BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24384_g1_i1 len=1625 path=[1697:0-215 1913:216-251 1948:252-303
1289:304-344 2040:345-417 7573:418-443 2138:444-460 2155:461-576
158:577-601 2294:602-777 511:778-803 2495:804-1163 2855:1164-1624]

Length=1625
                                                                      Score     E

ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                837   0.0      
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                833   0.0      
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                832   0.0      
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  829   0.0      
ref|XP_003534146.1|  PREDICTED: beta-glucosidase 44                     798   0.0      
gb|KDP41124.1|  hypothetical protein JCGZ_03615                         798   0.0      
gb|EYU40222.1|  hypothetical protein MIMGU_mgv1a004735mg                793   0.0      
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                792   0.0      
gb|ACU24532.1|  unknown                                                 792   0.0      Glycine max [soybeans]
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                792   0.0      
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                791   0.0      
ref|XP_011084444.1|  PREDICTED: beta-glucosidase 44-like                789   0.0      
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     789   0.0      
ref|XP_007152698.1|  hypothetical protein PHAVU_004G151800g             788   0.0      
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                787   0.0      
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                785   0.0      
gb|KDO62878.1|  hypothetical protein CISIN_1g010049mg                   785   0.0      
ref|XP_006451662.1|  hypothetical protein CICLE_v10008010mg             783   0.0      
ref|XP_004512738.1|  PREDICTED: beta-glucosidase 44-like                779   0.0      
ref|XP_007036679.1|  B-S glucosidase 44 isoform 1                       778   0.0      
gb|KEH16707.1|  glycoside hydrolase family 1 protein                    778   0.0      
gb|AGV54748.1|  beta-glucosidase 44-like protein                        777   0.0      
ref|XP_010032608.1|  PREDICTED: beta-glucosidase 44-like                776   0.0      
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                775   0.0      
gb|KCW83978.1|  hypothetical protein EUGRSUZ_B00859                     773   0.0      
ref|XP_004161840.1|  PREDICTED: beta-glucosidase 44-like                771   0.0      
gb|KEH16706.1|  glycoside hydrolase family 1 protein                    770   0.0      
gb|KCW83975.1|  hypothetical protein EUGRSUZ_B00859                     770   0.0      
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             769   0.0      
ref|XP_004137494.1|  PREDICTED: beta-glucosidase 44-like                769   0.0      
ref|XP_010097587.1|  Beta-glucosidase 44                                769   0.0      
gb|KCW83977.1|  hypothetical protein EUGRSUZ_B00859                     769   0.0      
gb|KCW83979.1|  hypothetical protein EUGRSUZ_B00859                     768   0.0      
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                768   0.0      
ref|XP_008462973.1|  PREDICTED: beta-glucosidase 44-like                767   0.0      
ref|XP_008810053.1|  PREDICTED: beta-glucosidase 1-like                 767   0.0      
ref|XP_002533126.1|  beta-glucosidase, putative                         766   0.0      Ricinus communis
ref|XP_010032621.1|  PREDICTED: beta-glucosidase 44-like                765   0.0      
ref|XP_008240180.1|  PREDICTED: beta-glucosidase 44-like                764   0.0      
gb|KCW83981.1|  hypothetical protein EUGRSUZ_B00859                     764   0.0      
ref|XP_002322085.1|  glycosyl hydrolase family 1 family protein         764   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010032630.1|  PREDICTED: beta-glucosidase 44-like                764   0.0      
gb|KCW83987.1|  hypothetical protein EUGRSUZ_B00860                     762   0.0      
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                762   0.0      
ref|NP_188436.1|  beta-glucosidase 44                                   762   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                762   0.0      
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                762   0.0      
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     761   0.0      Vitis vinifera
ref|XP_010465882.1|  PREDICTED: beta-glucosidase 44                     761   0.0      
ref|XP_002322086.2|  hypothetical protein POPTR_0015s04280g             761   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039106.1|  PREDICTED: beta-glucosidase 44-like                761   0.0      
ref|XP_009347765.1|  PREDICTED: beta-glucosidase 44-like                760   0.0      
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                760   0.0      
gb|KCW83982.1|  hypothetical protein EUGRSUZ_B00859                     760   0.0      
ref|XP_008374823.1|  PREDICTED: beta-glucosidase 44-like                759   0.0      
emb|CAN74265.1|  hypothetical protein VITISV_040977                     759   0.0      Vitis vinifera
gb|EPS65829.1|  beta-mannosidase                                        756   0.0      
gb|KHN23728.1|  Beta-glucosidase 44                                     747   0.0      
gb|KFK39134.1|  beta-glucosidase 44                                     749   0.0      
ref|XP_007036681.1|  B-S glucosidase 44 isoform 3                       747   0.0      
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             743   0.0      
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             743   0.0      
gb|KFK39133.1|  beta-glucosidase 44                                     739   0.0      
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                739   0.0      
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                739   0.0      
ref|XP_002883106.1|  beta-glucosidase                                   738   0.0      
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     736   0.0      
ref|XP_010314225.1|  PREDICTED: beta-glucosidase 44-like isoform X2     736   0.0      
ref|XP_009394432.1|  PREDICTED: beta-glucosidase 1-like                 736   0.0      
ref|XP_010922562.1|  PREDICTED: beta-glucosidase 1-like                 734   0.0      
gb|ABC55716.1|  beta-mannosidase 3                                      733   0.0      
gb|ABC55717.1|  beta-mannosidase 2                                      731   0.0      
emb|CDO98378.1|  unnamed protein product                                729   0.0      
ref|XP_007033096.1|  B-S glucosidase 44                                 731   0.0      
ref|XP_010906974.1|  PREDICTED: beta-glucosidase 1-like                 730   0.0      
ref|XP_006644213.1|  PREDICTED: beta-glucosidase 1-like                 730   0.0      
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     729   0.0      
emb|CDY18494.1|  BnaA01g27010D                                          731   0.0      
gb|EAY74244.1|  hypothetical protein OsI_02124                          730   0.0      Oryza sativa Indica Group [Indian rice]
gb|ABC55718.1|  beta-mannosidase 1                                      729   0.0      
ref|XP_007033088.1|  Beta-glucosidase 44                                728   0.0      
ref|XP_008792825.1|  PREDICTED: beta-glucosidase 1-like                 728   0.0      
ref|XP_006431835.1|  hypothetical protein CICLE_v10004010mg             728   0.0      
ref|XP_006471035.1|  PREDICTED: beta-glucosidase 44-like                727   0.0      
ref|NP_001043156.1|  Os01g0508000                                       728   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDX95557.1|  BnaC01g34490D                                          728   0.0      
ref|XP_006430656.1|  hypothetical protein CICLE_v10013386mg             728   0.0      
gb|KDO63132.1|  hypothetical protein CISIN_1g046891mg                   726   0.0      
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                725   0.0      
gb|KCW83983.1|  hypothetical protein EUGRSUZ_B00859                     722   0.0      
emb|CDX95558.1|  BnaC01g34500D                                          723   0.0      
ref|XP_006845279.1|  hypothetical protein AMTR_s00005p00266150          723   0.0      
ref|XP_007048474.1|  Beta-glucosidase 44                                725   0.0      
ref|XP_009113523.1|  PREDICTED: beta-glucosidase 44                     723   0.0      
ref|XP_010257514.1|  PREDICTED: beta-glucosidase 44-like isoform X2     723   0.0      
ref|XP_006376723.1|  hypothetical protein POPTR_0012s04670g             722   0.0      
gb|KDO63131.1|  hypothetical protein CISIN_1g036937mg                   716   0.0      
ref|XP_006482389.1|  PREDICTED: beta-glucosidase 44-like                717   0.0      
ref|XP_010257596.1|  PREDICTED: beta-glucosidase 44-like isoform X3     716   0.0      
ref|XP_010257433.1|  PREDICTED: beta-glucosidase 44-like isoform X1     717   0.0      
ref|XP_006430653.1|  hypothetical protein CICLE_v10013421mg             715   0.0      
ref|XP_006832849.1|  hypothetical protein AMTR_s00095p00053110          713   0.0      
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             712   0.0      
ref|XP_008811965.1|  PREDICTED: beta-glucosidase 1-like isoform X1      712   0.0      
gb|ABR17739.1|  unknown                                                 711   0.0      Picea sitchensis
ref|XP_006430655.1|  hypothetical protein CICLE_v10013521mg             712   0.0      
dbj|BAB02019.1|  beta-glucosidase                                       709   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482390.1|  PREDICTED: beta-glucosidase 44-like                709   0.0      
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                709   0.0      Vitis vinifera
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       706   0.0      
ref|NP_188435.2|  beta glucosidase 43                                   705   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010916341.1|  PREDICTED: beta-glucosidase 1-like                 704   0.0      
ref|XP_008811966.1|  PREDICTED: beta-glucosidase 1-like isoform X2      702   0.0      
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                702   0.0      
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                700   0.0      
ref|XP_007036680.1|  B-S glucosidase 44 isoform 2                       691   0.0      
ref|XP_004140826.1|  PREDICTED: beta-glucosidase 44-like                689   0.0      
ref|XP_004157213.1|  PREDICTED: beta-glucosidase 44-like                689   0.0      
gb|AEV76986.1|  beta-glucosidase 4                                      683   0.0      
ref|XP_008457084.1|  PREDICTED: beta-glucosidase 44-like                680   0.0      
ref|XP_006845277.1|  hypothetical protein AMTR_s00005p00265710          678   0.0      
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          676   0.0      
ref|XP_009394053.1|  PREDICTED: beta-glucosidase 26-like                674   0.0      
ref|XP_003562544.1|  PREDICTED: beta-glucosidase 26                     672   0.0      
ref|XP_008655551.1|  PREDICTED: beta-glucosidase 1-like                 674   0.0      
gb|KHN44611.1|  Beta-glucosidase 44                                     667   0.0      
gb|KDO62879.1|  hypothetical protein CISIN_1g010049mg                   665   0.0      
gb|AFW79802.1|  hypothetical protein ZEAMMB73_091278                    666   0.0      
gb|ACF07998.1|  beta-glucosidase                                        665   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|EMT08337.1|  Beta-glucosidase 44                                     663   0.0      
emb|CBI33559.3|  unnamed protein product                                661   0.0      
gb|AAA87339.1|  beta-glucosidase                                        663   0.0      Hordeum vulgare [barley]
ref|XP_008453769.1|  PREDICTED: beta-glucosidase 44-like                661   0.0      
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                660   0.0      
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                660   0.0      
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     657   0.0      
ref|XP_006658055.1|  PREDICTED: beta-glucosidase 26-like                659   0.0      
emb|CDM80087.1|  unnamed protein product                                655   0.0      
pdb|4JIE|A  Chain A, Structural Analysis And Insights Into Glycon...    653   0.0      
gb|ACF35791.1|  beta-mannosidase/beta-glucosidase                       652   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004958541.1|  PREDICTED: beta-glucosidase 26-like                653   0.0      
sp|A3BMZ5.1|BGL26_ORYSJ  RecName: Full=Beta-glucosidase 26; Short...    651   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             650   0.0      
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             649   0.0      
gb|EMS60983.1|  Beta-glucosidase 26                                     650   0.0      
gb|ACL52625.1|  unknown                                                 644   0.0      Zea mays [maize]
gb|KDO62881.1|  hypothetical protein CISIN_1g010049mg                   640   0.0      
ref|XP_006495386.1|  PREDICTED: beta-glucosidase 44-like                640   0.0      
gb|EMT23872.1|  Beta-glucosidase 44                                     644   0.0      
ref|XP_002461141.1|  hypothetical protein SORBIDRAFT_02g041550          643   0.0      Sorghum bicolor [broomcorn]
gb|EEC76023.1|  hypothetical protein OsI_13187                          644   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001051014.1|  Os03g0703100                                       644   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 643   0.0      
ref|NP_001148821.1|  LOC100282438 precursor                             640   0.0      Zea mays [maize]
ref|XP_002464026.1|  hypothetical protein SORBIDRAFT_01g010825          640   0.0      Sorghum bicolor [broomcorn]
gb|EEE54664.1|  hypothetical protein OsJ_01954                          632   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142124.1|  uncharacterized protein LOC100274288 precursor     635   0.0      Zea mays [maize]
ref|NP_001151026.1|  LOC100284659 precursor                             635   0.0      Zea mays [maize]
ref|XP_003559510.1|  PREDICTED: beta-glucosidase 8-like                 634   0.0      
ref|XP_002464027.1|  hypothetical protein SORBIDRAFT_01g010830          629   0.0      Sorghum bicolor [broomcorn]
ref|XP_008665263.1|  PREDICTED: beta-glucosidase 7-like                 629   0.0      
ref|XP_004982055.1|  PREDICTED: beta-glucosidase 7-like isoform X1      628   0.0      
ref|NP_001051013.1|  Os03g0703000                                       624   0.0      Oryza sativa Japonica Group [Japonica rice]
pdb|2RGL|A  Chain A, Rice Bglu1 Beta-Glucosidase, A Plant Exogluc...    624   0.0      
ref|XP_006651730.1|  PREDICTED: beta-glucosidase 7-like                 622   0.0      
ref|XP_004982054.1|  PREDICTED: beta-glucosidase 8-like                 625   0.0      
pdb|3F4V|A  Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Pl...    622   0.0      
gb|AAA84906.3|  beta-glucosidase                                        623   0.0      
ref|XP_004982056.1|  PREDICTED: beta-glucosidase 7-like isoform X2      622   0.0      
pdb|3SCR|A  Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant       621   0.0      
pdb|3SCP|A  Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant       621   0.0      
gb|AAX95520.1|  Putative Glycosyl hydrolase family 1 protein            625   0.0      Oryza sativa Japonica Group [Japonica rice]
pdb|3SCN|A  Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant       620   0.0      
pdb|3SCV|A  Chain A, Crystal Structure Of Rice Bglu1 E386gS334A M...    620   0.0      
pdb|3SCW|A  Chain A, Crystal Structure Of Rice Bglu1 E386gY341A M...    619   0.0      
ref|XP_003559508.1|  PREDICTED: beta-glucosidase 7-like                 617   0.0      
gb|ADP02192.1|  putative non-cyanogenic beta-glucosidase                616   0.0      
ref|XP_003559509.1|  PREDICTED: beta-glucosidase 7-like isoform X1      613   0.0      
dbj|BAJ90056.1|  predicted protein                                      611   0.0      
gb|EEC69164.1|  hypothetical protein OsI_38122                          604   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010237292.1|  PREDICTED: beta-glucosidase 38-like                602   0.0      
ref|XP_006664007.1|  PREDICTED: beta-glucosidase 38-like                602   0.0      
ref|NP_001066656.1|  Os12g0420100                                       599   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDM83785.1|  unnamed protein product                                597   0.0      
gb|KDO62882.1|  hypothetical protein CISIN_1g010049mg                   591   0.0      
ref|XP_006451661.1|  hypothetical protein CICLE_v10008010mg             588   0.0      
gb|ADP02193.1|  Glyco_hydro_1 domain-containing protein                 594   0.0      
ref|XP_008644990.1|  PREDICTED: beta-glucosidase 38-like                579   0.0      
ref|XP_004963948.1|  PREDICTED: beta-glucosidase 38-like                576   0.0      
gb|AFW69221.1|  hypothetical protein ZEAMMB73_365784                    576   0.0      
gb|KEH16708.1|  glycoside hydrolase family 1 protein                    572   0.0      
gb|KDO62884.1|  hypothetical protein CISIN_1g010049mg                   571   0.0      
gb|EMS48652.1|  Beta-glucosidase 7                                      570   0.0      
gb|EMS63424.1|  Beta-glucosidase 38                                     560   0.0      
gb|KCW83985.1|  hypothetical protein EUGRSUZ_B00859                     555   0.0      
gb|EMT31426.1|  Beta-glucosidase 1                                      556   0.0      
gb|EMS62097.1|  Beta-glucosidase 7                                      557   0.0      
gb|ACG44181.1|  non-cyanogenic beta-glucosidase precursor               553   0.0      Zea mays [maize]
ref|XP_002438912.1|  hypothetical protein SORBIDRAFT_10g028060          553   0.0      Sorghum bicolor [broomcorn]
gb|EMS62098.1|  Beta-glucosidase 8                                      553   0.0      
gb|ABF98424.1|  Glycosyl hydrolase family 1 protein, expressed          538   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT00720.1|  Beta-glucosidase 1                                      543   0.0      
ref|NP_001064347.1|  Os10g0323500                                       532   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC66726.1|  hypothetical protein OsI_33062                          531   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 527   4e-179   
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                526   6e-179   
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 525   1e-178   
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          525   1e-178   Sorghum bicolor [broomcorn]
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     525   2e-178   
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          524   3e-178   
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    525   4e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          523   4e-178   
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          524   4e-178   
gb|KDO50113.1|  hypothetical protein CISIN_1g0406882mg                  517   5e-178   
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                523   6e-178   
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     523   8e-178   
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     523   2e-177   
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             521   5e-177   
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     521   5e-177   
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 521   6e-177   
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    520   6e-177   
dbj|BAK07108.1|  predicted protein                                      519   8e-177   
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                521   1e-176   
ref|XP_003607794.1|  Beta-glucosidase                                   520   1e-176   
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         521   1e-176   
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      520   1e-176   
ref|NP_001049358.1|  Os03g0212800                                       521   1e-176   Oryza sativa Japonica Group [Japonica rice]
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    520   2e-176   
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    520   2e-176   
ref|XP_010109366.1|  Beta-glucosidase 40                                520   2e-176   
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                520   2e-176   
gb|EEC74750.1|  hypothetical protein OsI_10506                          520   2e-176   Oryza sativa Indica Group [Indian rice]
gb|EEE58575.1|  hypothetical protein OsJ_09895                          520   3e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                518   1e-175   
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    517   2e-175   
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             517   3e-175   
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     516   3e-175   
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     516   5e-175   
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     516   5e-175   
gb|KHN20526.1|  Beta-glucosidase 40                                     516   6e-175   
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      516   7e-175   
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           516   8e-175   
gb|KHG17589.1|  Beta-glucosidase 44 -like protein                       511   9e-175   
ref|NP_001268161.1|  beta-glucosidase precursor                         515   1e-174   
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             514   2e-174   
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           514   2e-174   Populus trichocarpa [western balsam poplar]
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                514   4e-174   
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 514   4e-174   
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                513   6e-174   
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           513   6e-174   
gb|AHC04401.1|  beta-glucosidase 1                                      513   7e-174   
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                514   9e-174   
gb|EMS46293.1|  Beta-glucosidase 34                                     513   1e-173   
ref|XP_002967460.1|  hypothetical protein SELMODRAFT_267120             513   1e-173   
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40-like isoform 2      512   2e-173   
emb|CBI27264.3|  unnamed protein product                                514   2e-173   
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    512   3e-173   
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             511   4e-173   
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             511   6e-173   
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             510   7e-173   
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     510   1e-172   
ref|XP_002960254.1|  hypothetical protein SELMODRAFT_163827             510   1e-172   
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                510   1e-172   
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             509   2e-172   
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    509   3e-172   
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                509   3e-172   
ref|XP_009631811.1|  PREDICTED: beta-glucosidase 40                     509   4e-172   
ref|NP_173978.1|  beta glucosidase 40                                   509   4e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     509   4e-172   
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             509   4e-172   
gb|AAM61600.1|  beta-glucosidase, putative                              508   4e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                509   4e-172   
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 508   6e-172   
ref|XP_002316096.2|  hydroxyisourate hydrolase family protein           508   9e-172   Populus trichocarpa [western balsam poplar]
dbj|BAO04176.1|  hypothetical protein                                   508   1e-171   
ref|XP_008390041.1|  PREDICTED: beta-glucosidase 40-like                506   1e-171   
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             507   2e-171   
ref|XP_009802933.1|  PREDICTED: beta-glucosidase 40-like                507   2e-171   
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     507   2e-171   
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      506   4e-171   
emb|CDX85027.1|  BnaC05g20280D                                          506   4e-171   
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                506   5e-171   
emb|CDY42461.1|  BnaA10g08370D                                          506   6e-171   
ref|XP_001771505.1|  predicted protein                                  507   7e-171   
gb|KDP20205.1|  hypothetical protein JCGZ_07925                         506   7e-171   
gb|EMT21383.1|  Beta-glucosidase 6                                      506   8e-171   
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 505   1e-170   
ref|XP_009119981.1|  PREDICTED: putative beta-glucosidase 41            506   1e-170   
gb|EAY86111.1|  hypothetical protein OsI_07481                          506   1e-170   
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                505   1e-170   
ref|XP_007133707.1|  hypothetical protein PHAVU_011G202000g             505   2e-170   
emb|CDY20561.1|  BnaC07g12280D                                          504   2e-170   
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    505   2e-170   
emb|CDY64930.1|  BnaCnng45520D                                          505   2e-170   
ref|XP_010521463.1|  PREDICTED: beta-glucosidase 40-like isoform X3     504   2e-170   
gb|AES96995.2|  beta-glucosidase                                        504   3e-170   
ref|XP_010482861.1|  PREDICTED: putative beta-glucosidase 41 isof...    505   3e-170   
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    504   4e-170   
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     504   4e-170   
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    504   5e-170   
ref|XP_007133703.1|  hypothetical protein PHAVU_011G201700g             504   6e-170   
ref|XP_008450458.1|  PREDICTED: beta-glucosidase 12-like                503   6e-170   
emb|CDY61627.1|  BnaA08g19770D                                          503   7e-170   
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                503   8e-170   
gb|KGN47642.1|  hypothetical protein Csa_6G366400                       502   8e-170   
gb|AES76414.2|  glycoside hydrolase family 1 protein                    503   8e-170   
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    502   1e-169   
ref|XP_002866052.1|  glycosyl hydrolase family 1 protein                503   2e-169   
ref|XP_008445464.1|  PREDICTED: beta-glucosidase 40                     501   3e-169   
ref|XP_002512138.1|  beta-glucosidase, putative                         501   3e-169   
ref|XP_004144181.1|  PREDICTED: beta-glucosidase 40-like                501   4e-169   
ref|NP_001078176.1|  beta glucosidase 43                                498   4e-169   
gb|KDP25142.1|  hypothetical protein JCGZ_22677                         501   5e-169   
ref|XP_007014882.1|  Beta-glucosidase 17                                501   6e-169   
ref|XP_002512097.1|  beta-glucosidase, putative                         500   7e-169   
ref|XP_006365136.1|  PREDICTED: beta-glucosidase 40-like                500   8e-169   
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          500   9e-169   
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         500   1e-168   
ref|XP_007207081.1|  hypothetical protein PRUPE_ppa024434mg             501   1e-168   
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                500   1e-168   
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                501   1e-168   
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    499   2e-168   
emb|CBI27265.3|  unnamed protein product                                500   2e-168   
gb|ACN41025.1|  unknown                                                 499   2e-168   
ref|XP_008241169.1|  PREDICTED: beta-glucosidase 12-like                499   4e-168   
ref|XP_004228406.1|  PREDICTED: beta-glucosidase 40                     498   7e-168   
ref|XP_003620203.1|  Beta-glucosidase D4                                498   8e-168   
ref|XP_001765414.1|  predicted protein                                  497   8e-168   
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         498   9e-168   
ref|XP_006475282.1|  PREDICTED: putative beta-glucosidase 41-like       498   1e-167   
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     498   1e-167   
ref|NP_200268.3|  beta glucosidase 41                                   498   1e-167   
ref|XP_003620196.1|  Beta-glucosidase D2                                498   1e-167   
ref|XP_002986009.1|  hypothetical protein SELMODRAFT_271823             497   1e-167   
ref|XP_007208264.1|  hypothetical protein PRUPE_ppa015887mg             497   2e-167   
ref|XP_009347257.1|  PREDICTED: beta-glucosidase 13-like                497   2e-167   
ref|XP_008245651.1|  PREDICTED: beta-glucosidase 12-like                497   2e-167   
ref|XP_004154675.1|  PREDICTED: beta-glucosidase 12-like                497   2e-167   
gb|EYU28848.1|  hypothetical protein MIMGU_mgv1a004935mg                496   2e-167   
ref|XP_010265850.1|  PREDICTED: beta-glucosidase 12-like                497   2e-167   
gb|KGN66450.1|  hypothetical protein Csa_1G611270                       496   3e-167   
ref|XP_006851185.1|  hypothetical protein AMTR_s00043p00189470          496   3e-167   
ref|XP_011095298.1|  PREDICTED: putative beta-glucosidase 41 isof...    497   3e-167   
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            496   3e-167   
gb|ABW76288.1|  beta-glucosidase G3                                     496   3e-167   
ref|XP_010443033.1|  PREDICTED: putative beta-glucosidase 41            497   4e-167   
ref|XP_007150405.1|  hypothetical protein PHAVU_005G150600g             496   4e-167   
ref|XP_006360112.1|  PREDICTED: putative beta-glucosidase 41-like       496   4e-167   
ref|XP_007221103.1|  hypothetical protein PRUPE_ppa017484mg             495   4e-167   
gb|KEH30278.1|  cyanogenic beta-glucosidase, putative                   496   5e-167   
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     496   5e-167   
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             495   5e-167   
emb|CDP05824.1|  unnamed protein product                                496   6e-167   
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                496   6e-167   
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                496   7e-167   
gb|AFK35893.1|  unknown                                                 496   7e-167   
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         498   1e-166   
ref|XP_003620192.1|  Beta-glucosidase                                   495   1e-166   
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             495   1e-166   
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      495   1e-166   
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     495   1e-166   
ref|XP_004244167.1|  PREDICTED: putative beta-glucosidase 41            494   2e-166   
ref|XP_002285582.1|  PREDICTED: beta-glucosidase 12-like                494   2e-166   
ref|XP_007219276.1|  hypothetical protein PRUPE_ppa018404mg             493   2e-166   
ref|XP_002437464.1|  hypothetical protein SORBIDRAFT_10g027600          494   3e-166   
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             491   3e-166   
ref|XP_010257423.1|  PREDICTED: beta-glucosidase 12-like                494   4e-166   
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                494   4e-166   
dbj|BAJ98823.1|  predicted protein                                      493   6e-166   
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             492   6e-166   
gb|EYU19188.1|  hypothetical protein MIMGU_mgv1a004736mg                493   6e-166   
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            493   7e-166   
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         493   1e-165   
gb|ABY48758.1|  glycosylhydrolase 1                                     492   1e-165   
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 493   1e-165   
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                492   1e-165   
gb|KEH30276.1|  cyanogenic beta-glucosidase, putative                   492   1e-165   
ref|XP_008229217.1|  PREDICTED: beta-glucosidase 12-like                492   1e-165   
emb|CBI20471.3|  unnamed protein product                                494   1e-165   
ref|XP_007208652.1|  hypothetical protein PRUPE_ppa020368mg             492   2e-165   
ref|XP_007206744.1|  hypothetical protein PRUPE_ppa025067mg             492   2e-165   
ref|XP_007206382.1|  hypothetical protein PRUPE_ppa017981mg             492   2e-165   
ref|XP_011027871.1|  PREDICTED: beta-glucosidase 24-like                491   2e-165   
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      491   4e-165   
gb|EYU28849.1|  hypothetical protein MIMGU_mgv1a004939mg                490   6e-165   
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  489   6e-165   
ref|XP_004507316.1|  PREDICTED: beta-glucosidase 12-like                490   7e-165   
ref|XP_004515054.1|  PREDICTED: beta-glucosidase 12-like isoform X2     491   7e-165   
emb|CDP00417.1|  unnamed protein product                                491   7e-165   
gb|ACD65509.2|  beta-glucosidase D4                                     490   7e-165   
ref|XP_010062938.1|  PREDICTED: putative beta-glucosidase 41            490   8e-165   
gb|KEH30766.1|  glycoside hydrolase family 1 protein                    490   9e-165   
gb|AES67732.2|  glycoside hydrolase family 1 protein                    490   1e-164   
ref|XP_009769966.1|  PREDICTED: putative beta-glucosidase 41            489   1e-164   
ref|XP_004515055.1|  PREDICTED: beta-glucosidase 12-like                490   1e-164   
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                490   1e-164   
ref|XP_004297253.1|  PREDICTED: beta-glucosidase 40-like isoform 1      493   1e-164   
ref|XP_007220127.1|  hypothetical protein PRUPE_ppa020817mg             488   3e-164   
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    488   4e-164   
ref|XP_002285585.2|  PREDICTED: beta-glucosidase 12                     488   4e-164   
ref|XP_010265852.1|  PREDICTED: beta-glucosidase 12-like                488   5e-164   
ref|XP_007220362.1|  hypothetical protein PRUPE_ppa015970mg             488   5e-164   
ref|XP_009615935.1|  PREDICTED: putative beta-glucosidase 41            488   5e-164   
ref|XP_004295227.1|  PREDICTED: beta-glucosidase 13-like                488   6e-164   
sp|Q7XKV5.2|BGL11_ORYSJ  RecName: Full=Beta-glucosidase 11; Short...    489   7e-164   
pdb|3PTK|A  Chain A, The Crystal Structure Of Rice (Oryza Sativa ...    487   1e-163   
ref|XP_006652406.1|  PREDICTED: beta-glucosidase 13-like                487   1e-163   
ref|XP_007220683.1|  hypothetical protein PRUPE_ppa020067mg             487   1e-163   
ref|XP_006858818.1|  hypothetical protein AMTR_s00066p00171930          488   1e-163   
gb|ACD65510.1|  beta-glucosidase D2                                     487   1e-163   
emb|CAH66812.1|  OSIGBa0135C13.7                                        487   2e-163   
ref|XP_002964840.1|  hypothetical protein SELMODRAFT_83357              488   2e-163   
gb|AAF04007.1|AF163097_1  dalcochinin 8'-O-beta-glucoside beta-gl...    488   2e-163   
ref|XP_008450457.1|  PREDICTED: cyanogenic beta-glucosidase-like        487   2e-163   
emb|CAH66811.1|  OSIGBa0135C13.6                                        488   2e-163   
ref|XP_010044986.1|  PREDICTED: beta-glucosidase 13-like                487   2e-163   
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     486   3e-163   
ref|XP_011025248.1|  PREDICTED: beta-glucosidase 12-like                486   3e-163   
ref|XP_002960920.1|  hypothetical protein SELMODRAFT_163822             486   3e-163   
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     486   3e-163   
ref|XP_007208473.1|  hypothetical protein PRUPE_ppa004108mg             487   3e-163   
ref|XP_002961770.1|  hypothetical protein SELMODRAFT_76748              487   3e-163   
ref|XP_003597481.1|  Beta-glucosidase D4                                486   4e-163   
ref|XP_008228992.1|  PREDICTED: beta-glucosidase 12-like                486   4e-163   
ref|XP_009357133.1|  PREDICTED: beta-glucosidase 12-like                486   4e-163   
ref|XP_002981889.1|  hypothetical protein SELMODRAFT_268527             486   5e-163   
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    486   5e-163   
ref|XP_002276051.2|  PREDICTED: beta-glucosidase 12-like                485   8e-163   
ref|XP_009364758.1|  PREDICTED: beta-glucosidase 13-like                485   8e-163   
gb|AEB61486.1|  beta-glucosidase                                        484   1e-162   
emb|CBI24820.3|  unnamed protein product                                485   1e-162   
sp|Q7XKV4.2|BGL12_ORYSJ  RecName: Full=Beta-glucosidase 12; Short...    484   1e-162   
ref|XP_010267073.1|  PREDICTED: beta-glucosidase 12-like isoform X1     485   2e-162   
ref|XP_004505421.1|  PREDICTED: putative beta-glucosidase 41-like       484   2e-162   
ref|XP_004151252.1|  PREDICTED: beta-glucosidase 24-like                484   2e-162   
ref|XP_009343017.1|  PREDICTED: beta-glucosidase 12-like                484   2e-162   
gb|AAV34606.1|  beta-glycosidase                                        484   4e-162   
ref|XP_010038524.1|  PREDICTED: beta-glucosidase 42                     483   4e-162   
ref|XP_007207988.1|  hypothetical protein PRUPE_ppa015161mg             484   4e-162   
ref|XP_009355663.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    484   4e-162   
ref|XP_008243589.1|  PREDICTED: beta-glucosidase 13-like                483   6e-162   
ref|XP_009364765.1|  PREDICTED: beta-glucosidase 13-like                483   6e-162   
ref|XP_002967091.1|  hypothetical protein SELMODRAFT_169039             483   6e-162   
dbj|BAG13451.1|  beta-glucosidase                                       484   7e-162   
ref|XP_004507318.1|  PREDICTED: non-cyanogenic beta-glucosidase-like    483   7e-162   
ref|XP_007133712.1|  hypothetical protein PHAVU_011G202500g             483   7e-162   
ref|XP_010539263.1|  PREDICTED: putative beta-glucosidase 41 isof...    483   8e-162   
gb|KHG13868.1|  Putative beta-glucosidase 41 -like protein              483   9e-162   
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41-like...    483   9e-162   
ref|XP_008350605.1|  PREDICTED: beta-glucosidase 12-like                483   9e-162   
ref|XP_007014814.1|  Beta-glucosidase 17 isoform 2                      482   1e-161   
ref|XP_008218659.1|  PREDICTED: beta-glucosidase 12-like                484   1e-161   
ref|XP_007207911.1|  hypothetical protein PRUPE_ppa019573mg             482   1e-161   
ref|XP_008347516.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    482   1e-161   
ref|XP_011075589.1|  PREDICTED: beta-glucosidase 6                      482   2e-161   
sp|A3RF67.1|BAGBG_DALNI  RecName: Full=Isoflavonoid 7-O-beta-apio...    483   2e-161   
ref|XP_010265851.1|  PREDICTED: beta-glucosidase 12-like                481   2e-161   
ref|XP_008384453.1|  PREDICTED: beta-glucosidase 12-like                481   3e-161   
ref|XP_001753376.1|  predicted protein                                  481   3e-161   
ref|XP_007203718.1|  hypothetical protein PRUPE_ppa019137mg             480   3e-161   
ref|XP_002277198.1|  PREDICTED: beta-glucosidase 12-like                481   4e-161   
ref|XP_006370585.1|  linamarase family protein                          481   4e-161   
ref|XP_003597509.1|  Beta-glucosidase D2                                481   4e-161   
ref|XP_007200290.1|  hypothetical protein PRUPE_ppa004226mg             481   4e-161   
ref|XP_008454582.1|  PREDICTED: beta-glucosidase 25 isoform X1          481   4e-161   
gb|ACD65511.1|  beta-glucosidase D7                                     481   5e-161   
gb|AFZ78537.1|  beta-glucosidase                                        481   5e-161   
gb|AEB61485.1|  beta-glucosidase                                        481   6e-161   
ref|XP_009355662.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    481   6e-161   
ref|XP_009353726.1|  PREDICTED: beta-glucosidase 13-like                481   7e-161   
ref|XP_004975939.1|  PREDICTED: beta-glucosidase 12-like                480   8e-161   
ref|XP_007133036.1|  hypothetical protein PHAVU_011G145900g             480   8e-161   
gb|AAL07489.1|AF414606_1  amygdalin hydrolase isoform AH I precursor    481   9e-161   
ref|XP_008358873.1|  PREDICTED: beta-glucosidase 13-like                480   1e-160   
ref|XP_002966845.1|  hypothetical protein SELMODRAFT_144295             479   1e-160   
ref|XP_004154617.1|  PREDICTED: beta-glucosidase 24-like                480   1e-160   
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    480   1e-160   
ref|XP_008226929.1|  PREDICTED: beta-glucosidase 12-like isoform X2     481   1e-160   
ref|XP_007203079.1|  hypothetical protein PRUPE_ppa023565mg             479   1e-160   
gb|AAA93234.2|  amygdalin hydrolase isoform AH I precursor              481   2e-160   
ref|XP_004507317.1|  PREDICTED: beta-glucosidase 24-like                479   2e-160   
ref|XP_010943597.1|  PREDICTED: beta-glucosidase 12-like                479   2e-160   
ref|XP_008218497.1|  PREDICTED: beta-glucosidase 42                     478   2e-160   
ref|XP_008245635.1|  PREDICTED: beta-glucosidase 12-like isoform X2     480   2e-160   
ref|XP_008372964.1|  PREDICTED: beta-glucosidase 12-like                479   2e-160   
ref|NP_001053071.1|  Os04g0474900                                       479   2e-160   
ref|XP_002277408.1|  PREDICTED: beta-glucosidase 12                     479   2e-160   
ref|XP_004514568.1|  PREDICTED: beta-glucosidase 42-like                478   3e-160   
gb|KHN28382.1|  Putative beta-glucosidase 41                            478   3e-160   
dbj|BAJ93012.1|  predicted protein                                      478   4e-160   
ref|XP_002962270.1|  hypothetical protein SELMODRAFT_76384              478   4e-160   
ref|XP_002994357.1|  hypothetical protein SELMODRAFT_163405             478   4e-160   
ref|XP_003599468.1|  Beta-glucosidase G4                                478   5e-160   
ref|XP_010659318.1|  PREDICTED: beta-glucosidase 13-like                478   5e-160   
ref|XP_008441735.1|  PREDICTED: beta-glucosidase 42 isoform X1          478   5e-160   
ref|XP_002960251.1|  hypothetical protein SELMODRAFT_75234              477   5e-160   
ref|XP_008226920.1|  PREDICTED: beta-glucosidase 12-like isoform X1     479   6e-160   
emb|CBI24818.3|  unnamed protein product                                479   6e-160   
ref|XP_003537944.1|  PREDICTED: beta-glucosidase 12-like isoform 1      478   7e-160   
ref|XP_002273684.2|  PREDICTED: furcatin hydrolase                      478   7e-160   



>ref|XP_009757932.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=515

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/488 (80%), Positives = 438/488 (90%), Gaps = 6/488 (1%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             D+SPE++ F+TGGLSRESFP GF+FGTA+SAYQVEGA      GRGPSIWDTF+K PG+E
Sbjct  30    DISPEKLSFDTGGLSRESFPKGFIFGTATSAYQVEGAASTD--GRGPSIWDTFIKRPGVE  87

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
             PNNA GEVAVDQYHRYK DIDL+  LNF+AYRFSISW+RIFPNGTGKVNWKGVAYYNRLI
Sbjct  88    PNNANGEVAVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLI  147

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +YMLE+GITPYANLNHYDLPQAL+DRY GWL R+VV+DYADYAEFCFK FGDRVKNWFSF
Sbjct  148   DYMLERGITPYANLNHYDLPQALQDRYNGWLSREVVKDYADYAEFCFKTFGDRVKNWFSF  207

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEPRVVAALGYDTGFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AAQRYR  YQ
Sbjct  208   NEPRVVAALGYDTGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHATAAQRYREKYQ  267

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
              KQKG+FGILLDFVWYEPLTR KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG R
Sbjct  268   EKQKGKFGILLDFVWYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGKR  327

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+FT +EVK+VKGSID +GINQYT +Y+YDP+  TP    YQ DWNVGFAY R GVPIG
Sbjct  328   LPKFTKEEVKMVKGSIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIG  387

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
             PRA+S+WLY+VPWGL+KAV YVKERYGNP M L+ENGMDY GN+TL ++L DTKRI+YYK
Sbjct  388   PRAHSDWLYIVPWGLHKAVNYVKERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYK  447

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
             SYL ELK+ VD+GAN+ GYFAWSL+DNFEWR+GYTSRFGIVYVDF+TLKRYPK+SA WF+
Sbjct  448   SYLKELKKTVDEGANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDFNTLKRYPKLSALWFK  507

Query  108   NFLRRNKH  85
               LRR+KH
Sbjct  508   KLLRRHKH  515



>ref|XP_009600118.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=515

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/488 (80%), Positives = 437/488 (90%), Gaps = 6/488 (1%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             DV PE++ F+TGGLSRESFP GF+FGTA+SAYQVEGA      GRGPSIWDTF+K PG+E
Sbjct  30    DVLPEKLSFDTGGLSRESFPKGFIFGTATSAYQVEGAASTE--GRGPSIWDTFIKRPGVE  87

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
             PNNA GEVAVDQYHRYK DIDL+  LNF+AYRFSISW+RIFPNGTGKVNWKGVAYYNRLI
Sbjct  88    PNNANGEVAVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLI  147

