQGYD  218

Query  837   TGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  673
              G  APGRCS      C  GNS TEPY+VAHN IL HA  ++ YR  Y+A QKG+ G+  
Sbjct  219   AGLQAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSRIYRNKYRATQKGQLGMAF  278

Query  672   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  493
             D +WYEP+T    D  AA+RA++F +GWF  P  +G+YP+TM+  VG+RLPRFTP+E +L
Sbjct  279   DVMWYEPMTSRAVDVEAAKRAQEFQLGWFADPFFFGDYPETMRKRVGERLPRFTPEEAEL  338

Query  492   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWN-VGFAYA-------------RNGV  355
             VKG++D+VGIN YTT+Y            T QND N +G  +              RNG 
Sbjct  339   VKGALDFVGINHYTTYY------------TRQNDTNIIGKLFNDTLADTGTISLPFRNGK  386

Query  354   PIGPRVHS  331
              IG R +S
Sbjct  387   AIGDRANS  394



>ref|XP_010521461.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Tarenaya hassleriana]
Length=512

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 239/338 (71%), Gaps = 14/338 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQ-----VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1210
             ++R SFP GFVFGTAS+A+Q      EGA  V + GRGPS+WDTF  T G   + +  +V
Sbjct  28    INRASFPNGFVFGTASAAFQGNLLQYEGA--VKEDGRGPSVWDTFSHTLGKIADFSNADV  85

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYHRY+ DI LM  +  DAYRFSISWTRIFPNGTG++N  G+ +YN+LIN +L +GI
Sbjct  86    AVDQYHRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGI  145

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PY  L H+DLPQAL DRY GWL  Q++ DYA YAE CF+ FGDRVK+W +FNEP   A 
Sbjct  146   QPYVTLYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAI  205

Query  849   LGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
              GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+AKQ G  
Sbjct  206   QGYDVGLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWL  265

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GI  D +WYEP T ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG RLPRFT  
Sbjct  266   GIAFDVIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTAS  325

Query  504   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND  391
             E  +VKGS+D+VGIN YTT+Y  +   KT  I T  ND
Sbjct  326   EAAMVKGSLDFVGINHYTTYYARN--NKTNLIGTLLND  361



>ref|XP_010910032.1| PREDICTED: beta-glucosidase 25 isoform X4 [Elaeis guineensis]
Length=409

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 231/321 (72%), Gaps = 7/321 (2%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             +T  L+R  FP+ FVFGTASSA+Q EGA +  K  RG SIWDTF + PG   + +  E+A
Sbjct  16    STEALTRADFPSDFVFGTASSAFQFEGAVNEGK--RGDSIWDTFTRRPGRILDFSNAEIA  73

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
             VDQYHRYK D+DLM  +  DAYRFSISW+RIFPNGTG+ N +G+++YN LI+ +LEKG+ 
Sbjct  74    VDQYHRYKTDVDLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PY  L H+DLPQ+LEDRY GWL RQ+VED+  YA  CF+ FGDRVK+W +FNEP   +  
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQ  193

Query  846   GYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             GYDTG  APGRCS      C +G S+TEPY+VAHN++L HA A   Y+  ++AKQ G  G
Sbjct  194   GYDTGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAAFHTYKRNFKAKQDGAIG  253

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             I LD  WYEP++ +  D  AA RA DF +GWFL P+++G YP++MQNIVG RLP  T   
Sbjct  254   IALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNITSKM  313

Query  501   VKLVKGSIDYVGINQYTTFYV  439
              K + G++D+VGIN YTT YV
Sbjct  314   SKSLAGTLDFVGINHYTTLYV  334



>gb|KEH16705.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=314

 Score =   385 bits (988),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 202/248 (81%), Gaps = 6/248 (2%)
 Frame = -3

Query  1404  PERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN  1225
             PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K PG+  NN
Sbjct  33    PETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGIAS--KEGRGPSIWDVFIKKPGIVANN  90

Query  1224  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1045
              TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAYYNRLI+Y+
Sbjct  91    GTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAYYNRLIDYL  150

Query  1044  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  865
             LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVKNW +FNEP
Sbjct  151   LEKGITPYANLYHYDLPLALELKYNGLLNRNVVKDFADYADFCFKTFGDRVKNWMTFNEP  210

Query  864   RVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  697
             RV+AALGYDTGFFAPGRCS    NCT GNS TEPY+VAHNLIL HA AAQRYR  YQ K 
Sbjct  211   RVIAALGYDTGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAAQRYRQKYQIKC  270

Query  696   KGRFGILL  673
               R  + L
Sbjct  271   VFRLSMSL  278



>gb|KHN20526.1| Beta-glucosidase 40 [Glycine soja]
Length=503

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 233/327 (71%), Gaps = 7/327 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
              ++  +  ++R +FP GFVFGTASSA+Q EGA  V + GRGPS+WDTF  T G   + + 
Sbjct  18    EIQICSSEINRGNFPNGFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHTFGKIIDFSN  75

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +VAVDQYHRY+ DI LM  +  DAYRFSISW+RIFPNG G++N  GV +YN+LIN +L 
Sbjct  76    ADVAVDQYHRYEEDIQLMKDMGMDAYRFSISWSRIFPNGYGQINQAGVDHYNKLINALLA  135

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             KGI PY  L H+DLPQALE++Y GWL   ++ D+A YAE CF+ FGDRVK+W +FNEP  
Sbjct  136   KGIEPYVTLYHWDLPQALENKYSGWLNASIIMDFATYAETCFQKFGDRVKHWITFNEPHT  195

Query  858   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
              A  GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+  Q 
Sbjct  196   FATQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHATVADIYRKKYKKIQG  255

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             G  G+  D +WYEPLT +K D  AAQRA+DF +GWFL P+++G+YP +M+  VG RLP+F
Sbjct  256   GSLGVAFDVIWYEPLTNTKEDIDAAQRAQDFQLGWFLDPLMFGDYPSSMRTRVGSRLPKF  315

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYD  433
             +  E  LVKGS+D+VGIN YTTFY  D
Sbjct  316   SQSEAALVKGSLDFVGINHYTTFYAKD  342



>ref|XP_003556662.1| PREDICTED: beta-glucosidase 40 [Glycine max]
Length=503

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 233/327 (71%), Gaps = 7/327 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
              ++  +  ++R +FP GFVFGTASSA+Q EGA  V + GRGPS+WDTF  T G   + + 
Sbjct  18    EIQICSSEINRGNFPNGFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHTFGKIIDFSN  75

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +VAVDQYHRY+ DI LM  +  DAYRFSISW+RIFPNG G++N  GV +YN+LIN +L 
Sbjct  76    ADVAVDQYHRYEEDIQLMKDMGMDAYRFSISWSRIFPNGYGQINQAGVDHYNKLINALLA  135

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             KGI PY  L H+DLPQALE++Y GWL   ++ D+A YAE CF+ FGDRVK+W +FNEP  
Sbjct  136   KGIEPYVTLYHWDLPQALENKYSGWLNASIIMDFATYAETCFQKFGDRVKHWITFNEPHT  195

Query  858   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
              A  GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+  Q 
Sbjct  196   FATQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHATVADIYRKKYKKIQG  255

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             G  G+  D +WYEPLT +K D  AAQRA+DF +GWFL P+++G+YP +M+  VG RLP+F
Sbjct  256   GSLGVAFDVIWYEPLTNTKEDIDAAQRAQDFQLGWFLDPLMFGDYPSSMRTRVGSRLPKF  315

Query  513   TPDEVKLVKGSIDYVGINQYTTFYVYD  433
             +  E  LVKGS+D+VGIN YTTFY  D
Sbjct  316   SQSEAALVKGSLDFVGINHYTTFYAKD  342



>ref|XP_002311330.1| hydroxyisourate hydrolase family protein [Populus trichocarpa]
 gb|EEE88697.1| hydroxyisourate hydrolase family protein [Populus trichocarpa]
Length=512

 Score =   391 bits (1005),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 232/321 (72%), Gaps = 12/321 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN-----ATGEV  1210
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPS+WD F  T  + P       +  +V
Sbjct  26    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPSVWDKFSHTFVIGPAGKIIDFSNADV  83

Query  1209  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1030
             AVDQYH +  DI LM  +  DAYRFSISWTRI+PNGTGK+N  GV +YN+ IN +L +GI
Sbjct  84    AVDQYHHFDEDIKLMKDMGMDAYRFSISWTRIYPNGTGKINQAGVDHYNKFINALLAQGI  143