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +YMLE+GITPYANLNHYDLPQAL+DRY GWL R+VV+DYADYAEFCFK FGDRVKNWFSF
Sbjct  148   DYMLERGITPYANLNHYDLPQALQDRYNGWLSREVVKDYADYAEFCFKTFGDRVKNWFSF  207

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEPRVVAALGYDTGFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AA+RYR  YQ
Sbjct  208   NEPRVVAALGYDTGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHASAAKRYREKYQ  267

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
              KQKG+FGILLDFVWYEPLTR KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNI+G R
Sbjct  268   EKQKGKFGILLDFVWYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNILGKR  327

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+FT +EVK+VKGSID +GINQYT +Y+YDP+  TP    YQ DWNVGFAY R GVPIG
Sbjct  328   LPKFTKEEVKMVKGSIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIG  387

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
             PRA+S+WLY+VPWGL+KAV YVKERYGNP M L+ENGMDY GN+TL ++L DTKRI+YYK
Sbjct  388   PRAHSDWLYIVPWGLHKAVNYVKERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYK  447

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
             SYL ELK+ VD+GAN+ GYFAWSL+DNFEWR+GYTSRFGIVYVDF+TLKRYPK+SA WF+
Sbjct  448   SYLQELKKTVDEGANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDFNTLKRYPKLSALWFK  507

Query  108   NFLRRNKH  85
               LRR+KH
Sbjct  508   KLLRRHKH  515



>ref|XP_006341563.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=512

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/488 (80%), Positives = 435/488 (89%), Gaps = 6/488 (1%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             DVSPE    +TGGLSRESFP GF+FGTA+SAYQVEG+      GRGPSIWDTFLK PGLE
Sbjct  27    DVSPENTILDTGGLSRESFPKGFIFGTATSAYQVEGSASTE--GRGPSIWDTFLKIPGLE  84

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
             PNNA GE+AVDQYHRYK DIDLM KLNF+AYRFSISW+RIFPNGTG+VNWKGVAYYNRLI
Sbjct  85    PNNANGEIAVDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGEVNWKGVAYYNRLI  144

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +YML++GITPYANLNHYDLPQAL+DRY GWLGR+VV+D+ADYAEFCFK FGDRVKNWFSF
Sbjct  145   DYMLKRGITPYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFSF  204

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEPRVVAALGYD GFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AAQRYR  YQ
Sbjct  205   NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHASAAQRYREKYQ  264

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
              KQKG+FGILLDFVWYEPLT+ KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG R
Sbjct  265   EKQKGKFGILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTR  324

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+F+ +EVK+VKGS DYVGINQYT++Y+YDP+  TP    YQ DWNVGFAY R GVPIG
Sbjct  325   LPKFSKEEVKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIG  384

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
             PRA+S WLY+VPWGLYKAV YVKE YGNP + L+ENGMDY GN+TL ++L+DTKRI YYK
Sbjct  385   PRAHSYWLYIVPWGLYKAVNYVKEHYGNPTIILAENGMDYAGNITLPKALHDTKRIDYYK  444

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
             SYL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF+TLKRYPKMSAYWF+
Sbjct  445   SYLQQLKKTVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFNTLKRYPKMSAYWFK  504

Query  108   NFLRRNKH  85
               L+R KH
Sbjct  505   KLLKRQKH  512



>ref|NP_001234620.1| beta-mannosidase enzyme precursor [Solanum lycopersicum]
 gb|AAL37714.1|AF403444_1 beta-mannosidase enzyme [Solanum lycopersicum]
 gb|AAL37719.1|AF413204_1 beta-mannosidase [Solanum lycopersicum]
Length=514

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/487 (80%), Positives = 434/487 (89%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             VSPE    +TGGLSRESFP GF FGTA+SAYQVEG+      GRGPSIWDTFLK PGLEP
Sbjct  30    VSPENTILDTGGLSRESFPKGFTFGTATSAYQVEGSASTE--GRGPSIWDTFLKIPGLEP  87

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNA GE+AVDQYHRYK DIDLM KLNF+AYRFSISW+RIFPNGTGKVNWKGVAYYNRLI+
Sbjct  88    NNANGEIAVDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLID  147

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             YML++GITPYANLNHYDLPQAL+DRY GWLGR+VV+D+ADYAEFCFK FGDRVKNWFSFN
Sbjct  148   YMLKRGITPYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFSFN  207

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT+G+SATEPY+VAHNLILCHA AAQRYR  YQ 
Sbjct  208   EPRVVAALGYDNGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLILCHASAAQRYREKYQE  267

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKG+FGILLDFVWYEPLT+ KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG RL
Sbjct  268   KQKGKFGILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRL  327

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+F+ +EVK+VKGS DYVGINQYT++Y+YDP+  TP    YQ DWNVGFAY R GVPIGP
Sbjct  328   PKFSKEEVKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGP  387

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+S WLY+VPWGLYKA+ YVKE YGNP + L+ENGMDY GN+TL ++L+DTKRI+YYKS
Sbjct  388   RAHSYWLYIVPWGLYKAINYVKEHYGNPTIILAENGMDYAGNITLPKALHDTKRINYYKS  447

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF+TL+RYPKMSAYWF+ 
Sbjct  448   YLQQLKKTVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFNTLRRYPKMSAYWFKK  507

Query  105   FLRRNKH  85
              L+R KH
Sbjct  508   LLKRQKH  514



>ref|XP_003534146.1| PREDICTED: beta-glucosidase 44 [Glycine max]
Length=506

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/487 (77%), Positives = 422/487 (87%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               P+ VRF+TGGLSR++FP GF+FGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  22    AEPQTVRFDTGGLSRDTFPKGFLFGTATSAYQVEGM--AHKDGRGPSIWDVFIKKPGIVA  79

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLIN
Sbjct  80    NNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLIN  139

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+LEKGITPYANL HYDLP ALE+RY G L RQVV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  140   YLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFN  199

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYRA YQ 
Sbjct  200   EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYRAKYQE  259

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RL
Sbjct  260   KQKGRIGILLDFVWYEPLTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRL  319

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  320   PKFTSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  379

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS WLY VPWG+YK++ Y+KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  380   RANSYWLYNVPWGMYKSLMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  439

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+ 
Sbjct  440   YLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQ  499

Query  105   FLRRNKH  85
              + + K+
Sbjct  500   LITKKKY  506



>gb|KDP41124.1| hypothetical protein JCGZ_03615 [Jatropha curcas]
Length=516

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/486 (77%), Positives = 423/486 (87%), Gaps = 6/486 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
              PE+++F+TGGLSR+SFPAGF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  N
Sbjct  33    QPEKIKFDTGGLSRQSFPAGFLFGTATSAYQVEGMAD--KDGRGPSIWDEFVKIPGIVAN  90

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRLI+Y
Sbjct  91    NATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIDY  150

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ML+KGITPYANL HYDLP ALE +Y G LGRQVV+D+ADYA+FCFK FGDRVKNW +FNE
Sbjct  151   MLKKGITPYANLYHYDLPLALEKKYKGLLGRQVVKDFADYADFCFKTFGDRVKNWMTFNE  210

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G+FAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  YQ K
Sbjct  211   PRVVAALGYDNGYFAPGRCSKAFGNCTAGNSATEPYIVAHNLILSHAAAVQRYREKYQEK  270

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP
Sbjct  271   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLP  330

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR  463
             +FT +E+K+VKGSIDYVGINQYTT+Y+YDP+   P    YQ DWN GFAY +NGV IGPR
Sbjct  331   KFTQEEIKIVKGSIDYVGINQYTTYYMYDPHQSKPKDLGYQQDWNAGFAYEKNGVQIGPR  390

Query  462   ANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSY  283
             ANS WLY VPWGLYKA+ Y+KERYGNP +FLSENGMD  GN+TL + L+DT RI+YY+SY
Sbjct  391   ANSYWLYNVPWGLYKALIYIKERYGNPTVFLSENGMDDPGNVTLPKGLHDTTRINYYRSY  450

Query  282   LAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNF  103
             L +LK+ VDDGAN+ GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMSAYWF+  
Sbjct  451   LTQLKKAVDDGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQL  510

Query  102   LRRNKH  85
             + R KH
Sbjct  511   MERKKH  516



>gb|EYU40222.1| hypothetical protein MIMGU_mgv1a004735mg [Erythranthe guttata]
Length=512

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/499 (76%), Positives = 422/499 (85%), Gaps = 12/499 (2%)
 Frame = -3

Query  1551  SIVQC-----DVSPER-VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSI  1390
             S+ QC     D SPE  V  + GGLSR +FP  FVFGTA+SAYQVEG     K GRGPSI
Sbjct  16    SLSQCFTHEDDASPETAVGLDLGGLSRRTFPKNFVFGTAASAYQVEGMAS--KDGRGPSI  73

Query  1389  WDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVN  1210
             WDTF+KTPGLEPNNA+GEV+VDQYH+YK D+DLM KLNFDAYRFSISW+RIFPNGTGKVN
Sbjct  74    WDTFIKTPGLEPNNASGEVSVDQYHKYKDDLDLMAKLNFDAYRFSISWSRIFPNGTGKVN  133

Query  1209  WKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKI  1030
              KGVAYYNRLINYML+KGITPY NLNHYDLPQAL+DRY GWLGR+VV+D+ADYAEFCFK 
Sbjct  134   KKGVAYYNRLINYMLKKGITPYPNLNHYDLPQALQDRYKGWLGREVVKDFADYAEFCFKT  193

Query  1029  FGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHA  862
             FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT+G+S+TEPY VAHNLIL HA
Sbjct  194   FGDRVKNWQTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTEGDSSTEPYTVAHNLILSHA  253

Query  861   VAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEY  682
              AAQRYR  YQ KQKGR GILLDFVWYEPLT+SKADNYAAQRARDFHIGWF+HP+VYGEY
Sbjct  254   AAAQRYRQKYQKKQKGRIGILLDFVWYEPLTKSKADNYAAQRARDFHIGWFMHPLVYGEY  313

Query  681   PKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVG  502
             PKTMQNIVG RLP+FT DEVK+VKGS D+VGINQYT +Y+YD   + P    YQ DWN G
Sbjct  314   PKTMQNIVGKRLPKFTKDEVKMVKGSFDFVGINQYTAYYIYDAKQENPKNLGYQQDWNSG  373

Query  501   FAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAES  322
             FAY R+GVPIGPRA+S WLY+VPWGLYKAV Y+KE YGNP M L+ENGMD  G LTL   
Sbjct  374   FAYDRHGVPIGPRAHSYWLYIVPWGLYKAVNYIKEHYGNPTMILAENGMDQPGELTLPAV  433

Query  321   LNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLK  142
             LNDT RI+YYKSYL ELK+ +D+GAN+ GYF W+ +DNFEWR+GYTSRFGIVYVDF TLK
Sbjct  434   LNDTIRINYYKSYLVELKKAIDEGANVEGYFQWTFVDNFEWRLGYTSRFGIVYVDFKTLK  493

Query  141   RYPKMSAYWFQNFLRRNKH  85
             RYPK SAYWFQ   +RNKH
Sbjct  494   RYPKFSAYWFQKLQQRNKH  512



>ref|XP_009624185.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=513

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/494 (75%), Positives = 426/494 (86%), Gaps = 7/494 (1%)
 Frame = -3

Query  1551  SIVQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFL  1375
             +++Q D V PE   F+TGGLSR+SFP GFVFGT++SAYQVEGA    K GRGPS+WD F+
Sbjct  22    NLIQSDNVLPETAVFDTGGLSRDSFPKGFVFGTSTSAYQVEGAAS--KDGRGPSVWDIFI  79

Query  1374  KTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVA  1195
             K PG EPNNA+GEV+ DQYHRYK DIDLMVKLNFDAYRFSISW+RIFPNGTGK+NWKGVA
Sbjct  80    KKPGREPNNASGEVSADQYHRYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVA  139

Query  1194  YYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRV  1015
             YYN+LI+Y L+KGITPY NLNHYDLPQAL+D Y GWL  +VV+D+ADYAEFCFK +GDRV
Sbjct  140   YYNKLIDYTLKKGITPYVNLNHYDLPQALQDNYKGWLSHEVVKDFADYAEFCFKTYGDRV  199

Query  1014  KNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQR  847
             KNWFSFNEPRVVA LGY+TG+FAPGRCS    NCT G+SATEPY+VAHNLIL HA AAQR
Sbjct  200   KNWFSFNEPRVVADLGYNTGYFAPGRCSKAFGNCTSGDSATEPYIVAHNLILSHAAAAQR  259

Query  846   YRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQ  667
             YR  YQ KQKG+FGI+LDFVW+EPLT+SKADNYAAQRARDF +GWFLHP++YGEYPKTMQ
Sbjct  260   YRDKYQEKQKGKFGIILDFVWFEPLTKSKADNYAAQRARDFELGWFLHPLIYGEYPKTMQ  319

Query  666   NIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYAR  487
             NIVG+RLP+FT +E+K+VKGSIDYVGIN YTTFY YD +   P    Y+ DWN  FAY R
Sbjct  320   NIVGNRLPKFTKEEIKMVKGSIDYVGINHYTTFYAYDRHLSKPKALGYRQDWNCAFAYDR  379

Query  486   NGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTK  307
              G PIGPRA+S+WLY+VPWGLYKAV YVKE YGNP + LSENGMDY GN++L E+L+DTK
Sbjct  380   KGAPIGPRAHSDWLYIVPWGLYKAVNYVKEHYGNPTIVLSENGMDYAGNISLPEALHDTK  439

Query  306   RISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKM  127
             RI YY+SYLAELK+ +D GAN+ GYFAWSLLDNFEWR GYTSRFGI+YVD+ TL+RYPKM
Sbjct  440   RIDYYRSYLAELKKAIDKGANVIGYFAWSLLDNFEWRRGYTSRFGIIYVDYRTLERYPKM  499

Query  126   SAYWFQNFLRRNKH  85
             SAYWF+  L+R+ H
Sbjct  500   SAYWFKQLLQRHMH  513



>gb|ACU24532.1| unknown [Glycine max]
Length=506

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/487 (76%), Positives = 420/487 (86%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               P+ VRF+TGGLSR++FP GF+FGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  22    AEPQTVRFDTGGLSRDTFPKGFLFGTATSAYQVEGM--AHKDGRGPSIWDVFIKKPGIVA  79

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLIN
Sbjct  80    NNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLIN  139

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+LEKGITPYANL HYDLP ALE+RY G L RQVV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  140   YLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFN  199

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYRA YQ 
Sbjct  200   EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYRAKYQE  259

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEP TRSKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RL
Sbjct  260   KQKGRIGILLDFVWYEPPTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRL  319

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  320   PKFTSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  379

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS WLY V WG+YK++ Y+KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  380   RANSYWLYNVLWGMYKSLMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  439

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+ 
Sbjct  440   YLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQ  499

Query  105   FLRRNKH  85
              + + K+
Sbjct  500   LITKKKY  506



>ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max]
Length=515

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/499 (75%), Positives = 423/499 (85%), Gaps = 12/499 (2%)
 Frame = -3

Query  1551  SIVQCDV------SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSI  1390
             S+++C         PE VRF+TGGLSRE+FP GF+FGTA+SAYQVEG    HK GRGPSI
Sbjct  19    SVIRCAAGADAAAEPETVRFDTGGLSRETFPKGFLFGTATSAYQVEGM--AHKDGRGPSI  76

Query  1389  WDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVN  1210
             WD F+K PG+  NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG+VN
Sbjct  77    WDLFIKKPGIVANNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVN  136

Query  1209  WKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKI  1030
             WKGVAYYNRLINY+LEKGITPYANL HYDLP ALE+RY G L RQVV D+ADYAEFCFK 
Sbjct  137   WKGVAYYNRLINYLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVNDFADYAEFCFKT  196

Query  1029  FGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHA  862
             FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA
Sbjct  197   FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHA  256

Query  861   VAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEY  682
              A QRYR  YQ KQKGR GILLDFVWYEPLTRSKADN AAQRARDFH+GWF+HP+VYGEY
Sbjct  257   AAVQRYREKYQEKQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPLVYGEY  316

Query  681   PKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVG  502
             P T+QNIVG+RLP+FT +EVK+VKGSID+VGINQYTT+Y+YDP+   P +  YQ DWN G
Sbjct  317   PTTIQNIVGNRLPKFTSEEVKIVKGSIDFVGINQYTTYYMYDPHQAKPKVPGYQMDWNAG  376

Query  501   FAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAES  322
             FAYA+NGVPIGPRA S WLY VPWG+YK++ Y+KERYGNP +FLSENGMD  GN+TL + 
Sbjct  377   FAYAKNGVPIGPRAYSYWLYNVPWGMYKSLMYIKERYGNPTVFLSENGMDDPGNVTLPKG  436

Query  321   LNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLK  142
             L+DT RI+YYK YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLK
Sbjct  437   LHDTTRINYYKGYLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLK  496

Query  141   RYPKMSAYWFQNFLRRNKH  85
             RYPKMSAYWF+  + + K+
Sbjct  497   RYPKMSAYWFKQLIAKKKY  515



>ref|XP_006490742.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=519

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/487 (76%), Positives = 419/487 (86%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKEGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKKPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS WLY VPWG+YKA+ Y+KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  393   RANSYWLYNVPWGMYKALMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  452

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+ 
Sbjct  453   YLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTTLKRYPKMSAYWFKQ  512

Query  105   FLRRNKH  85
              L+RNKH
Sbjct  513   LLKRNKH  519



>ref|XP_011084444.1| PREDICTED: beta-glucosidase 44-like [Sesamum indicum]
Length=502

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/491 (77%), Positives = 415/491 (85%), Gaps = 9/491 (2%)
 Frame = -3

Query  1545  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
              QCD   E    + GGLSR SFP  FVFGTA+SAYQVEG     K GRGPSIWDTF+K P
Sbjct  17    AQCD---EAESVDLGGLSRRSFPKDFVFGTAASAYQVEGMAS--KGGRGPSIWDTFIKQP  71

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
             G EPNNA+GEV+VDQYH+YK DIDLM KLNFDAYRFSISW RIFPNGTGKVN KGVAYYN
Sbjct  72    GREPNNASGEVSVDQYHKYKEDIDLMAKLNFDAYRFSISWPRIFPNGTGKVNKKGVAYYN  131

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
             RLINYML+KGITPY NLNHYDLPQAL+DRY GWLGRQVVED+ADYAEFCFK FGDRVKNW
Sbjct  132   RLINYMLKKGITPYPNLNHYDLPQALQDRYNGWLGRQVVEDFADYAEFCFKTFGDRVKNW  191

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  838
              +FNEPRVVAALGYD GFFAPGRCS    NCT+GNSATEPY+VAHNLILCHA A QRYR 
Sbjct  192   QTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTEGNSATEPYIVAHNLILCHAAAVQRYRE  251

Query  837   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  658
              YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIV
Sbjct  252   KYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFMHPLVYGEYPKTMQNIV  311

Query  657   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  478
             G RLP+FT +EVK+VKGS D+VGINQYT +Y+YD          YQ DW  GFAY R+GV
Sbjct  312   GKRLPKFTKEEVKMVKGSFDFVGINQYTAYYMYDAKQTNSKDLGYQQDWQCGFAYDRHGV  371

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRA+S WLY+VPWGLYKAV Y+KERYGNP M L+ENGMD  GNLT+ + L+DT RI+
Sbjct  372   PIGPRAHSYWLYIVPWGLYKAVNYIKERYGNPTMILAENGMDQPGNLTIPKVLHDTVRIN  431

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YYKSYL ELK+ + DGAN+ GYF W+ +DNFEWR+GYTSRFGIVYVDF TLKRYPKMSAY
Sbjct  432   YYKSYLVELKKAIKDGANVVGYFQWTFVDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAY  491

Query  117   WFQNFLRRNKH  85
             WF+   +R+KH
Sbjct  492   WFKRLQQRDKH  502



>ref|XP_004252272.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Solanum lycopersicum]
Length=526

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/492 (76%), Positives = 422/492 (86%), Gaps = 7/492 (1%)
 Frame = -3

Query  1548  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             I   +V  E   F+TGGL+RESFP GFVFGT++SAYQVEGA    K GRGPS+WDTF+K 
Sbjct  38    IESDNVLAETTVFDTGGLNRESFPKGFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFIKQ  95

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG EPNNA+GEV+ DQYH YK DIDLMVKLNFDAYRFSISW+RIFPNGT K+NWKGV YY
Sbjct  96    PGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPNGTEKINWKGVTYY  155

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             N+LINYML +GITPY NLNHYDLPQAL++RY GWL R+VV+D+ADYAEFCFK +GDRVKN
Sbjct  156   NKLINYMLFRGITPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKN  215

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  841
             WFSFNEPRVVA LGYDTGFFAPGRCS    NCT G+SATEPY+VAHNLIL HA AA RYR
Sbjct  216   WFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILSHAAAAHRYR  275

Query  840   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  661
               YQ KQKG+FGI+LDFVWYEPLTRSKADNYAAQRARDF +GWFLHP+V+GEYPKTMQNI
Sbjct  276   KNYQEKQKGKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNI  335

Query  660   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG  481
             VG+RLP+FT +E+K+VKGSIDYVGIN YTTFY YD   K   +  YQ D N GFA  RNG
Sbjct  336   VGNRLPKFTTEEIKMVKGSIDYVGINHYTTFYAYDHVSKLKAL-AYQQDQNCGFANDRNG  394

Query  480   VPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRI  301
             VPIGPRA+S WLY+VPWGLYKAV YVKE YGNP + LSENGMDY GN++++E+L+DTKRI
Sbjct  395   VPIGPRAHSYWLYIVPWGLYKAVNYVKEHYGNPTILLSENGMDYAGNISISEALHDTKRI  454

Query  300   SYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSA  121
              YY+SYLAELK+ +D+GAN+ GYFAWSLLDNFEWR GYTSRFGIVYVD+ TL+RYPKMSA
Sbjct  455   DYYRSYLAELKKAIDEGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTTLERYPKMSA  514

Query  120   YWFQNFLRRNKH  85
             YWF   L+ +KH
Sbjct  515   YWFNQLLKSHKH  526



>ref|XP_007152698.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
 gb|ESW24692.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
Length=540

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/487 (77%), Positives = 415/487 (85%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             + PE VRF+TGGLSRE FP GF+ GTA+SAYQVEG    H+ GRGPSIWD F++ PG+  
Sbjct  56    LHPETVRFDTGGLSREVFPKGFIIGTATSAYQVEGMA--HQDGRGPSIWDVFIQKPGIVA  113

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGEV+VDQYHRYK DIDLM KLNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLI+
Sbjct  114   NNGTGEVSVDQYHRYKDDIDLMSKLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLID  173

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+LEKGITPYANL HYDLP ALE+RY G LGRQVV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  174   YLLEKGITPYANLYHYDLPLALEERYNGLLGRQVVKDFADYAEFCFKTFGDRVKNWMTFN  233

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY VAHNLIL HA A QRYR  YQ 
Sbjct  234   EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILSHAAAVQRYREKYQE  293

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYPKT+Q IVG RL
Sbjct  294   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRL  353

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGP
Sbjct  354   PKFTSEEVKIVKGSIDFVGINQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGP  413

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS WLY VPWG+YK++ Y+KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  414   RANSYWLYNVPWGIYKSLMYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  473

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL  LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKR+PKMSAYWF+ 
Sbjct  474   YLTNLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRHPKMSAYWFKQ  533

Query  105   FLRRNKH  85
                R KH
Sbjct  534   LNARKKH  540



>ref|XP_009799689.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=513

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/494 (75%), Positives = 423/494 (86%), Gaps = 7/494 (1%)
 Frame = -3

Query  1551  SIVQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFL  1375
             +++Q D V PE   F+TGGLSR+SFP  FVFGT++SAYQVEGA    K GRGPS+WDTF+
Sbjct  22    TLIQSDNVLPETTVFDTGGLSRDSFPKDFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFI  79

Query  1374  KTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVA  1195
             K PG EPNNA+GEV+ DQYHRYK DIDLMVKLNFDAYRFSISW+RIFPNGTGK+NWKGVA
Sbjct  80    KKPGREPNNASGEVSADQYHRYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVA  139

Query  1194  YYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRV  1015
             YYNRLI+YML+KGIT Y NLNHYDLPQAL+D+Y GWL  +VV+D+ADYAEFCFK +GDRV
Sbjct  140   YYNRLIDYMLKKGITSYVNLNHYDLPQALQDKYKGWLSHEVVKDFADYAEFCFKAYGDRV  199

Query  1014  KNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQR  847
             KNWFSFNEPRVVA LGY+TG+FAPGRCS    NC  G+SATEPY+VAHNLIL HA AAQR
Sbjct  200   KNWFSFNEPRVVADLGYNTGYFAPGRCSKAFGNCISGDSATEPYIVAHNLILSHAAAAQR  259

Query  846   YRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQ  667
             YR  YQ KQKG+FGI+LDFVW+EPLTRSK DNYAAQRARDF +GWFLHP+VYGEYPKTMQ
Sbjct  260   YRDKYQEKQKGKFGIILDFVWFEPLTRSKVDNYAAQRARDFELGWFLHPLVYGEYPKTMQ  319

Query  666   NIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYAR  487
             NIVG+RLP+FT +EVK+VKGSIDYVGIN YTTFY +D +   P    Y+ DWN  FAY R
Sbjct  320   NIVGNRLPKFTKEEVKMVKGSIDYVGINHYTTFYAFDRHLSKPKALGYRQDWNCAFAYDR  379

Query  486   NGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTK  307
              GVPIGPRA+S+WLY+VPWGLYKAV YVKE YGNP + LSENGMDY GN++L E+L DTK
Sbjct  380   KGVPIGPRAHSDWLYIVPWGLYKAVNYVKENYGNPTIILSENGMDYAGNISLPEALQDTK  439

Query  306   RISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKM  127
             R  YY+SYLAELK+ + +GAN+ GYFAWSLLDNFEWR GYTSRFGI+YVD+ TLKRYPKM
Sbjct  440   RTDYYRSYLAELKKAIVEGANVTGYFAWSLLDNFEWRRGYTSRFGIIYVDYRTLKRYPKM  499

Query  126   SAYWFQNFLRRNKH  85
             SAYWF+  L+ + H
Sbjct  500   SAYWFKQLLQHHMH  513



>ref|XP_006353826.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=502

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/477 (77%), Positives = 415/477 (87%), Gaps = 7/477 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGL+RESFP  FVFGT++SAYQVEGA    K GRGPS+WDTF+K PG EPNNA+GEV
Sbjct  28    FDTGGLNRESFPKSFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFIKLPGREPNNASGEV  85

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             + DQYH YK DIDLMVKLNFDAYRFSISW+RIFPNGTGK+NWKGV YYN+LINYML+KGI
Sbjct  86    SADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVTYYNKLINYMLKKGI  145

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PY NLNHYDLPQAL++RY GWL R+VV+D+ADYAEFCFK +GDRVKNWFSFNEPRVVA 
Sbjct  146   APYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKNWFSFNEPRVVAD  205

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LGYDTGFFAPGRCS    NCT G+SATEPY+VAHNLIL HA AA RYR  YQ KQKG+FG
Sbjct  206   LGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILSHAAAAHRYRENYQEKQKGKFG  265

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I+LDFVWYEPLTRSKADNYAAQRARDF +GWFLHP+VYGEYPKTMQNIV DRLP+FT DE
Sbjct  266   IILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVRDRLPKFTTDE  325

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             +K+VKGSIDYVGIN YTTFY YD   K   +  YQ D N GFA  RNGVPIGPRA+S WL
Sbjct  326   IKMVKGSIDYVGINHYTTFYAYDHLSKLKAL-AYQQDQNCGFANDRNGVPIGPRAHSYWL  384

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWGLYKAV YVKE YGNP + LSENGMDY GN++L+++L+DTKRI YY+SYLA+LK+
Sbjct  385   YIVPWGLYKAVNYVKEHYGNPTILLSENGMDYAGNISLSDALHDTKRIDYYRSYLAKLKK  444

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
              +D+GAN+ GYFAWSLLDNFEWR GYTSRFGIVYVD+ TLKRYPKMSAYWF+  L+ 
Sbjct  445   AIDEGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTTLKRYPKMSAYWFKQLLQE  501



>gb|KDO62878.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=519

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/487 (76%), Positives = 416/487 (85%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS WLY VPWG+YKA+ Y+K  YGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  393   RANSYWLYNVPWGMYKALMYIKGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  452

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF  LKRYPKMSAYWF+ 
Sbjct  453   YLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTNLKRYPKMSAYWFKQ  512

Query  105   FLRRNKH  85
              L+RNKH
Sbjct  513   LLKRNKH  519



>ref|XP_006451662.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64902.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=519

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/487 (76%), Positives = 416/487 (85%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYIGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHN IL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNSILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS WLY VPWG+YKA+ Y+KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  393   RANSYWLYNVPWGMYKALMYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  452

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF  LKRYPKMSAYWF+ 
Sbjct  453   YLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTNLKRYPKMSAYWFKQ  512

Query  105   FLRRNKH  85
              L+RNKH
Sbjct  513   LLKRNKH  519



>ref|XP_004512738.1| PREDICTED: beta-glucosidase 44-like [Cicer arietinum]
Length=512

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/483 (76%), Positives = 415/483 (86%), Gaps = 6/483 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E VRF+TGGLSRE FP GFVFG A+SAYQVEG    HK GRGPSIWD F++ PG+  NN 
Sbjct  32    ETVRFDTGGLSREVFPKGFVFGVATSAYQVEGMA--HKDGRGPSIWDVFIQKPGIVANNG  89

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             TG+V+VDQYHRYK DIDLM KLNFDAYRFSISW+RIFPNGTGK+NWKGVAYYNRLI+Y+L
Sbjct  90    TGDVSVDQYHRYKEDIDLMAKLNFDAYRFSISWSRIFPNGTGKLNWKGVAYYNRLIDYLL  149

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             EKGITPYANL HYDLP ALE RY G L   VV+D+ADYA+FCFK FGDRVKNW +FNEPR
Sbjct  150   EKGITPYANLYHYDLPLALELRYKGLLSYDVVKDFADYADFCFKTFGDRVKNWMTFNEPR  209

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYR  YQ KQK
Sbjct  210   VVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYREKYQEKQK  269

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYP+TMQNIVG+RLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPLVYGEYPRTMQNIVGNRLPKF  329

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             T +EVKLVKGSID+VGINQYTT+Y+YDP+   P +  YQ DWNVGFAYA+NGVP+GPRA 
Sbjct  330   TKEEVKLVKGSIDFVGINQYTTYYMYDPHKSKPKVPGYQMDWNVGFAYAKNGVPVGPRAY  389

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY VPWGLYK++ Y+KE YGNP + LSENGMD  GN+T ++ L+DT RI+YYK YL+
Sbjct  390   SYWLYNVPWGLYKSLIYIKEHYGNPTVILSENGMDDPGNVTFSKGLHDTTRINYYKGYLS  449

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             +LK+ VDDGAN+ GY+AWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+  L 
Sbjct  450   QLKKAVDDGANVVGYYAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLLT  509

Query  96    RNK  88
             + K
Sbjct  510   KKK  512



>ref|XP_007036679.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
 gb|EOY21180.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
Length=513

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 413/489 (84%), Gaps = 6/489 (1%)
 Frame = -3

Query  1539  CDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1360
               V PE V+ +TGGLSRESFP GFVFGTA+SAYQVEG       GRGPSIWD F+K PG+
Sbjct  27    SQVQPETVKLDTGGLSRESFPKGFVFGTATSAYQVEGMASGD--GRGPSIWDVFVKIPGI  84

Query  1359  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1180
                NATGEV+VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRL
Sbjct  85    VAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRL  144

Query  1179  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  1000
             I+ +L++GITPYANL HYDLP+ALE RY G L  QVV+D+AD+A+FCFK FGDRVKNW +
Sbjct  145   IDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNWMT  204

Query  999   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL H  A QRYR  Y
Sbjct  205   FNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILAHGAAVQRYRLKY  264

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+
Sbjct  265   QPKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGN  324

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  472
             RLP+FT +EVK+VKGSID+VGINQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPI
Sbjct  325   RLPKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPI  384

Query  471   GPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYY  292
             GPRANS WLY VPWGLYKA+ Y+KERYGNP + LSENGMD  GN+TL++ L+DT RI+YY
Sbjct  385   GPRANSNWLYNVPWGLYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYY  444

Query  291   KSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWF  112
             K+YL +L++ VD GAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF  LKRYPKMSAYWF
Sbjct  445   KAYLTQLRKAVDGGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFSNLKRYPKMSAYWF  504

Query  111   QNFLRRNKH  85
             +  L R KH
Sbjct  505   KQLLTRKKH  513



>gb|KEH16707.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/492 (75%), Positives = 414/492 (84%), Gaps = 6/492 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             S V     PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K
Sbjct  25    SSVNGVTVPETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGMAS--KEGRGPSIWDVFIK  82

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+  NN TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAY
Sbjct  83    KPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAY  142

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVK
Sbjct  143   YNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLSRNVVKDFADYADFCFKTFGDRVK  202

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY VAHNLIL HA AAQRY
Sbjct  203   NWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILSHAAAAQRY  262

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYP+TMQN
Sbjct  263   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPRTMQN  322

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVG+RLP+FT +EVKLVKGSID+VGINQYTT+Y+YDP+ + P +  YQ+DWN GFAYA+N
Sbjct  323   IVGNRLPKFTKEEVKLVKGSIDFVGINQYTTYYMYDPHNQKPKVPGYQSDWNAGFAYAKN  382

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVP+GPRA S WLY VPWGLYK++ Y+KE Y NP MFLSENGMD  GN+T ++ L+DT R
Sbjct  383   GVPVGPRAYSYWLYNVPWGLYKSIMYIKEHYKNPTMFLSENGMDDPGNVTFSKGLHDTTR  442

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I+YYK YL +LK+ +DDGAN+FGY AWSLLDNFEWR+GYTSRFGIVYVDF TLKR PKMS
Sbjct  443   INYYKGYLTQLKKAIDDGANVFGYHAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRTPKMS  502

Query  123   AYWFQNFLRRNK  88
             AYWF+  L + K
Sbjct  503   AYWFKQLLTKKK  514



>gb|AGV54748.1| beta-glucosidase 44-like protein [Phaseolus vulgaris]
Length=518

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 414/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             +     + PE VRF+TGGLSRE FP GF+ GTA+SAYQVEG    H+ GRGPSIWD F++
Sbjct  28    AAADATLHPETVRFDTGGLSREVFPKGFIIGTATSAYQVEGMA--HQDGRGPSIWDVFIQ  85

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+  NN TGEV+VDQYHRYK DIDLM KLNFDAYRFSISW+RIFPNGTG VNWKGVAY
Sbjct  86    KPGIVANNGTGEVSVDQYHRYKDDIDLMSKLNFDAYRFSISWSRIFPNGTGNVNWKGVAY  145

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+LEKGITPYANL HYDLP ALE+RY G LGRQVV+D+ADYAEFCFK FG+RVK
Sbjct  146   YNRLIDYLLEKGITPYANLYHYDLPLALEERYNGLLGRQVVKDFADYAEFCFKTFGNRVK  205

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGY  G FAPG+CS    NCT GNS TEPY+VAHNLIL HA A QRY
Sbjct  206   NWMTFNEPRVVAALGYKKGSFAPGKCSKEYGNCTTGNSGTEPYIVAHNLILSHAAAVQRY  265

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDFVWYEP +RSKADNYAAQRARDFHIGWF+HP+VYGEYPKT+Q 
Sbjct  266   REKYQEKQKGRIGILLDFVWYEPFSRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQE  325

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVG RLP+FT +EVK+VKGSID+VGINQYTT+Y+YDP+   P +  YQ DWN GFAYA+N
Sbjct  326   IVGQRLPKFTSEEVKIVKGSIDFVGINQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKN  385

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRANS WLY VPWG+YK++ Y+KE YGNP + LSENGMD  GN+TL + L+DT R
Sbjct  386   GVPIGPRANSYWLYNVPWGIYKSLMYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTR  445

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I+YYK YL  LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKR+PKMS
Sbjct  446   INYYKGYLTNLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRHPKMS  505

Query  123   AYWFQNFLRRNKH  85
             AYWF+    R KH
Sbjct  506   AYWFKQLNARKKH  518



>ref|XP_010032608.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 414/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V PE  RF+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIPETTRFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLINY+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP M LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>ref|XP_010243804.1| PREDICTED: beta-glucosidase 44-like [Nelumbo nucifera]
Length=518

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/488 (76%), Positives = 411/488 (84%), Gaps = 6/488 (1%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             D  PE  RF+TGGLSRESFP GFVFGTA+SAYQVEG     K GRGPSIWD F++ PG+ 
Sbjct  33    DAWPETARFDTGGLSRESFPKGFVFGTATSAYQVEGMAS--KEGRGPSIWDVFVRIPGIV  90

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
               NATGE++VDQYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  91    AKNATGEMSVDQYHRYKEDVNLMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  150

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +Y+L KGITPYANL HYDLP ALE +Y G L R+VV D+A++AEFCFK FGDRVKNW +F
Sbjct  151   DYLLAKGITPYANLYHYDLPLALEKKYNGLLSREVVNDFANFAEFCFKTFGDRVKNWMTF  210

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAHNLIL HA A QRYR  YQ
Sbjct  211   NEPRVVAALGYDNGFFAPGRCSKPYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYREKYQ  270

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
             A QKGR GILLDFVWYEPLTR KAD  AAQRARDFH+GWFLHPIVYGEYPKT+QNIVG R
Sbjct  271   AHQKGRIGILLDFVWYEPLTRGKADQQAAQRARDFHVGWFLHPIVYGEYPKTVQNIVGKR  330

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+FT +EVK+VKGSID+VGINQYTT+Y+YDP+        YQNDWN GFAYA+ GVPIG
Sbjct  331   LPKFTDEEVKMVKGSIDFVGINQYTTYYMYDPHQTKKQPPGYQNDWNAGFAYAKKGVPIG  390

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
             PRANS WLY VPWGLYKA+ Y+KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK
Sbjct  391   PRANSYWLYEVPWGLYKALIYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYK  450

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
             SYL ELK+ VD+GAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+
Sbjct  451   SYLLELKKAVDEGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFK  510

Query  108   NFLRRNKH  85
               L R KH
Sbjct  511   ELLGRKKH  518



>gb|KCW83978.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/493 (74%), Positives = 414/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP M LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=503

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/486 (74%), Positives = 414/486 (85%), Gaps = 6/486 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             + PE V F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  
Sbjct  19    MHPETVHFDTGGLSRDSFPKGFIFGTATSAYQVEGMAD--KEGRGPSIWDVFIKKPGIVA  76

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGE++VDQYH+Y +DID+M KLNFDAYRFSISW+RIFPNG GKVNWKGVAYYN+LIN
Sbjct  77    NNGTGEISVDQYHKYPQDIDIMAKLNFDAYRFSISWSRIFPNGRGKVNWKGVAYYNKLIN  136

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLPQALE+ Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  137   YLLKRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFN  196

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+ AH+LIL HA A QRYR  YQ 
Sbjct  197   EPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILSHAAAVQRYRQKYQE  256

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+T+QNIVG+RL
Sbjct  257   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRL  316

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID VGINQYTT+Y+YDP+ +   +  YQ DWN GFAY +NGVPIGP
Sbjct  317   PKFTKEEVKMVKGSIDLVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGP  376

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+S WLY VPWG+YKA+ YVK+ YGNP + LSENGMD  GN+TL + L+DT RI++YK 
Sbjct  377   RAHSYWLYNVPWGMYKALMYVKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKG  436

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVD+  LKRYPKMSAYWF+ 
Sbjct  437   YLTQLKKAVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQ  496

Query  105   FLRRNK  88
              L R K
Sbjct  497   LLERKK  502



>gb|KEH16706.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/492 (75%), Positives = 408/492 (83%), Gaps = 6/492 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             S V+    PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K
Sbjct  25    SSVKGVTVPETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGIAS--KEGRGPSIWDVFIK  82

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+  NN TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAY
Sbjct  83    KPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAY  142

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVK
Sbjct  143   YNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLNRNVVKDFADYADFCFKTFGDRVK  202

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRV+AALGYDTGFFAPGRCS    NCT GNS TEPY+VAHNLIL HA AAQRY
Sbjct  203   NWMTFNEPRVIAALGYDTGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILSHAAAAQRY  262

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKG  GILLD VWYE LTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+TMQ 
Sbjct  263   RQKYQEKQKGSIGILLDLVWYESLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTMQT  322

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVG+RLP+FT +EV LVKGSID+VGINQYTTFYVYDP  + P +  YQ DWN  FAYA+N
Sbjct  323   IVGNRLPKFTKEEVNLVKGSIDFVGINQYTTFYVYDPRQQKPKVPGYQKDWNAEFAYAKN  382

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVP+GPR  S WLY VPWGLYK+V Y+KE Y NP MFLSENGMD  GN+T ++ L+DT R
Sbjct  383   GVPVGPREYSSWLYNVPWGLYKSVMYIKEHYKNPTMFLSENGMDDPGNVTFSKGLHDTTR  442

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I+YYK YL +LK+ +DDGAN+FGY AWSLLDNFEWR+GYTSRFGIVYVDF TLKR PKMS
Sbjct  443   INYYKGYLTQLKKAIDDGANVFGYHAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRTPKMS  502

Query  123   AYWFQNFLRRNK  88
             AYWF+  L + K
Sbjct  503   AYWFKQLLTKKK  514



>gb|KCW83975.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83976.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/493 (74%), Positives = 412/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLINY+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP M LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>ref|XP_007209912.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
 gb|EMJ11111.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
Length=513

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/487 (74%), Positives = 410/487 (84%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             + PE +  +TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  29    LDPESLNLDTGGLSRASFPKGFVFGTATSAYQVEGMA--HKEGRGPSIWDEFIKIPGIVA  86

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGEVAVDQYHRYK+D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRLIN
Sbjct  87    NNGTGEVAVDQYHRYKQDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIN  146

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y++++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  147   YLIKRGITPYANLYHYDLPLALEKKYLGLLNDEVVKDFADYAEFCFKTFGDRVKNWMTFN  206

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAP RCS    NCT GNS+TEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVVAALGYDNGFFAPARCSKAYGNCTAGNSSTEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVGDRL
Sbjct  267   VQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRL  326

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGS+D+VGINQYT +Y+YDP+   P +  YQ DWN GFAY +NGVPIGP
Sbjct  327   PKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNGVPIGP  386

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA S WLY VPWGLYKA+TY+KE YGNP + LSENGMD  GN T AE L+DT RI +YKS
Sbjct  387   RAYSSWLYQVPWGLYKALTYIKEHYGNPPVILSENGMDNPGNWTRAEVLHDTTRIKFYKS  446

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             Y+ +LK+ VD+GAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TL+RYPKMSAYWF+ 
Sbjct  447   YMIQLKKAVDEGANVLGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLERYPKMSAYWFKK  506

Query  105   FLRRNKH  85
              L + KH
Sbjct  507   LLTKTKH  513



>ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN64162.1| hypothetical protein Csa_1G042700 [Cucumis sativus]
Length=503

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/483 (75%), Positives = 412/483 (85%), Gaps = 6/483 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E V F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  NN 
Sbjct  22    ETVHFDTGGLSRDSFPKGFIFGTATSAYQVEGMAD--KEGRGPSIWDVFIKKPGIVANNG  79

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             TGE++VDQYH+Y +DID+M KLNFDAYRFSISW+RIFPNG GKVNWKGVAYYN+LINY+L
Sbjct  80    TGEISVDQYHKYPQDIDIMAKLNFDAYRFSISWSRIFPNGRGKVNWKGVAYYNKLINYLL  139

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             ++GITPYANL HYDLPQALE+ Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FNEPR
Sbjct  140   KRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFNEPR  199

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VVAALGYD GFFAPGRCS    NCT GNS TEPY+ AH+LIL HA A QRYR  YQ KQK
Sbjct  200   VVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILSHAAAVQRYRQKYQEKQK  259

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+T+QNIVG+RLP+F
Sbjct  260   GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRLPKF  319

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             T +EVK+VKGSID VGINQYTT+Y+YDP+ +   +  YQ DWN GFAY +NGVPIGPRA+
Sbjct  320   TKEEVKMVKGSIDLVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGPRAH  379

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY VPWG+YKA+ YVK+ YGNP + LSENGMD  GN+TL + L+DT RI++YK YL 
Sbjct  380   SYWLYNVPWGMYKALMYVKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLT  439

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVD+  LKRYPKMSAYWF+  L 
Sbjct  440   QLKKAVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLE  499

Query  96    RNK  88
             R K
Sbjct  500   RKK  502



>ref|XP_010097587.1| Beta-glucosidase 44 [Morus notabilis]
 gb|EXB69119.1| Beta-glucosidase 44 [Morus notabilis]
Length=512

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/490 (73%), Positives = 414/490 (84%), Gaps = 6/490 (1%)
 Frame = -3

Query  1545  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
                 +SPER+  +TGGLSR SFP GFVFGTA+SAYQVEG T  H+ GRGPSIWD F+KTP
Sbjct  25    ASSSLSPERLDLDTGGLSRASFPKGFVFGTATSAYQVEGMT--HQDGRGPSIWDVFVKTP  82

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
             G+  +N T EV VDQYHRY+ D+D+M KLNFDAYRFSISW+RIFP G GKVNWKGVAYYN
Sbjct  83    GIIADNGTAEVTVDQYHRYREDVDIMKKLNFDAYRFSISWSRIFPEGAGKVNWKGVAYYN  142

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
             RLINYM+++GITPYANL HYDLP+ALE++Y G L  QVV+D+ADYA+FCFK FGDRVKNW
Sbjct  143   RLINYMIKRGITPYANLYHYDLPEALEEKYLGLLNDQVVKDFADYADFCFKTFGDRVKNW  202

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  838
              +FNEPRVVAALGYD G  APGRCS    NCT GNSATEPY+ AH+LIL HA A QRYR 
Sbjct  203   MTFNEPRVVAALGYDNGLHAPGRCSKEFGNCTAGNSATEPYIAAHHLILSHAAAVQRYRE  262

Query  837   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  658
              YQ  QKGR GIL DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP+T+Q IV
Sbjct  263   KYQKTQKGRIGILTDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTIQEIV  322

Query  657   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  478
             G+RLP+FT ++VK+VKGSID+VGINQYT++Y+YDP+   P +  YQ DWNVGFAYA+NG 
Sbjct  323   GERLPKFTKEQVKMVKGSIDFVGINQYTSYYMYDPHASKPKVLGYQQDWNVGFAYAKNGK  382

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
              IGPRA SEWLY VP GLYK + Y+KERYGNP + LSENGMD  GN+TLA+ L+DT R++
Sbjct  383   LIGPRAYSEWLYQVPSGLYKCLMYLKERYGNPTVILSENGMDDPGNVTLAQGLHDTTRVN  442

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+SYL +LK+  DDGAN+ GYFAWSLLDNFEWR+GYTSRFG+VYVD+ +LKRYPKMSAY
Sbjct  443   YYRSYLLQLKKAADDGANVIGYFAWSLLDNFEWRLGYTSRFGMVYVDYHSLKRYPKMSAY  502

Query  117   WFQNFLRRNK  88
             WFQ  L+RNK
Sbjct  503   WFQKLLKRNK  512



>gb|KCW83977.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/493 (74%), Positives = 412/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP M LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>gb|KCW83979.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83980.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/493 (74%), Positives = 412/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP M LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>ref|XP_011000474.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/486 (74%), Positives = 410/486 (84%), Gaps = 6/486 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
              PE + F T G  R+ FP GFVFGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  N
Sbjct  31    QPETISFETAGGLRQGFPKGFVFGTATSAYQVEGMAD--KDGRGPSIWDAFVKIPGIVAN  88

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NATGEV+VDQYHRYK D+D+M KLNFDAYRFSISW+RIFP+G GKVNW GVAYYNRLI+Y
Sbjct  89    NATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVNWNGVAYYNRLIDY  148

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ++E+GITPYANL HYDLP ALE +Y G L +QVV+D+ADYA+FCFK FGDRVKNW +FNE
Sbjct  149   LIERGITPYANLYHYDLPLALEKKYNGLLSKQVVKDFADYADFCFKTFGDRVKNWMTFNE  208

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYDTGFFAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ K
Sbjct  209   PRVVAALGYDTGFFAPGRCSKAFGNCTAGNSATEPYIVAHHLILSHAAAVQRYREKYQEK  268

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP
Sbjct  269   QKGRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLP  328

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR  463
             +FT +EVK+VKGS+D+VGIN YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPR
Sbjct  329   KFTEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPR  388

Query  462   ANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSY  283
             A S WLY VPWG+YKAV Y+KERYGNP + LSENGMD  GNLT +++L DT RI YYK+Y
Sbjct  389   AYSYWLYNVPWGMYKAVMYIKERYGNPTIILSENGMDDPGNLTRSKALQDTTRIGYYKAY  448

Query  282   LAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNF  103
             L++LK+ VDDGANL GYFAWSLLDNFEWR+GYTSRFGIVYVD+ +LKRYPKMSA WF++ 
Sbjct  449   LSQLKKAVDDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSSLKRYPKMSANWFKHL  508

Query  102   LRRNKH  85
             L RNKH
Sbjct  509   LERNKH  514



>ref|XP_008462973.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=507

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/486 (74%), Positives = 413/486 (85%), Gaps = 6/486 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             V PE V F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  
Sbjct  23    VQPETVHFDTGGLSRDSFPKGFIFGTATSAYQVEGMAD--KEGRGPSIWDVFIKKPGIVA  80

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGE++VDQYHRY +DID+M KLNFDAYRFSISW+RIFPNG  KVNWKGVAYYN+LIN
Sbjct  81    NNGTGEISVDQYHRYPQDIDIMAKLNFDAYRFSISWSRIFPNGRRKVNWKGVAYYNKLIN  140

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLPQALE+ Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  141   YLLKRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFN  200

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NC  GNS TEPY+VAH+LIL HA A QRYR  YQ 
Sbjct  201   EPRVVAALGYDNGFFAPGRCSKAYGNCRAGNSGTEPYIVAHHLILSHAAAVQRYRQKYQE  260

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+T+Q IVG+RL
Sbjct  261   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFLHPIVYGEYPRTVQEIVGNRL  320

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYTT+Y+YDP+ +   +  YQ DWN GFAY ++GVPIGP
Sbjct  321   PKFTKEEVKMVKGSIDFVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKHGVPIGP  380

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+S WLY VPWG+YKA+ YVK+ YGNP + LSENGMD  GN+TL + L+DT RI++YK 
Sbjct  381   RAHSYWLYNVPWGMYKALMYVKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKG  440

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVD+  LKRYPKMSAYWF+ 
Sbjct  441   YLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQ  500

Query  105   FLRRNK  88
              L R K
Sbjct  501   LLERKK  506



>ref|XP_008810053.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=509

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/495 (74%), Positives = 420/495 (85%), Gaps = 12/495 (2%)
 Frame = -3

Query  1551  SIVQCDV--------SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGP  1396
             ++V+C          +P RVRF+TGGLSRE+FPAGFVFGTA+SAYQVEG     K GRGP
Sbjct  14    AVVRCSAAADAGTTKTPSRVRFDTGGLSREAFPAGFVFGTAASAYQVEGMA--LKDGRGP  71

Query  1395  SIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGK  1216
             SIWD F+K PG   NNAT +V+VD+YHRYK D+++M K+NFDAYRFSISW+RIFPNG GK
Sbjct  72    SIWDVFVKIPGEIANNATADVSVDEYHRYKEDVEIMKKMNFDAYRFSISWSRIFPNGVGK  131

Query  1215  VNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCF  1036
             VNWKGVAYYNRLINYML+KGITPYANL HYDLP+ALE +Y GWL  ++VE YADYA+FCF
Sbjct  132   VNWKGVAYYNRLINYMLKKGITPYANLYHYDLPEALEKQYNGWLSSKIVEAYADYADFCF  191

Query  1035  KIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAV  859
             KIFGDRVKNWF+FNEPRVVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA 
Sbjct  192   KIFGDRVKNWFTFNEPRVVAALGYDDGKFAPGRCTNCSAGGNSATEPYIVAHNLILSHAA  251

Query  858   AAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYP  679
             A +RYR  YQA+QKGR GILLDFVWYEPLT SK D+ AAQRARDFH+GWFLHPI+YGEYP
Sbjct  252   AVKRYREKYQAEQKGRIGILLDFVWYEPLTDSKDDHAAAQRARDFHLGWFLHPIIYGEYP  311

Query  678   KTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVG  502
             KTMQNIV +RLP+FT +EVK+V GSIDYVGINQYT +Y+YD +   P   T Y NDW+V 
Sbjct  312   KTMQNIVKERLPKFTVEEVKMVNGSIDYVGINQYTAYYMYDSHLSEPQKPTRYANDWHVV  371

Query  501   FAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAES  322
             FAYARNGVPIGPRA S+WLY+VPWG+YKAV+YVKE Y NP M LSENGMD  GN+TL + 
Sbjct  372   FAYARNGVPIGPRAYSDWLYIVPWGMYKAVSYVKEHYRNPTMILSENGMDDPGNMTLPKG  431

Query  321   LNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLK  142
             L+DT RI+YYKSY+ ELK+ +DDGAN+ GYFAWSLLDNFEW++GYTSRFGIVYVDF TLK
Sbjct  432   LHDTTRINYYKSYITELKKAIDDGANVIGYFAWSLLDNFEWKLGYTSRFGIVYVDFRTLK  491

Query  141   RYPKMSAYWFQNFLR  97
             RYPKMSAYWF+  L+
Sbjct  492   RYPKMSAYWFREMLK  506



>ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis]
Length=517

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/487 (73%), Positives = 416/487 (85%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             V  +++ F+TGGLSR+SFP GF+FGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  
Sbjct  33    VQMDKINFDTGGLSRDSFPEGFLFGTATSAYQVEGMAD--KDGRGPSIWDVFVKVPGIIA  90

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             +N+TGEV+VDQYHRYK+D+D+M KLNFDAYRFSISW+RIFP GTGKVNWKGVAYY+RLI+
Sbjct  91    DNSTGEVSVDQYHRYKQDVDIMQKLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYHRLID  150

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             YML++GITPYANL HYDLP ALE +Y G L RQVV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  151   YMLKRGITPYANLYHYDLPLALEKKYNGLLNRQVVKDFADYADFCFKTFGDRVKNWMTFN  210

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRV+AALGYD GFFAP RCS    NCT G+SATEPY+ AHNLIL HA A QRYR  YQ 
Sbjct  211   EPRVIAALGYDNGFFAPARCSKAFGNCTAGDSATEPYIAAHNLILSHAAAVQRYREKYQE  270

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKG+ GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RL
Sbjct  271   KQKGKIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGTRL  330

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT  EV++VKGSID+VGINQYTT+Y+ DP+   P    YQ DW+ GFAY +NGVP+GP
Sbjct  331   PKFTKQEVEMVKGSIDFVGINQYTTYYISDPHQAKPKYLGYQQDWDAGFAYEKNGVPVGP  390

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             +ANS WLY VPWG+YKA+TY+KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK 
Sbjct  391   KANSYWLYNVPWGMYKALTYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKG  450

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL ++K+ +DDGAN+ GYFAWSL+DNFEWR GYTSRFGIVYVDF TLKRYPKMSAYWF+ 
Sbjct  451   YLTQMKKAIDDGANVVGYFAWSLVDNFEWRSGYTSRFGIVYVDFTTLKRYPKMSAYWFKQ  510

Query  105   FLRRNKH  85
              L+R K+
Sbjct  511   MLQRKKN  517



>ref|XP_010032621.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
 gb|KCW83984.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/493 (74%), Positives = 413/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP + LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR+GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>ref|XP_008240180.1| PREDICTED: beta-glucosidase 44-like [Prunus mume]
Length=513

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/487 (73%), Positives = 409/487 (84%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             + PE +  +TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG+  
Sbjct  29    LDPESLNLDTGGLSRASFPKGFVFGTATSAYQVEGMA--HKEGRGPSIWDEFIKIPGIVA  86

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN TGEVAVDQYHRYK+D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRLIN
Sbjct  87    NNGTGEVAVDQYHRYKQDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIN  146

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y++++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  147   YLIKRGITPYANLYHYDLPLALEKKYLGLLNDKVVKDFADYAEFCFKTFGDRVKNWMTFN  206

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAP RCS    NCT GNS+TEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVVAALGYDNGFFAPARCSKAYGNCTAGNSSTEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVGDRL
Sbjct  267   VQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRL  326

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGS+D+VGINQYT +Y+YDP+   P +  YQ DWN GFAY +N VPIGP
Sbjct  327   PKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNEVPIGP  386

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA S WLY VPWGLYKA+TY+KE YGNP + LSENGMD  GN T A+ L+DT RI +YKS
Sbjct  387   RAYSSWLYQVPWGLYKALTYIKEHYGNPPVILSENGMDNPGNWTRAKGLHDTTRIKFYKS  446

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             Y+ +LK+ VD+GAN+ GYFAWSLLDNFEWR+GYTSRFG+VYVDF TL+RYPKMSAYWF+ 
Sbjct  447   YIIQLKKAVDEGANVMGYFAWSLLDNFEWRLGYTSRFGLVYVDFKTLERYPKMSAYWFKK  506

Query  105   FLRRNKH  85
              L + KH
Sbjct  507   LLTKTKH  513



>gb|KCW83981.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/493 (74%), Positives = 412/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP + LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMS
Sbjct  440   INFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFKQLLTRKKN  512



>ref|XP_002322085.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEF06212.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=514

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/484 (74%), Positives = 406/484 (84%), Gaps = 6/484 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E + F T G  R+ FP GFVFGTA+SAYQVEG  D  K GRGPSIWD F+K PG+  NNA
Sbjct  33    ETISFGTAGGLRQGFPEGFVFGTATSAYQVEGMAD--KDGRGPSIWDAFVKIPGIVANNA  90

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             TGEV+VDQYHRYK D+D+M KLNFDAYRFSISW+RIFP+G GKVNW GVAYYNRLI+YM+
Sbjct  91    TGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVNWNGVAYYNRLIDYMI  150

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             E+GITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+FCFK FGDRVKNW +FNEPR
Sbjct  151   ERGITPYANLYHYDLPLALEKKYNGLLSNQVVKDFADYADFCFKTFGDRVKNWMTFNEPR  210

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VVAALGYD GFFAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ KQK
Sbjct  211   VVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHHLILSHAAAVQRYREKYQEKQK  270

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+F
Sbjct  271   GRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKF  330

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             T +EVK+VKGS+D+VGIN YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPRAN
Sbjct  331   TEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRAN  390

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY VPWG+YKAV Y+KERYGNP M LSENGMD  GNLT ++++ DT RI YYK+YL+
Sbjct  391   SYWLYNVPWGMYKAVMYIKERYGNPTMILSENGMDDPGNLTRSKAMQDTTRIGYYKAYLS  450

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             +LK+  DDGANL GYFAWSLLDNFEWR+GYTSRFGIVYVD+  LKRYPKMSA WF++ L 
Sbjct  451   QLKKAADDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSANWFKHLLE  510

Query  96    RNKH  85
             RNKH
Sbjct  511   RNKH  514



>ref|XP_010032630.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/493 (72%), Positives = 414/493 (84%), Gaps = 6/493 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V PE +RF+TG LSR +FP GF++GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIPETMRFDTGRLSRSAFPKGFIWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG   NNATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGTVANNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLINY+L+KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCF+ FGDRVK
Sbjct  140   YNRLINYLLKKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFETFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD G FAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGIFAPGRCSLAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKGR GILLDF WYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ 
Sbjct  260   REKYQEKQKGRIGILLDFTWYEPLTRSKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQE  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+YDP+     +  YQ DWN G+A+ ++
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKH  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP + LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSSWLYNVPWGLYKAVMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++YK Y+ +LK+ VDDGAN+ GYFAWSLLDNFEW+ GYTSRFGIVY+D+  LKRYPKMS
Sbjct  440   INFYKGYITQLKKAVDDGANVVGYFAWSLLDNFEWKSGYTSRFGIVYIDYTNLKRYPKMS  499

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R K+
Sbjct  500   AYWFEQLLSRKKN  512



>gb|KCW83987.1| hypothetical protein EUGRSUZ_B00860 [Eucalyptus grandis]
Length=490

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/492 (72%), Positives = 413/492 (84%), Gaps = 6/492 (1%)
 Frame = -3

Query  1548  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             + +  V PE +RF+TG LSR +FP GF++GTA+SAYQVEG  D  K GRGPSIWD F+K 
Sbjct  1     MAEETVIPETMRFDTGRLSRSAFPKGFIWGTATSAYQVEGMAD--KEGRGPSIWDVFVKI  58

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG   NNATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAYY
Sbjct  59    PGTVANNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYY  118

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             NRLINY+L+KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCF+ FGDRVKN
Sbjct  119   NRLINYLLKKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFETFGDRVKN  178

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  841
             W +FNEPRVVAALGYD G FAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRYR
Sbjct  179   WMTFNEPRVVAALGYDNGIFAPGRCSLAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRYR  238

Query  840   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  661
               YQ KQKGR GILLDF WYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ I
Sbjct  239   EKYQEKQKGRIGILLDFTWYEPLTRSKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQEI  298

Query  660   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG  481
             VGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+YDP+     +  YQ DWN G+A+ ++G
Sbjct  299   VGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKHG  358

Query  480   VPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRI  301
             VPIGPRA+S WLY VPWGLYKAV Y+KERYGNP + LSENGMD  GN+TL++ L+DT RI
Sbjct  359   VPIGPRAHSSWLYNVPWGLYKAVMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRI  418

Query  300   SYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSA  121
             ++YK Y+ +LK+ VDDGAN+ GYFAWSLLDNFEW+ GYTSRFGIVY+D+  LKRYPKMSA
Sbjct  419   NFYKGYITQLKKAVDDGANVVGYFAWSLLDNFEWKSGYTSRFGIVYIDYTNLKRYPKMSA  478

Query  120   YWFQNFLRRNKH  85
             YWF+  L R K+
Sbjct  479   YWFEQLLSRKKN  490



>ref|XP_010487722.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/489 (74%), Positives = 410/489 (84%), Gaps = 7/489 (1%)
 Frame = -3

Query  1542  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             +   S + ++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  25    ESSPSIQNIKLDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  82

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
                 NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+G+GKVNWKGVAYYNR
Sbjct  83    TIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPDGSGKVNWKGVAYYNR  142

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+Y+++KGITPYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCFK FGDRVKNW 
Sbjct  143   LIDYLVQKGITPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWM  202

Query  1002  SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +FNEPRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V H+LIL HA A QRYR  
Sbjct  203   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILAHAAAVQRYRKY  262

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             YQAKQKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV 
Sbjct  263   YQAKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVK  322

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  478
             DRLP+FT +EVK+VKGSIDYVGINQYTT+Y+ +P+  T P    YQ DWNV F +A+ G 
Sbjct  323   DRLPKFTAEEVKMVKGSIDYVGINQYTTYYMSEPHFTTKPKDLGYQQDWNVQFGFAKLGK  382

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRA+S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI 
Sbjct  383   PIGPRAHSTWLYNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIK  442

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+ YL  LK+  DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA 
Sbjct  443   YYRDYLTNLKKATDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAK  502

Query  117   WFQNFLRRN  91
             WF+  L+RN
Sbjct  503   WFRKLLKRN  511



>ref|NP_188436.1| beta-glucosidase 44 [Arabidopsis thaliana]
 sp|Q9LV33.1|BGL44_ARATH RecName: Full=Beta-glucosidase 44; Short=AtBGLU44; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02020.1| beta-glucosidase [Arabidopsis thaliana]
 gb|AAM61427.1| beta-glucosidase, putative [Arabidopsis thaliana]
 dbj|BAH19552.1| AT3G18080 [Arabidopsis thaliana]
 dbj|BAH19607.1| AT3G18080 [Arabidopsis thaliana]
 gb|AEE76044.1| beta-glucosidase 44 [Arabidopsis thaliana]
Length=512

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/489 (74%), Positives = 410/489 (84%), Gaps = 7/489 (1%)
 Frame = -3

Query  1542  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             +  +S E+ + +TGGLSR+SFP GFVFGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  24    ESSLSAEKNKLHTGGLSRQSFPKGFVFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  81

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
                 NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNR
Sbjct  82    KIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNR  141

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+YM++KGITPYANL HYDLP ALE++Y G LGRQVV+D+ADYAEFC+K FGDRVKNW 
Sbjct  142   LIDYMVQKGITPYANLYHYDLPLALENKYKGLLGRQVVKDFADYAEFCYKTFGDRVKNWM  201

Query  1002  SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +FNEPRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V H+LIL HA A QRYR  
Sbjct  202   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILAHAAAVQRYRKY  261

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             YQAKQKGR GILLDFVWYEPLTRSKADN AAQRARDFHIGWF+HP+VYGEYPKTMQNIV 
Sbjct  262   YQAKQKGRVGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQNIVK  321

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  478
             +RLP+FT  EVK+VKGSID+VGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G 
Sbjct  322   ERLPKFTEKEVKMVKGSIDFVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGK  381

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRA S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI 
Sbjct  382   PIGPRAYSSWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIK  441

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YYK YL  LK+  DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA 
Sbjct  442   YYKDYLTNLKKARDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQ  501

Query  117   WFQNFLRRN  91
             WF+  L+RN
Sbjct  502   WFKQLLKRN  510



>ref|XP_010533966.1| PREDICTED: beta-glucosidase 44-like [Tarenaya hassleriana]
Length=514

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/480 (75%), Positives = 411/480 (86%), Gaps = 7/480 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR SFP+GFVFGTA+SAYQVEG T  ++ GRGPSIWDTF+K PG+  NNAT  V
Sbjct  36    FDTGGLSRRSFPSGFVFGTATSAYQVEGET--YQDGRGPSIWDTFVKIPGIVANNATANV  93

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGKVNWKGVAYYN LI+Y+L+KGI
Sbjct  94    TVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNSLIDYLLKKGI  153

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLP+ALE RY G LG+QVV D+ADYAEFCFK FGDRVKNW +FNEPRVVAA
Sbjct  154   TPYANLYHYDLPEALEKRYKGLLGKQVVRDFADYAEFCFKTFGDRVKNWMTFNEPRVVAA  213

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LGYD GFFAPGRCS    NCT G+SATEPY VAH+LIL H+ A QRYR  YQ KQKGR G
Sbjct  214   LGYDNGFFAPGRCSKAFGNCTAGDSATEPYTVAHHLILAHSSAVQRYRLKYQEKQKGRIG  273

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEPLTR KADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVGDRLP+F+ +E
Sbjct  274   ILLDFVWYEPLTRGKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGDRLPKFSEEE  333

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIH-TYQNDWNVGFAYARNGVPIGPRANSEW  448
             VK+VKGS+D+VGINQYTT+Y+YDP+   P  +  YQ DWN GFA+++ G PIGPRANS W
Sbjct  334   VKMVKGSMDFVGINQYTTYYMYDPHLSNPPKYFGYQQDWNAGFAFSKKGKPIGPRANSYW  393

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY VPWG+YKA+ Y+KERYGNP + LSENGMD  GN+TL++ L+DT RI +Y+ YL +LK
Sbjct  394   LYNVPWGMYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRIGFYRGYLTQLK  453

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             + VDDGAN+ GYFAWSLLDNFEW++GYTSRFGIVYVD+  LKRYPKMSA+WF+  L RNK
Sbjct  454   KAVDDGANVAGYFAWSLLDNFEWKLGYTSRFGIVYVDYKNLKRYPKMSAHWFKQLLERNK  513



>ref|XP_002883107.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59366.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/489 (74%), Positives = 411/489 (84%), Gaps = 7/489 (1%)
 Frame = -3

Query  1542  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             +   S E+++F+TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  25    ESSPSVEKIKFDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  82

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
                 NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNR
Sbjct  83    TIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNR  142

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+Y+++KGI+PYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCFK FGDRVKNW 
Sbjct  143   LIDYLVQKGISPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWM  202

Query  1002  SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +FNEPRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V+H+LIL HA A QRYR  
Sbjct  203   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILAHAAAVQRYRKY  262

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             YQAKQKGR GILLDFVWYEPLTRSKADN AAQRARDFHIGWF+HPIVYGEYPKTMQNIV 
Sbjct  263   YQAKQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVK  322

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  478
             +RLP+FT +EVK+VKGSID+VGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G 
Sbjct  323   ERLPKFTKEEVKMVKGSIDFVGINQYTTYYMSEPHPTTKPKALGYQQDWNVDFGFAKLGK  382

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRA S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI 
Sbjct  383   PIGPRAYSYWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIK  442

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YYK YL  LK+  DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA 
Sbjct  443   YYKDYLTNLKKARDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQ  502

Query  117   WFQNFLRRN  91
             WF+  L+RN
Sbjct  503   WFKQLLKRN  511



>ref|XP_002281407.1| PREDICTED: beta-glucosidase 44 [Vitis vinifera]
 emb|CBI15543.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/498 (73%), Positives = 417/498 (84%), Gaps = 15/498 (3%)
 Frame = -3

Query  1548  IVQC-----DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWD  1384
             ++QC     + + E + FNT GLSRESFP GFVFGTA+SAYQVEG  D  K GRGPSIWD
Sbjct  15    VIQCVADAAEHNEESLIFNTHGLSRESFPKGFVFGTATSAYQVEGMAD--KDGRGPSIWD  72

Query  1383  TFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWK  1204
              F++ PG+  NN TGEVAVDQYHRYK DIDLM  LNF+AYRFSISW+RIFP GTGKVNWK
Sbjct  73    VFIRKPGIVANNGTGEVAVDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWK  132

Query  1203  GVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFG  1024
             GVAYYNRLINY+L+KGITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK+FG
Sbjct  133   GVAYYNRLINYLLKKGITPYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFG  192

Query  1023  DRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVA  856
             DRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A
Sbjct  193   DRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHHLILSHAAA  252

Query  855   AQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPK  676
              QRYR  YQ +QKGR GILLDFVWYEPLTRSKADN AAQR+RDFH+GWF+HPIVYGEYP+
Sbjct  253   VQRYREKYQKEQKGRIGILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPR  312

Query  675   TMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF  499
             TMQ IVGDRLP+FT  EVK+VKGS+D+VGINQYT +Y+YD P PK P    YQ DW+ GF
Sbjct  313   TMQEIVGDRLPKFTKAEVKMVKGSMDFVGINQYTAYYMYDKPKPKVP---GYQEDWHAGF  369

Query  498   AYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESL  319
             AY ++GVPIGPRA S WLY VPWGLYKAVTY+KERYGNP + LSENGMD  GN+TL++ L
Sbjct  370   AYEKHGVPIGPRAYSSWLYKVPWGLYKAVTYIKERYGNPTVILSENGMDDPGNVTLSQGL  429

Query  318   NDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKR  139
             +DTKR+++Y +YL ELK+ +DDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVD+ TLKR
Sbjct  430   HDTKRVNFYTNYLTELKKAIDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDWRTLKR  489

Query  138   YPKMSAYWFQNFLRRNKH  85
             YPKMSA WF+  L +  H
Sbjct  490   YPKMSAKWFKQMLAQKGH  507



>ref|XP_010465882.1| PREDICTED: beta-glucosidase 44 [Camelina sativa]
Length=513

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/485 (74%), Positives = 408/485 (84%), Gaps = 7/485 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             S + ++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    
Sbjct  29    SIQNIKLDTGGLSRKSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAK  86

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNRLI+Y
Sbjct  87    NATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDY  146

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +++KGITPYANL HYDLP ALE +Y G LGRQV+ D+ADYAEFCFK FGDRVKNW +FNE
Sbjct  147   LVQKGITPYANLYHYDLPLALEKKYKGLLGRQVLNDFADYAEFCFKTFGDRVKNWMTFNE  206

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V H+LIL HA A QRYR  YQAK
Sbjct  207   PRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILAHAAAVQRYRKYYQAK  266

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIV DRLP
Sbjct  267   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKDRLP  326

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGP  466
             +FT  EVK+VKGSIDYVGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G PIGP
Sbjct  327   KFTAKEVKMVKGSIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGKPIGP  386

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ 
Sbjct  387   RAHSTWLYNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRD  446

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL  LK+  DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA WF+ 
Sbjct  447   YLTNLKKATDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSARWFRK  506

Query  105   FLRRN  91
              L+RN
Sbjct  507   LLKRN  511



>ref|XP_002322086.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
 gb|EEF06213.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
Length=515

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/485 (74%), Positives = 406/485 (84%), Gaps = 7/485 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP-GLEPNN  1348
             E + F T G  R+ FP GFVFGTA+SAYQVEG  D  K GRGPSIWD F+K P G+  NN
Sbjct  33    ETISFGTAGGLRQGFPEGFVFGTATSAYQVEGMAD--KDGRGPSIWDAFVKIPAGIVANN  90

Query  1347  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1168
             ATGEV+VDQYHRYK D+D+M KLNFDAYRFSISW+RIFP+G GKVNW GVAYYNRLI+YM
Sbjct  91    ATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVNWNGVAYYNRLIDYM  150

Query  1167  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  988
             +E+GITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+FCFK FGDRVKNW +FNEP
Sbjct  151   IERGITPYANLYHYDLPLALEKKYNGLLSNQVVKDFADYADFCFKTFGDRVKNWMTFNEP  210

Query  987   RVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  820
             RVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ KQ
Sbjct  211   RVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHHLILSHAAAVQRYREKYQEKQ  270

Query  819   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  640
             KGR GILLDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+
Sbjct  271   KGRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPK  330

Query  639   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRA  460
             FT +EVK+VKGS+D+VGIN YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPRA
Sbjct  331   FTEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRA  390

Query  459   NSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYL  280
             NS WLY VPWG+YKAV Y+KERYGNP M LSENGMD  GNLT ++++ DT RI YYK+YL
Sbjct  391   NSYWLYNVPWGMYKAVMYIKERYGNPTMILSENGMDDPGNLTRSKAMQDTTRIGYYKAYL  450

Query  279   AELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             ++LK+  DDGANL GYFAWSLLDNFEWR+GYTSRFGIVYVD+  LKRYPKMSA WF++ L
Sbjct  451   SQLKKAADDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSANWFKHLL  510

Query  99    RRNKH  85
              RNKH
Sbjct  511   ERNKH  515



>ref|XP_011039106.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/503 (73%), Positives = 410/503 (82%), Gaps = 16/503 (3%)
 Frame = -3

Query  1551  SIVQC----------DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGR  1402
             SIVQC             PE V     G  R SFP GFVFGTA+SAYQVEG  +  K GR
Sbjct  14    SIVQCISHAAESNGASEKPETVGLEAAGGLRHSFPKGFVFGTATSAYQVEGMAE--KDGR  71

Query  1401  GPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGT  1222
             GPSIWD F+K PG+  NNATGEVAVDQYH YK D+D+M  LNFDAYRFSISW+RIFP+GT
Sbjct  72    GPSIWDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGT  131

Query  1221  GKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEF  1042
             GKVNW GVAYYNRLI+YM+EKGITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+F
Sbjct  132   GKVNWLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADF  191

Query  1041  CFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLI  874
             CFK FGDRVKNW +FNEPRVVAALGYD G FAPGRCS    NCT G+SATEPY+VAH+LI
Sbjct  192   CFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLI  251

Query  873   LCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIV  694
             L HA A QRYR  YQ KQKGR GILLDFV+YEPLT SKADN AAQRARDFHIGWF+HPIV
Sbjct  252   LSHAAAVQRYRDKYQEKQKGRIGILLDFVYYEPLTSSKADNLAAQRARDFHIGWFIHPIV  311

Query  693   YGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND  514
             YGEYPKTM+NIVG+RLP+FT +EV++VKGS+D+VGINQYTTFY+YDP+   P    YQ D
Sbjct  312   YGEYPKTMKNIVGNRLPQFTKEEVRMVKGSMDFVGINQYTTFYMYDPHQPKPKYLGYQQD  371

Query  513   WNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLT  334
             WNVGFAY +NGVPIGPRANS WLY VPWG+YKAV Y+KERYGNP + LSENGMD  GN T
Sbjct  372   WNVGFAYKKNGVPIGPRANSNWLYNVPWGMYKAVMYIKERYGNPTIILSENGMDDPGNFT  431

Query  333   LAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF  154
              +++L+DT RI Y+K+YL +LK+  D+GANL GYFAWSLLDNFEWR GYTSRFGIVYVD+
Sbjct  432   RSKALHDTTRIGYFKAYLTQLKKAADEGANLAGYFAWSLLDNFEWRSGYTSRFGIVYVDY  491

Query  153   DTLKRYPKMSAYWFQNFLRRNKH  85
               LKRYPKMSAYWF+  L RNKH
Sbjct  492   TNLKRYPKMSAYWFKKLLERNKH  514



>ref|XP_009347765.1| PREDICTED: beta-glucosidase 44-like [Pyrus x bretschneideri]
Length=513

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/487 (74%), Positives = 405/487 (83%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             + PE V+ +TGGLSR SF  GFVFGTA+SAYQVEG  +  K GRGPSIWD F+K PG+  
Sbjct  29    LEPESVKLDTGGLSRASFRKGFVFGTATSAYQVEGMAN--KDGRGPSIWDAFVKIPGIIA  86

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN T +VAVDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLIN
Sbjct  87    NNGTADVAVDQYHRYKDDIDLMASLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLIN  146

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  147   YLLKRGITPYANLYHYDLPLALEKKYLGLLSDKVVKDFADYADFCFKTFGDRVKNWMTFN  206

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRV+AALGYD GF APGRCS    NCT GNSATEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVIAALGYDNGFHAPGRCSKAFGNCTAGNSATEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVGDRL
Sbjct  267   IQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRL  326

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGS+DYVGINQYTT+Y+Y P P       YQ DWN GFAYA+NGVPIGP
Sbjct  327   PKFTKEEVKMVKGSMDYVGINQYTTYYMYHPKPSKSNDLGYQQDWNAGFAYAKNGVPIGP  386

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA S WLY VPWGLYKAV Y+KERYGNP + LSENGMD  GN+TLAE L DT R ++Y+S
Sbjct  387   RAYSYWLYQVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLAEGLRDTTRANFYRS  446

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             Y+ +LK+  DDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+ 
Sbjct  447   YITQLKKAADDGANVMGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKK  506

Query  105   FLRRNKH  85
              L  NKH
Sbjct  507   LLTGNKH  513



>ref|XP_010506359.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/485 (74%), Positives = 409/485 (84%), Gaps = 7/485 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             S + ++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    
Sbjct  29    SIQNIKLDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAK  86

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP G+GKVNWKGVAYYNRLI+Y
Sbjct  87    NATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDY  146

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +++KGITPYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCFK FGDRVKNW +FNE
Sbjct  147   LVQKGITPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNE  206

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G FAPGRCS    NCT+GNSATEPY+V+H+LIL HA A QRYR  YQAK
Sbjct  207   PRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILAHAAAVQRYRKYYQAK  266

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP
Sbjct  267   QKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLP  326

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGP  466
             +FT +EVK+VKGSIDYVGINQYTT+Y+ +P+P T P    YQ DWNV F +A+ G  IGP
Sbjct  327   KFTAEEVKMVKGSIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVQFGFAKLGKLIGP  386

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ 
Sbjct  387   RAHSTWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRD  446

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL  LK+  DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA WF+ 
Sbjct  447   YLTNLKKATDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFRK  506

Query  105   FLRRN  91
              L+RN
Sbjct  507   LLKRN  511



>gb|KCW83982.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=513

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/494 (73%), Positives = 412/494 (83%), Gaps = 7/494 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN  484
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFAYA+ 
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKL  379

Query  483   GVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP + LSENGMD  GN+TL++ L+DT R
Sbjct  380   GVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLSQGLHDTTR  439

Query  303   ISYYKSYLAELKR-VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKM  127
             I++YK YL +LK+  VDDGANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKM
Sbjct  440   INFYKGYLTQLKKAAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKM  499