Query  1029  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  850
              PY  L H+DLPQAL DRY GWL  Q+++D+A +AE CF+ +GDRVKNW +FNEP  V+ 
Sbjct  144   EPYVTLFHWDLPQALHDRYNGWLSPQIIKDFATFAETCFQNYGDRVKNWITFNEPHTVSI  203

Query  849   LGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  685
              GYD G  APGRCS      C  GNSATEPY+VAHN++L H  AA  YR  Y+AKQ+G  
Sbjct  204   QGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNMLLSHGAAADIYRKKYKAKQQGSV  263

Query  684   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  505
             GI LD +W+EP T S  D  AAQRA+DF +GWF+ P++ G+YP +M+N VGDRLP+FT +
Sbjct  264   GISLDVIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNRVGDRLPKFTEN  323

Query  504   EVKLVKGSIDYVGINQYTTFY  442
             +  LVKGS+D+VGIN YTTFY
Sbjct  324   DAALVKGSLDFVGINHYTTFY  344



>gb|EAZ28287.1| hypothetical protein OsJ_12262 [Oryza sativa Japonica Group]
Length=424

 Score =   388 bits (997),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 223/315 (71%), Gaps = 27/315 (9%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             GGLSR +FP  FVFGTA+SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  36    GGLSRAAFPKRFVFGTATSAYQVEGM--AASGGRGPSIWDAFAHTPGNVAGNQNGDVATD  93

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
             QYHRYK D++LM  LNFDAYRFSISW+RIFP                        GITPY
Sbjct  94    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFP------------------------GITPY  129

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  130   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  189

Query  840   DTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  664
             D G   P RC+ C  G NSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  190   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  249

Query  663   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  484
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  250   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  309

Query  483   SIDYVGINQYTTFYV  439
             S DY+GINQYT  Y+
Sbjct  310   SADYIGINQYTASYM  324



>ref|XP_008658980.1| PREDICTED: uncharacterized protein LOC100502286 isoform X2 [Zea 
mays]
Length=453

 Score =   389 bits (999),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 243/358 (68%), Gaps = 15/358 (4%)
 Frame = -3

Query  1374  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1195
             L+R SFP GFVFGTASSAYQ EGA  V + GRG +IWD F  T G   + +  +VAVDQY
Sbjct  31    LTRGSFPKGFVFGTASSAYQYEGA--VKEDGRGKTIWDKFAHTFGKVADLSNADVAVDQY  88

Query  1194  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1015
             HR++ DI LM  +  DAYRFSI+W+RI PNGTG+VN  GV +YNR I+ +L KGI PY  
Sbjct  89    HRFEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVT  148

Query  1014  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  835
             L H+DLPQALEDRY GWL RQ+V D+A+YAE CF+ FGDRV++W + NEP  VA  GYD 
Sbjct  149   LYHWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDA  208

Query  834   GFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  670
             G  APGRCS      C  G+SATEPYVVAHN IL HA  +  YR  Y+A Q G  GI  D
Sbjct  209   GLQAPGRCSLLLHLYCRSGDSATEPYVVAHNFILAHAKVSDVYRKKYKAAQNGELGIAFD  268

Query  669   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  490
              +W+EP+T + AD  AA+R ++F +GWF  P  +G+YP +M++ VGDRLPRFT  E  LV
Sbjct  269   VMWFEPMTNTTADIEAAKRGQEFQLGWFADPFFFGDYPASMRSRVGDRLPRFTAAEAALV  328

Query  489   KGSIDYVGINQYTTFYVYDPYPKTPYI-----HTYQNDWNVGFAYARNGVPIGPRVHS  331
             KG++D+VGIN YTT+Y    +  T  +     +T  +   +   + RNG  IG R +S
Sbjct  329   KGALDFVGINHYTTYYT--KHNSTDLVGRLLHNTLADTGTISLPF-RNGKAIGDRANS  383



>gb|EMS46293.1| Beta-glucosidase 34 [Triticum urartu]
Length=512

 Score =   391 bits (1005),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 244/359 (68%), Gaps = 13/359 (4%)
 Frame = -3

Query  1380  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1201
             G L+R SFP GFVFGTA+SAYQ EGA +V   GRGP+IWD F  T G   + +  +VAVD
Sbjct  36    GNLTRGSFPKGFVFGTAASAYQYEGAVNVD--GRGPTIWDKFAHTFGKILDFSNADVAVD  93