Query  126   SAYWFQNFLRRNKH  85
             SAYWF+  L R K+
Sbjct  500   SAYWFKQLLTRKKN  513



>ref|XP_008374823.1| PREDICTED: beta-glucosidase 44-like [Malus domestica]
Length=513

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/487 (74%), Positives = 404/487 (83%), Gaps = 6/487 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             + PE V+ +TGGLSR SF   FVFGTA+SAYQVEG  +  K GRGPSIWD F+K PG+  
Sbjct  29    LEPESVKLDTGGLSRASFRKDFVFGTATSAYQVEGMAN--KEGRGPSIWDAFVKIPGIIA  86

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NN T +VAVDQYHRYK DIDLM  LNFDAYRFSISW+RIFPNGTG VNWKGVAYYNRLIN
Sbjct  87    NNGTADVAVDQYHRYKDDIDLMASLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYNRLIN  146

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  147   YLLKRGITPYANLYHYDLPLALEKKYLGLLSDKVVKDFADYADFCFKTFGDRVKNWMTFN  206

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRV+AALGYD GF APGRCS    NCT GNSATEPY+ AH+LIL H  A QRYR  YQ 
Sbjct  207   EPRVIAALGYDNGFHAPGRCSKAFGNCTAGNSATEPYIAAHHLILSHGAAVQRYREKYQK  266

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVGDRL
Sbjct  267   IQKGRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRL  326

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGS+DYVGINQYTT+Y+Y P P    +  YQ DWN GFAYA+NGVPIGP
Sbjct  327   PKFTKEEVKMVKGSMDYVGINQYTTYYMYHPKPSKSNVLGYQQDWNAGFAYAKNGVPIGP  386

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA S WLY VPWGLYKAV Y+KE YGNP + LSENGMD  GN+TLAE L DT R ++Y+S
Sbjct  387   RAYSYWLYQVPWGLYKAVMYIKEHYGNPPVILSENGMDDPGNVTLAEGLRDTTRANFYRS  446

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             Y+ +LK+  DDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSA WF+ 
Sbjct  447   YITQLKKAADDGANVMGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSANWFKK  506

Query  105   FLRRNKH  85
              L RNKH
Sbjct  507   LLTRNKH  513



>emb|CAN74265.1| hypothetical protein VITISV_040977 [Vitis vinifera]
Length=506

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/498 (73%), Positives = 416/498 (84%), Gaps = 15/498 (3%)
 Frame = -3

Query  1548  IVQC-----DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWD  1384
             ++QC     + + E + FNT GLSRESFP G VFGTA+SAYQVEG  D  K GRGPSIWD
Sbjct  14    VIQCVADAAEHNEESLIFNTHGLSRESFPKGLVFGTATSAYQVEGMAD--KDGRGPSIWD  71

Query  1383  TFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWK  1204
              F++ PG+  NN TGEVAVDQYHRYK DIDLM  LNF+AYRFSISW+RIFP GTGKVNWK
Sbjct  72    VFIRKPGIVANNGTGEVAVDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWK  131

Query  1203  GVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFG  1024
             GVAYYNRLINY+L+KGITPYANL HYDLP ALE +Y G L  +VV+D+ADYA+FCFK+FG
Sbjct  132   GVAYYNRLINYLLKKGITPYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFG  191

Query  1023  DRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVA  856
             DRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A
Sbjct  192   DRVKNWMTFNEPRVVAALGYDNGFFAPGRCSREYGNCTAGNSGTEPYIVAHHLILSHAAA  251

Query  855   AQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPK  676
              QRYR  YQ +QKGR GILLDFVWYEPLTRSKADN AAQR+RDFH+GWF+HPIVYGEYP+
Sbjct  252   VQRYREKYQKEQKGRIGILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPR  311

Query  675   TMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF  499
             TMQ IVGDRLP+FT  EVK+VKGS+D+VGINQYT +Y+YD P PK P    YQ DW+ GF
Sbjct  312   TMQEIVGDRLPKFTKAEVKMVKGSMDFVGINQYTAYYMYDKPKPKVP---GYQEDWHAGF  368

Query  498   AYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESL  319
             AY ++GVPIGPRA S WLY VPWGLYKAVTY+KERYGNP + LSENGMD  GN+TL++ L
Sbjct  369   AYEKHGVPIGPRAYSSWLYKVPWGLYKAVTYIKERYGNPTVILSENGMDDPGNVTLSQGL  428

Query  318   NDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKR  139
             +DTKR+++Y +YL ELK+ +DDGAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVD+ TLKR
Sbjct  429   HDTKRVNFYTNYLTELKKAIDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDWRTLKR  488

Query  138   YPKMSAYWFQNFLRRNKH  85
             YPKMSA WF+  L +  H
Sbjct  489   YPKMSAKWFKQMLAQKGH  506



>gb|EPS65829.1| beta-mannosidase, partial [Genlisea aurea]
Length=472

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/474 (76%), Positives = 399/474 (84%), Gaps = 6/474 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR+SF  GFVFGTA+SAYQVEGA   H+ GRGPSIWDTF+KTPG+E NNATGEV+ DQY
Sbjct  1     LSRQSFRNGFVFGTAASAYQVEGA--AHEDGRGPSIWDTFIKTPGIEANNATGEVSADQY  58

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             H+YK DIDLM KLNFDAYRFS+SW RIFPNGTG VNWKGV YYNRLINYML KGITPY N
Sbjct  59    HKYKEDIDLMAKLNFDAYRFSVSWPRIFPNGTGGVNWKGVDYYNRLINYMLRKGITPYLN  118

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             LNHYDLPQAL+ RY GWL RQVV+D+ADYAEFCF+ FGDRVKNW +FNEPRVVAALGYD 
Sbjct  119   LNHYDLPQALQHRYQGWLSRQVVKDFADYAEFCFETFGDRVKNWQTFNEPRVVAALGYDN  178

Query  957   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  790
             G FAPGRCS    NCT GNSATEPY+VAHNLIL HA A  RYR  YQAKQ+GR GILLDF
Sbjct  179   GIFAPGRCSKPFGNCTSGNSATEPYIVAHNLILSHAAAVGRYRRNYQAKQQGRIGILLDF  238

Query  789   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  610
              WYEP TRSKAD+YAAQRARDFH+GWFLHP+VYGEYPKTMQNIV +RLP+FT  EVK+VK
Sbjct  239   TWYEPHTRSKADSYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVSERLPKFTSREVKMVK  298

Query  609   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPW  430
             GS D+VG+NQYT +Y YD     P    YQ DWN GFAY RNG+PIGPRANS WLY+VPW
Sbjct  299   GSFDFVGLNQYTAYYAYDAGRPNPTNKGYQQDWNCGFAYERNGIPIGPRANSYWLYIVPW  358

Query  429   GLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDG  250
             GLYKAV+Y+KERYGNP + LSENGMD  GNLTL E+L D +RI YY+ Y+ ELKR VD+G
Sbjct  359   GLYKAVSYIKERYGNPTVILSENGMDQPGNLTLPEALRDRRRIDYYERYIGELKRAVDEG  418

Query  249   ANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             AN+ GYF W+ +DNFEWR+GYTSRFGIVYVDF TL+RYPK SAYWF  F +R K
Sbjct  419   ANVIGYFQWTFVDNFEWRLGYTSRFGIVYVDFKTLRRYPKSSAYWFGKFQKREK  472



>gb|KHN23728.1| Beta-glucosidase 44 [Glycine soja]
Length=450

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/449 (78%), Positives = 391/449 (87%), Gaps = 4/449 (1%)
 Frame = -3

Query  1419  VHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTR  1240
              HK GRGPSIWD F+K PG+  NN TGEV+VDQYHRYK DIDLM  LNFDAYRFSISW+R
Sbjct  2     AHKDGRGPSIWDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSR  61

Query  1239  IFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDY  1060
             IFPNGTG+VNWKGVAYYNRLINY+LEKGITPYANL HYDLP ALE+RY G L RQVV+D+
Sbjct  62    IFPNGTGQVNWKGVAYYNRLINYLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDF  121

Query  1059  ADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYV  892
             ADYAEFCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+
Sbjct  122   ADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYI  181

Query  891   VAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGW  712
             VAHNLIL HA A QRYRA YQ KQKGR GILLDFVWYEPLTRSKADN+AAQRARDFHIGW
Sbjct  182   VAHNLILSHAAAVQRYRAKYQEKQKGRIGILLDFVWYEPLTRSKADNFAAQRARDFHIGW  241

Query  711   FLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYI  532
             F+HP+VYGEYPKT+QNIVG+RLP+FT +EVK+VKGSID+VGINQYTTF++YDP+   P +
Sbjct  242   FIHPLVYGEYPKTIQNIVGNRLPKFTSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKV  301

Query  531   HTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMD  352
               YQ DWN GFAYA+NGVPIGPRANS WLY VPWG+YK++ Y+KERYGNP + LSENGMD
Sbjct  302   PGYQMDWNAGFAYAKNGVPIGPRANSYWLYNVPWGMYKSLIYIKERYGNPTVILSENGMD  361

Query  351   YVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFG  172
               GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFAWSLLDNFEWR+GYTSRFG
Sbjct  362   DPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFG  421

Query  171   IVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             IVYVDF TLKRYPKMSAYWF+  + + K+
Sbjct  422   IVYVDFKTLKRYPKMSAYWFKQLITKKKY  450



>gb|KFK39134.1| beta-glucosidase 44 [Arabis alpina]
Length=514

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/483 (73%), Positives = 406/483 (84%), Gaps = 7/483 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E+++ +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NA
Sbjct  32    EKIKLDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNA  89

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             T E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+NWKGVAYYNRLI+Y++
Sbjct  90    TAELTVDQYHRYKEDVDLMKNLNFDAYRFSISWSRIFPEGTGKINWKGVAYYNRLIDYLI  149

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             +KGITPYANL HYDLP ALE +Y G LGR+VVED+ADYA+FCF +FGDRVKNW +FNEPR
Sbjct  150   QKGITPYANLYHYDLPLALEKKYKGLLGREVVEDFADYAQFCFNLFGDRVKNWMTFNEPR  209

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VV+ALGYD G FAPGRCS    NCTQGNSATEPY+V H+LIL HA A QRYR  YQAKQK
Sbjct  210   VVSALGYDNGIFAPGRCSKAFGNCTQGNSATEPYIVTHHLILAHAAAVQRYRKYYQAKQK  269

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFVWYEPLTRSKADN AAQRARDFHIGWF+HP+VYGEYPKTMQ IV +RLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQYIVKERLPKF  329

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRA  460
             T +EVK+VKGSID+VGINQYTT+++ D + P  P    YQ DWN  F++A+ G PIGPRA
Sbjct  330   TEEEVKMVKGSIDFVGINQYTTYFMSDTHNPTIPKDLGYQQDWNATFSFAKLGKPIGPRA  389

Query  459   NSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYL  280
              S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL
Sbjct  390   YSYWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYL  449

Query  279   AELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
              +LK+ VDDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA WF+  L
Sbjct  450   TQLKKAVDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFKQLL  509

Query  99    RRN  91
             +RN
Sbjct  510   KRN  512



>ref|XP_007036681.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
 gb|EOY21182.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
Length=532

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/470 (74%), Positives = 398/470 (85%), Gaps = 6/470 (1%)
 Frame = -3

Query  1539  CDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1360
               V PE V+ +TGGLSRESFP GFVFGTA+SAYQVEG       GRGPSIWD F+K PG+
Sbjct  27    SQVQPETVKLDTGGLSRESFPKGFVFGTATSAYQVEGMASGD--GRGPSIWDVFVKIPGI  84

Query  1359  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1180
                NATGEV+VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP+GTGKVNWKGVAYYNRL
Sbjct  85    VAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRL  144

Query  1179  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  1000
             I+ +L++GITPYANL HYDLP+ALE RY G L  QVV+D+AD+A+FCFK FGDRVKNW +
Sbjct  145   IDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNWMT  204

Query  999   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL H  A QRYR  Y
Sbjct  205   FNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILAHGAAVQRYRLKY  264

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+
Sbjct  265   QPKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGN  324

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  472
             RLP+FT +EVK+VKGSID+VGINQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPI
Sbjct  325   RLPKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPI  384

Query  471   GPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYY  292
             GPRANS WLY VPWGLYKA+ Y+KERYGNP + LSENGMD  GN+TL++ L+DT RI+YY
Sbjct  385   GPRANSNWLYNVPWGLYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYY  444

Query  291   KSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLK  142
             K+YL +L++ VD GAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF  LK
Sbjct  445   KAYLTQLRKAVDGGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFSNLK  494



>ref|XP_006297463.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
 gb|EOA30361.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
Length=511

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/481 (76%), Positives = 408/481 (85%), Gaps = 7/481 (1%)
 Frame = -3

Query  1515  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1336
             R +TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NAT E
Sbjct  32    RLDTGGLSRQSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNATAE  89

Query  1335  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1156
             + VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGKVNWKGVAYYNRLI+Y+++KG
Sbjct  90    ITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNRLIDYLVQKG  149

Query  1155  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  976
             ITPYANL HYDLP ALE +Y G LGRQVVED+ADYAEFCFK FGDRVKNW +FNEPRVVA
Sbjct  150   ITPYANLYHYDLPLALEKKYKGLLGRQVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVA  209

Query  975   ALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
             ALGYD G FAPGRCS    NCT+GNSATEPY+V+H+LIL HA AAQRYR  YQAKQKGR 
Sbjct  210   ALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILAHAAAAQRYRKYYQAKQKGRI  269

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP+FT D
Sbjct  270   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTAD  329

Query  627   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSE  451
             EVK+VKGSID+VGINQYTT+Y+ +P+P T      YQ DWNV F +A+ G PIG RA S+
Sbjct  330   EVKMVKGSIDFVGINQYTTYYMSEPHPTTKSKDLGYQQDWNVEFGFAKLGKPIGSRAYSK  389

Query  450   WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAEL  271
             WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ YL  L
Sbjct  390   WLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNL  449

Query  270   KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRN  91
             K+  DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA WF+  L+RN
Sbjct  450   KKARDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYTTLKRYPKMSAQWFRKLLKRN  509

Query  90    K  88
             K
Sbjct  510   K  510



>ref|XP_006406654.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 ref|XP_006406658.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
 gb|ESQ48107.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 gb|ESQ48111.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
Length=512

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/482 (73%), Positives = 403/482 (84%), Gaps = 7/482 (1%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             + +F+TGGLSR+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   NNAT
Sbjct  31    KFKFDTGGLSRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIANNAT  88

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP G GK+NWKGVAYYNRLI+Y+++
Sbjct  89    AEITVDQYHRYKEDVDLMKNLNFDAYRFSISWSRIFPEGAGKINWKGVAYYNRLIDYLIQ  148

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GITPYANL HYDLP ALE +Y G LGRQVVED+A+YAEFCFK FGDRVKNW +FNEPRV
Sbjct  149   RGITPYANLYHYDLPLALEKKYKGLLGRQVVEDFANYAEFCFKTFGDRVKNWMTFNEPRV  208

Query  981   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             VAALGYD G FAPGRCS    NCTQGNSATEPY+V+H+LIL HA A QRYR  YQAKQKG
Sbjct  209   VAALGYDNGIFAPGRCSKTYGNCTQGNSATEPYIVSHHLILAHAAAVQRYRKNYQAKQKG  268

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             R GILLDFVWYEPL +SKAD  AAQRARDFHIGWF+HP+VYGEYPKTMQ IV +RLP+FT
Sbjct  269   RIGILLDFVWYEPLQKSKADYLAAQRARDFHIGWFIHPLVYGEYPKTMQLIVKERLPKFT  328

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRAN  457
              +EVK+VKGSID+VGINQYTT+++ D +  T P    YQ DWNV F +++ G PIGPRAN
Sbjct  329   EEEVKMVKGSIDFVGINQYTTYFMSDTHNSTIPKDLGYQQDWNVTFGFSKLGKPIGPRAN  388

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY VPWG+YKA+ Y+KE YGNP M LSENGMD  GN TLA+ L+DT RI YY+ YL 
Sbjct  389   SYWLYNVPWGMYKALMYMKEHYGNPTMILSENGMDDPGNFTLAQGLHDTTRIKYYRDYLT  448

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             +LK+ VDDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD++TLKRYPKMSA WF   L+
Sbjct  449   QLKKAVDDGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDYNTLKRYPKMSALWFNQLLK  508

Query  96    RN  91
             RN
Sbjct  509   RN  510



>gb|KFK39133.1| beta-glucosidase 44 [Arabis alpina]
Length=497

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/489 (72%), Positives = 405/489 (83%), Gaps = 9/489 (2%)
 Frame = -3

Query  1533  VSPER--VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGL  1360
              SP R  V  +TGGLSR+SFP GF+FGTA+SAYQVEG T  ++ GRGPSIWD F+K PG 
Sbjct  10    ASPPRDSVPLDTGGLSRKSFPEGFLFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGK  67

Query  1359  EPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRL  1180
               NNAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+N KGVAYYNRL
Sbjct  68    IANNATAEITVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINLKGVAYYNRL  127

Query  1179  INYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFS  1000
             I+Y+++KGITPYANL HYDLP ALE +Y G L +QVV D+ADYAEFCFK FGDRVKNW +
Sbjct  128   IDYLIQKGITPYANLYHYDLPLALEQKYQGLLSKQVVVDFADYAEFCFKTFGDRVKNWMT  187

Query  999   FNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             FNEPRVVAALGYD G FAP RCS    NCT+GNSA EPY+VAH+LIL HA A QRYR  Y
Sbjct  188   FNEPRVVAALGYDNGIFAPARCSKAFGNCTEGNSAIEPYIVAHHLILAHATAVQRYRQNY  247

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q KQKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HP+VYGEYPKTMQNIV +
Sbjct  248   QEKQKGRIGILLDFVWFEPLTSSEADNDAAQRARDFHVGWFIHPVVYGEYPKTMQNIVKE  307

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVP  475
             RLPRFT +EVK+VKGSID+VGINQYTT+++ DP+  TP     YQ DWNV F +A+NG P
Sbjct  308   RLPRFTEEEVKMVKGSIDFVGINQYTTYFMSDPHLSTPPKDLGYQQDWNVAFNFAKNGTP  367

Query  474   IGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISY  295
             IG RA+SEWLY VPWG+YKA+ Y+KE YGNP M LSENGMD  GN+TLA+ LNDT R +Y
Sbjct  368   IGSRAHSEWLYNVPWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRTNY  427

Query  294   YKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYW  115
             Y+ YL +LK+ VDDGANL GYFAWSLLDNFEW  GYTSRFGIVYVD+ +LKRYPKMSA W
Sbjct  428   YRDYLLQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYQSLKRYPKMSALW  487

Query  114   FQNFLRRNK  88
             F+  L+R++
Sbjct  488   FKQLLKRDQ  496



>ref|XP_010686092.1| PREDICTED: beta-glucosidase 44-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/488 (72%), Positives = 403/488 (83%), Gaps = 6/488 (1%)
 Frame = -3

Query  1542  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             QC       +F++GGLSR+SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG
Sbjct  29    QCKALALATKFHSGGLSRKSFPKGFVFGTATSAYQVEGM--AHKDGRGPSIWDEFVKKPG  86

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
             +  NNAT EV+VDQYHRYK D+D+M  LN DAYRFSISW+RIFP G G+VNWKGVAYYNR
Sbjct  87    IIANNATAEVSVDQYHRYKEDVDIMANLNMDAYRFSISWSRIFPKGAGEVNWKGVAYYNR  146

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+Y++E+GITPYANL HYDLP ALE +Y G L  +VV+D+ DYAEFCFK +GDRVKNW 
Sbjct  147   LIDYLIERGITPYANLYHYDLPLALERKYKGLLSPRVVKDFGDYAEFCFKTYGDRVKNWM  206

Query  1002  SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +FNEPRV+AALGY+ GF APGRCS    NCT+GNS TEPY+ AH+LIL HA A QRYR  
Sbjct  207   TFNEPRVIAALGYNDGFHAPGRCSKEYGNCTEGNSGTEPYIAAHHLILSHAEAVQRYRQK  266

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             Y AKQKGR GILLDFVWYEPLTR K DNYAAQRARDFHIGWF+HPIVYGEYPKTMQ+IV 
Sbjct  267   YLAKQKGRIGILLDFVWYEPLTRGKKDNYAAQRARDFHIGWFIHPIVYGEYPKTMQDIVK  326

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP  475
             DRLP+FT +EVK+VKGS+D+VGINQYTT+Y+Y+    T     YQ DW+ GF +++NGV 
Sbjct  327   DRLPKFTTEEVKMVKGSMDFVGINQYTTYYMYNQQINTTKPPGYQQDWHAGFNFSKNGVQ  386

Query  474   IGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISY  295
             IGPRANS WLY VPWGLYKA+ Y+KERYGNP M LSENGMD  GN+TLAE L+DTKRI Y
Sbjct  387   IGPRANSYWLYEVPWGLYKAINYIKERYGNPTMILSENGMDDPGNVTLAEGLHDTKRIHY  446

Query  294   YKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYW  115
             Y+SYL  LK+ +D+GAN+ GYFAWSL+DNFEWR+GYTSRFGIVYVD+  LKRYPKMSA W
Sbjct  447   YRSYLVALKKTIDEGANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDYKDLKRYPKMSANW  506

Query  114   FQNFLRRN  91
             F+  LRR 
Sbjct  507   FKYMLRRQ  514



>ref|XP_004299545.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/479 (73%), Positives = 402/479 (84%), Gaps = 9/479 (2%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL R SFP GFVFGTA+SAYQVEG  +  K GRGPSIWDTF+K PG+  NNATG+V VD
Sbjct  37    GGL-RASFPKGFVFGTATSAYQVEGMAN--KEGRGPSIWDTFVKIPGIVANNATGDVTVD  93

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK DIDL+  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYNRLI+Y+L++GITPY
Sbjct  94    QYHRYKEDIDLLANLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNRLIDYLLKRGITPY  153

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
             ANL HYDLP ALE +Y G L  +VV+D+AD+A+FCFK +GDRVKNW +FNEPRVVAALGY
Sbjct  154   ANLYHYDLPLALEKKYLGLLSDRVVKDFADFADFCFKTYGDRVKNWMTFNEPRVVAALGY  213

Query  963   DTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             DTGFFAPGRCS    NCT GNS TEPY+ AH+LIL HA A QRYR  YQ  QKG+ GILL
Sbjct  214   DTGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILSHAAAVQRYREKYQKTQKGKIGILL  273

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEPLTRSKAD YAAQRARDFH+GWF+HPIVYGEYPKT+QNIVG+RLP+FT +EVK+
Sbjct  274   DFVWYEPLTRSKADRYAAQRARDFHVGWFIHPIVYGEYPKTIQNIVGNRLPKFTKEEVKM  333

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHT--YQNDWNVGFAYARNGVPIGPRANSEWLY  442
             VKGS+D+VGIN+YT +Y+Y P       +   YQNDWN GFAY +NGVPIGPRA S WLY
Sbjct  334   VKGSMDFVGINEYTAYYIYAPDKNQTKSNALGYQNDWNAGFAYEKNGVPIGPRAYSSWLY  393

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
              VPWG+YK +TY+KE YGNP + LSENGMD  GN TL ++L+DT RI YY+SYL +LK+ 
Sbjct  394   QVPWGMYKCITYIKEHYGNPPVILSENGMDNPGNQTLPKALHDTNRIHYYRSYLEQLKKA  453

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             VD+GAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+  L + KH
Sbjct  454   VDEGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTTLKRYPKMSAYWFKKLLTKKKH  512



>ref|XP_002883106.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59365.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/490 (72%), Positives = 403/490 (82%), Gaps = 9/490 (2%)
 Frame = -3

Query  1536  DVSP--ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             D SP  + V  +TG L+R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG
Sbjct  15    DSSPSGDAVPLDTGDLNRQSFPKGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPG  72

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
                NNAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP G+GK+NW GVAYYNR
Sbjct  73    KIANNATAEITVDQYHRYKEDVDLMENLNFDAYRFSISWSRIFPEGSGKINWNGVAYYNR  132

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+Y+++KGITPYANL HYDLP  LE +Y G L +QVV+D+ADYAEFCFK FGDRVKNW 
Sbjct  133   LIDYLIQKGITPYANLYHYDLPLVLERKYQGLLSKQVVDDFADYAEFCFKTFGDRVKNWM  192

Query  1002  SFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +FNEPRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  
Sbjct  193   TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHAAAVQRYRQN  252

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             Y+ KQKGR GILLDFVW+EPLT SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV 
Sbjct  253   YKEKQKGRIGILLDFVWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPYTMQNIVK  312

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGV  478
             +RLP+F  +EVK+VKGSID+VGINQYTT+++ DP   T P    YQ DWNV F +A+NG 
Sbjct  313   ERLPKFAEEEVKMVKGSIDFVGINQYTTYFMSDPKISTIPKDLGYQQDWNVTFNFAKNGT  372

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRA+SEWLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TL +  NDT RI 
Sbjct  373   PIGPRAHSEWLYNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNITLTQGQNDTTRIK  432

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+ YLA+LK+ VDDGANL GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA 
Sbjct  433   YYRDYLAQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSAL  492

Query  117   WFQNFLRRNK  88
             WF+  L+R++
Sbjct  493   WFKQLLKRDQ  502



>ref|XP_010487721.1| PREDICTED: beta-glucosidase 43 [Camelina sativa]
Length=504

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/486 (72%), Positives = 402/486 (83%), Gaps = 7/486 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             S + V  +T  L+RESFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  20    SGDGVPMDTSDLNRESFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  77

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT E+ VDQYHRYK D+DLM  LNFDAYRFSISW+RIFP GTGK+NW GVAYYNRLI+Y
Sbjct  78    NATAELTVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLIDY  137

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ++ KGI PYANL HYDLP ALE +Y G L +QVVED+ DYAEFCFK FGDRVKNW +FNE
Sbjct  138   LILKGIKPYANLYHYDLPLALEQKYQGLLSKQVVEDFVDYAEFCFKTFGDRVKNWMTFNE  197

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL H+ A QRYR IYQ K
Sbjct  198   PRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHSAAVQRYRQIYQEK  257

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYG+YP TMQNIV +RLP
Sbjct  258   QKGRIGILLDFVWFEPLTSSEADNDAAQRARDFHVGWFIHPIVYGKYPNTMQNIVKERLP  317

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGP  466
             +FT +EVK+VKGSID++GINQYTT+++ DP   T P    YQ DWNV F +A+NG PIGP
Sbjct  318   KFTEEEVKMVKGSIDFIGINQYTTYFMSDPKISTPPKALGYQQDWNVAFNFAKNGTPIGP  377

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+SEWLY VPWG+YKA+ Y+KE YGNP M LSENGMD  GN+TLA+ LNDT RI+YY+ 
Sbjct  378   RAHSEWLYNVPWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRINYYRD  437

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YLA+LK+ VD+GAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+ 
Sbjct  438   YLAQLKKAVDEGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQ  497

Query  105   FLRRNK  88
              L+R++
Sbjct  498   LLKRDQ  503



>ref|XP_010314225.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Solanum lycopersicum]
Length=502

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/492 (72%), Positives = 401/492 (82%), Gaps = 31/492 (6%)
 Frame = -3

Query  1548  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             I   +V  E   F+TGGL+RESFP GFVFGT++SAYQVEGA    K GRGPS+WDTF+K 
Sbjct  38    IESDNVLAETTVFDTGGLNRESFPKGFVFGTSTSAYQVEGAAS--KDGRGPSVWDTFIKQ  95

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG EPNNA+GEV+ DQYH YK DIDLMVKLNFDAYRFSISW+RIFP+             
Sbjct  96    PGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPS-------------  142

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
                        ITPY NLNHYDLPQAL++RY GWL R+VV+D+ADYAEFCFK +GDRVKN
Sbjct  143   -----------ITPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKN  191

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYR  841
             WFSFNEPRVVA LGYDTGFFAPGRCS    NCT G+SATEPY+VAHNLIL HA AA RYR
Sbjct  192   WFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILSHAAAAHRYR  251

Query  840   AIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNI  661
               YQ KQKG+FGI+LDFVWYEPLTRSKADNYAAQRARDF +GWFLHP+V+GEYPKTMQNI
Sbjct  252   KNYQEKQKGKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNI  311

Query  660   VGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG  481
             VG+RLP+FT +E+K+VKGSIDYVGIN YTTFY YD   K   +  YQ D N GFA  RNG
Sbjct  312   VGNRLPKFTTEEIKMVKGSIDYVGINHYTTFYAYDHVSKLKAL-AYQQDQNCGFANDRNG  370

Query  480   VPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRI  301
             VPIGPRA+S WLY+VPWGLYKAV YVKE YGNP + LSENGMDY GN++++E+L+DTKRI
Sbjct  371   VPIGPRAHSYWLYIVPWGLYKAVNYVKEHYGNPTILLSENGMDYAGNISISEALHDTKRI  430

Query  300   SYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSA  121
              YY+SYLAELK+ +D+GAN+ GYFAWSLLDNFEWR GYTSRFGIVYVD+ TL+RYPKMSA
Sbjct  431   DYYRSYLAELKKAIDEGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTTLERYPKMSA  490

Query  120   YWFQNFLRRNKH  85
             YWF   L+ +KH
Sbjct  491   YWFNQLLKSHKH  502



>ref|XP_009394432.1| PREDICTED: beta-glucosidase 1-like [Musa acuminata subsp. malaccensis]
Length=511

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/476 (72%), Positives = 401/476 (84%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
              +TGGLSR +FPAGF FGTA+SAYQVEG     + GRGPSIWD F+K PG   NNAT +V
Sbjct  36    LDTGGLSRGAFPAGFTFGTAASAYQVEGM--ALQDGRGPSIWDAFVKIPGEIANNATADV  93

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             +VD+YHRYK D+D+M K+NFDAYRFSISW+RIFP G G+VNWKGVAYYNRLINYML +GI
Sbjct  94    SVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPEGEGRVNWKGVAYYNRLINYMLLRGI  153

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLP+ALE +Y G L R++V+ YA+YAEFCFK FGDRVKNW +FNEPRVVAA
Sbjct  154   TPYANLYHYDLPEALEKKYNGLLSRRIVDAYANYAEFCFKTFGDRVKNWMTFNEPRVVAA  213

Query  972   LGYDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             LGYD G FAPGRC+NC+ GNSATEPY+VAHN+IL HA A +RYR  YQAKQKGR GILLD
Sbjct  214   LGYDDGKFAPGRCTNCSAGNSATEPYIVAHNMILSHAAAVKRYRDKYQAKQKGRIGILLD  273

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
             FVWYEPLT SK D  AAQR+RDFH+GWFLHPI+YGEYPK+MQ IV  RLP+FT +E+K+V
Sbjct  274   FVWYEPLTDSKDDQDAAQRSRDFHLGWFLHPIIYGEYPKSMQEIVQARLPKFTEEEIKMV  333

Query  612   KGSIDYVGINQYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             KGSIDYVGINQYT +Y++DP+ PK      YQ+DWN GFA+ RNGVPIGPRA+SEWLY+V
Sbjct  334   KGSIDYVGINQYTAYYMFDPHLPKQEKPTRYQSDWNAGFAFERNGVPIGPRAHSEWLYIV  393

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+YKAVTYVKE YGNP + LSENGMD  GN+TL + L+DT RI+YY+SY+ ELK+ +D
Sbjct  394   PWGMYKAVTYVKEHYGNPTVILSENGMDDPGNVTLRQGLHDTTRINYYRSYITELKKAID  453

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEW+ GYTSRFGIVYVD+  L+RY KMSAYWF+  L R K
Sbjct  454   DGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKNLRRYAKMSAYWFKQMLDRGK  509



>ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=509

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/481 (74%), Positives = 412/481 (86%), Gaps = 4/481 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             +  RVRF+TGGLSRE+FPAGFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   N
Sbjct  29    TASRVRFDTGGLSREAFPAGFVFGTAASAYQVEGM--ALKDGRGPSIWDVFVKIPGEIAN  86

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT +V+VD+YHRYK D+D+M K+NFDAYRFSISW+RIFPNG GKVNW+GV+YYNRLINY
Sbjct  87    NATADVSVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPNGAGKVNWEGVSYYNRLINY  146

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ML+KG+TPYANL HYDLP+ALE +Y G L  +VVE YADYA+FCFK FGDRVKNWF+FNE
Sbjct  147   MLKKGVTPYANLYHYDLPEALEKQYNGLLSPKVVEAYADYADFCFKTFGDRVKNWFTFNE  206

Query  990   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             PRVVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA A +RYR  YQAKQKG
Sbjct  207   PRVVAALGYDDGTFAPGRCTNCSAGGNSATEPYIVAHNLILSHAAAVKRYREKYQAKQKG  266

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             R GILLDFVWYE LT S AD  AAQRARDFH+GWFLHPI+YGEYPKT+Q IV +RLP+FT
Sbjct  267   RIGILLDFVWYEALTSSTADQAAAQRARDFHVGWFLHPIIYGEYPKTIQEIVKERLPKFT  326

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRAN  457
              +EVK+VKGSIDYVGINQYTT+Y+YDP+   P   T Y NDW+VG+AY R+GVPIGPRA+
Sbjct  327   EEEVKMVKGSIDYVGINQYTTYYMYDPHQPEPQKPTSYANDWHVGYAYERDGVPIGPRAH  386

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY+VPWG+YKAV+YVKE Y NP + LSENGMD  GN+TL + L+DT RI+YYKSY+ 
Sbjct  387   SNWLYIVPWGMYKAVSYVKEHYCNPTVILSENGMDDPGNITLPKGLHDTTRINYYKSYIT  446

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             ELK+ +DDGAN+ GYFAWSLLDNFEW+ GYTSRFGIVYVDF  LKRYPKMSAYWF++ L+
Sbjct  447   ELKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFTNLKRYPKMSAYWFRDMLK  506

Query  96    R  94
             R
Sbjct  507   R  507



>gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar]
Length=491

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/477 (72%), Positives = 397/477 (83%), Gaps = 3/477 (1%)
 Frame = -3

Query  1515  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1336
             R + GGL+R+ FP GF FGTA+SAYQVEG     K GRGPSIWD F+K PG   NNAT  
Sbjct  17    RTDAGGLNRDKFPVGFTFGTAASAYQVEGM--ALKDGRGPSIWDDFVKIPGEIKNNATAA  74

Query  1335  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1156
             V VD+YHRYK DI++M  +NFDAYRFSISW+RIFPNG+GKVNWKGVAYYNRLI+YML++G
Sbjct  75    VTVDEYHRYKVDINIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQG  134

Query  1155  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  976
             ITP+ANL HYDLP ALE  Y G L R VV+DYADYAEFCFK FGDRVKNWF+FNEPRVVA
Sbjct  135   ITPFANLYHYDLPDALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVA  194

Query  975   ALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             ALGYD G FAPGRC+ CT G NS TEPY+VAHNLIL HA A +RYR  YQ  QKGR GIL
Sbjct  195   ALGYDNGIFAPGRCTGCTAGGNSTTEPYIVAHNLILSHAAALKRYRDKYQVSQKGRIGIL  254

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
             LDFVWYEPLT S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RLP FT +E+ 
Sbjct  255   LDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLPTFTAEEIS  314

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYM  439
             LVKGS+DY+G+NQYT++Y++DP+  T     YQ DWNVGFAY RNGVPIGPRANSEWLY+
Sbjct  315   LVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRANSEWLYI  374

Query  438   VPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVV  259
             VPWG+YKAVTYVKE Y NP + LSENGMD  GN++L   L+DT R++YYKSY++ELKR +
Sbjct  375   VPWGMYKAVTYVKENYQNPTIILSENGMDDPGNVSLKVGLHDTTRLNYYKSYISELKRAI  434

Query  258   DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DDGA + GYFAWSLLDNFEW+ GYTSRFGIVYVDF TLKRYPKMSAYWF++ L++ K
Sbjct  435   DDGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQKKK  491



>gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar]
Length=501

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/513 (68%), Positives = 410/513 (80%), Gaps = 16/513 (3%)
 Frame = -3

Query  1623  FFLVLFLMARRAPllllllvlttVSIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSA  1444
             FFL++FL  R +             +    V+  R   + GGL+R++FP GF FGTA+SA
Sbjct  4     FFLLIFLFPRTS-----------QPVAAAPVAGSRT--DAGGLNRDNFPVGFTFGTAASA  50

Query  1443  YQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAY  1264
             YQVEG     K GRGPSIWD F+K PG   NNAT  V VD+YHRYK DID+M  +NFDAY
Sbjct  51    YQVEGM--ALKDGRGPSIWDEFIKIPGEIKNNATAAVTVDEYHRYKVDIDIMKNMNFDAY  108

Query  1263  RFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWL  1084
             RFSISW+RIFPNG+GKVNWKGVAYYNRLI+YML++GITP+ANL HYDLP+ALE  Y G L
Sbjct  109   RFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQGITPFANLYHYDLPEALEKSYNGLL  168

Query  1083  GRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQG-NSA  907
              R VV+DYADYAEFCFK FGDRVKNWF+FNEPRVVAALGYD G FAPGRC+ CT G NS 
Sbjct  169   SRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVAALGYDNGIFAPGRCTGCTAGGNST  228

Query  906   TEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARD  727
             TEPY+VAHNLIL HA A +RYR  Y   QKGR GILLDFVWYEPLT S  D  AAQRARD
Sbjct  229   TEPYIVAHNLILSHAAAVKRYRDKYHVSQKGRIGILLDFVWYEPLTNSTDDEAAAQRARD  288

Query  726   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  547
             FHIGWFLHPI+YGEYPK++Q+IV +RLP FT +E+ +VKGS+DY+G+NQYT++Y++DP+ 
Sbjct  289   FHIGWFLHPIIYGEYPKSVQDIVKERLPTFTAEEISIVKGSVDYLGVNQYTSYYMFDPHL  348

Query  546   KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  367
              T     YQ DWNVGFAY R+GVPIGPRANS+WLY+VPWG+YKAVTYVKE Y NP + LS
Sbjct  349   PTQTSTGYQTDWNVGFAYERDGVPIGPRANSDWLYIVPWGMYKAVTYVKENYQNPTIILS  408

Query  366   ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  187
             ENGMD  GN++L   ++D  R++YYKSY++ELKR +DDGA + GYFAWSLLDNFEW++GY
Sbjct  409   ENGMDDPGNVSLTVGVHDATRLNYYKSYISELKRAIDDGATVIGYFAWSLLDNFEWKLGY  468

Query  186   TSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             TSRFGIVYVDF TLKRYPKMSAYWF++ L++ K
Sbjct  469   TSRFGIVYVDFKTLKRYPKMSAYWFKDVLQKKK  501



>emb|CDO98378.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/445 (76%), Positives = 383/445 (86%), Gaps = 4/445 (1%)
 Frame = -3

Query  1413  KYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIF  1234
             K GRGPSIWDTF+K PG EPNNATGEV VD+YHRYK+D+DLM +LNFDAYRFSISW+RIF
Sbjct  4     KDGRGPSIWDTFIKAPGREPNNATGEVTVDEYHRYKKDVDLMKRLNFDAYRFSISWSRIF  63

Query  1233  PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYAD  1054
             PNGTGKVNWKGVAYYNRLI+YM+++GITPYANLNHYDLPQ L+DRY GWLGR+V +D+AD
Sbjct  64    PNGTGKVNWKGVAYYNRLIDYMIKQGITPYANLNHYDLPQELQDRYNGWLGREVAKDFAD  123

Query  1053  YAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVA  886
             YAEFCFK FGDRVKNWF+FNEPRV+AALGYD G+FAPGRCS    NCT GNSATEPY+ A
Sbjct  124   YAEFCFKTFGDRVKNWFTFNEPRVIAALGYDNGYFAPGRCSKAFGNCTAGNSATEPYIAA  183

Query  885   HNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  706
             HNLILCHA A QRYR  +Q +QKG+ GILLDFVWYEP T SK D+ AAQRARDFHIGWF+
Sbjct  184   HNLILCHASAVQRYREKHQEQQKGKIGILLDFVWYEPHTYSKEDSDAAQRARDFHIGWFM  243

Query  705   HPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT  526
             HP+VYGEYPK +QNIV DRLP+FT +EVK+VKGS DYVG+NQYT +Y+YDP+        
Sbjct  244   HPLVYGEYPKNLQNIVADRLPKFTKEEVKIVKGSFDYVGVNQYTAYYMYDPHRGQQKDLG  303

Query  525   YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYV  346
             YQ DWN GFAY RNGVPIGPRA+S+WLY VPWGLYKAV YVKE+Y NP + L+ENGMD  
Sbjct  304   YQQDWNCGFAYDRNGVPIGPRAHSDWLYKVPWGLYKAVMYVKEKYQNPTIILAENGMDDP  363

Query  345   GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIV  166
             GNLTL   L DT RISYYK+YLA+L++ +DDGAN+ GYFAWSLLDNFEWR+GYTSRFGIV
Sbjct  364   GNLTLPAGLKDTARISYYKAYLAQLRKTMDDGANVIGYFAWSLLDNFEWRLGYTSRFGIV  423

Query  165   YVDFDTLKRYPKMSAYWFQNFLRRN  91
             YVDF TLKRYPKMSA WFQ  L R 
Sbjct  424   YVDFKTLKRYPKMSARWFQKLLHRQ  448



>ref|XP_007033096.1| B-S glucosidase 44 [Theobroma cacao]
 gb|EOY04022.1| B-S glucosidase 44 [Theobroma cacao]
Length=514

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/479 (72%), Positives = 394/479 (82%), Gaps = 6/479 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
              +TGGLSRESFP GFVFGTA+SAYQVEG  +  K GRGPSIWD ++K PG   NN T +V
Sbjct  38    LDTGGLSRESFPKGFVFGTATSAYQVEGMAN--KDGRGPSIWDAYVKVPGHIANNDTADV  95

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYH YK DIDLM K NFDAYRFSISW+RIFP GTG+VNWKGVAYYNRLI+Y+++KGI
Sbjct  96    AVDQYHHYKEDIDLMAKFNFDAYRFSISWSRIFPEGTGRVNWKGVAYYNRLIDYLIKKGI  155

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPY NL HYDLP AL+++Y GWL RQ VEDYA+YAEFCFK FGDRVKNWF+FNEPR+VAA
Sbjct  156   TPYGNLYHYDLPLALQEKYNGWLNRQAVEDYANYAEFCFKTFGDRVKNWFTFNEPRIVAA  215

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNSATEPY+VAHNLIL HA A +RYR  YQ KQKGR G
Sbjct  216   LGFDNGINPPSRCSKEFGNCTAGNSATEPYIVAHNLILSHATAVKRYREKYQDKQKGRIG  275

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDF WYEPLTRSKAD YAAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLP+FT DE
Sbjct  276   ILLDFNWYEPLTRSKADEYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGERLPKFTKDE  335

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             +K+V GS+DYVGIN YT+ Y+YDP    P +  YQ DWN GFA A+NGV IGP+ANS WL
Sbjct  336   IKMVNGSMDYVGINHYTSTYIYDPKQPKPNVTGYQADWNAGFANAKNGVQIGPKANSWWL  395

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWG+YK VTYVKE YGN  +F+SENGMD  GN TL  +LNDT RI+++K Y+ +LK+
Sbjct  396   YIVPWGMYKTVTYVKEHYGNLNIFISENGMDDPGNGTLPNALNDTTRINFFKDYMTQLKK  455

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
              +DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TL+RYPKMSA WFQ  L + K
Sbjct  456   AIDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYTTLRRYPKMSANWFQKILEKKK  514



>ref|XP_010906974.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=510

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/482 (74%), Positives = 409/482 (85%), Gaps = 4/482 (1%)
 Frame = -3

Query  1527  PERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN  1348
             P R RF+TGGLSR +FPAGFVFGTA+SAYQVEG     K GRGP IWD F+K PG   NN
Sbjct  31    PSRARFDTGGLSRAAFPAGFVFGTAASAYQVEGMA--LKDGRGPCIWDVFVKIPGNIANN  88

Query  1347  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1168
             AT +V+VD+YHRYK D+D+M K+NFD YRFSISW+RIFPNG GKVNWKGVAYYNRLI+YM
Sbjct  89    ATADVSVDEYHRYKEDVDIMKKMNFDGYRFSISWSRIFPNGVGKVNWKGVAYYNRLIDYM  148

Query  1167  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  988
             L++GITPYANL HYDLPQALE +Y G L  ++VE YADYA+FCFK FGDRVKNWF+FNEP
Sbjct  149   LKQGITPYANLYHYDLPQALEVQYKGLLSAKIVEAYADYADFCFKTFGDRVKNWFTFNEP  208

Query  987   RVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGR  811
             RVVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA A +RYR  YQA QKGR
Sbjct  209   RVVAALGYDDGMFAPGRCTNCSAGGNSATEPYIVAHNLILSHAAAVKRYRDKYQATQKGR  268

Query  810   FGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  631
              GILLDFVWYEPLT S+AD  AAQRARDFH+GWFLHPIVYGEYPKT+Q+IV DRLP+FT 
Sbjct  269   IGILLDFVWYEPLTNSEADQAAAQRARDFHLGWFLHPIVYGEYPKTLQDIVKDRLPKFTV  328

Query  630   DEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANS  454
             +E+K+VKGSIDYVGIN YT++Y+YDP+   P   T Y NDWN GFA+ RNGVPIGPRA S
Sbjct  329   EEIKMVKGSIDYVGINHYTSYYMYDPHLPEPQKPTRYANDWNCGFAFERNGVPIGPRAYS  388

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY+VPWG+YKAVTYVKE+YGNP + LSENGMD  GN+TL   L+DT RI+YYKSY+ E
Sbjct  389   YWLYIVPWGMYKAVTYVKEQYGNPTVILSENGMDDPGNVTLPNGLHDTTRINYYKSYITE  448

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             LK+ +DDGAN+ GYFAWSLLDNFEW++GYTSRFG+VYVD+  LKRYPKMSAYWF   L+R
Sbjct  449   LKKAIDDGANVIGYFAWSLLDNFEWKLGYTSRFGLVYVDYRNLKRYPKMSAYWFGQMLQR  508

Query  93    NK  88
             NK
Sbjct  509   NK  510



>ref|XP_006644213.1| PREDICTED: beta-glucosidase 1-like [Oryza brachyantha]
Length=511

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/469 (73%), Positives = 395/469 (84%), Gaps = 2/469 (0%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGLSR SFPAGFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   NNAT +V V
Sbjct  41    TGGLSRRSFPAGFVFGTAASAYQVEGMA--LKDGRGPSIWDAFVKIPGEIANNATADVTV  98

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             D+YHRYK D+D+M ++ FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITP
Sbjct  99    DEYHRYKEDVDIMKRMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITP  158

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  159   YANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  218

Query  966   YDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             YD G FAPGRC+ C  GNSATEPY+VAH+LIL HA AAQ YR  YQ  QKGR GILLDFV
Sbjct  219   YDDGAFAPGRCTKCKAGNSATEPYIVAHHLILSHAAAAQIYRHKYQHVQKGRIGILLDFV  278

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLPRFT DE+++VKG
Sbjct  279   WYEGLTNSTADQDAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPRFTADEIQMVKG  338

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             SIDYVGINQYT +YV D  P    I +Y +DW+  FAY RNGVPIGPRANS+WLY+VPWG
Sbjct  339   SIDYVGINQYTAYYVRDQQPNATTIPSYSSDWHAAFAYERNGVPIGPRANSDWLYIVPWG  398

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             LYKAVTYVKE+YGNP M LSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGA
Sbjct  399   LYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVAQGVHDTARVAYYRSYITKLKEAIDDGA  458

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             N  GYFAWS+LDNFEW++GYTSRFG+VYVDF TL+RYPK SAYWF++ +
Sbjct  459   NCVGYFAWSMLDNFEWKLGYTSRFGLVYVDFATLRRYPKASAYWFRDVV  507



>ref|XP_009113531.1| PREDICTED: beta-glucosidase 43 [Brassica rapa]
Length=498

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 398/478 (83%), Gaps = 7/478 (1%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TG L+R+SFP GFVFGTA+SAYQVEG T  ++ GRGPSIWD F+K PG   NNAT E+ V
Sbjct  23    TGDLNRKSFPEGFVFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGKIANNATAELTV  80

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYH YK D+DLM  LNFDAYRFSISW+RIFP+GTGK+NW GVAYYNRLI+Y+++KGITP
Sbjct  81    DQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQKGITP  140

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP ALE +Y G LGR VVED+ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  141   YANLYHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  200

Query  966   YDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             YD G FAP RCS    NCT+GNSATEPY+VAH+LI+ HA A QRYR  YQ KQKGR GIL
Sbjct  201   YDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLIVAHASAVQRYRQHYQEKQKGRIGIL  260

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
             LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLP FT +EVK
Sbjct  261   LDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVK  320

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             +VKGSID+VGINQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPRA+SEWLY
Sbjct  321   MVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSEWLY  380

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
              VPWG+YKA+ YVKE YGNP M LSENGMD  GN+T A+ +NDT RI+YY+ YL +LK+ 
Sbjct  381   NVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKA  440

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             V+DGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+  L R++
Sbjct  441   VEDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKRILERDQ  498



>emb|CDY18494.1| BnaA01g27010D [Brassica napus]
Length=524

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 398/478 (83%), Gaps = 7/478 (1%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TG L+R+SFP GFVFGTA+SAYQVEG T  ++ GRGPSIWD F+K PG   NNAT E+ V
Sbjct  49    TGDLNRKSFPEGFVFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGKIANNATAELTV  106

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYH YK D+DLM  LNFDAYRFSISW+RIFP+GTGK+NW GVAYYNRLI+Y+++KGITP
Sbjct  107   DQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQKGITP  166

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP ALE +Y G LGR VVED+ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  167   YANLYHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  226

Query  966   YDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             YD G FAP RCS    NCT+GNSATEPY+VAH+LI+ HA A QRYR  YQ KQKGR GIL
Sbjct  227   YDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLIVAHASAVQRYRQHYQEKQKGRIGIL  286

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
             LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLP FT +EVK
Sbjct  287   LDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVK  346

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             +VKGSID+VGINQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPRA+SEWLY
Sbjct  347   MVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSEWLY  406

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
              VPWG+YKA+ YVKE YGNP M LSENGMD  GN+T A+ +NDT RI+YY+ YL +LK+ 
Sbjct  407   NVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKA  466

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             V+DGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+  L R++
Sbjct  467   VEDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKRILERDQ  524



>gb|EAY74244.1| hypothetical protein OsI_02124 [Oryza sativa Indica Group]
Length=516

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/470 (73%), Positives = 396/470 (84%), Gaps = 2/470 (0%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGLSR SFPAGFVFGTA+SAYQVEG     K GRGPSIWD F+KTPG   NNAT +V V
Sbjct  46    TGGLSRRSFPAGFVFGTAASAYQVEGM--ALKDGRGPSIWDAFVKTPGEIANNATADVTV  103

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             D+YHRYK D+++M  + FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITP
Sbjct  104   DEYHRYKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITP  163

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  164   YANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  223

Query  966   YDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             YD G FAPGRC+ CT GNSATEPY+VAH+LIL HA A QRYR  YQ  QKG+ GILLDFV
Sbjct  224   YDDGNFAPGRCTKCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFV  283

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKG
Sbjct  284   WYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKG  343

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             SIDYVGINQYT +YV D  P    + +Y +DW+    Y R+GVPIGPRANS+WLY+VPWG
Sbjct  344   SIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANSDWLYIVPWG  403

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             LYKAVTYVKE+YGNP MFLSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGA
Sbjct  404   LYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAIDDGA  463

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             N  GYFAWSLLDNFEW++GYTSRFG+VYVDF TL+RYPKMSAYWF++ +R
Sbjct  464   NCIGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKMSAYWFRDLVR  513



>gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar]
Length=491

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/477 (72%), Positives = 396/477 (83%), Gaps = 3/477 (1%)
 Frame = -3

Query  1515  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1336
             R + GGL+R+ FP GF FGTA+SAYQVEG     K GRGPSIWD F+K PG   NNAT  
Sbjct  17    RTDAGGLNRDKFPVGFTFGTAASAYQVEGM--ALKDGRGPSIWDDFVKIPGEIKNNATAA  74

Query  1335  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1156
             V VD+YHRYK DI++M  +NFDAYRFSISW+RIFPNG+GKVNWKGVAYYNRLI+YML++G
Sbjct  75    VTVDEYHRYKVDINIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQG  134

Query  1155  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  976
             ITP+ANL HYDLP ALE  Y G L R VV+DYADYAEFCFK FGDRVKNWF+FNEPRVVA
Sbjct  135   ITPFANLYHYDLPDALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVA  194

Query  975   ALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             ALGYD G FAPGRC+ CT G NS TEPY+VAHNLIL HA A +RYR  YQ  QKGR GIL
Sbjct  195   ALGYDNGIFAPGRCTGCTAGGNSTTEPYIVAHNLILSHAAAVKRYRDKYQVSQKGRIGIL  254

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
             LDFVWYEPLT S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RL  FT +E+ 
Sbjct  255   LDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLLTFTAEEIS  314

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYM  439
             LVKGS+DY+G+NQYT++Y++DP+  T     YQ DWNVGFAY RNGVPIGPRANSEWLY+
Sbjct  315   LVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRANSEWLYI  374

Query  438   VPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVV  259
             VPWG+YKAVTYVKE Y NP + LSENGMD  GN++L   L+DT R++YYKSY++ELKR +
Sbjct  375   VPWGMYKAVTYVKENYQNPTIILSENGMDDPGNVSLKVGLHDTTRLNYYKSYISELKRAI  434

Query  258   DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DDGA + GYFAWSLLDNFEW+ GYTSRFGIVYVDF TLKRYPKMSAYWF++ L++ K
Sbjct  435   DDGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQKKK  491



>ref|XP_007033088.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOY04014.1| Beta-glucosidase 44 [Theobroma cacao]
Length=511

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/481 (72%), Positives = 398/481 (83%), Gaps = 6/481 (1%)
 Frame = -3

Query  1515  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1336
             R +TGGLSRE FP GFVFGTA+SAYQVEG     K GRG SIWD F+  PG   +NATGE
Sbjct  33    RLDTGGLSREIFPEGFVFGTATSAYQVEGMAS--KEGRGRSIWDVFVNIPGNIVDNATGE  90

Query  1335  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1156
             V+VDQYH YK D++LM  LNFDAYRFSISW RIFPNGTGKVNWKGVAYYNRLIN +LEKG
Sbjct  91    VSVDQYHHYKEDVNLMHMLNFDAYRFSISWPRIFPNGTGKVNWKGVAYYNRLINALLEKG  150

Query  1155  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  976
             ITPYANL HYDLP AL+++YGG LG QVV+D+ADYA+FCFK FGDRVKNW +FNEPRV+A
Sbjct  151   ITPYANLYHYDLPLALQEKYGGLLGDQVVKDFADYADFCFKAFGDRVKNWMTFNEPRVIA  210

Query  975   ALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
             ALG+D G   P RCS    NCT G+SATEPY+ AHNLIL HA AA+RYR  YQ KQKGR 
Sbjct  211   ALGFDNGINPPCRCSKPFGNCTAGDSATEPYIAAHNLILSHAEAAKRYREKYQTKQKGRI  270

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GILLDFVWYEPLTR KADNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIVG+RLP+F+  
Sbjct  271   GILLDFVWYEPLTRGKADNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKFSKS  330

Query  627   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             +V+ VK S D++GIN YT+FY+YDP+   P +  YQ DWNVGFA+ R G PIG RA+S W
Sbjct  331   DVETVKNSFDFIGINHYTSFYMYDPHQPKPNVTGYQQDWNVGFAFERWGEPIGRRAHSGW  390

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY VPWG+YKAVTYVKERYGNP + L+ENGMD  GN+T  E+L D +R++YY+SYL ELK
Sbjct  391   LYQVPWGIYKAVTYVKERYGNPNVILAENGMDNPGNVTFPEALFDRERVNYYRSYLKELK  450

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             R +DDGAN+ GYFAWSLLDNFEW +GY+SRFG+VYVDF TLKRYPKMSAYWF+  L R +
Sbjct  451   RAMDDGANVTGYFAWSLLDNFEWLLGYSSRFGMVYVDFKTLKRYPKMSAYWFKQMLERKQ  510

Query  87    H  85
              
Sbjct  511   Q  511



>ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=512

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/481 (74%), Positives = 408/481 (85%), Gaps = 4/481 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
              R R +TGGL R +FPAGFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   NNA
Sbjct  34    SRARLDTGGLGRAAFPAGFVFGTAASAYQVEGMA--LKDGRGPSIWDAFVKIPGEIANNA  91

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             T +++VD+YHRYK D+D+M K+NFD YRFSISW+RIFPNG G+VNWKGVAYYNRLI+YML
Sbjct  92    TADISVDEYHRYKEDVDIMKKMNFDGYRFSISWSRIFPNGVGRVNWKGVAYYNRLIDYML  151

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             ++G+TPYANL HYDLP+ALE +Y G L  ++VE YAD+A+FCFK FGDRVKNWF+FNEPR
Sbjct  152   KQGVTPYANLYHYDLPEALEVQYNGLLSPKIVEAYADFADFCFKTFGDRVKNWFTFNEPR  211

Query  984   VVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
             VVAALGYD G FAPGRC+NC+  GNSATEPY+VAHNLIL HA A +RYR  YQA QKGR 
Sbjct  212   VVAALGYDEGKFAPGRCTNCSAGGNSATEPYIVAHNLILSHAAAVKRYREKYQATQKGRI  271

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GILLDFVWYEPLT SKAD  AAQRARDFH+GWFLHPIVYGEYPKTMQ IV +RLP+FT +
Sbjct  272   GILLDFVWYEPLTISKADQAAAQRARDFHLGWFLHPIVYGEYPKTMQEIVKERLPKFTVE  331

Query  627   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSE  451
             E+K+VKGSIDYVGINQYTT+Y+Y P    P   T Y NDWN GFAY RNGVPIGPRA+S+
Sbjct  332   EIKMVKGSIDYVGINQYTTYYMYHPLLPAPQKPTRYANDWNCGFAYERNGVPIGPRAHSD  391

Query  450   WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAEL  271
             WLY+VPWG+YKAV+YVKE+YGNP + LSENGMD  GN+TL + L+DT RI+YYKSY+ EL
Sbjct  392   WLYIVPWGMYKAVSYVKEQYGNPTVILSENGMDDPGNITLPKGLHDTTRINYYKSYITEL  451

Query  270   KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRN  91
             KR +DDGAN+ GYFAWSLLDNFEW++GYTSRFG+VYVD+ TLKRYPKMSAYWF   LRR 
Sbjct  452   KRAIDDGANVIGYFAWSLLDNFEWKLGYTSRFGVVYVDYRTLKRYPKMSAYWFGEMLRRK  511

Query  90    K  88
             K
Sbjct  512   K  512



>ref|XP_006431835.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
 gb|ESR45075.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
Length=506

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/490 (71%), Positives = 404/490 (82%), Gaps = 9/490 (2%)
 Frame = -3

Query  1545  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
             V  DV P+ +  +T G+SR+SFP GF+FGTA+SAYQVEG TD  K GRGP IWD ++K  
Sbjct  22    VDLDVRPDGL--DTAGMSRKSFPEGFIFGTATSAYQVEGMTD--KDGRGPCIWDPYVKA-  76

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
             G   NNAT ++ VDQYH YK DID+M KLNFDAYRFSISW+RIFPNGTG+VN  GVAYYN
Sbjct  77    GNIANNATADLTVDQYHHYKEDIDIMAKLNFDAYRFSISWSRIFPNGTGEVNPLGVAYYN  136

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
             RLI+YML+KGITPYANL HYDLP AL+D+Y G L   +V+DYADYA+FCFK FGDRVKNW
Sbjct  137   RLIDYMLKKGITPYANLYHYDLPLALQDKYNGLLSCDIVKDYADYADFCFKTFGDRVKNW  196

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  838
             F+FNEPRV+AALG+D G   P RCS    NCT GNSATEPY+ AHN+IL HA A +R+R 
Sbjct  197   FTFNEPRVIAALGFDNGINPPSRCSKGMGNCTAGNSATEPYIAAHNMILSHAAAVERFRE  256

Query  837   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  658
              YQ  QKG+ GILLDFVWYEPLTRSKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IV
Sbjct  257   KYQETQKGKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIV  316

Query  657   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  478
             G+RLP+FT  EV++VKGSIDY+G+NQYTTFY++DP    P I  YQNDWNVGFAY R GV
Sbjct  317   GERLPKFTDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGV  376

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             P+GPRANS WLY+VPWG+YKA+TYVKERY NP M L+ENGMD  GN+T  ++L+D  R++
Sbjct  377   PVGPRANSGWLYIVPWGIYKAITYVKERYQNPTMILAENGMDDPGNVTFPQALHDATRVN  436

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             Y++ YL+ LK+ VDDGANL GYFAWSLLDNFEW  GYTSRFGIVYVD+D LKRYPKMSAY
Sbjct  437   YFRDYLSYLKKAVDDGANLIGYFAWSLLDNFEWLSGYTSRFGIVYVDYDNLKRYPKMSAY  496

Query  117   WFQNFLRRNK  88
             WFQ  L+R++
Sbjct  497   WFQKLLKRDQ  506



>ref|XP_006471035.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=507

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/490 (70%), Positives = 403/490 (82%), Gaps = 8/490 (2%)
 Frame = -3

Query  1545  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
             V  DV P+ +  +T G+SR+SFP GF+FGTA+SAYQVEG TD  K GRGP IWD ++K  
Sbjct  22    VDLDVRPDGL--DTAGMSRKSFPEGFIFGTATSAYQVEGMTD--KDGRGPCIWDPYVKAG  77

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
                 +NAT ++ VDQYH YK DID+M KLNFDAYRFSISW+RIFPNGTG+VN  GVAYYN
Sbjct  78    RNIASNATADLTVDQYHHYKEDIDIMAKLNFDAYRFSISWSRIFPNGTGEVNPLGVAYYN  137

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
             RLI+YMLEKGITPYANL HYDLP AL+D+Y G L   +V+DYADYA+FCFK FGDRVKNW
Sbjct  138   RLIDYMLEKGITPYANLYHYDLPLALQDKYNGLLSCDIVKDYADYADFCFKTFGDRVKNW  197

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  838
             F+FNEPRV+AALG+D G   P RCS    NCT GNS+TEPY+ AHN+IL HA A +R+R 
Sbjct  198   FTFNEPRVIAALGFDNGINPPSRCSKGMGNCTAGNSSTEPYIAAHNMILSHAAAVERFRE  257

Query  837   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  658
              YQ  QKG+ GILLDFVWYEPLTRSKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IV
Sbjct  258   KYQETQKGKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIV  317

Query  657   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  478
             G+RLP+FT  EV++VKGSIDY+G+NQYTTFY++DP    P I  YQNDWNVGFAY R GV
Sbjct  318   GERLPKFTDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGV  377

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             P+GPRANS WLY+VPWG+YKA+TYVKERY NP M L+ENGMD  GN+T  ++L+D  R++
Sbjct  378   PVGPRANSGWLYIVPWGIYKAITYVKERYQNPTMILAENGMDDPGNVTFPQALHDATRVN  437

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             Y++ YL+ LK+ VDDGANL GYFAWSLLDNFEW  GYTSRFGIVYVD+D LKRYPKMSAY
Sbjct  438   YFRDYLSYLKKAVDDGANLIGYFAWSLLDNFEWLSGYTSRFGIVYVDYDNLKRYPKMSAY  497

Query  117   WFQNFLRRNK  88
             WFQ  L+R++
Sbjct  498   WFQKLLKRDQ  507



>ref|NP_001043156.1| Os01g0508000 [Oryza sativa Japonica Group]
 sp|Q5QMT0.1|BGL01_ORYSJ RecName: Full=Beta-glucosidase 1; Short=Os1bglu1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD73293.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF05070.1| Os01g0508000 [Oryza sativa Japonica Group]
Length=516

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/469 (72%), Positives = 395/469 (84%), Gaps = 2/469 (0%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGLSR SFPAGFVFGTA+SAYQVEG     K GRGPSIWD F+KTPG   NNAT +V V
Sbjct  46    TGGLSRRSFPAGFVFGTAASAYQVEGM--ALKDGRGPSIWDAFVKTPGEIANNATADVTV  103

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             D+YHRYK D+++M  + FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITP
Sbjct  104   DEYHRYKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITP  163

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  164   YANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  223

Query  966   YDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             YD G FAPGRC+ CT GNSATEPY+VAH+LIL HA A QRYR  YQ  QKG+ GILLDFV
Sbjct  224   YDDGNFAPGRCTKCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFV  283

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKG
Sbjct  284   WYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKG  343

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             SIDYVGINQYT +YV D  P    + +Y +DW+    Y R+GVPIGPRANS+WLY+VPWG
Sbjct  344   SIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANSDWLYIVPWG  403

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             LYKAVTYVKE+YGNP MFLSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGA
Sbjct  404   LYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAIDDGA  463

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             N  GYFAWSLLDNFEW++GYTSRFG+VYVDF TL+RYPKMSAYWF++ +
Sbjct  464   NCIGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKMSAYWFRDLV  512



>emb|CDX95557.1| BnaC01g34490D [Brassica napus]
Length=514

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/484 (74%), Positives = 403/484 (83%), Gaps = 7/484 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E+++ +TGGLSR+SFP  F+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NA
Sbjct  32    EKIKLDTGGLSRQSFPKDFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNA  89

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             T E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGK+NWKGV YYNRLINY++
Sbjct  90    TAELTVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLINYLI  149

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             +KGITPYANL HYDLP ALE +Y G L RQVV D+ADYAEFCF IFGDRVKNW +FNEPR
Sbjct  150   QKGITPYANLYHYDLPLALEKKYKGLLDRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPR  209

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VVAALGYD G FAPGRCS    NCTQGNS TEPY+V+H+LIL HA AAQRYR  YQAKQK
Sbjct  210   VVAALGYDNGIFAPGRCSKSYGNCTQGNSGTEPYIVSHHLILAHAAAAQRYRKYYQAKQK  269

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFVWYEPLTRSKAD  AAQRARDFHIGWF+HPIVYGEYP+TMQNIV DRLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQNIVKDRLPKF  329

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRA  460
             T +EVK+VKGSID+VGINQYTT+++ D +  T P    YQ DWN  F +A+ G PIGPRA
Sbjct  330   TEEEVKMVKGSIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGFAKLGKPIGPRA  389

Query  459   NSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYL  280
              S WLY VPWG+YKA+ Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL
Sbjct  390   YSYWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDSGNVTLAQGLHDTTRIKYYKDYL  449

Query  279   AELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
              +LK+ VDDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA WF   L
Sbjct  450   TQLKKAVDDGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFMQLL  509

Query  99    RRNK  88
             +RNK
Sbjct  510   KRNK  513



>ref|XP_006430656.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
 gb|ESR43896.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
Length=520

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/479 (71%), Positives = 400/479 (84%), Gaps = 6/479 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+T GL+R+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++ TPG   NNAT +V
Sbjct  44    FDTAGLTRKSFPDGFVFGTATSAYQVEGMAN--KDGRGPCIWDVYVHTPGNIANNATADV  101

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM KLNFDAYRFSISW+RIFP G G+VNWKGVAYYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL +RYGG LGRQVV+DYAD+AEFCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D+G   P RCS    NCT+G+S TEPY  AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDSGTNPPSRCSKEVNNCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIG  281

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP +RSKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+E
Sbjct  282   ILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEE  341

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             V +VKGS DY+G+NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG RANSEWL
Sbjct  342   VAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSEWL  401

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWGLY A+ YVKERYGNP + LSENGMD   N TL   L+DT RI+YY+ Y+++LK+
Sbjct  402   YIVPWGLYNALMYVKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYISQLKK  461

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
              +DDGAN+ GYFAWSLLDNFEW +GYT+RFGI YVDFDTL+R PKMSAYWF+  L+R++
Sbjct  462   AIDDGANVTGYFAWSLLDNFEWLLGYTARFGITYVDFDTLQRIPKMSAYWFKQLLQRDQ  520



>gb|KDO63132.1| hypothetical protein CISIN_1g046891mg [Citrus sinensis]
Length=520

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/479 (71%), Positives = 399/479 (83%), Gaps = 6/479 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+T GL+R+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++ TPG   NNAT +V
Sbjct  44    FDTAGLTRKSFPDGFVFGTATSAYQVEGMAN--KDGRGPCIWDVYVHTPGNIANNATADV  101

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM KLNFDAYRFSISW+RIFP G G+VNWKGVAYYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL +RYGG LGRQVV+DYAD+AEFCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D+G   P RCS    NCT+G+S TEPY  AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDSGINPPSRCSKEVNNCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIG  281

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP +RSKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+E
Sbjct  282   ILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEE  341

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             V +VKGS DY+G+NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG RANS WL
Sbjct  342   VAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSGWL  401

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWGLY A+ YVKERYGNP + LSENGMD   N TL   L+DT RI+YY+ Y+++LK+
Sbjct  402   YIVPWGLYNALMYVKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYISQLKK  461

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
              +DDGAN+ GYFAWSLLDNFEW +GYT+RFGI YVDFDTL+R PKMSAYWF+  L+R++
Sbjct  462   AIDDGANVTGYFAWSLLDNFEWLLGYTARFGITYVDFDTLQRIPKMSAYWFKQLLQRDQ  520



>ref|XP_006482391.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/479 (71%), Positives = 399/479 (83%), Gaps = 6/479 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+T GL+R+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++ TPG   NNAT +V
Sbjct  44    FDTAGLTRKSFPDGFVFGTATSAYQVEGMAN--KDGRGPCIWDVYVHTPGNIANNATADV  101

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM KLNFDAYRFSISW+RIFP G G+VNWKGVAYYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL +RYGG LGRQVV+DYAD+AEFCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D+G   P RCS    NCT+G+S TEPY  AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDSGINPPSRCSKEVNNCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIG  281

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP +RSKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+E
Sbjct  282   ILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEE  341

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             V +VKGS DY+G+NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG RANS WL
Sbjct  342   VAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSGWL  401

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWGLY A+ YVKERYGNP + LSENGMD   N TL   L+DT RI+YY+ Y+++LK+
Sbjct  402   YIVPWGLYNALMYVKERYGNPTVMLSENGMDDPSNYTLTHLLHDTTRINYYRDYISQLKK  461

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
              +DDGAN+ GYFAWSLLDNFEW +GYT+RFGI YVDFDTL+R PKMSAYWF+  L+R++
Sbjct  462   AIDDGANVTGYFAWSLLDNFEWLLGYTARFGITYVDFDTLQRIPKMSAYWFKQLLQRDQ  520



>gb|KCW83983.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=450

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/447 (76%), Positives = 380/447 (85%), Gaps = 4/447 (1%)
 Frame = -3

Query  1413  KYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIF  1234
             K GRGPSIWD F+K PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIF
Sbjct  4     KEGRGPSIWDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIF  63

Query  1233  PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYAD  1054
             P+GTGKVNWKGVAYYNRLINY+L KGITPYANL HYDLP+ALE +Y G L   VV+D+AD
Sbjct  64    PDGTGKVNWKGVAYYNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFAD  123

Query  1053  YAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVA  886
             YA+FCFK FGDRVKNW +FNEPRVVAALGYD G FAP RCS    NCT GNS TEPY+VA
Sbjct  124   YADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVA  183

Query  885   HNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  706
             H+LIL HA A QRYR  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+
Sbjct  184   HHLILSHAAAVQRYREKYQEKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFI  243

Query  705   HPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT  526
             HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGINQYT FY+YDP+     +  
Sbjct  244   HPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPG  303

Query  525   YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYV  346
             YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y+KERYGNP M LSENGMD  
Sbjct  304   YQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDP  363

Query  345   GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIV  166
             GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFAWSLLDNFEWR GYTSRFGIV
Sbjct  364   GNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIV  423

Query  165   YVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             YVD+  LKRYPKMSAYWF+  L R K+
Sbjct  424   YVDYTNLKRYPKMSAYWFKQLLTRKKN  450



>emb|CDX95558.1| BnaC01g34500D [Brassica napus]
Length=493

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/478 (72%), Positives = 397/478 (83%), Gaps = 8/478 (2%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             +G  +R+SFP GFVFGTA+SAYQVEG T  ++ GRGPSIWD F+K PG   NNAT E+ V
Sbjct  19    SGDANRKSFPEGFVFGTATSAYQVEGET--YQDGRGPSIWDAFVKIPGKIANNATAELTV  76

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYH YK D+DLM  LNFDAYRFSISW+RIFP G GK+NW GVAYYNRLI+Y+++KGITP
Sbjct  77    DQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPEGAGKINWNGVAYYNRLIDYLVQKGITP  136

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP ALE +Y G LGRQV ED+ADYAEFCFK FGDRVKNW +FNEPRVVAALG
Sbjct  137   YANLYHYDLPLALEKKYKGLLGRQV-EDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALG  195

Query  966   YDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             YD G FAP RCS    NCT+GNSATEPY+VAH+LIL HA A QRYR  YQ KQKGR GIL
Sbjct  196   YDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLILAHASAVQRYRQHYQEKQKGRIGIL  255

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
             LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQ+IV +RLP+FT +EVK
Sbjct  256   LDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQDIVKERLPKFTEEEVK  315

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             LVKGSID+VGINQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPRA+SEWLY
Sbjct  316   LVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSEWLY  375

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
              VPWG+YKA+ YVKE YGNP M LSENGMD  GN+T A+ +NDT RI+YY+ YL +LK+ 
Sbjct  376   NVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKA  435

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             VDDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+  L+R++
Sbjct  436   VDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFRRLLKRDQ  493



>ref|XP_006845279.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
 gb|ERN06954.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
Length=482

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 398/484 (82%), Gaps = 10/484 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
              +TGGLSRE FP GFVFGTA+SAYQVEGA   H+ GRGPSIWD F++ PG+ PN ATGEV
Sbjct  1     MSTGGLSRERFPPGFVFGTATSAYQVEGA--AHEDGRGPSIWDVFIQQPGIIPNGATGEV  58

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             + D+YHRYK D+D+M  +N DAYRFSISW+RIFP G G+VN KGV YYNRLI+Y+LEKGI
Sbjct  59    SADEYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGAGRVNQKGVDYYNRLIDYLLEKGI  118

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLPQALED Y G L R+VV+D+A YA+FCFK FGDRVKNW +FNEPRV+AA
Sbjct  119   TPYANLYHYDLPQALEDSYNGLLNRRVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAA  178

Query  972   LGYDTGFFAPGRCSN--------CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             LGYD GF APGRCSN        CT G+S+TEPY+VAHNLIL HA A +RYR  YQA QK
Sbjct  179   LGYDNGFHAPGRCSNPFGNDGMNCTAGDSSTEPYIVAHNLILSHASAVKRYREKYQATQK  238

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFVWYEP + +KAD  AAQR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+F
Sbjct  239   GRIGILLDFVWYEPFSNAKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKF  298

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             T +EV++VKGSID+VGINQYT++Y+ D + K   +  YQ DW+ GF Y+R+G  IGP+AN
Sbjct  299   TNEEVEMVKGSIDFVGINQYTSYYITDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQAN  358

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLYMVPWG+YKAVTY+KE Y NP M LSENGMDY  N+TL  +L+DTKRISYY+SYL 
Sbjct  359   SYWLYMVPWGMYKAVTYIKENYRNPTMILSENGMDYAANITLPAALHDTKRISYYRSYLI  418

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
              LK+ +DDGAN+ GYFAWSL+DNFEWR+GYTSRFG+VYVD+ TLKRYPKMSA WF+  ++
Sbjct  419   NLKKAIDDGANVIGYFAWSLVDNFEWRLGYTSRFGLVYVDYQTLKRYPKMSASWFRGLIQ  478

Query  96    RNKH  85
             R  H
Sbjct  479   RKSH  482



>ref|XP_007048474.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOX92631.1| Beta-glucosidase 44 [Theobroma cacao]
Length=562

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/528 (67%), Positives = 405/528 (77%), Gaps = 50/528 (9%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E+ R +TGGLSR+SFP GFVFGTA+SAYQVEG     K GRGPSIWD F+K PG   NNA
Sbjct  37    EKQRLDTGGLSRDSFPEGFVFGTAASAYQVEGMAS--KEGRGPSIWDVFVKVPGNIVNNA  94

Query  1344  TGEVAVDQYHRYKR--------------------------------------------DI  1297
             TGEV+VDQYHRYK+                                            D+
Sbjct  95    TGEVSVDQYHRYKKSQAIRSSLVYGLSPCYVSLISASHESWDNSKDSKTICHSSCLQEDV  154

Query  1296  DLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLP  1117
             DLM KLNFDAYRFSISW+RIFPNGTGKVN KGVAYYNRLI+ MLEKGITPYANL HYDLP
Sbjct  155   DLMHKLNFDAYRFSISWSRIFPNGTGKVNRKGVAYYNRLIDSMLEKGITPYANLYHYDLP  214

Query  1116  QALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGR  937
              AL+++YGG LG QVV+D+ADYA+FCFK FGDRVKNW +FNEPRVVAALG+D G   P R
Sbjct  215   LALQEKYGGLLGDQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGFDNGINPPNR  274

Query  936   CS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLT  769
             CS    NCT GNSATEPY+ AHNLIL HA AA+RYR  YQ KQKGR GILLDFVWYEPLT
Sbjct  275   CSKPFGNCTAGNSATEPYIAAHNLILSHAEAAKRYREKYQPKQKGRIGILLDFVWYEPLT  334

Query  768   RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVG  589
             R KADNYAAQRARDFH+GWFLHP+VYGEYP+TMQ IVG+RLP+F+  +VK VK S D++G
Sbjct  335   RGKADNYAAQRARDFHVGWFLHPLVYGEYPRTMQEIVGERLPKFSKSDVKTVKNSFDFIG  394

Query  588   INQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  409
             INQYT++Y+YDP    P +  YQ DWNVGFA+ R G PIG RA S WLY VPWG+YKAVT
Sbjct  395   INQYTSYYMYDPDQPKPNVTGYQQDWNVGFAHERTGNPIGRRAYSPWLYEVPWGMYKAVT  454

Query  408   YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  229
             Y+KERYGNP + L+ENGMD  GN+TL ++L D +R++YY+SYL ELKR +DDGAN+ GYF
Sbjct  455   YIKERYGNPNVILAENGMDDPGNVTLPDALYDRERVNYYRSYLKELKRAMDDGANVTGYF  514

Query  228   AWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             AWSLLDNFEW  GY+SRFGIVYVDF TLKRYPKMSA+WF+  L R KH
Sbjct  515   AWSLLDNFEWLSGYSSRFGIVYVDFKTLKRYPKMSAHWFKQMLERKKH  562



>ref|XP_009113523.1| PREDICTED: beta-glucosidase 44 [Brassica rapa]
 emb|CDY18495.1| BnaA01g27000D [Brassica napus]
Length=514

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/484 (74%), Positives = 401/484 (83%), Gaps = 7/484 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E+++ +TGGLSR+SFP  F+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG    NA
Sbjct  32    EKIKLDTGGLSRQSFPKDFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGTIAKNA  89

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             T E+ VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP GTGK+NWKGV YYNRLI+Y++
Sbjct  90    TAELTVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLIDYLI  149

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             +KGITPYANL HYDLP ALE +Y G LGRQVV D+ADYAEFCF IFGDRVKNW +FNEPR
Sbjct  150   QKGITPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPR  209

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VVAALGYD G FAPGRCS    NCTQGNS TEPY+V+H+LIL HA AAQRYR  YQAKQK
Sbjct  210   VVAALGYDNGIFAPGRCSKSYGNCTQGNSGTEPYIVSHHLILAHAAAAQRYRKYYQAKQK  269

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             GR GILLDFVWYEPLTRSKAD  AAQRARDFHIGWF+HPIVYGEYP+TMQ IV DRLP+F
Sbjct  270   GRIGILLDFVWYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQYIVKDRLPKF  329