Query  1200  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1021
              YHR++ DI LM  +  DAYRFSI+W+RI PNG G+VN  G+ +YN++I+ +L KGI PY
Sbjct  94    HYHRFQEDIQLMADMGLDAYRFSIAWSRILPNGAGEVNPAGINHYNKVIDALLAKGIKPY  153

Query  1020  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  841
               L H+DLPQALED+Y G L RQ++ DYA YAE CFK FGDRVK W +FNEP  VA  GY
Sbjct  154   VTLYHWDLPQALEDKYNGLLDRQIINDYAAYAETCFKAFGDRVKRWITFNEPHTVAVQGY  213

Query  840   DTGFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  676
             D+G  APGRCS      C QG+S TEPY+VAHN+IL HA+ +  YR  Y+A+Q G  G+ 
Sbjct  214   DSGIHAPGRCSVLRHLCCKQGSSGTEPYIVAHNIILAHAMVSDIYRKKYKAEQNGEVGMS  273

Query  675   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  496
             LD +WYEP++ S AD  A +RA++F +GWF  P  +G+YP TM++ VG RLPRF   E  
Sbjct  274   LDVIWYEPVSNSTADVEATKRAQEFQLGWFADPFFFGDYPATMRSRVGQRLPRFMTKEAD  333

Query  495   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRVHS  331
             LVKGS+D+VGIN YTTFY  + +  T  I    ND  V         RNG  IG + +S
Sbjct  334   LVKGSLDFVGINHYTTFYTKEDH--TTVIKYLLNDTLVDSGSVSLPFRNGKAIGDKANS  390



>ref|XP_007157842.1| hypothetical protein PHAVU_002G102800g [Phaseolus vulgaris]
 gb|ESW29836.1| hypothetical protein PHAVU_002G102800g [Phaseolus vulgaris]
Length=503

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 236/325 (73%), Gaps = 7/325 (2%)
 Frame = -3

Query  1398  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1219
             ++R     ++R++FP GFVFGTASSA+Q EGA  V + GRGPS+WD F  T G   + + 
Sbjct  18    QMRICKSEINRQNFPNGFVFGTASSAFQYEGA--VKEDGRGPSVWDKFSHTFGKILDFSN  75

Query  1218  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1039
              +VAVDQYHRY+ D+ LM  +  DAYRFSISW+RIFPNG+G++N  GV +YN+LIN +L 
Sbjct  76    ADVAVDQYHRYEEDVQLMKDMGMDAYRFSISWSRIFPNGSGQINQAGVDHYNKLINALLA  135

Query  1038  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  859
             KGI PY  L H+DLPQALED+Y GWL   +++D++ YAE CF+ FGDRVK+W +FNEP  
Sbjct  136   KGIEPYVTLYHWDLPQALEDKYNGWLNTSIIKDFSTYAETCFQKFGDRVKHWITFNEPHT  195

Query  858   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  694
              A  GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y++ QK
Sbjct  196   FATQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHAAVADIYRKKYKSIQK  255

Query  693   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  514
             G  GI  D +WYEP T ++ +  AAQRA+DF +GWFL P+++G+YP +M++ VG RLP+F
Sbjct  256   GSLGIAFDVIWYEPETNTQENIDAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPKF  315

Query  513   TPDEVKLVKGSIDYVGINQYTTFYV  439
             +  E  LVKGS+D+VGIN YTTFY 
Sbjct  316   SQFEASLVKGSLDFVGINHYTTFYA  340



>ref|XP_010936327.1| PREDICTED: beta-glucosidase 6 isoform X2 [Elaeis guineensis]
Length=504

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 233/325 (72%), Gaps = 7/325 (2%)
 Frame = -3

Query  1401  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1222
             +R   + GGLSR SFP GF+FGTASSAYQ EGA  V + GRGP++WDTF  + G   + +
Sbjct  18    KRCSSDNGGLSRGSFPEGFIFGTASSAYQYEGA--VKEAGRGPTVWDTFAHSFGKVIDFS  75

Query  1221  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1042
               +VAVDQYHR+  D+ LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L
Sbjct  76    NADVAVDQYHRFVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALL  135

Query  1041  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  862
              KGI PY  L H+DLPQAL+D+Y GWL RQ+++DYA+YAE CF+ FGDRV +W +FNEP 
Sbjct  136   AKGIEPYVTLYHWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPH  195