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRA  460
             T +EVK+VKGSID+VGINQYTT+++ D +  T P    YQ DWN  F YA+ G PIGPRA
Sbjct  330   TEEEVKMVKGSIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGYAKLGKPIGPRA  389

Query  459   NSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYL  280
              S WLY VPWG+YKA+ Y+KE YGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL
Sbjct  390   YSYWLYNVPWGMYKALMYMKEHYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYL  449

Query  279   AELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
              +LK+ VDDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ TLKRYPKMSA WF   L
Sbjct  450   TQLKKAVDDGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFMQLL  509

Query  99    RRNK  88
              RNK
Sbjct  510   NRNK  513



>ref|XP_010257514.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Nelumbo nucifera]
Length=534

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/488 (69%), Positives = 393/488 (81%), Gaps = 6/488 (1%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+ 
Sbjct  49    DARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGIV  106

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
              +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  107   ASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  166

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW + 
Sbjct  167   DYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMTL  226

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  YQ
Sbjct  227   NEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKYQ  286

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
             A QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG R
Sbjct  287   AHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKR  346

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+FT + +K+VKGSID++GINQYT  Y Y  +    +   Y+ D NVGFA+A++GVPIG
Sbjct  347   LPKFTKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIG  406

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
             PRANS WLY VPW LYK +TY+KE YGNP + ++ENGMD  GN+TL + L+DT+RI++Y+
Sbjct  407   PRANSAWLYDVPWSLYKVLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFYR  466

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
              YL +LK+ +DDG N+ GYFAWSL+D FEWR+GYT+RFGIVY+DF TLKRYPKMSAYWF+
Sbjct  467   GYLTQLKKAIDDGVNVVGYFAWSLIDTFEWRLGYTTRFGIVYIDFKTLKRYPKMSAYWFR  526

Query  108   NFLRRNKH  85
               L R KH
Sbjct  527   ELLHRKKH  534



>ref|XP_006376723.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
 gb|ERP54520.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
Length=546

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/535 (67%), Positives = 401/535 (75%), Gaps = 48/535 (9%)
 Frame = -3

Query  1551  SIVQC----------DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGR  1402
             SIVQC             PE V F T G  R SFP GFVFGTA+SAYQVEG  +  K GR
Sbjct  14    SIVQCISHAAESNGASEKPETVSFETAGGLRHSFPKGFVFGTATSAYQVEGMAE--KDGR  71

Query  1401  GPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGT  1222
             GPSIWD F+K PG+  NNATGEVAVDQYH YK D+D+M  LNFDAYRFSISW+RIFP+GT
Sbjct  72    GPSIWDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGT  131

Query  1221  GKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEF  1042
             GKVNW GVAYYNRLI+YM+EKGITPYANL HYDLP ALE +Y G L  QVV+D+ADYA+F
Sbjct  132   GKVNWLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADF  191

Query  1041  CFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLI  874
             CFK FGDRVKNW +FNEPRVVAALGYD G FAPGRCS    NCT G+SATEPY+VAH+LI
Sbjct  192   CFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLI  251

Query  873   LCHAVAAQRYRAIYQ--------------------------------AKQKGRFGILLDF  790
             L HA A QRYR  YQ                                 K KG+    L F
Sbjct  252   LSHAAAVQRYREKYQVSICSSVFELDAIHIFNGEECYIPYSFSFYIAGKTKGKDWDSLGF  311

Query  789   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  610
                   T SKADN AAQRARDFHIGWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VK
Sbjct  312   CLLRTFTSSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVGNRLPQFTKEEVKMVK  371

Query  609   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPW  430
             GS+D+VGINQYTTFY+YDP+   P    YQ DWNVGFAY +NGVPIGPRANS WLY VPW
Sbjct  372   GSMDFVGINQYTTFYMYDPHQPKPKYLGYQQDWNVGFAYKKNGVPIGPRANSNWLYNVPW  431

Query  429   GLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDG  250
             G+YKAV Y+KERYGNP + LSENGMD  GN T +++L+DT R+ Y+K+YL +LK+  D+G
Sbjct  432   GMYKAVMYIKERYGNPTIILSENGMDDPGNFTRSKALHDTTRVGYFKAYLTQLKKAADEG  491

Query  249   ANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             ANL GYFAWSLLDNFEWR GYTSRFGIVYVD+  LKRYPKMSAYWF+  L RNKH
Sbjct  492   ANLAGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKKLLERNKH  546



>gb|KDO63131.1| hypothetical protein CISIN_1g036937mg, partial [Citrus sinensis]
Length=497

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/480 (71%), Positives = 397/480 (83%), Gaps = 8/480 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  21    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  78

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  79    TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  138

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  139   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  198

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG  G
Sbjct  199   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILSHAAAVQRYREKYQETQKGNIG  258

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  259   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  318

Query  624   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS W
Sbjct  319   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGW  377

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY+VPWGLY A+ YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK
Sbjct  378   LYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLK  437

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             + VDDGAN+ GYFAWSLLDNFEW +GY+SRFGI YVDFDTLKR PKMSAYWF+  L+R++
Sbjct  438   KAVDDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQRDQ  497



>ref|XP_006482389.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/480 (71%), Positives = 397/480 (83%), Gaps = 8/480 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  44    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  101

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  222   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIG  281

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  282   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  341

Query  624   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS W
Sbjct  342   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGW  400

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY+VPWGLY A+ YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK
Sbjct  401   LYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLK  460

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             +  DDGAN+ GYFAWSLLDNFEW +GY+SRFGI YVDFDTLKR PKMSAYWF+  L+R++
Sbjct  461   KAADDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQRDQ  520



>ref|XP_010257596.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257682.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/493 (68%), Positives = 393/493 (80%), Gaps = 11/493 (2%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+ 
Sbjct  28    DARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGIV  85

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
              +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  86    ASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  145

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW + 
Sbjct  146   DYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMTL  205

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  YQ
Sbjct  206   NEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKYQ  265

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
             A QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG R
Sbjct  266   AHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKR  325

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+FT + +K+VKGSID++GINQYT  Y Y  +    +   Y+ D NVGFA+A++GVPIG
Sbjct  326   LPKFTKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIG  385

Query  468   PR-----ANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             PR     ANS WLY VPW LYK +TY+KE YGNP + ++ENGMD  GN+TL + L+DT+R
Sbjct  386   PRVIKITANSAWLYDVPWSLYKVLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRR  445

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++Y+ YL +LK+ +DDG N+ GYFAWSL+D FEWR+GYT+RFGIVY+DF TLKRYPKMS
Sbjct  446   INFYRGYLTQLKKAIDDGVNVVGYFAWSLIDTFEWRLGYTTRFGIVYIDFKTLKRYPKMS  505

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R KH
Sbjct  506   AYWFRELLHRKKH  518



>ref|XP_010257433.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Nelumbo nucifera]
Length=539

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/493 (68%), Positives = 393/493 (80%), Gaps = 11/493 (2%)
 Frame = -3

Query  1536  DVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLE  1357
             D  PE VRF+TGGLSRESFP GFVFG A+SAYQVEG     K GRGPSIWD FL+ PG+ 
Sbjct  49    DARPETVRFDTGGLSRESFPKGFVFGAATSAYQVEGMAS--KDGRGPSIWDAFLRIPGIV  106

Query  1356  PNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLI  1177
              +NAT EVA DQYHRYK D+D+M  LNFDAYRFSISW+RIFP+G GKVNWKGVAYYNRLI
Sbjct  107   ASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVNWKGVAYYNRLI  166

Query  1176  NYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSF  997
             +YML KGITP+A + HYDLP ALE +Y G L R+VV+DY ++AEFCFK FGDRVKNW + 
Sbjct  167   DYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKTFGDRVKNWMTL  226

Query  996   NEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             NEP VV+  GY  G  APGRCS    NCT GNSATEPY+ AHN+ILCHAVA Q YR  YQ
Sbjct  227   NEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMILCHAVAVQIYREKYQ  286

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
             A QKGR GI+LDF+WYEPLTR KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG R
Sbjct  287   AHQKGRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKR  346

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP+FT + +K+VKGSID++GINQYT  Y Y  +    +   Y+ D NVGFA+A++GVPIG
Sbjct  347   LPKFTKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIG  406

Query  468   PR-----ANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKR  304
             PR     ANS WLY VPW LYK +TY+KE YGNP + ++ENGMD  GN+TL + L+DT+R
Sbjct  407   PRVIKITANSAWLYDVPWSLYKVLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRR  466

Query  303   ISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMS  124
             I++Y+ YL +LK+ +DDG N+ GYFAWSL+D FEWR+GYT+RFGIVY+DF TLKRYPKMS
Sbjct  467   INFYRGYLTQLKKAIDDGVNVVGYFAWSLIDTFEWRLGYTTRFGIVYIDFKTLKRYPKMS  526

Query  123   AYWFQNFLRRNKH  85
             AYWF+  L R KH
Sbjct  527   AYWFRELLHRKKH  539



>ref|XP_006430653.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
 gb|ESR43893.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
Length=528

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/480 (70%), Positives = 397/480 (83%), Gaps = 8/480 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  52    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  109

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  110   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  169

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  170   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  229

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  230   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIG  289

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  290   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  349

Query  624   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIG RANS W
Sbjct  350   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGQRANSGW  408

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY+VPWGLY A+ YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK
Sbjct  409   LYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLK  468

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             + VDDGAN+ GYFAWSL+DNFEW +GY+SRFGI YVDFDTLKR PKMSAYWF+  L+R++
Sbjct  469   KAVDDGANVTGYFAWSLVDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQRDQ  528



>ref|XP_006832849.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
 gb|ERM98127.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
Length=509

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/483 (70%), Positives = 399/483 (83%), Gaps = 6/483 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             V P+    +TGGLSRE FP GFVFGTA+SAYQVEGA D  K GRGPSIWD F++ PG+  
Sbjct  25    VWPDAGDMSTGGLSREGFPPGFVFGTATSAYQVEGAAD--KDGRGPSIWDVFIRKPGVVA  82

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             +N+TGEV+VD+YHRYK D+D+M  +N DAYRFSISW+RIFP G G+VN KGV YYNRLI+
Sbjct  83    DNSTGEVSVDEYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGVGRVNQKGVDYYNRLID  142

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+LE+G+TPYANL HYDLP+ALE+ Y G L R+VV+D+ADYAEFCFK FGDRVKNW +FN
Sbjct  143   YLLERGVTPYANLYHYDLPEALEESYNGLLNRRVVDDFADYAEFCFKTFGDRVKNWMTFN  202

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD G FAPGRCS    NCT GNS TEPY+VAHNLIL HA A +RYR  YQA
Sbjct  203   EPRVVAALGYDNGIFAPGRCSAPFGNCTAGNSTTEPYIVAHNLILSHASAVKRYREKYQA  262

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEPLT +KAD  AAQR+RDFH+GWFLHPIVYG YP++M  IVGDRL
Sbjct  263   TQKGRIGILLDFVWYEPLTAAKADVRAAQRSRDFHVGWFLHPIVYGTYPRSMVRIVGDRL  322

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EV++VKGSID+VGIN YTT+Y+YD + +   +  YQ +W+ GFA+AR+G PIGP
Sbjct  323   PKFTNEEVEMVKGSIDFVGINHYTTYYMYDQHIRKGTVMDYQMEWHAGFAFARDGKPIGP  382

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA S  LYMVPWG+YKAVT +KE Y NP + LSENGMDY GN+TL  S++DTKRI YY+S
Sbjct  383   RAYSPGLYMVPWGIYKAVTCIKENYKNPTIILSENGMDYPGNVTLLASVHDTKRIDYYRS  442

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL  LK+ +DDGAN+ GYFAWSLLDNFEW  GYTSRFG+VYV++ TLKRYPKMSA WF++
Sbjct  443   YLINLKKAIDDGANVVGYFAWSLLDNFEWLSGYTSRFGLVYVNYQTLKRYPKMSASWFRH  502

Query  105   FLR  97
              L+
Sbjct  503   LLQ  505



>ref|XP_006299658.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
 gb|EOA32556.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
Length=491

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/487 (70%), Positives = 391/487 (80%), Gaps = 19/487 (4%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             S + V  +TG L R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  19    SGDGVSLDTGDLKRQSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  76

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT E+ VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTGK+NW GVAYYN LI+Y
Sbjct  77    NATAEITVDQYHRYKEDIDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNSLIDY  136

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +++KGI PYANL HYDLP ALE +Y G L            +FCFK FGDRVKNW +FNE
Sbjct  137   LIQKGIKPYANLYHYDLPLALEQKYQGLL------------KFCFKTFGDRVKNWMTFNE  184

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL H+ A QRYR  YQ K
Sbjct  185   PRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILAHSAAVQRYRQNYQEK  244

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKG  GILLDFVW+EPLT SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV +RLP
Sbjct  245   QKGMIGILLDFVWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPNTMQNIVKERLP  304

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGP  466
             +FT +EV+++KGSID+VGINQYTT+++ DP   TP  +  YQ DWNV F YA+NG PIGP
Sbjct  305   KFTEEEVRMMKGSIDFVGINQYTTYFMSDPKITTPPKNLGYQQDWNVAFNYAKNGTPIGP  364

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA SEWLY VPWG+YKA+ Y+KE YGNP M LSENGMD  GN+TLA+ LNDT RISYY+ 
Sbjct  365   RAYSEWLYNVPWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRISYYRD  424

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YLA+LK+ VDDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+ 
Sbjct  425   YLAQLKKAVDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQ  484

Query  105   FLRRNKH  85
              L+R+K+
Sbjct  485   LLKRDKN  491



>ref|XP_008811965.1| PREDICTED: beta-glucosidase 1-like isoform X1 [Phoenix dactylifera]
Length=505

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/470 (72%), Positives = 395/470 (84%), Gaps = 7/470 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR SFP GFVFGTA+SAYQVEG     K GRGP IWDTF+K PG    NAT +V VD+Y
Sbjct  34    LSRSSFPEGFVFGTAASAYQVEGM--ALKEGRGPCIWDTFVKIPGNIAGNATADVTVDEY  91

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK D+D+M K+NFDAYRFSISW+RIFP GTGKVNW+GV YYNRLINYML++GITPYAN
Sbjct  92    HRYKEDVDIMKKMNFDAYRFSISWSRIFPKGTGKVNWRGVFYYNRLINYMLKQGITPYAN  151

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQAL+D Y GWL  ++VE YA++A+FCFK+FGDRVKNWF+FNEPRVVAALGYD 
Sbjct  152   LYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKMFGDRVKNWFTFNEPRVVAALGYDD  211

Query  957   GFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             G  APGRC+NC+ G NSATEPY+VAH+LIL HA A +RYR  YQA QKG+ GIL DFVWY
Sbjct  212   GTHAPGRCTNCSAGGNSATEPYIVAHHLILSHAAAVKRYREKYQAHQKGKIGILCDFVWY  271

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT S  D  AAQRARDFHIGWFLHPI+YGEYPKTMQ IV +RLP+FT +EV++VKGSI
Sbjct  272   EPLTNSIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKFTREEVEMVKGSI  331

Query  600   DYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             DYVGINQYT++Y+ D   Y +TP   +Y  DW+  FAY R+GVPIGPRA+SEWLY+VPWG
Sbjct  332   DYVGINQYTSYYMEDQPTYSQTPV--SYSADWHTQFAYDRDGVPIGPRAHSEWLYIVPWG  389

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +YKA TYVKE YGNP + L+ENGMD  GN+TL  +L DT+R++YYKSY+ ELK+ +DDGA
Sbjct  390   MYKAATYVKETYGNPTVILAENGMDQPGNVTLPGALRDTQRVNYYKSYITELKKAIDDGA  449

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             N+ GYFAWSLLDNFEW++GYTSRFG+VYVD+ TLKRYPK SAYWF+N L+
Sbjct  450   NVMGYFAWSLLDNFEWKLGYTSRFGLVYVDYSTLKRYPKNSAYWFRNMLK  499



>gb|ABR17739.1| unknown [Picea sitchensis]
Length=505

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/479 (70%), Positives = 388/479 (81%), Gaps = 6/479 (1%)
 Frame = -3

Query  1515  RFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGE  1336
               +TGGLSR SFP GFVFGTA+SAYQVEGA      GRGPSIWDTF+  PG+  NNAT +
Sbjct  29    EIDTGGLSRASFPKGFVFGTATSAYQVEGAAKTD--GRGPSIWDTFILQPGIIANNATAD  86

Query  1335  VAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKG  1156
             V+VD+YHRYK D++LMVK+N DAYRFSISW+RIFP G G++N+KGV YYN LINY+L++G
Sbjct  87    VSVDEYHRYKTDVELMVKMNMDAYRFSISWSRIFPKGAGQINYKGVQYYNNLINYLLKRG  146

Query  1155  ITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVA  976
             ITPYANL HYDLPQ LE  YGG L  +VV+DYA +AEFCFK FGDRVK W +FNEPRVVA
Sbjct  147   ITPYANLYHYDLPQGLETAYGGLLNSKVVDDYAKFAEFCFKTFGDRVKYWMTFNEPRVVA  206

Query  975   ALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
             ALGYD G FAPGRCS    NCT GNSATEPY+VAHNL+L HA A + YR  YQ  QKG+ 
Sbjct  207   ALGYDNGIFAPGRCSAPFGNCTAGNSATEPYIVAHNLLLSHATAVKIYREKYQPIQKGKI  266

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GILLDFVWYEPLT S  D  AAQR+RDFHIGWFLHPIVYG+YP +M  IVG RLP+FT +
Sbjct  267   GILLDFVWYEPLTNSSEDQAAAQRSRDFHIGWFLHPIVYGKYPDSMVEIVGKRLPKFTKE  326

Query  627   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             + ++VKGSIDY+G+NQYT +Y+YDP      +  YQ DWNVGFAYARNGVPIGP+ANS W
Sbjct  327   QYQMVKGSIDYLGVNQYTAYYMYDPKQPKQNVTGYQMDWNVGFAYARNGVPIGPKANSYW  386

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY+VPWGLYKAVTY+KE YGNP M LSENGMD  GN+TL   L+DT R++YYKSYL  L 
Sbjct  387   LYIVPWGLYKAVTYIKEHYGNPTMILSENGMDDPGNVTLPAGLHDTTRVNYYKSYLQNLI  446

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRN  91
               ++DGAN+ GYFAWSLLDNFEW+ GYTSRFG+VYVDF  LKRYPKMSAYWF   L+R+
Sbjct  447   GAMNDGANVVGYFAWSLLDNFEWKSGYTSRFGVVYVDFTNLKRYPKMSAYWFSKLLQRH  505



>ref|XP_006430655.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
 gb|ESR43895.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
Length=520

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/480 (70%), Positives = 396/480 (83%), Gaps = 8/480 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  44    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  101

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QR+R  YQ  QKG+ G
Sbjct  222   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRFREKYQETQKGKIG  281

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  282   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  341

Query  624   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIG RANS W
Sbjct  342   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGQRANSGW  400

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY+VPWGLY A+ YVKERYGNP + LSENGMD   N T+   L+DT R++YY+ Y+++LK
Sbjct  401   LYIVPWGLYNALMYVKERYGNPTVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLK  460

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             + VDDGAN+ GYFAWSLLDNFEW +GY++RFGI YVDFDTLKR PKMSAYWF+  L+R++
Sbjct  461   KAVDDGANVTGYFAWSLLDNFEWLLGYSARFGITYVDFDTLKRTPKMSAYWFKQLLQRDQ  520



>dbj|BAB02019.1| beta-glucosidase [Arabidopsis thaliana]
Length=495

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/486 (70%), Positives = 391/486 (80%), Gaps = 15/486 (3%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             S + V   TGGL+R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  19    SGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  76

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT E+ VDQYHRYK D+DLM  LN DAYRFSISW+RIFP G+GK+N  GVAYYNRLI+Y
Sbjct  77    NATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDY  136

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ++EKGITPYANL HYDLP ALE +Y G L +QVV          F+ FGDRVKNW +FNE
Sbjct  137   LIEKGITPYANLYHYDLPLALEQKYQGLLSKQVV--------VLFQTFGDRVKNWMTFNE  188

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ K
Sbjct  189   PRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAHAAAVQRYRQNYQEK  248

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP
Sbjct  249   QKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLP  308

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             +FT +EVK+VKGSID+VGINQYTT+++ DP    TP    YQ DWNV F +A+NG PIGP
Sbjct  309   KFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGP  368

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+SEWLY VPWG+YKA+ Y++ERYGNP M LSENGMD  GN+TL + LNDT R+ YY+ 
Sbjct  369   RAHSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRD  428

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGANL GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+ 
Sbjct  429   YLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQ  488

Query  105   FLRRNK  88
              L+R++
Sbjct  489   LLKRDQ  494



>ref|XP_006482390.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=518

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/480 (70%), Positives = 395/480 (82%), Gaps = 10/480 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR+SFP GFVFGTA+SAYQVEG  D  K GRGP IWD +  TPG   NNAT +V
Sbjct  44    FDTGGLSRKSFPEGFVFGTATSAYQVEGMAD--KDGRGPCIWDVYAHTPGHIANNATADV  101

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE+GI
Sbjct  102   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYD+P AL+++YGG L  QV  DYADYA+FCFK FGDRVKNW++FNEPRV+AA
Sbjct  162   TPYANLYHYDMPLALQEKYGGLLDCQV--DYADYADFCFKTFGDRVKNWYTFNEPRVIAA  219

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG+ G
Sbjct  220   LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIG  279

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+E
Sbjct  280   ILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEE  339

Query  624   VKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEW  448
             V +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS W
Sbjct  340   VLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGW  398

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELK  268
             LY+VPWGLY A+ YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK
Sbjct  399   LYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLK  458

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             +  DDGAN+ GYFAWSLLDNFEW +GY+SRFGI YVDFDTLKR PKMSAYWF+  L+R++
Sbjct  459   KAADDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQRDQ  518



>ref|XP_002272413.2| PREDICTED: beta-glucosidase 44-like [Vitis vinifera]
Length=552

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/485 (68%), Positives = 400/485 (82%), Gaps = 7/485 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E +   TGGLSRESFP GF+FGTASSAYQVEG TD  K GRGP IWD ++K PG    N 
Sbjct  69    EGLGLETGGLSRESFPKGFLFGTASSAYQVEGMTD--KAGRGPCIWDPYVKIPGNIAENG  126

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             T +VAVDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNW+GVAYYNRLINYML
Sbjct  127   TADVAVDQYHRYKEDLDIMKILNFDAYRFSISWSRIFPEGTGKVNWEGVAYYNRLINYML  186

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             +KGI PYANL HYDLP  L+++Y G L R++VED+A+YAEFCFK FGDRVK+W +FNEPR
Sbjct  187   KKGIIPYANLYHYDLPLVLQEKYNGLLSRRIVEDFANYAEFCFKTFGDRVKHWTTFNEPR  246

Query  984   VVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             V+AALG+D G   P RCS    NCT GNS+TEPY+ AHN++L HA AAQRYR  YQ KQK
Sbjct  247   VIAALGFDNGINPPSRCSKAFGNCTAGNSSTEPYIAAHNMLLSHAAAAQRYREKYQEKQK  306

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             G+ GILLD VWYEPLTRSK D  AAQRA DFH+GWFLHPI++G+YPK MQ+IVG+RLP+F
Sbjct  307   GKIGILLDTVWYEPLTRSKDDQQAAQRAIDFHLGWFLHPIIWGKYPKNMQDIVGERLPKF  366

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             + +E+KLVKGS+D+VGINQYT+FY++DP+   P +  YQ +WN GFAY RNGVPIGPRAN
Sbjct  367   SEEEIKLVKGSVDFVGINQYTSFYMFDPHKPKPKVTGYQEEWNAGFAYDRNGVPIGPRAN  426

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY+VPWG+YK VTYVKE+YGNP + +SENGMD  GN+TL  +L+DT R+ Y++ YL 
Sbjct  427   SFWLYIVPWGMYKTVTYVKEQYGNPPIIISENGMDDPGNVTLPMALHDTTRVKYFQDYLI  486

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
             ELK+ +D+GAN+ GYFAWS++DNFEW+ GYTSRFG+V++D+ + LKR+PKMSA+WF+  L
Sbjct  487   ELKKGIDEGANVHGYFAWSIVDNFEWKSGYTSRFGMVFIDYKNQLKRHPKMSAFWFKKLL  546

Query  99    RRNKH  85
             +R K 
Sbjct  547   QRKKQ  551



>gb|KHG12317.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=497

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/479 (69%), Positives = 389/479 (81%), Gaps = 7/479 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
              +TGGLSR+SFP GFVFGTA+SAYQVEG  +  K GRGP IWD ++K PG   NN T +V
Sbjct  22    MDTGGLSRDSFPKGFVFGTATSAYQVEGMAN--KGGRGPCIWDVYVKQPGHIANNDTADV  79

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYH YK D+DL+   NFDAYRFSISW+RIFP G G+VNW+GV YYNRLINY+++KGI
Sbjct  80    AVDQYHHYKEDVDLLANFNFDAYRFSISWSRIFPEGVGRVNWEGVDYYNRLINYLVKKGI  139

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPY NL HYDLPQAL+++Y G+L RQ+VEDYADYAEFCFK FGDRVKNWF+FNEPR+VAA
Sbjct  140   TPYGNLYHYDLPQALQEKYNGFLNRQIVEDYADYAEFCFKTFGDRVKNWFTFNEPRIVAA  199

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             LG+D G   P RCS    NCT GNSA EPY+V HNLIL HA A +RYR  YQAKQKG  G
Sbjct  200   LGFDNGINPPSRCSKEVGNCTDGNSAIEPYIVGHNLILSHAEAVKRYREKYQAKQKGSIG  259

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDF WYEPLTRSKADNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG RLP+FT +E
Sbjct  260   ILLDFNWYEPLTRSKADNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGKRLPKFTEEE  319

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             VK+V GS DYVGINQYTT Y+ +P   +  + +YQ+DWN  FA A+NGV IGPRANS WL
Sbjct  320   VKMVNGSFDYVGINQYTTSYISNPTSPSN-VTSYQSDWNAAFANAKNGVQIGPRANSWWL  378

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWG+YK VTY+KERYG+  + +SENGMD  GN TL   L DT RI ++K Y+ +LK+
Sbjct  379   YIVPWGMYKTVTYIKERYGDMNVIISENGMDDPGNATLPNGLKDTTRIKFFKDYMTQLKK  438

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
              +D+GAN+ GYFAWSLLDNFEW +GYTSRFGIVYVD++ LKRYPKMSAYWF+  L + +
Sbjct  439   AIDEGANVTGYFAWSLLDNFEWLLGYTSRFGIVYVDYNNLKRYPKMSAYWFKQLLEKKQ  497



>ref|NP_188435.2| beta glucosidase 43 [Arabidopsis thaliana]
 sp|Q9LV34.2|BGL43_ARATH RecName: Full=Beta-glucosidase 43; Short=AtBGLU43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE76042.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=501

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/486 (69%), Positives = 390/486 (80%), Gaps = 9/486 (2%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             S + V   TGGL+R+SFP GF+FGTA+SAYQVEG T  H+ GRGPSIWD F+K PG   N
Sbjct  19    SGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGET--HQDGRGPSIWDAFVKIPGKIAN  76

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NAT E+ VDQYHRYK D+DLM  LN DAYRFSISW+RIFP G+GK+N  GVAYYNRLI+Y
Sbjct  77    NATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDY  136

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ++EKGITPYANL HYDLP ALE +Y G L +Q    +       F+ FGDRVKNW +FNE
Sbjct  137   LIEKGITPYANLYHYDLPLALEQKYQGLLSKQ--GRFCGLRRVLFQTFGDRVKNWMTFNE  194

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAK  823
             PRVVAALGYD G FAPGRCS    NCT GNSATEPY+VAH+LIL HA A QRYR  YQ K
Sbjct  195   PRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAHAAAVQRYRQNYQEK  254

Query  822   QKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLP  643
             QKGR GILLDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP
Sbjct  255   QKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLP  314

Query  642   RFTPDEVKLVKGSIDYVGINQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             +FT +EVK+VKGSID+VGINQYTT+++ DP    TP    YQ DWNV F +A+NG PIGP
Sbjct  315   KFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGP  374

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RA+SEWLY VPWG+YKA+ Y++ERYGNP M LSENGMD  GN+TL + LNDT R+ YY+ 
Sbjct  375   RAHSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRD  434

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             YL +LK+ VDDGANL GYFAWSLLDNFEW  GYTSRFGIVYVD+  LKRYPKMSA WF+ 
Sbjct  435   YLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQ  494

Query  105   FLRRNK  88
              L+R++
Sbjct  495   LLKRDQ  500



>ref|XP_010916341.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=503

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/472 (70%), Positives = 394/472 (83%), Gaps = 3/472 (1%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             + G LSR SFP GFVFGTA+SAYQVEG     K GRGP IWDTF++ PG    NAT +V 
Sbjct  30    HAGFLSRGSFPEGFVFGTAASAYQVEGM--ALKAGRGPCIWDTFVRIPGNIAGNATADVT  87

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
             VD+YHRYK D+D+M K+NFDAYRFSISW+RIFPNGTG VNW+GV YYNRLINYML++GIT
Sbjct  88    VDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPNGTGTVNWRGVHYYNRLINYMLKQGIT  147

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PYANL HYDLPQAL+D Y GWL  ++VE YA++A+FCFK +GDRVKNWF+FNEPRVVAAL
Sbjct  148   PYANLYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKTYGDRVKNWFTFNEPRVVAAL  207

Query  969   GYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             GYD G  APGRC+NC+ G NS+TEPY+VAH+LILCHA A +RYR  YQ  Q+GR GILLD
Sbjct  208   GYDDGTHAPGRCTNCSAGGNSSTEPYIVAHHLILCHAAAVKRYREKYQVHQQGRIGILLD  267

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
             FVWYEPLT S +D  AA R+RDFHIGWFLHPI YGEYPKTMQ IV +RLP+FT +EV++V
Sbjct  268   FVWYEPLTNSISDQEAAHRSRDFHIGWFLHPITYGEYPKTMQEIVKERLPKFTREEVEMV  327

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVP  433
             KGSIDYVG+NQYT++Y+ D    +    +Y  DW+V FAY R+GVPIGPRA+S+WLY+VP
Sbjct  328   KGSIDYVGVNQYTSYYIKDHPTTSQTPVSYSADWHVTFAYDRDGVPIGPRAHSDWLYIVP  387

Query  432   WGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDD  253
             WG+YKAVTYVKE YGNP + LSENGMD  GN+TL  +L DT RI+YY+SY+A+LK  +DD
Sbjct  388   WGMYKAVTYVKETYGNPTIILSENGMDQPGNVTLPGALWDTVRINYYRSYIAKLKEAIDD  447

Query  252   GANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             GAN+ GYFAWSLLDNFEW++GYTSRFG+VYVD+ TL+RYPK SAYWF+N L+
Sbjct  448   GANVVGYFAWSLLDNFEWKLGYTSRFGLVYVDYSTLERYPKNSAYWFRNMLK  499



>ref|XP_008811966.1| PREDICTED: beta-glucosidase 1-like isoform X2 [Phoenix dactylifera]
Length=525

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/490 (69%), Positives = 395/490 (81%), Gaps = 27/490 (6%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR SFP GFVFGTA+SAYQVEG     K GRGP IWDTF+K PG    NAT +V VD+Y
Sbjct  34    LSRSSFPEGFVFGTAASAYQVEGMA--LKEGRGPCIWDTFVKIPGNIAGNATADVTVDEY  91

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK D+D+M K+NFDAYRFSISW+RIFP GTGKVNW+GV YYNRLINYML++GITPYAN
Sbjct  92    HRYKEDVDIMKKMNFDAYRFSISWSRIFPKGTGKVNWRGVFYYNRLINYMLKQGITPYAN  151

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQAL+D Y GWL  ++VE YA++A+FCFK+FGDRVKNWF+FNEPRVVAALGYD 
Sbjct  152   LYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKMFGDRVKNWFTFNEPRVVAALGYDD  211

Query  957   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             G  APGRC+NC+  GNSATEPY+VAH+LIL HA A +RYR  YQA QKG+ GIL DFVWY
Sbjct  212   GTHAPGRCTNCSAGGNSATEPYIVAHHLILSHAAAVKRYREKYQAHQKGKIGILCDFVWY  271

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT S  D  AAQRARDFHIGWFLHPI+YGEYPKTMQ IV +RLP+FT +EV++VKGSI
Sbjct  272   EPLTNSIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKFTREEVEMVKGSI  331

Query  600   DYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN----------  457
             DYVGINQYT++Y+ D   Y +TP   +Y  DW+  FAY R+GVPIGPR N          
Sbjct  332   DYVGINQYTSYYMEDQPTYSQTPV--SYSADWHTQFAYDRDGVPIGPRVNFCIFSVEELI  389

Query  456   ----------SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTK  307
                       SEWLY+VPWG+YKAVTYVKE YGNP + L+ENGMD  GN+TL  +L DT+
Sbjct  390   LDCFSCMQAHSEWLYIVPWGMYKAVTYVKETYGNPTVILAENGMDQPGNVTLPGALRDTQ  449

Query  306   RISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKM  127
             R++YYKSY+ ELK+ +DDGAN+ GYFAWSLLDNFEW++GYTSRFG+VYVD+ TLKRYPK 
Sbjct  450   RVNYYKSYITELKKAIDDGANVMGYFAWSLLDNFEWKLGYTSRFGLVYVDYSTLKRYPKN  509

Query  126   SAYWFQNFLR  97
             SAYWF+N L+
Sbjct  510   SAYWFRNMLK  519



>ref|XP_010034459.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=507

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/489 (69%), Positives = 392/489 (80%), Gaps = 6/489 (1%)
 Frame = -3

Query  1545  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
             VQ       V+F+ GGLSR SFP GF+FGTA+SAYQVEG       GRGPSIWD F++ P
Sbjct  21    VQSSDVKSEVKFDMGGLSRASFPKGFLFGTATSAYQVEGMASGD--GRGPSIWDAFVQVP  78

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
             G      +GE+AVDQYH+YK DIDLM KLNFDAYRFSISW+RIFPNGTG VNW+GV YYN
Sbjct  79    GNIKELDSGEMAVDQYHKYKEDIDLMHKLNFDAYRFSISWSRIFPNGTGYVNWRGVNYYN  138

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
             RLI+ ++ KGITPYANL HYD+P AL+ RY G L   VV+D+ADYAEFCFK FGDRVKNW
Sbjct  139   RLIDALIAKGITPYANLYHYDMPLALQLRYEGLLSINVVKDFADYAEFCFKTFGDRVKNW  198

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRA  838
              +FNEPRV+AALG+D+G   P RCS    NCT GNSATEPY+ AH+LIL HA A +RYR 
Sbjct  199   MTFNEPRVIAALGFDSGSNPPNRCSKPYGNCTAGNSATEPYIAAHHLILSHAAAVKRYRK  258

Query  837   IYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIV  658
              YQAKQ+GR GILLDFVWYEPLT S  DNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIV
Sbjct  259   RYQAKQQGRIGILLDFVWYEPLTSSLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIV  318

Query  657   GDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV  478
             G+RLP+FT  EV +VKG  D+VG+N YT++Y+Y+P         YQ DWNVGFA+ +NGV
Sbjct  319   GERLPKFTKREVNIVKGGFDFVGVNHYTSYYMYNPNWTETSPPGYQADWNVGFAFEKNGV  378

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRANS WLY+VPWG+ KAVTYVKE YGNP MFLSENGMD  GN+T  E L+D+ RI+
Sbjct  379   PIGPRANSGWLYIVPWGVNKAVTYVKENYGNPYMFLSENGMDDPGNVTYLEGLHDSTRIN  438

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+SYL ELK  +D+GAN+ GYFAWSLLDNFEW +GYT+RFGIVY+DF+ L R+PKMSAY
Sbjct  439   YYRSYLQELKAAIDNGANVNGYFAWSLLDNFEWLLGYTARFGIVYMDFNDLSRHPKMSAY  498

Query  117   WFQNFLRRN  91
             WF+  L +N
Sbjct  499   WFKQLLEKN  507



>ref|XP_004299546.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=513

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/479 (71%), Positives = 385/479 (80%), Gaps = 9/479 (2%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL R  FP GFVFGTA+SAYQVEG  +  K GRGPSIWD F+K PG   NN T +V  D
Sbjct  38    GGL-RTGFPKGFVFGTATSAYQVEGMAN--KEGRGPSIWDAFVKIPGNIANNDTADVTAD  94

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             +YHRYK DID+M  LNFD YRFSISW+RIFP+GTGKVN KGVAYYNRLINY+LE+GITPY
Sbjct  95    EYHRYKEDIDIMQDLNFDVYRFSISWSRIFPDGTGKVNLKGVAYYNRLINYLLERGITPY  154

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
             ANL+HYDLP ALE  Y G+L  +VV+D+ADYAEFCFK +GDRVK W +FNEPRVVAALGY
Sbjct  155   ANLHHYDLPLALEQEYLGFLSDRVVKDFADYAEFCFKTYGDRVKYWTTFNEPRVVAALGY  214

Query  963   DTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             D     P RCS    NCT GNS TEPY+VAH+L+L HA A  RYR  YQ  QKG  GILL
Sbjct  215   DNALNPPARCSKAYGNCTVGNSGTEPYIVAHHLLLSHAAAVHRYREKYQKTQKGSVGILL  274

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DF WYEPLT SK D  AAQRARDFHIGWF+HPIVYGEYPKTMQ+IVGDRLP+FT +EVK+
Sbjct  275   DFNWYEPLTSSKDDRDAAQRARDFHIGWFIHPIVYGEYPKTMQHIVGDRLPKFTKEEVKM  334

Query  615   VKGSIDYVGINQYTTFYVYDPYPK--TPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             VKGSID+VGINQYT +Y+YDP+     P    YQNDWN GFA+ +NGV IGP+A S WLY
Sbjct  335   VKGSIDFVGINQYTAYYMYDPHQNKTKPNALGYQNDWNAGFAFEKNGVLIGPQAYSSWLY  394

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
              VPWGLYK VTY+K+ YGNP + +SENGMD  GN TL E+L+DT RI +Y+SYL +LK+ 
Sbjct  395   QVPWGLYKCVTYIKKNYGNPTVIISENGMDNPGNQTLQEALHDTNRIDFYRSYLEQLKKA  454

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             VD+GAN+ GYFAWSLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+  L + KH
Sbjct  455   VDEGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTTLKRYPKMSAYWFKKLLTKKKH  513



>ref|XP_007036680.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
 gb|EOY21181.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
Length=469

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/429 (75%), Positives = 367/429 (86%), Gaps = 4/429 (1%)
 Frame = -3

Query  1416  HKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRI  1237
             H  GRGPSI D F+K PG+   NATGEV+VDQYHRYK D+DLM  LNFDAYRFSISW+RI
Sbjct  3     HCDGRGPSICDVFVKIPGIVAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRI  62

Query  1236  FPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYA  1057
             FP+GTGKVNWKGVAYYNRLI+ +L++GITPYANL HYDLP+ALE RY G L  QVV+D+A
Sbjct  63    FPDGTGKVNWKGVAYYNRLIDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFA  122

Query  1056  DYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVV  889
             D+A+FCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+V
Sbjct  123   DFADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIV  182

Query  888   AHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWF  709
             AH+LIL H  A QRYR  YQ KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF
Sbjct  183   AHHLILAHGAAVQRYRLKYQPKQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWF  242

Query  708   LHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIH  529
             +HPIVYGEYP+TMQ IVG+RLP+FT +EVK+VKGSID+VGINQYT +Y+YDP+   P + 
Sbjct  243   IHPIVYGEYPRTMQEIVGNRLPKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVL  302

Query  528   TYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDY  349
              YQ DWN GFAYA+ GVPIGPRANS WLY VPWGLYKA+ Y+KERYGNP + LSENGMD 
Sbjct  303   GYQQDWNAGFAYAKRGVPIGPRANSNWLYNVPWGLYKALMYIKERYGNPTVILSENGMDD  362

Query  348   VGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGI  169
              GN+TL++ L+DT RI+YYK+YL +L++ VD GAN+ GYFAWSLLDNFEWR+GYTSRFGI
Sbjct  363   PGNVTLSQGLHDTTRINYYKAYLTQLRKAVDGGANVVGYFAWSLLDNFEWRLGYTSRFGI  422

Query  168   VYVDFDTLK  142
             VYVDF  LK
Sbjct  423   VYVDFSNLK  431



>ref|XP_004140826.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN57432.1| hypothetical protein Csa_3G185120 [Cucumis sativus]
Length=515

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/481 (68%), Positives = 391/481 (81%), Gaps = 8/481 (2%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             +++F+TGGLSR +FP  F+FGTA+SAYQVEG  D  K GRG SIWD +++ PG    NAT
Sbjct  36    KIKFDTGGLSRNAFPKEFIFGTATSAYQVEGMAD--KDGRGQSIWDPYVQIPGNIAGNAT  93

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
             GEVAVDQYH+YK D+D+M +LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLI+YM++
Sbjct  94    GEVAVDQYHKYKEDVDIMKRLNFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMVD  153

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GITPYANL HYDLP  L++RYGG LG Q+V+D+A YAEFCF+ FGDRVKNW +FNEPRV
Sbjct  154   QGITPYANLYHYDLPLTLQERYGGLLGMQIVKDFAKYAEFCFEHFGDRVKNWMTFNEPRV  213

Query  981   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             +AALG+D G   P RCS    NCT GNS TEPY+ AH++IL HA A   YR  YQ  Q+G
Sbjct  214   IAALGFDNGINPPSRCSKEYGNCTNGNSGTEPYIAAHHIILSHAAAVDIYRNNYQKAQEG  273

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             R GILLDF +YEPLTR K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLP+F+
Sbjct  274   RIGILLDFAYYEPLTRGKQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKFS  333

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
              +EV LVKGSID++GINQYTTFY+++P         YQNDWNVGFA+ +NGVPIGPRA+S
Sbjct  334   EEEVSLVKGSIDFLGINQYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAHS  393

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY VPWG+YKA+ YVKERYGNP + LSENG D   ++ L E+L D +RI Y+K Y+  
Sbjct  394   TWLYQVPWGMYKALMYVKERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQN  452

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLR  97
             +KR +DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ + LKRYPKMSA+WF+  L+
Sbjct  453   MKRAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIVYVDYKNGLKRYPKMSAHWFKQMLQ  512

Query  96    R  94
             R
Sbjct  513   R  513



>ref|XP_004157213.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=515

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/481 (68%), Positives = 391/481 (81%), Gaps = 8/481 (2%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             +++F+TGGLSR +FP  F+FGTA+SAYQVEG  D  K GRG SIWD +++ PG    NAT
Sbjct  36    KIKFDTGGLSRNAFPKEFIFGTATSAYQVEGMAD--KDGRGQSIWDPYVQIPGNIAGNAT  93

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
             GEVAVDQYH+YK D+D+M +LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLI+YM++
Sbjct  94    GEVAVDQYHKYKEDVDIMKRLNFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMVD  153

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GITPYANL HYDLP  L++RYGG LG Q+V+D+A YAEFCF+ FGDRVKNW +FNEPRV
Sbjct  154   QGITPYANLYHYDLPLTLQERYGGLLGMQIVKDFAKYAEFCFEHFGDRVKNWMTFNEPRV  213

Query  981   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             +AALG+D G   P RCS    NCT GNS TEPY+ AH++IL HA A   YR  YQ  Q+G
Sbjct  214   IAALGFDNGINPPSRCSKEYGNCTNGNSGTEPYIAAHHIILSHAAAVDIYRNNYQKAQEG  273

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             R GILLDF +YEPLTR K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLP+F+
Sbjct  274   RIGILLDFAYYEPLTRGKQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKFS  333

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
              +EV LVKGSID++GINQYTTFY+++P         YQNDWNVGFA+ +NGVPIGPRA+S
Sbjct  334   EEEVSLVKGSIDFLGINQYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAHS  393

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY VPWG+YKA+ YVKERYGNP + LSENG D   ++ L E+L D +RI Y+K Y+  
Sbjct  394   TWLYQVPWGMYKALMYVKERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQN  452

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLR  97
             +KR +DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ + LKRYPKMSA+WF+  L+
Sbjct  453   MKRAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIVYVDYRNGLKRYPKMSAHWFKQMLQ  512

Query  96    R  94
             R
Sbjct  513   R  513



>gb|AEV76986.1| beta-glucosidase 4, partial [Triticum aestivum]
Length=501

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/486 (67%), Positives = 383/486 (79%), Gaps = 4/486 (1%)
 Frame = -3

Query  1542  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             QCD     +R NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGPSIWD F   PG
Sbjct  17    QCDGPNPEIR-NTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPSIWDAFAAIPG  73

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
                 N + +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNR
Sbjct  74    TIAGNGSADVTVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNR  133

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKNWF
Sbjct  134   LIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWF  193

Query  1002  SFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             +FNEPRVVAALGYD G  APGRCS C   G+S TEPY+V HN+IL HA A QRYR  YQ 
Sbjct  194   TFNEPRVVAALGYDNGLHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKYQP  253

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+RL
Sbjct  254   HQKGRIGILLDFVWYEPHSNSNADQGAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRL  313

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P F+ +E ++VKGSIDYVGINQYT++Y+ DP        +YQ+DW+VGF Y RNGVPIGP
Sbjct  314   PGFSTNESRMVKGSIDYVGINQYTSYYMKDPGAWNLTPVSYQDDWHVGFVYERNGVPIGP  373

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKS  286
             RANS+WLY+VPWG+ KAVTYVKERYGNP M LSENGMD  GN+++A+ ++DT RI YY+ 
Sbjct  374   RANSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTIRIRYYRD  433

Query  285   YLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+GYT+RFGI YVDF+TLKRYPK SA WF+N
Sbjct  434   YITELKKAIDNGARVVGYFAWSLLDNFEWRLGYTARFGIAYVDFNTLKRYPKDSALWFKN  493

Query  105   FLRRNK  88
              L   K
Sbjct  494   MLSEKK  499



>ref|XP_008457084.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=517

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/481 (67%), Positives = 388/481 (81%), Gaps = 8/481 (2%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             ++  +TG LSR +FP GF+FGTA+SAYQVEG     + GRG SIWD +++ PG    NAT
Sbjct  38    KIELDTGELSRNAFPKGFIFGTATSAYQVEGMA--KEDGRGQSIWDPYVQIPGNIAGNAT  95

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
             GEVAVDQYHRYK D+D+M +LNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM++
Sbjct  96    GEVAVDQYHRYKEDVDIMKRLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMID  155

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GITPYANL HYDLP  L++RYGG LG+Q+V+D+A YA+FCF+ FGDRVKNW +FNEPRV
Sbjct  156   QGITPYANLYHYDLPLTLQERYGGLLGKQIVKDFAKYAKFCFEHFGDRVKNWMTFNEPRV  215

Query  981   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             +AALG+D G   P RCS    NCT GNS TEPY+ AH+++L HA A   YR  YQ +Q G
Sbjct  216   IAALGFDNGINPPSRCSKEYGNCTNGNSGTEPYLAAHHILLSHAAAVDIYRNNYQKEQGG  275

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             R GILLDFV+YEPLTR K DNYAAQRARDFHIGWFLHPI YGEYP+TMQ IV +RLP+F+
Sbjct  276   RIGILLDFVYYEPLTRGKQDNYAAQRARDFHIGWFLHPITYGEYPRTMQEIVKERLPKFS  335

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
              +E+ LVKGSID++GINQYTTFY+++P         YQNDWNVGFA+ + GVPIGPRA+S
Sbjct  336   EEEISLVKGSIDFLGINQYTTFYMFNPQSTQLDAPGYQNDWNVGFAFEKKGVPIGPRAHS  395

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY VPWG+YKA+ YVKERYGNP + LSENG D   ++ L E+L D +RI Y+K Y+  
Sbjct  396   AWLYQVPWGMYKALMYVKERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQS  454

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLR  97
             +KR +DDGAN+ GYFAWSLLDNFEW  GYTSRFGIVYVD+ + LKRYPKMSA+WF+  L+
Sbjct  455   MKRAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIVYVDYKNGLKRYPKMSAHWFKQMLQ  514

Query  96    R  94
             R
Sbjct  515   R  515



>ref|XP_006845277.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
 gb|ERN06952.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
Length=479

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 375/459 (82%), Gaps = 10/459 (2%)
 Frame = -3

Query  1437  VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRF  1258
             VEGA   H+ GRGPSIWD F++ PG+ PN ATGEV+ D+YHRYK D+D+M  +N DAYRF
Sbjct  23    VEGAA--HEDGRGPSIWDVFVQYPGIIPNGATGEVSADEYHRYKEDVDIMADMNMDAYRF  80

Query  1257  SISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGR  1078
             SISW+RIFP G G+VN KGV YYNRLI+Y+LEKGITPYANL HYDLPQ+LED Y G L R
Sbjct  81    SISWSRIFPEGVGRVNQKGVDYYNRLIDYLLEKGITPYANLYHYDLPQSLEDSYNGLLNR  140

Query  1077  QVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSN--------CT  922
             +VV+D+A YA+FCFK FGDRVKNW +FNEPRV+AALGYD GF APGRCSN        CT
Sbjct  141   RVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGFHAPGRCSNPFGNDGMNCT  200

Query  921   QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAA  742
              G+S+TEPY+VAHNLIL HA A +RYR  YQA QKGR GILLDFVWYEP + +KAD  AA
Sbjct  201   AGDSSTEPYIVAHNLILSHASAVKRYREKYQATQKGRIGILLDFVWYEPFSNAKADVRAA  260

Query  741   QRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYV  562
             QR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGINQYT++Y+
Sbjct  261   QRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGINQYTSYYI  320

Query  561   YDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNP  382
              D + K   +  YQ DW+ GF Y+R+G  IGP+ANS WLYMVPWG+YKAVTY+KE Y NP
Sbjct  321   KDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANSYWLYMVPWGMYKAVTYIKENYRNP  380

Query  381   LMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFE  202
              M LSENGMDY  N+TL  +L+DTKRI YY+SYL  LK+ +DDGAN+ GYFAWSL+DNFE
Sbjct  381   TMILSENGMDYAANITLPAALHDTKRIGYYRSYLINLKKAIDDGANVIGYFAWSLVDNFE  440

Query  201   WRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             WR+GYTSRFG+VYVD+ TLKRYPKMSA WF+  ++R  H
Sbjct  441   WRLGYTSRFGLVYVDYQTLKRYPKMSASWFRGLIQRKSH  479



>ref|XP_006845278.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
 gb|ERN06953.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
Length=479

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/459 (68%), Positives = 374/459 (81%), Gaps = 10/459 (2%)
 Frame = -3

Query  1437  VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRF  1258
             VEGA   H+ GRGPSIWD F++ PG+ PN ATGEV+ D+YHRYK D+D+M  +N DAYRF
Sbjct  23    VEGAA--HEDGRGPSIWDVFVQYPGIIPNGATGEVSADEYHRYKEDVDIMADMNMDAYRF  80

Query  1257  SISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGR  1078
             SISW+RIFP G G+VN KGV YYNRLI+Y+LEKGITPYANL HYDLPQ+LED Y G L R
Sbjct  81    SISWSRIFPEGVGRVNQKGVDYYNRLIDYLLEKGITPYANLYHYDLPQSLEDSYNGLLNR  140

Query  1077  QVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSN--------CT  922
             +VV+D+A YA+FCFK FGDRVKNW +FNEPRV+AALGYD GF APGRCSN        CT
Sbjct  141   RVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGFHAPGRCSNPFGNDGMNCT  200

Query  921   QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAA  742
              G+S+TEPY+VAHNLIL HA A +RYR  YQA QKGR GILLDFVWYEP + +KAD  AA
Sbjct  201   AGDSSTEPYIVAHNLILSHASAVKRYREKYQATQKGRIGILLDFVWYEPFSNAKADVRAA  260

Query  741   QRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYV  562
             QR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGIN YT++Y+
Sbjct  261   QRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGINHYTSYYI  320

Query  561   YDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNP  382
              D + K   +  YQ DW+ GF Y+R+G  IGP+ANS WLYMVPWG+YKAVTY+KE Y NP
Sbjct  321   KDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANSYWLYMVPWGMYKAVTYIKENYRNP  380

Query  381   LMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFE  202
              M LSENGMDY  N+TL  +L+DTKRI YY+SYL  LK+ +DDGAN+ GYFAWSL+DNFE
Sbjct  381   TMILSENGMDYAANITLPAALHDTKRIGYYRSYLINLKKAIDDGANVIGYFAWSLVDNFE  440

Query  201   WRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             WR+GYTSRFG+VYVD+ TLKRYPKMSA WF+  ++R  H
Sbjct  441   WRLGYTSRFGLVYVDYQTLKRYPKMSASWFRGLIQRKSH  479



>ref|XP_009394053.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/477 (66%), Positives = 385/477 (81%), Gaps = 5/477 (1%)
 Frame = -3

Query  1515  RFNTGG--LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             RF  G   L+R++FP GFVFGTA+SAYQVEG     + GRGP IWD F++ PG+ PNNAT
Sbjct  26    RFAVGANQLNRDAFPEGFVFGTAASAYQVEGMA--LEGGRGPCIWDAFVRVPGIIPNNAT  83

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +V+VD+YH YK D+D+M K NFDAYRFSISW+RIFPNGTG++NW+GV YY+RLI+Y++ 
Sbjct  84    ADVSVDEYHHYKEDVDIMKKFNFDAYRFSISWSRIFPNGTGEINWQGVDYYDRLIDYLIL  143

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GITPYANL HYDLP AL   Y GW+  ++V+ +A+YA+FCF+ +GDRVKNWF+FNEPRV
Sbjct  144   QGITPYANLYHYDLPLALHKEYLGWVSPKIVDAFANYADFCFERYGDRVKNWFTFNEPRV  203

Query  981   VAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             V+ALGYD G  APGRC++C   GNS TEPY+V HN+IL HA A +RYR  YQ  QKG+ G
Sbjct  204   VSALGYDNGLHAPGRCTDCKVGGNSTTEPYIVTHNIILSHAAAVKRYREKYQVDQKGKIG  263

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I+LDFVWYEP T S  D  AAQRARDFH+GWFLHP+ YG YPK++Q IV DRLP+FT D+
Sbjct  264   IILDFVWYEPHTHSANDEAAAQRARDFHLGWFLHPLTYGYYPKSIQEIVKDRLPKFTDDQ  323

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             VK+VKGS DYVG+NQYT +Y+ D     P   +YQ+DW+V F Y ++GVPIGPRANS WL
Sbjct  324   VKMVKGSYDYVGVNQYTAYYMKDNGVTNPKPVSYQDDWHVEFKYDQDGVPIGPRANSYWL  383

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VPWG+YKAVTYVKE YG+P++ L+ENGMD  GN+TL E L D +RI+Y+KSY+ ELKR
Sbjct  384   YIVPWGMYKAVTYVKENYGDPIIILAENGMDQPGNVTLPEGLRDAERINYFKSYITELKR  443

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
              +DDGA + GYFAWSLLDNFEWRIGYTSRFG+VYVDF T  RYPK SAYWF+N L+R
Sbjct  444   AIDDGATVIGYFAWSLLDNFEWRIGYTSRFGLVYVDFKTNIRYPKQSAYWFKNMLKR  500



>ref|XP_003562544.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
 ref|XP_010234616.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
Length=500

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/488 (67%), Positives = 394/488 (81%), Gaps = 6/488 (1%)
 Frame = -3

Query  1548  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             + QC   PE    +TGGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ 
Sbjct  17    LAQCH-RPEI--HDTGGLSRGAFPEGFVFGTAASAYQVEGMAK--RGGRGPSIWDAFIEI  71

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG+   N T +VAVD+YHRYK D+D+M  + FDAYRFSISW+RIFPNG GKVN +GV YY
Sbjct  72    PGMISGNGTADVAVDEYHRYKEDVDIMKSMGFDAYRFSISWSRIFPNGAGKVNQEGVDYY  131

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++VE +ADYA+FCFK+FGDRVKN
Sbjct  132   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVEAFADYADFCFKVFGDRVKN  191

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             WF+FNEPR VAALGYD G+ APGRCS CT  GNS TEPY+VAH+LIL HA A +RYR  Y
Sbjct  192   WFTFNEPRCVAALGYDNGYHAPGRCSQCTAGGNSMTEPYLVAHHLILSHAAAVKRYREKY  251

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q  QKG+ GILLDFVWYEPL++SKAD  AAQRARDFH+GWFL PIV+G+YP++M  IV  
Sbjct  252   QHHQKGKIGILLDFVWYEPLSKSKADQAAAQRARDFHLGWFLDPIVHGQYPESMLKIVEG  311

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPI  472
             RLP F+ +E ++VKGS+DYVGIN YT++Y+ DP        +YQ+DW+VGF Y RNGVPI
Sbjct  312   RLPTFSHEESRMVKGSMDYVGINHYTSYYMKDPGAWNLTPVSYQDDWHVGFVYERNGVPI  371

Query  471   GPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYY  292
             G RANS WLY+VPWG+ KAVTYVKERYGNP MFLSENGMD  GN+++ E ++DT R+ YY
Sbjct  372   GARANSYWLYIVPWGINKAVTYVKERYGNPTMFLSENGMDQPGNVSITEGVHDTVRVRYY  431

Query  291   KSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWF  112
             + Y+ ELK+V+DDGA + GYFAWSLLDNFEWR+GYTSRFGIVYVD+ TLKRYPK SA+WF
Sbjct  432   REYITELKKVIDDGARVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWF  491

Query  111   QNFLRRNK  88
             +N L + +
Sbjct  492   KNMLSKKR  499



>ref|XP_008655551.1| PREDICTED: beta-glucosidase 1-like [Zea mays]
Length=570

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/478 (69%), Positives = 388/478 (81%), Gaps = 5/478 (1%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E+    TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG   NNA
Sbjct  91    EKAAAWTGGLSRRSFPKGFVFGTAASAYQVEGMA--HKDGRGPSIWDAFIKIPGEIANNA  148

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
             T +V VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLINYM+
Sbjct  149   TADVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLINYMV  208

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
             +KGITPYANL HYDLP+ALE RYGG L R+VV  +ADYA+FCF  FGDRVKNW +FNEPR
Sbjct  209   KKGITPYANLYHYDLPEALEVRYGGLLSREVVRSFADYADFCFGAFGDRVKNWLTFNEPR  268

Query  984   VVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
             VVAALGYD G FAPGRC+ C   G+S TEPYVVAH+LIL HA A QRYR  +Q  Q+GR 
Sbjct  269   VVAALGYDDGRFAPGRCTGCEAGGDSGTEPYVVAHHLILSHAAAVQRYRRRHQPTQRGRV  328

Query  807   GILLDFVWYEPLT-RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  631
             GILLDFVWYEPLT  S AD  AAQR+RDFH+GWFLHPIVYGEYPK+++  V  RLP+FT 
Sbjct  329   GILLDFVWYEPLTADSAADRAAAQRSRDFHVGWFLHPIVYGEYPKSVRRSVKGRLPKFTA  388

Query  630   DEVKLVKGSIDYVGINQYTTFYVYDPYPK-TPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
             +E  LV+GSIDYVG+NQYT +YV D  P  T    +Y +DW+  F Y R+GVPIGPRANS
Sbjct  389   EEAGLVRGSIDYVGVNQYTAYYVRDRRPNATAAPPSYSSDWHAEFVYERDGVPIGPRANS  448

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
             +WLY+VPWGLYKAVTYVKE+YGNP M LSENGMD  GN+T+ + + D  R++YY+SY+AE
Sbjct  449   DWLYIVPWGLYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVGQGVRDAARVAYYRSYVAE  508

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             LK  +D GAN  GYFAWSLLDNFEW++GYTSRFG+VYVDF TL+RYPK SAYWF++ +
Sbjct  509   LKAAIDGGANCVGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKSSAYWFRDVI  566



>gb|KHN44611.1| Beta-glucosidase 44 [Glycine soja]
Length=406

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/406 (77%), Positives = 351/406 (86%), Gaps = 4/406 (1%)
 Frame = -3

Query  1290  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  1111
             M  LNFDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLINY+LEKGITPYANL HYDLP A
Sbjct  1     MASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLINYLLEKGITPYANLYHYDLPLA  60

Query  1110  LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  931
             LE+RY G L RQVV D+ADYAEFCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS
Sbjct  61    LEERYNGLLSRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCS  120

Query  930   ----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRS  763
                 NCT GNS TEPY+VAHNLIL HA A QRYR  YQ KQKGR GILLDFVWYEPLTRS
Sbjct  121   KEYGNCTAGNSGTEPYIVAHNLILSHAAAVQRYREKYQEKQKGRIGILLDFVWYEPLTRS  180

Query  762   KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  583
             KADN AAQRARDFH+GWF+HP+VYGEYP T+QNIVG+RLP+FT +EVK+VKGSID+VGIN
Sbjct  181   KADNLAAQRARDFHVGWFIHPLVYGEYPTTIQNIVGNRLPKFTSEEVKIVKGSIDFVGIN  240

Query  582   QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  403
             QYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGPRA S WLY VPWG+YK++ Y+
Sbjct  241   QYTTYYMYDPHQAKPKVPGYQMDWNAGFAYAKNGVPIGPRAYSYWLYNVPWGMYKSLMYI  300

Query  402   KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  223
             KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFAW
Sbjct  301   KERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFAW  360

Query  222   SLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             SLLDNFEWR+GYTSRFGIVYVDF TLKRYPKMSAYWF+  + + K+
Sbjct  361   SLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIAKKKY  406



>gb|KDO62879.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62880.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=406

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/406 (77%), Positives = 352/406 (87%), Gaps = 4/406 (1%)
 Frame = -3

Query  1290  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  1111
             M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LINY+L++GITPYANL HYDLP+A
Sbjct  1     MANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLINYLLKRGITPYANLYHYDLPEA  60

Query  1110  LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  931
             LE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FNEPRVVAALGYD GFFAPGRCS
Sbjct  61    LEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCS  120

Query  930   ----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRS  763
                 NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ KQKGR GILLDFVWYEPLTRS
Sbjct  121   KAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQKQKGRIGILLDFVWYEPLTRS  180

Query  762   KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  583
             KADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGIN
Sbjct  181   KADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGIN  240

Query  582   QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  403
             QYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPRANS WLY VPWG+YKA+ Y+
Sbjct  241   QYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRANSYWLYNVPWGMYKALMYI  300

Query  402   KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  223
             K  YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFAW
Sbjct  301   KGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFAW  360

Query  222   SLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
             SLLDNFEWR+GYTSRFGIVYVDF  LKRYPKMSAYWF+  L+RNKH
Sbjct  361   SLLDNFEWRLGYTSRFGIVYVDFTNLKRYPKMSAYWFKQLLKRNKH  406



>gb|AFW79802.1| hypothetical protein ZEAMMB73_091278 [Zea mays]
Length=539

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/484 (68%), Positives = 386/484 (80%), Gaps = 17/484 (4%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGLSR SFP GFVFGTA+SAYQVEG    HK GRGPSIWD F+K PG   NNAT +V V
Sbjct  54    TGGLSRRSFPKGFVFGTAASAYQVEGMA--HKDGRGPSIWDAFIKIPGEIANNATADVTV  111

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             D+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG+VNWKGVAYYNRLINYM++KGITP
Sbjct  112   DEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLINYMVKKGITP  171

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             YANL HYDLP+ALE RYGG L R+VV  +ADYA+FCF  FGDRVKNW +FNEPRVVAALG
Sbjct  172   YANLYHYDLPEALEVRYGGLLSREVVRSFADYADFCFGAFGDRVKNWLTFNEPRVVAALG  231

Query  966   YDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  790
             YD G FAPGRC+ C   G+S TEPYVVAH+LIL HA A QRYR  +Q  Q+GR GILLDF
Sbjct  232   YDDGRFAPGRCTGCEAGGDSGTEPYVVAHHLILSHAAAVQRYRRRHQPTQRGRVGILLDF  291

Query  789   VWYEPLT-RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
             VWYEPLT  S AD  AAQR+RDFH+GWFLHPIVYGEYPK+++  V  RLP+FT +E  LV
Sbjct  292   VWYEPLTADSAADRAAAQRSRDFHVGWFLHPIVYGEYPKSVRRSVKGRLPKFTAEEAGLV  351

Query  612   KGSIDYVGINQYTTFYVYDPYPK-TPYIHTYQNDWNVGF------------AYARNGVPI  472
             +GSIDYVG+NQYT +YV D  P  T    +Y +DW+  F            A  R+GVPI
Sbjct  352   RGSIDYVGVNQYTAYYVRDRRPNATAAPPSYSSDWHAEFVSSLTPIHATLHADERDGVPI  411

Query  471   GPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYY  292
             GPRANS+WLY+VPWGLYKAVTYVKE+YGNP M LSENGMD  GN+T+ + + D  R++YY
Sbjct  412   GPRANSDWLYIVPWGLYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVGQGVRDAARVAYY  471

Query  291   KSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWF  112
             +SY+AELK  +D GAN  GYFAWSLLDNFEW++GYTSRFG+VYVDF TL+RYPK SAYWF
Sbjct  472   RSYVAELKAAIDGGANCVGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKSSAYWF  531

Query  111   QNFL  100
             ++ +
Sbjct  532   RDVI  535



>gb|ACF07998.1| beta-glucosidase [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/490 (67%), Positives = 390/490 (80%), Gaps = 8/490 (2%)
 Frame = -3

Query  1545  VQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             ++CD  +P     NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGP IWD F+  
Sbjct  22    LECDGPNPNPEIGNTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPCIWDAFVAI  79

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG+   N T +V VD+YHRYK D+ +M  + FDAYRFSI W+RIFP+GTGKVN +GV YY
Sbjct  80    PGMIAGNGTADVTVDEYHRYKEDVGIMKNMGFDAYRFSIIWSRIFPDGTGKVNQEGVDYY  139

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKN
Sbjct  140   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKN  199

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             WF+FNEPRVVAALGYD GF APGRCS C   G+S TEPY+V HN+IL HA A QRYR  Y
Sbjct  200   WFTFNEPRVVAALGYDNGFHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKY  259

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q  QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+
Sbjct  260   QPHQKGRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVGN  319

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  478
             RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGV
Sbjct  320   RLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGV  377

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M LSENGMD  GN+++A+ ++DT RI 
Sbjct  378   PIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTVRIR  437

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+ Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+GYT+RFGIVYVDF+TLKRYPK SA 
Sbjct  438   YYRDYITELKKAIDNGARVAGYFAWSLLDNFEWRLGYTARFGIVYVDFNTLKRYPKDSAL  497

Query  117   WFQNFLRRNK  88
             WF+N L   K
Sbjct  498   WFKNMLSEKK  507



>gb|EMT08337.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=507

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/488 (67%), Positives = 387/488 (79%), Gaps = 8/488 (2%)
 Frame = -3

Query  1542  QCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPG  1363
             QCD     +R NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGPSIWD F   PG
Sbjct  23    QCDGPNPEIR-NTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPSIWDAFAAIPG  79

Query  1362  LEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNR  1183
                 N + +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNR
Sbjct  80    TIAGNGSADVTVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNR  139

Query  1182  LINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWF  1003
             LI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKNWF
Sbjct  140   LIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWF  199

Query  1002  SFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             +FNEPRVVAALGYD G  APGRCS C   G+S TEPY+V HN+IL HA A QRYR  YQ 
Sbjct  200   TFNEPRVVAALGYDNGLHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKYQP  259

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
              QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IV +RL
Sbjct  260   HQKGRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVSNRL  319

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPI  472
             P F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGVPI
Sbjct  320   PGFSADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGVPI  377

Query  471   GPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYY  292
             GPRANS+WLY+VPWG+ KAVTYVKERYGNP M LSENGMD  GN+++A+ ++DT RI +Y
Sbjct  378   GPRANSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTVRIRFY  437

Query  291   KSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWF  112
             + Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+GYT+RFGIVYVDF+TLKRYPK SA WF
Sbjct  438   RDYITELKKAIDNGARVVGYFAWSLLDNFEWRLGYTARFGIVYVDFNTLKRYPKDSALWF  497

Query  111   QNFLRRNK  88
             +N L   K
Sbjct  498   KNMLSEKK  505



>emb|CBI33559.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/448 (67%), Positives = 371/448 (83%), Gaps = 5/448 (1%)
 Frame = -3

Query  1413  KYGRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIF  1234
             K GRGP IWD ++K PG    N T +VAVDQYHRYK D+D+M  LNFDAYRFSISW+RIF
Sbjct  4     KAGRGPCIWDPYVKIPGNIAENGTADVAVDQYHRYKEDLDIMKILNFDAYRFSISWSRIF  63

Query  1233  PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYAD  1054
             P GTGKVNW+GVAYYNRLINYML+KGI PYANL HYDLP  L+++Y G L R++VED+A+
Sbjct  64    PEGTGKVNWEGVAYYNRLINYMLKKGIIPYANLYHYDLPLVLQEKYNGLLSRRIVEDFAN  123

Query  1053  YAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVA  886
             YAEFCFK FGDRVK+W +FNEPRV+AALG+D G   P RCS    NCT GNS+TEPY+ A
Sbjct  124   YAEFCFKTFGDRVKHWTTFNEPRVIAALGFDNGINPPSRCSKAFGNCTAGNSSTEPYIAA  183

Query  885   HNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFL  706
             HN++L HA AAQRYR  YQ KQKG+ GILLD VWYEPLTRSK D  AAQRA DFH+GWFL
Sbjct  184   HNMLLSHAAAAQRYREKYQEKQKGKIGILLDTVWYEPLTRSKDDQQAAQRAIDFHLGWFL  243

Query  705   HPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHT  526
             HPI++G+YPK MQ+IVG+RLP+F+ +E+KLVKGS+D+VGINQYT+FY++DP+   P +  
Sbjct  244   HPIIWGKYPKNMQDIVGERLPKFSEEEIKLVKGSVDFVGINQYTSFYMFDPHKPKPKVTG  303

Query  525   YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYV  346
             YQ +WN GFAY RNGVPIGPRANS WLY+VPWG+YK VTYVKE+YGNP + +SENGMD  
Sbjct  304   YQEEWNAGFAYDRNGVPIGPRANSFWLYIVPWGMYKTVTYVKEQYGNPPIIISENGMDDP  363

Query  345   GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIV  166
             GN+TL  +L+DT R+ Y++ YL ELK+ +D+GAN+ GYFAWS++DNFEW+ GYTSRFG+V
Sbjct  364   GNVTLPMALHDTTRVKYFQDYLIELKKGIDEGANVHGYFAWSIVDNFEWKSGYTSRFGMV  423

Query  165   YVDF-DTLKRYPKMSAYWFQNFLRRNKH  85
             ++D+ + LKR+PKMSA+WF+  L+R K 
Sbjct  424   FIDYKNQLKRHPKMSAFWFKKLLQRKKQ  451



>gb|AAA87339.1| beta-glucosidase [Hordeum vulgare]
Length=509

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/490 (67%), Positives = 390/490 (80%), Gaps = 8/490 (2%)
 Frame = -3

Query  1545  VQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             ++CD  +P     NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGP IWD F+  
Sbjct  22    LECDGPNPNPEIGNTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPCIWDAFVAI  79

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
              G+   N T +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YY
Sbjct  80    QGMIAGNGTADVTVDEYHRYKEDVGIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYY  139

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKN
Sbjct  140   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKN  199

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             WF+FNEPRVVAALGYD GF APGRCS C   G+S TEPY+V HN+IL HA A QRYR  Y
Sbjct  200   WFTFNEPRVVAALGYDNGFHAPGRCSKCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKY  259

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q  QKGR GILLDFVWYEP + + AD  AAQRARDFHIGWFL PI  G YP +M  IVG+
Sbjct  260   QPHQKGRIGILLDFVWYEPHSDTDADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVGN  319

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  478
             RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGV
Sbjct  320   RLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGV  377

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M LSENGMD  GN+++A+ ++DT RI 
Sbjct  378   PIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTVRIR  437

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+ Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+GYT+RFGIVYVDF+TLKRYPK SA 
Sbjct  438   YYRDYITELKKAIDNGARVAGYFAWSLLDNFEWRLGYTARFGIVYVDFNTLKRYPKDSAL  497

Query  117   WFQNFLRRNK  88
             WF+N L   K
Sbjct  498   WFKNMLSEKK  507



>ref|XP_008453769.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=506

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/480 (66%), Positives = 378/480 (79%), Gaps = 8/480 (2%)
 Frame = -3

Query  1518  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1339
             + F+TGGLSR +FP GFVFGTA+SAYQVEG  D  K GRG SIWD F+K PG    NATG
Sbjct  29    IIFDTGGLSRAAFPEGFVFGTATSAYQVEGMAD--KDGRGQSIWDPFVKLPGKIAGNATG  86

Query  1338  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1159
             +VAVDQYHRYK DID M KLNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM+++
Sbjct  87    DVAVDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQ  146

Query  1158  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  979
             GITPYANL HYDLP AL++RYGG L +Q+V D+  YAEFCF+ FGDRVKNW +FNEPRV+
Sbjct  147   GITPYANLYHYDLPLALQERYGGLLDKQIVADFTSYAEFCFEEFGDRVKNWMTFNEPRVI  206

Query  978   AALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGR  811
             A +G+++G   P RCS    NCT GNS TEPY+VAHN+IL HA     YR  +Q KQ GR
Sbjct  207   ADVGFNSGIMPPSRCSKEYGNCTNGNSGTEPYIVAHNIILSHANVVDTYRRKFQEKQGGR  266

Query  810   FGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTP  631
              GILLDF +YEPLT  K D  AAQRARDF IGWFLHP  YGEYP+ MQ IV +RLP+F+ 
Sbjct  267   VGILLDFTYYEPLTNGKEDRDAAQRARDFTIGWFLHPFTYGEYPRRMQEIVKERLPKFSE  326

Query  630   DEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSE  451
             +EV +VKGS+D+VGINQYTTFY+++P    P    YQ+DW+VG+AY +NG PIG RA++ 
Sbjct  327   EEVTMVKGSVDFVGINQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGKRAHTG  386

Query  450   WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAEL  271
             WLY VPWG++KA+ YVKE YGNP + +SENGMD   ++ L E LND +RI+YYK+YL  +
Sbjct  387   WLYEVPWGMHKALMYVKEHYGNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQNM  445

Query  270   KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD-TLKRYPKMSAYWFQNFLRR  94
             K+ +DDGAN+ GYFAWSLLDNFEW  GYTSRFGI+YVD+   L R PKMSAYWF+  + +
Sbjct  446   KKAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIIYVDYKHNLNRIPKMSAYWFKQMIHK  505



>ref|XP_004149144.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN53236.1| hypothetical protein Csa_4G031070 [Cucumis sativus]
Length=506

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/479 (66%), Positives = 379/479 (79%), Gaps = 8/479 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR +FP GFVFGTA+SAYQVEG  D  K GRG SIWD F+K PG   +NATG+V
Sbjct  31    FDTGGLSRAAFPEGFVFGTATSAYQVEGMAD--KDGRGQSIWDPFVKLPGKIVDNATGDV  88

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYHRYK DID M KLNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM+++GI
Sbjct  89    AVDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGI  148

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLP AL++RY G L +Q+V D+ +YAEFCF+ FGDRVKNW +FNEPRV+A 
Sbjct  149   TPYANLYHYDLPLALQERYRGLLDKQIVIDFTNYAEFCFEEFGDRVKNWMTFNEPRVIAD  208

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             +G+++G   P RCS    NCT GNS TEPY+VAHN+IL HA     YR  +Q KQ GR G
Sbjct  209   VGFNSGIMPPSRCSKEYGNCTDGNSGTEPYIVAHNIILSHANVVDTYRKKFQEKQGGRVG  268

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDF +YEPLT  K D  AAQRARDFHIGWFLHP  YGEYP+ MQ IV +RLP+F+ +E
Sbjct  269   ILLDFTYYEPLTNEKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEE  328

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             VK VKGS+D+VGINQYTTFY+++P    P    YQ+DW+VG+AY +NG PIG RA++ WL
Sbjct  329   VKKVKGSVDFVGINQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGQRAHTGWL  388

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y VPWG+YKA+ YVK+ Y NP + +SENGMD   ++ L E LND +RI+YYK+YL  +K+
Sbjct  389   YEVPWGMYKALMYVKQHYRNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQNMKK  447

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD-TLKRYPKMSAYWFQNFLRRN  91
              +DDGAN+ GYFAWSLLDNFEW  GYTSRFGI+YVD+   L R PKMSAYWF+  + +N
Sbjct  448   AIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIIYVDYKHNLNRIPKMSAYWFKQMISKN  506



>ref|XP_004163493.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=506

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/479 (66%), Positives = 378/479 (79%), Gaps = 8/479 (2%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             F+TGGLSR +FP GFVFGTA+SAYQVEG  D  K GRG SIWD F+K PG   +NATG+V
Sbjct  31    FDTGGLSRAAFPEGFVFGTATSAYQVEGMAD--KDGRGQSIWDPFVKLPGKIVDNATGDV  88

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYHRYK DID M KLNFDAYRFSISW RIFPNGTG+VNWKGVAYYNRLI+YM+++GI
Sbjct  89    AVDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGI  148

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLP AL++RY G L +Q+V D+ +YAEFCF+ FGDRVKNW +FNEPRV+A 
Sbjct  149   TPYANLYHYDLPLALQERYRGLLDKQIVIDFTNYAEFCFEEFGDRVKNWMTFNEPRVIAD  208

Query  972   LGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             +G+++G   P RCS    NCT GNS TEPY+VAHN+IL HA     YR  +Q KQ GR G
Sbjct  209   VGFNSGIMPPSRCSKEYGNCTDGNSGTEPYIVAHNIILSHANVVDTYRKKFQEKQGGRVG  268

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             ILLDF +YEPLT  K D  AAQRARDFHIGWFLHP  YGEYP+ MQ IV +RLP+F+ +E
Sbjct  269   ILLDFTYYEPLTNEKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEE  328

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
             VK VKGS+D+VGINQYTTFY+ +P    P    YQ+DW+VG+AY +NG PIG RA++ WL
Sbjct  329   VKKVKGSVDFVGINQYTTFYMLNPTWPKPTTPDYQSDWHVGYAYEKNGKPIGQRAHTGWL  388

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y VPWG+YKA+ YVK+ Y NP + +SENGMD   ++ L E LND +RI+YYK+YL  +K+
Sbjct  389   YEVPWGMYKALMYVKQHYRNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQNMKK  447

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD-TLKRYPKMSAYWFQNFLRRN  91
              +DDGAN+ GYFAWSLLDNFEW  GYTSRFGI+YVD+   L R PKMSAYWF+  + +N
Sbjct  448   AIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIIYVDYKHNLNRIPKMSAYWFKQMISKN  506



>gb|KCW52109.1| hypothetical protein EUGRSUZ_J01543 [Eucalyptus grandis]
Length=448

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/443 (70%), Positives = 363/443 (82%), Gaps = 4/443 (1%)
 Frame = -3

Query  1407  GRGPSIWDTFLKTPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPN  1228
             GRGPSIWD F++ PG      +GE+AVDQYH+YK DIDLM KLNFDAYRFSISW+RIFPN
Sbjct  6     GRGPSIWDAFVQVPGNIKELDSGEMAVDQYHKYKEDIDLMHKLNFDAYRFSISWSRIFPN  65

Query  1227  GTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYA  1048
             GTG VNW+GV YYNRLI+ ++ KGITPYANL HYD+P AL+ RY G L   VV+D+ADYA
Sbjct  66    GTGYVNWRGVNYYNRLIDALIAKGITPYANLYHYDMPLALQLRYEGLLSINVVKDFADYA  125

Query  1047  EFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHN  880
             EFCFK FGDRVKNW +FNEPRV+AALG+D+G   P RCS    NCT GNSATEPY+ AH+
Sbjct  126   EFCFKTFGDRVKNWMTFNEPRVIAALGFDSGSNPPNRCSKPYGNCTAGNSATEPYIAAHH  185