Query  861   VVAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  697
               A  GYD G  APGRCS      C  GNSATEPY+V HN++L HA  A  YR  Y+A Q
Sbjct  196   TFAIQGYDVGLQAPGRCSIILRLFCRAGNSATEPYIVGHNVLLSHATVADIYRRKYKATQ  255

Query  696   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  517
              G  GI  D +W+ P+T S  D  A QRA+DF  GWF+ P+ +G+YP +M+  VG+RLP+
Sbjct  256   HGTVGIAFDVMWFIPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPK  315

Query  516   FTPDEVKLVKGSIDYVGINQYTTFY  442
             F+  E  LVKGS+D+VGIN YTT+Y
Sbjct  316   FSTAEAALVKGSLDFVGINHYTTYY  340



>ref|XP_008789189.1| PREDICTED: beta-glucosidase 25 isoform X1 [Phoenix dactylifera]
Length=497

 Score =   389 bits (1000),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 233/321 (73%), Gaps = 7/321 (2%)
 Frame = -3

Query  1386  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1207
             +T  LSR  FP+GFVFGTASSAYQ EGA +  K  RG SIWDTF + PG   + +  E+A
Sbjct  16    STKALSRADFPSGFVFGTASSAYQFEGAVNEGK--RGDSIWDTFTRRPGRILDFSNAEIA  73

Query  1206  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1027
             VDQYHRYK D DLM  +  DAYRFSISW+RIFPNGTG+ N +G+++YN LI+ +LEKG+ 
Sbjct  74    VDQYHRYKTDADLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  1026  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  847
             PY  L H+DLPQ+LEDRY GWL RQ+VED+  YA  CF+ FGDRVK+W +FNEP   +  
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYACTCFEAFGDRVKHWITFNEPHGFSIQ  193

Query  846   GYDTGFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  682
             GYD G  APGRCS      C +G S+TEPY+VAHN++L HA     Y+ +++AKQ G  G
Sbjct  194   GYDLGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAVFHTYKRLFKAKQGGSIG  253

Query  681   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  502
             I LD  WYEP++ +  D+ AA RA DF +GWFL P+++G YP++MQNIVG RLP+ T + 
Sbjct  254   IALDSKWYEPISDADEDHDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPKITSEM  313

Query  501   VKLVKGSIDYVGINQYTTFYV  439
              K + G++D+VGIN YTT YV
Sbjct  314   SKSLAGTLDFVGINHYTTLYV  334



>ref|XP_003607794.1| Beta-glucosidase [Medicago truncatula]
 gb|AES89991.1| beta-glucosidase [Medicago truncatula]
Length=505

 Score =   389 bits (999),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 230/320 (72%), Gaps = 7/320 (2%)
 Frame = -3

Query  1383  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1204
             +  +SR +FP GF+FGTASSA+Q EGA  V + GRGPS+WDTF  T G   + +  +VAV
Sbjct  25    SAEISRANFPHGFIFGTASSAFQYEGA--VKEDGRGPSVWDTFSHTFGKVTDFSNADVAV  82

Query  1203  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1024
             DQYHRY+ DI LM  L  DAYRFSISW+RI+PNG+G +N  G+ +YN+ IN +L KGI P
Sbjct  83    DQYHRYEEDIQLMKDLGMDAYRFSISWSRIYPNGSGAINQAGIDHYNKFINALLAKGIEP  142

Query  1023  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  844
             Y  L H+DLPQAL+D+Y GWL   +++D+A YAE CF+ FGDRVK+W +FNEP      G
Sbjct  143   YVTLYHWDLPQALDDKYKGWLSTDIIKDFATYAETCFQKFGDRVKHWITFNEPHTFTTQG  202

Query  843   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  679
             YD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+  Q G  GI
Sbjct  203   YDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLTHAAVADIYRKKYKNTQGGSLGI  262

Query  678   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  499
               D +WYEP T +K D  AAQRA+DF +GWFL P+++G+YP +M++ VG+RLP+F+  E 
Sbjct  263   AFDVIWYEPATNTKEDIAAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSSSEA  322

Query  498   KLVKGSIDYVGINQYTTFYV  439
              LVKGS+D+VGIN YTTFY 
Sbjct  323   ALVKGSLDFVGINHYTTFYA  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4125412501398