Query  879   LILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHP  700
             LIL HA A +RYR  YQAKQ+GR GILLDFVWYEPLT S  DNYAAQRARDFHIGWFLHP
Sbjct  186   LILSHAAAVKRYRKRYQAKQQGRIGILLDFVWYEPLTSSLEDNYAAQRARDFHIGWFLHP  245

Query  699   IVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQ  520
             +VYGEYPKTMQNIVG+RLP+FT  EV +VKG  D+VG+N YT++Y+Y+P         YQ
Sbjct  246   LVYGEYPKTMQNIVGERLPKFTKREVNIVKGGFDFVGVNHYTSYYMYNPNWTETSPPGYQ  305

Query  519   NDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN  340
              DWNVGFA+ +NGVPIGPRANS WLY+VPWG+ KAVTYVKE YGNP MFLSENGMD  GN
Sbjct  306   ADWNVGFAFEKNGVPIGPRANSGWLYIVPWGVNKAVTYVKENYGNPYMFLSENGMDDPGN  365

Query  339   LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYV  160
             +T  E L+D+ RI+YY+SYL ELK  +D+GAN+ GYFAWSLLDNFEW +GYT+RFGIVY+
Sbjct  366   VTYLEGLHDSTRINYYRSYLQELKAAIDNGANVNGYFAWSLLDNFEWLLGYTARFGIVYM  425

Query  159   DFDTLKRYPKMSAYWFQNFLRRN  91
             DF+ L R+PKMSAYWF+  L +N
Sbjct  426   DFNDLSRHPKMSAYWFKQLLEKN  448



>ref|XP_006658055.1| PREDICTED: beta-glucosidase 26-like [Oryza brachyantha]
Length=511

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/476 (67%), Positives = 382/476 (80%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  36    YDAGGLSRRAFPKGFVFGTAASAYQVEGMAK--QGGRGPSIWDAFIEKPGTIPNNATADV  93

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNRLI+YM++KGI
Sbjct  94    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMIKKGI  153

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF  FGDRVK+WF+FNEPR VAA
Sbjct  154   TPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFLTFGDRVKDWFTFNEPRCVAA  213

Query  972   LGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD G  APGRCS+C  G NS TEPY+VAH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  214   LGYDNGLHAPGRCSDCDAGGNSTTEPYLVAHHLILSHAAAVKRYREKYQLYQKGRIGILL  273

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DRLP F+ +E ++
Sbjct  274   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRLPTFSDEESRM  333

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VKGSIDYVGIN YT+FY+ DP P      +YQ+DW+VGF Y RNGVPIG  ANS WLY+V
Sbjct  334   VKGSIDYVGINHYTSFYMKDPGPWNLTPVSYQDDWHVGFVYERNGVPIGAHANSYWLYIV  393

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAVTYVKE YGNP M LSENGMD  GN+++ + ++DT R+ YY+ Y+ ELK+ +D
Sbjct  394   PWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRVRYYRDYITELKKAID  453

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFGI+YVD+ TLKRYPK SA+WF+N L R K
Sbjct  454   DGAKVIGYFAWSLLDNFEWRLGYTSRFGIIYVDYKTLKRYPKDSAFWFKNMLSRKK  509



>emb|CDM80087.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/490 (67%), Positives = 387/490 (79%), Gaps = 10/490 (2%)
 Frame = -3

Query  1545  VQCD-VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
              QC  ++PE    + GGLSR+ FP GFVFGTA+SAYQVEG  +  + GRGPSIWD F+K 
Sbjct  22    AQCHRLNPEI--HDAGGLSRQGFPEGFVFGTAASAYQVEGMAE--QGGRGPSIWDAFIKI  77

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG    N T +VAVD+YHRYK D+D+M  + FDAYRFSISW+RIFP+GTGKVNW+GV YY
Sbjct  78    PGTIAGNGTADVAVDEYHRYKEDVDIMKNMGFDAYRFSISWSRIFPDGTGKVNWEGVDYY  137

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             NRLI+YML++GITPYANL HYDLP AL  +Y GWL  ++V  +ADYA+FCFK+FGDRVKN
Sbjct  138   NRLIDYMLQQGITPYANLYHYDLPLALHQQYLGWLSPRIVGAFADYADFCFKVFGDRVKN  197

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             WF+FNEPR VAALGYD G  APGRCS C+  G+S TEPY+ AH+LIL HA A +RYR  Y
Sbjct  198   WFTFNEPRCVAALGYDNGLHAPGRCSQCSAGGDSTTEPYLAAHHLILSHAAAVRRYRDKY  257

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q  QKGR GILLDFVWYEPL+ S AD  AAQRARDFH+GWFL PI++G YP TM  IV D
Sbjct  258   QHHQKGRIGILLDFVWYEPLSNSNADQAAAQRARDFHLGWFLDPIIHGRYPFTMLEIVKD  317

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGV  478
             RLPRF+ DE  +VKGSIDYVGINQYT+FY+ D   +  TP   +YQ+DW+V F Y RNGV
Sbjct  318   RLPRFSADESTMVKGSIDYVGINQYTSFYMKDNGTWNLTPI--SYQDDWHVEFVYERNGV  375

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
             PIG  ANS WLY+VPWG+ KAVTYVKERYGNP M L+ENGMD  GN+++A+ + DT RI 
Sbjct  376   PIGAHANSYWLYIVPWGINKAVTYVKERYGNPTMILAENGMDQPGNVSIADGVRDTVRIR  435

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             YY+ Y+ ELK+ ++DGA + GYFAWSLLDNFEWR+GYT+RFGIVYVD+ TLKRYPK SA 
Sbjct  436   YYRDYITELKKAINDGAQVIGYFAWSLLDNFEWRLGYTARFGIVYVDYKTLKRYPKDSAL  495

Query  117   WFQNFLRRNK  88
             WF+N L   K
Sbjct  496   WFKNMLSEKK  505



>pdb|4JIE|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
 pdb|4JHO|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
Length=503

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/476 (67%), Positives = 380/476 (80%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  28    YDAGGLSRRAFPEGFVFGTAASAYQVEGM--AKQGGRGPSIWDAFIEKPGTIPNNATADV  85

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG VN +GV YYNRLI+YM++KGI
Sbjct  86    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKKGI  145

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PYANL HYDLP AL ++Y GWL   +VE +ADYA+FCF+ FGDRVK+WF+FNEPR VAA
Sbjct  146   KPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAA  205

Query  972   LGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD GF APGRCS C  G NS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  206   LGYDNGFHAPGRCSGCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQKGRIGILL  265

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DR+P F+ +E ++
Sbjct  266   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRM  325

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VK SIDYVGIN YT+FY+ DP P      +YQ+DW+VGFAY RNGVPIG +ANS WLY+V
Sbjct  326   VKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIV  385

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAVTYVKE YGNP M LSENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +D
Sbjct  386   PWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAID  445

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFGIVYVD+ TLKRYPK SA+WF+N L   K
Sbjct  446   DGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLSSKK  501



>gb|ACF35791.1| beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group]
Length=483

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/476 (67%), Positives = 380/476 (80%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  8     YDAGGLSRRAFPEGFVFGTAASAYQVEGM--AKQGGRGPSIWDAFIEKPGTIPNNATADV  65

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG VN +GV YYNRLI+YM++KGI
Sbjct  66    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKKGI  125

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PYANL HYDLP AL ++Y GWL   +VE +ADYA+FCF+ FGDRVK+WF+FNEPR VAA
Sbjct  126   KPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAA  185

Query  972   LGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD GF APGRCS C  G NS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  186   LGYDNGFHAPGRCSGCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQKGRIGILL  245

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DR+P F+ +E ++
Sbjct  246   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRM  305

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VK SIDYVGIN YT+FY+ DP P      +YQ+DW+VGFAY RNGVPIG +ANS WLY+V
Sbjct  306   VKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIV  365

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAVTYVKE YGNP M LSENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +D
Sbjct  366   PWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAID  425

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFGIVYVD+ TLKRYPK SA+WF+N L   K
Sbjct  426   DGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLSSKK  481



>ref|XP_004958541.1| PREDICTED: beta-glucosidase 26-like [Setaria italica]
Length=539

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/487 (66%), Positives = 387/487 (79%), Gaps = 6/487 (1%)
 Frame = -3

Query  1545  VQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
              QC  +PE   +NTGGLSR +FPAGFVFGTA+SAYQVEG     + GRGPSIWD F+K P
Sbjct  57    AQC-FNPEI--YNTGGLSRRAFPAGFVFGTAASAYQVEGMAK--QGGRGPSIWDAFIKVP  111

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
             G  P+NAT +VAVD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG+VN +GV YYN
Sbjct  112   GTIPDNATADVAVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNQEGVDYYN  171

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
             RLI+YM+++GITPYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF++FGDRVKNW
Sbjct  172   RLIDYMIQQGITPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFQMFGDRVKNW  231

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             F+FNEPR VAALGYD G  APGRCS C   GNS TEPY+VAH+LIL HA A +RYR  YQ
Sbjct  232   FTFNEPRCVAALGYDNGLHAPGRCSGCAAGGNSTTEPYLVAHHLILSHAAAVKRYRDKYQ  291

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
               QKGR GILLDFVWYEP + S AD  AAQRARDFH+GWFL PIV G YP +MQ IV DR
Sbjct  292   LYQKGRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIVNGRYPYSMQEIVEDR  351

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP F+ +E ++VKGSIDYVGIN YT+FY+ DP        +YQ DW+  F Y RNGVPIG
Sbjct  352   LPLFSDEESRMVKGSIDYVGINHYTSFYMKDPGTWNLMPISYQYDWHASFVYERNGVPIG  411

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
               ANS WLY+VPWG+ KAV YVKE Y NP+M L+ENGMD  GN+++++ ++DT RI YY+
Sbjct  412   AHANSYWLYIVPWGINKAVNYVKETYENPIMILAENGMDQPGNISISQGVHDTIRIRYYR  471

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
              Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GYTSRFG+VYVD+ TLKRYPK SA+WF+
Sbjct  472   DYITELKKAIDDGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFK  531

Query  108   NFLRRNK  88
             + L + +
Sbjct  532   HMLSKKR  538



>sp|A3BMZ5.1|BGL26_ORYSJ RecName: Full=Beta-glucosidase 26; Short=Os7bglu26; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|EAZ04982.1| hypothetical protein OsI_27163 [Oryza sativa Indica Group]
 gb|EAZ40934.1| hypothetical protein OsJ_25416 [Oryza sativa Japonica Group]
Length=510

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/476 (67%), Positives = 380/476 (80%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG     + GRGPSIWD F++ PG  PNNAT +V
Sbjct  35    YDAGGLSRRAFPEGFVFGTAASAYQVEGM--AKQGGRGPSIWDAFIEKPGTIPNNATADV  92

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTG VN +GV YYNRLI+YM++KGI
Sbjct  93    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKKGI  152

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PYANL HYDLP AL ++Y GWL   +VE +ADYA+FCF+ FGDRVK+WF+FNEPR VAA
Sbjct  153   KPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAA  212

Query  972   LGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD GF APGRCS C  G NS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  213   LGYDNGFHAPGRCSGCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQKGRIGILL  272

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PI++G YP +M  IV DR+P F+ +E ++
Sbjct  273   DFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRM  332

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VK SIDYVGIN YT+FY+ DP P      +YQ+DW+VGFAY RNGVPIG +ANS WLY+V
Sbjct  333   VKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIV  392

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAVTYVKE YGNP M LSENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +D
Sbjct  393   PWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAID  452

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFGIVYVD+ TLKRYPK SA+WF+N L   K
Sbjct  453   DGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLSSKK  508



>ref|XP_002974513.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
 gb|EFJ24735.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
Length=494

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/475 (65%), Positives = 369/475 (78%), Gaps = 8/475 (2%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR SFP GF FGTA+SAYQVEGA    KYGRGPSIWD F++TPG    NATG+VAVD+Y
Sbjct  22    LSRASFPKGFTFGTATSAYQVEGA--AKKYGRGPSIWDVFIRTPGRVQENATGDVAVDEY  79

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK DIDLM  LN DAYRFSISW+RIFP G G+VN  GVAYYNRLI+Y+L KGI PYAN
Sbjct  80    HRYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYAN  139

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             LNHYDLP++LE  Y GWL R+VV+D+ ++AEFCFK FGDRVK W +FNEPRVVA LGYD 
Sbjct  140   LNHYDLPESLEKDYEGWLSREVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDN  199

Query  957   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  790
             G FAPGRCS    NCT+GNSATEPY+VAHNL+L H  AAQ YR  YQ KQKG  GILLDF
Sbjct  200   GQFAPGRCSTPYGNCTEGNSATEPYIVAHNLLLSHGSAAQVYRKNYQEKQKGSIGILLDF  259

Query  789   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  610
             V+YEP + S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLP+F+ D++++VK
Sbjct  260   VYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVK  319

Query  609   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPW  430
             GS+D+VGIN YTT+Y  D   +      Y  D N+   + R+GV IGPRA+S WLY+VPW
Sbjct  320   GSVDFVGINHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHSTWLYIVPW  379

Query  429   GLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDG  250
             G+YKA++Y+KE YGNP + LSENGMD   NLTL++SL+DT RI+YY+SY+  L   + DG
Sbjct  380   GMYKALSYIKEHYGNPKVVLSENGMDDPANLTLSQSLHDTTRINYYQSYIENLVAAMRDG  439

Query  249   ANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF--DTLKRYPKMSAYWFQNFLRRN  91
             AN+ GYFAWSL+DNFEW  GYTSRFG+VY+DF    LKR PK SA WF+  L+R+
Sbjct  440   ANVHGYFAWSLVDNFEWLSGYTSRFGLVYIDFKHKALKRIPKESAKWFKTLLKRD  494



>ref|XP_002990785.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
 gb|EFJ08058.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
Length=495

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/475 (65%), Positives = 369/475 (78%), Gaps = 8/475 (2%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR SFP GF FGTA+SAYQVEGA    KYGRGPSIWD F++TPG    NATG+VAVD+Y
Sbjct  23    LSRASFPKGFTFGTATSAYQVEGA--AKKYGRGPSIWDVFIRTPGRVQENATGDVAVDEY  80

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK DIDLM  LN DAYRFSISW+RIFP G G+VN  GVAYYNRLI+Y+L KGI PYAN
Sbjct  81    HRYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYAN  140

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             LNHYDLP++LE  Y GWL R+VV+D+ ++AEFCFK FGDRVK W +FNEPRVVA LGYD 
Sbjct  141   LNHYDLPESLEKDYEGWLSRKVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDN  200

Query  957   GFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  790
             G FAPGRCS    NCT+GNSATEPY+VAHNL+L H  AAQ YR  YQ KQKG  GILLDF
Sbjct  201   GQFAPGRCSAPYGNCTEGNSATEPYIVAHNLLLSHGSAAQVYRKKYQEKQKGSIGILLDF  260

Query  789   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  610
             V+YEP + S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLP+F+ D++++VK
Sbjct  261   VYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVK  320

Query  609   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPW  430
             GS+D+VGIN YTT+Y  D   +      Y  D N+   + R+GV IGPRA+S WLY+VPW
Sbjct  321   GSVDFVGINHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHSTWLYIVPW  380

Query  429   GLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDG  250
             G+YKA++Y+K+ YGNP + LSENGMD   NLTL +SL+DT RI+YY+SY+  L   + DG
Sbjct  381   GMYKALSYIKDHYGNPKVVLSENGMDDPANLTLFQSLHDTTRINYYQSYIENLVAAMKDG  440

Query  249   ANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF--DTLKRYPKMSAYWFQNFLRRN  91
             AN+ GYFAWSL+DNFEW  GYTSRFG+VY+DF   TLKR PK SA WF+  L+R+
Sbjct  441   ANVHGYFAWSLVDNFEWLSGYTSRFGLVYIDFKHKTLKRIPKESAKWFKTLLKRD  495



>gb|EMS60983.1| Beta-glucosidase 26 [Triticum urartu]
Length=525

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/506 (64%), Positives = 386/506 (76%), Gaps = 24/506 (5%)
 Frame = -3

Query  1548  IVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKT  1369
             + QCD     +R NTGGLSR+ FPAGFVFGTA+SAYQVEG     + GRGPSIWD F   
Sbjct  23    LAQCDGPNPEIR-NTGGLSRQGFPAGFVFGTAASAYQVEGMA--RQGGRGPSIWDAFAAI  79

Query  1368  PGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYY  1189
             PG    N + +V VD+YHRYK D+ +M  + FDAYRFSISW+RIFP+GTGKVN +GV YY
Sbjct  80    PGTIAGNGSADVTVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYY  139

Query  1188  NRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKN  1009
             NRLI+YML++GI PYANL HYDLP AL  +Y GWL  ++V  +ADYAEFCFK+FGDRVKN
Sbjct  140   NRLIDYMLQQGIAPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKN  199

Query  1008  WFSFNEPRVVAALGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIY  832
             WF+FNEPRVVAALGYD G  APGRC+ C   G+S TEPY+  HN+IL HA A Q YR  Y
Sbjct  200   WFTFNEPRVVAALGYDNGLHAPGRCTKCPAGGDSRTEPYIATHNIILSHAAAVQLYREKY  259

Query  831   QAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGD  652
             Q  QKGR GILLDFVWYEP + S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+
Sbjct  260   QPHQKGRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGCYPSSMLKIVGN  319

Query  651   RLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGV  478
             RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  + +TP   +YQ+DW+VGF Y RNGV
Sbjct  320   RLPGFSADEARMVKGSIDYVGINQYTSYYMKDPGAWNQTPV--SYQDDWHVGFVYERNGV  377

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSEN----------------GMDYV  346
             PIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M LSEN                GMD  
Sbjct  378   PIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGVLTDKETNDQCYDLTGMDQP  437

Query  345   GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIV  166
             GN+++A+ ++DT RI YY+ Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+GYT+RFGIV
Sbjct  438   GNVSIADGVHDTIRIRYYRDYITELKKAIDNGARVVGYFAWSLLDNFEWRLGYTARFGIV  497

Query  165   YVDFDTLKRYPKMSAYWFQNFLRRNK  88
             YVDF+TLKRYPK SA WF+N L   K
Sbjct  498   YVDFNTLKRYPKDSALWFKNMLSEKK  523



>gb|ACL52625.1| unknown [Zea mays]
 tpg|DAA63940.1| TPA: non-cyanogenic beta-glucosidase [Zea mays]
Length=512

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 377/476 (79%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F++ PG  PNNAT +V
Sbjct  38    YDAGGLSRRAFPDGFVFGTAASAYQVEGMAK--HGGRGPSIWDAFIEVPGTIPNNATADV  95

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNRLI+YML++GI
Sbjct  96    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGI  155

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF  FGDRVKNWF+FNEPR VAA
Sbjct  156   APYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFHAFGDRVKNWFTFNEPRCVAA  215

Query  972   LGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD G  APGRCS C   GNS TEPY+VAH+LIL HA A +RYR  YQ  QKG+ GILL
Sbjct  216   LGYDNGLHAPGRCSGCPAGGNSTTEPYLVAHHLILSHAAAVRRYRDKYQLHQKGKIGILL  275

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PIV+G YP +MQ I  DRLP F+ +E ++
Sbjct  276   DFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIVHGRYPYSMQEIAKDRLPLFSDEEARM  335

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VKGSIDYVGIN YT+FY+ DP        +YQ+DW+VGF Y RNGVPIG  ANS WLY+V
Sbjct  336   VKGSIDYVGINHYTSFYMKDPGTWNLTPVSYQDDWHVGFVYERNGVPIGAHANSYWLYIV  395

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAV+YVKE Y NP M L+ENGMD  G++++ + ++DT RI YY+ Y+ ELK+ +D
Sbjct  396   PWGINKAVSYVKETYKNPTMILAENGMDQPGDVSITQGVHDTVRIRYYRDYITELKKAID  455

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFG+VYVD+ TLKRYPK SA+WF++ L + +
Sbjct  456   DGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHMLSKKR  511



>gb|KDO62881.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=430

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/396 (76%), Positives = 338/396 (85%), Gaps = 6/396 (2%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENG  358
             RANS WLY VPWG+YKA+ Y+K  YGNP + LSENG
Sbjct  393   RANSYWLYNVPWGMYKALMYIKGHYGNPTVILSENG  428



>ref|XP_006495386.1| PREDICTED: beta-glucosidase 44-like, partial [Citrus sinensis]
Length=422

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 353/423 (83%), Gaps = 6/423 (1%)
 Frame = -3

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +V VDQYHRYK DIDLM  LNFDAYRFSISW+RIFP GTG VN KGV YYNRLI+YMLE
Sbjct  1     ADVTVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLE  60

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GITPYANL HYD+P AL+++YGG L  QVV+DYADYA+FCFK FGDRVKNW++FNEPRV
Sbjct  61    QGITPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRV  120

Query  981   VAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             +AALG+D G   P RCS    NCT GNS TEPY+ AHN+IL HA A QRYR  YQ  QKG
Sbjct  121   IAALGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKG  180

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             + GILLDFVWYEP TRSKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FT
Sbjct  181   KIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFT  240

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             P+EV +V+GS DY+G+NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRAN
Sbjct  241   PEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRAN  299

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY+VPWGLY A+ YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y++
Sbjct  300   SGWLYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  359

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             +LK+  DDGAN+ GYFAWSLLDNFEW +GY+SRFGI YVDFDTLKR PKMSAYWF+  L+
Sbjct  360   QLKKAADDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQ  419

Query  96    RNK  88
             R++
Sbjct  420   RDQ  422



>gb|EMT23872.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=537

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/497 (65%), Positives = 382/497 (77%), Gaps = 27/497 (5%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             + GG SR+ FP GFVFGTA+SAYQVEG  +  + GRGPSIWD F+K PG  P N T +VA
Sbjct  43    DAGGRSRQGFPEGFVFGTATSAYQVEGMAE--QGGRGPSIWDAFIKIPGTIPGNGTADVA  100

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
             VD+YHRYK D+D+M  + FDAYRFSISW+RIFP+GTGKVNW+GV YYNRLI+YML++GIT
Sbjct  101   VDEYHRYKEDVDIMKNMGFDAYRFSISWSRIFPDGTGKVNWEGVDYYNRLIDYMLQQGIT  160

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PYANL HYDLP AL  RY GWL   +V  +ADYA+FCFK+FGDRVKNWF+FNEPR VAAL
Sbjct  161   PYANLYHYDLPLALHQRYLGWLSPNIVGAFADYADFCFKVFGDRVKNWFTFNEPRCVAAL  220

Query  969   GYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             GYD G  APGRCS C+  G+S TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILLD
Sbjct  221   GYDIGLHAPGRCSQCSAGGDSTTEPYLAAHHLILSHAAAVRRYRDKYQHHQKGRIGILLD  280

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
             FVWYEPL+ S AD  AAQRARDFH+GWFL PI++G YP TM  IV DRLPRF+ DE ++V
Sbjct  281   FVWYEPLSNSNADQAAAQRARDFHLGWFLDPIIHGHYPFTMLEIVKDRLPRFSDDESRMV  340

Query  612   KGSIDYVGINQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGP---------  466
             KGSIDYVGINQYT+FY+ D   +  TP   +YQ+DW+V F + RNGV IG          
Sbjct  341   KGSIDYVGINQYTSFYMKDNGTWNLTPV--SYQDDWHVEFVFKRNGVLIGAHMDKCRFSV  398

Query  465   -----------RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESL  319
                        +ANS WLY+VPWG+ KAVTYVKERYGNP+M L+ENGMD  GN+++A+ +
Sbjct  399   EHCNCKLVEFMQANSYWLYIVPWGINKAVTYVKERYGNPIMILAENGMDQPGNISIADGV  458

Query  318   NDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKR  139
              DT RI YY+ Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GYT+RFGIVYVD+ TLKR
Sbjct  459   RDTVRIRYYRDYITELKKAIDDGARVIGYFAWSLLDNFEWRLGYTARFGIVYVDYKTLKR  518

Query  138   YPKMSAYWFQNFLRRNK  88
             YPK SA WF+N L   K
Sbjct  519   YPKDSALWFKNMLSEKK  535



>ref|XP_002461141.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
 gb|EER97662.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
Length=512

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 376/476 (79%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F++ PG  PNNAT +V
Sbjct  38    YDAGGLSRRAFPEGFVFGTAASAYQVEGMAK--HGGRGPSIWDAFIEVPGTIPNNATADV  95

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFPNGTGKVN +GV YYNRLI+YML++GI
Sbjct  96    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGKVNQEGVDYYNRLIDYMLQQGI  155

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
             TPYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF+ FGDRVKNWF+FNEPR VAA
Sbjct  156   TPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFQTFGDRVKNWFTFNEPRCVAA  215

Query  972   LGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD G  APGRCS C   GNS TEPY+ AH+LIL HA A +RYR  YQ  QKGR GILL
Sbjct  216   LGYDNGLHAPGRCSECAAGGNSTTEPYLAAHHLILSHAAAVRRYRDKYQLYQKGRIGILL  275

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PI+ G YP +MQ IV DRLP F+ +E ++
Sbjct  276   DFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIINGRYPYSMQEIVKDRLPLFSDEESRM  335

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VKGSIDYVGIN YT+FY+ DP        +YQ+DW+VGF Y RN +PIG  ANS WLY+V
Sbjct  336   VKGSIDYVGINHYTSFYMKDPGTWNLTPVSYQDDWHVGFVYERNSIPIGAHANSYWLYIV  395

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAV YVKE Y NP M L+ENGMD  G++++ + ++DT RI YY+ Y+ ELK+ +D
Sbjct  396   PWGINKAVNYVKETYENPTMILAENGMDQPGDISITQGVHDTIRIRYYRDYITELKKAID  455

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFG+VYVD+ TLKRYPK SA+WF++ L + +
Sbjct  456   DGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHMLSKKR  511



>gb|EEC76023.1| hypothetical protein OsI_13187 [Oryza sativa Indica Group]
Length=568

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/472 (64%), Positives = 366/472 (78%), Gaps = 3/472 (1%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TPG    N   +V 
Sbjct  41    DTGGLSRAAFPKGFVFGTATSAFQVEGM--AASGGRGPSIWDPFVHTPGNIAGNGNADVT  98

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
              D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LI+Y++++G+ 
Sbjct  99    TDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYNNLIDYVIKQGLI  158

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PY NLNHYDLP AL+ +Y GWL  ++V  ++DYAEFCFK +GDRVKNWF+FNEPR+VAAL
Sbjct  159   PYVNLNHYDLPLALQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNWFTFNEPRIVAAL  218

Query  969   GYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G+DTG   P RC+ C  G NSATEPY+VAHN+IL HA A  RYR  +QA QKG+ GI+LD
Sbjct  219   GHDTGTDPPNRCTKCAAGGNSATEPYIVAHNIILSHATAVDRYRNKFQASQKGKIGIVLD  278

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
             F WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLV
Sbjct  279   FNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLV  338

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVP  433
             KGS DY GINQYT  Y+ D         +Y +DW+V F + RNGVPIG +ANS WLY+VP
Sbjct  339   KGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANSNWLYIVP  398

Query  432   WGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDD  253
              G+Y AV Y+KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL ELK+ +DD
Sbjct  399   TGMYGAVNYIKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTELKKAIDD  458

Query  252   GANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             GAN+  YFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SA WF+N L+
Sbjct  459   GANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKNMLQ  510



>ref|NP_001051014.1| Os03g0703100 [Oryza sativa Japonica Group]
 sp|Q75I94.1|BGL08_ORYSJ RecName: Full=Beta-glucosidase 8; Short=Os3bglu8; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07251.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF98427.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12928.1| Os03g0703100 [Oryza sativa Japonica Group]
 dbj|BAH00173.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59768.1| hypothetical protein OsJ_12263 [Oryza sativa Japonica Group]
Length=568

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/484 (63%), Positives = 371/484 (77%), Gaps = 6/484 (1%)
 Frame = -3

Query  1536  DVSPERVRF---NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
             D +  RVR    +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TP
Sbjct  29    DRAGARVRAADDDTGGLSRAAFPKGFVFGTATSAFQVEGM--AASGGRGPSIWDPFVHTP  86

Query  1365  GLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYN  1186
             G    N   +V  D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN
Sbjct  87    GNIAGNGNADVTTDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYN  146

Query  1185  RLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNW  1006
              LI+Y++++G+ PY NLNHYDLP AL+ +Y GWL  ++V  ++DYAEFCFK +GDRVKNW
Sbjct  147   NLIDYVIKQGLIPYVNLNHYDLPLALQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNW  206

Query  1005  FSFNEPRVVAALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQ  829
             F+FNEPR+VAALG+DTG   P RC+ C  G NSATEPY+VAHN+IL HA A  RYR  +Q
Sbjct  207   FTFNEPRIVAALGHDTGTDPPNRCTKCAAGGNSATEPYIVAHNIILSHATAVDRYRNKFQ  266

Query  828   AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDR  649
             A QKG+ GI+LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +R
Sbjct  267   ASQKGKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKER  326

Query  648   LPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIG  469
             LP FTP++ KLVKGS DY GINQYT  Y+ D         +Y +DW+V F + RNGVPIG
Sbjct  327   LPTFTPEQAKLVKGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIG  386

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYK  289
              +ANS WLY+VP G+Y AV Y+KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK
Sbjct  387   QQANSNWLYIVPTGMYGAVNYIKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYK  446

Query  288   SYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQ  109
             +YL ELK+ +DDGAN+  YFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SA WF+
Sbjct  447   NYLTELKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFK  506

Query  108   NFLR  97
             N L+
Sbjct  507   NMLQ  510



>ref|XP_006650460.1| PREDICTED: beta-glucosidase 8-like [Oryza brachyantha]
Length=568

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/479 (63%), Positives = 368/479 (77%), Gaps = 5/479 (1%)
 Frame = -3

Query  1524  ERVRF--NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             +RVR   + GGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TPG    
Sbjct  34    DRVRAADDAGGLSRAAFPKGFVFGTATSAFQVEGM--AASAGRGPSIWDPFVHTPGNIAG  91

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NA  +V  D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G G++N +GVAYYN LI+Y
Sbjct  92    NANADVTTDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGRINTEGVAYYNNLIDY  151

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +L++G+ PY NLNHYDLP AL+ +Y GWL  ++V  +ADYAEFCFK +GDRVKNWF+FNE
Sbjct  152   VLKQGLIPYVNLNHYDLPLALQKKYEGWLSSKIVGVFADYAEFCFKTYGDRVKNWFTFNE  211

Query  990   PRVVAALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             PR+VAALG+D G   P RC+ C  G NSATEPY+VAHN+IL HA A  RYR  YQA QKG
Sbjct  212   PRIVAALGHDAGTDPPNRCTKCAAGGNSATEPYIVAHNIILSHATAVDRYRNKYQASQKG  271

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             + GI+LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FT
Sbjct  272   KIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFT  331

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
             P++ KLVKGS DY GINQYT  Y+ D         +Y +DW+V F + RNG+PIG +ANS
Sbjct  332   PEQAKLVKGSADYFGINQYTASYMSDQPAPQQAPTSYSSDWHVSFIFQRNGIPIGQQANS  391

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY+VP G+Y  V Y+KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL E
Sbjct  392   NWLYIVPTGMYGCVNYLKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTE  451

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             LK+ +DDGAN+  YFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SA WF++ L+
Sbjct  452   LKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKDMLQ  510



>ref|NP_001148821.1| LOC100282438 precursor [Zea mays]
 gb|ACG33023.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=512

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/476 (65%), Positives = 376/476 (79%), Gaps = 3/476 (1%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++ GGLSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F++ PG  PNNAT +V
Sbjct  38    YDAGGLSRRAFPDGFVFGTAASAYQVEGMAK--HGGRGPSIWDAFIEVPGTIPNNATADV  95

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
              VD+YHRYK D+++M  + FDAYRFSISW+RIFP+GTGKVN +GV YYNRLI+YML++GI
Sbjct  96    TVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGI  155

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PYANL HYDLP AL ++Y GWL  ++VE +ADYAEFCF  FGDRVKNWF+FNEPR VAA
Sbjct  156   APYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFHAFGDRVKNWFTFNEPRCVAA  215

Query  972   LGYDTGFFAPGRCSNC-TQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             LGYD G  APGRCS C   GNS TEPY+VAH+LIL HA A +RYR  YQ  QKG+ GILL
Sbjct  216   LGYDNGLHAPGRCSGCPAGGNSTTEPYLVAHHLILSHAAAVRRYRDKYQLHQKGKIGILL  275

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             DFVWYEP + S AD  AAQRARDFH+GWFL PIV+G YP +MQ I  DRLP F+ +E ++
Sbjct  276   DFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIVHGRYPYSMQEIAKDRLPLFSDEEARM  335

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMV  436
             VKGSIDYVGIN YT+FY+ DP        +YQ+DW+VGF Y RNGVPIG  ANS WLY+V
Sbjct  336   VKGSIDYVGINHYTSFYMKDPGTWNLTPVSYQDDWHVGFVYERNGVPIGAHANSYWLYIV  395

Query  435   PWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVD  256
             PWG+ KAV+YVKE Y N  M L+ENGMD  G++++ + ++DT RI YY+ Y+ ELK+ +D
Sbjct  396   PWGINKAVSYVKETYKNLTMILAENGMDQPGDVSITQGVHDTVRIRYYRDYITELKKAID  455

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             DGA + GYFAWSLLDNFEWR+GYTSRFG+VYVD+ TLKRYPK SA+WF++ L + +
Sbjct  456   DGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHMLSKKR  511



>ref|XP_002464026.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
 gb|EER91024.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
Length=567

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/474 (64%), Positives = 367/474 (77%), Gaps = 3/474 (1%)
 Frame = -3

Query  1518  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1339
             V  +TGGLSR++FP GF+FGTA+SA+QVEGA      GRGP IWD F+ TPG    +   
Sbjct  43    VGADTGGLSRDAFPKGFIFGTATSAFQVEGA--ATSGGRGPCIWDPFVHTPGKIAEDGNA  100

Query  1338  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1159
             +V  D+YHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI+YM+++
Sbjct  101   DVTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNEEGVQYYNDLIDYMIKQ  160

Query  1158  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  979
             G+TPYANLNHYDLP AL+ +Y GWLG ++V+ +ADYA+FCFK FGDRVKNWF+ NEPR+V
Sbjct  161   GLTPYANLNHYDLPLALQKKYQGWLGPKIVDIFADYADFCFKTFGDRVKNWFTLNEPRIV  220

Query  978   AALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
             + LGYD G   P RC+ CT G NS+TEPY+V HN++L HA A  RYR  YQA QKG+ GI
Sbjct  221   SFLGYDKGIDPPNRCTQCTAGGNSSTEPYIVVHNILLSHATAVARYRNKYQATQKGKVGI  280

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
             +LDF WYEPLT S  D  AAQRARDFHIGWFL P++ G+YPKTMQ+IV DRLP FTP++ 
Sbjct  281   VLDFNWYEPLTNSTEDQAAAQRARDFHIGWFLDPLINGQYPKTMQDIVKDRLPSFTPEQA  340

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             KLVKGS DY GINQYTT Y+ +         +Y +DW V + + RNGV IG  A+S WLY
Sbjct  341   KLVKGSSDYFGINQYTTNYISNQQTTQQGPPSYSSDWGVQYNFERNGVQIGQLAHSVWLY  400

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
             +VP G+Y  VTY+KE+Y NP + +SENGMD  G+LT  E L+DT RI +YK+YL ELK+ 
Sbjct  401   IVPTGMYGVVTYLKEKYQNPTIIISENGMDQPGDLTREEYLHDTVRIDFYKNYLTELKKG  460

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             +DDGAN+ GYFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SAYWF++ L
Sbjct  461   IDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFRDML  514



>gb|EEE54664.1| hypothetical protein OsJ_01954 [Oryza sativa Japonica Group]
Length=427

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/403 (72%), Positives = 342/403 (85%), Gaps = 0/403 (0%)
 Frame = -3

Query  1308  KRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNH  1129
             K D+++M  + FDAYRFSISW+RIFP GTGKVNWKGVAYYNRLINYML+ GITPYANL H
Sbjct  21    KEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPYANLYH  80

Query  1128  YDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFF  949
             YDLP+ALE +YGG L R++VE +ADYAEFCFK FGDRVKNW +FNEPRVVAALGYD G F
Sbjct  81    YDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDDGNF  140

Query  948   APGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLT  769
             APGRC+ CT GNSATEPY+VAH+LIL HA A QRYR  YQ  QKG+ GILLDFVWYE LT
Sbjct  141   APGRCTKCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFVWYEGLT  200

Query  768   RSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVG  589
              S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKGSIDYVG
Sbjct  201   NSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKGSIDYVG  260

Query  588   INQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  409
             INQYT +YV D  P    + +Y +DW+    Y R+GVPIGPRANS+WLY+VPWGLYKAVT
Sbjct  261   INQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANSDWLYIVPWGLYKAVT  320

Query  408   YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  229
             YVKE+YGNP MFLSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGAN  GYF
Sbjct  321   YVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAIDDGANCIGYF  380

Query  228   AWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             AWSLLDNFEW++GYTSRFG+VYVDF TL+RYPKMSAYWF++ +
Sbjct  381   AWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKMSAYWFRDLV  423



>ref|NP_001142124.1| uncharacterized protein LOC100274288 precursor [Zea mays]
 gb|ACF87697.1| unknown [Zea mays]
 gb|ACF87698.1| unknown [Zea mays]
 gb|ACR38603.1| unknown [Zea mays]
 tpg|DAA50881.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=502

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/472 (63%), Positives = 367/472 (78%), Gaps = 3/472 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD+F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDSFAHVPGNIAGNQNGDVAVD  90

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L++G+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNPEGVAYYNNLINYLLQQGMTPY  150

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + DYA+FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEKKYGGWLSAKMADLFTDYADFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             DTG   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  211   DTGSNPPQRCTRCAAGGNSATEPYIVAHNFLLAHATAVARYRTKYQAAQKGKVGIVLDFN  270

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEALTNSPDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GIN+YT+ Y+           +Y  DW V + +ARNG PIGP+ANS+WLY+ P G
Sbjct  331   SADYIGINEYTSSYMKGQKLVQLAPSSYSADWQVQYVFARNGKPIGPQANSKWLYIAPTG  390

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+KE+YGNP ++++ENGMD  GNLT  + L D  R+ +Y+SY+ +LK+ +D GA
Sbjct  391   MYGCVNYLKEKYGNPTIYITENGMDQPGNLTRDQYLRDATRVRFYRSYIGQLKKAIDQGA  450

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRN  91
             N+ GYFAWSLLDNFEW  GY+S+FGIVYVDF+TL+R+PK SAYWF++ L+++
Sbjct  451   NVAGYFAWSLLDNFEWLAGYSSKFGIVYVDFNTLERHPKASAYWFRDMLQKH  502



>ref|NP_001151026.1| LOC100284659 precursor [Zea mays]
 gb|ACG41348.1| beta-glucosidase precursor [Zea mays]
 tpg|DAA50884.1| TPA: hypothetical protein ZEAMMB73_397657 [Zea mays]
Length=564

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/471 (64%), Positives = 364/471 (77%), Gaps = 3/471 (1%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             +TGGLSR++FP GFVFGTA+SAYQVEGA      GRGP IWD F+ TPG    +A  +V 
Sbjct  44    DTGGLSRDAFPKGFVFGTATSAYQVEGAATSG--GRGPCIWDPFVHTPGKIAEDANADVT  101

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
              D+YHRYK D+DLM  LNFDAYRFSISW+RIFP+G GK+N +GV YYN LI+YM+++G+T
Sbjct  102   TDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKINEEGVQYYNNLIDYMIKQGLT  161

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PYANLNHYDLP AL+ +Y GWLG ++V+ +ADYA+FCFK FG+RVKNWF+ NEPR+VA L
Sbjct  162   PYANLNHYDLPLALQKKYQGWLGPKIVDIFADYADFCFKTFGNRVKNWFTLNEPRIVAFL  221

Query  969   GYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             GYD G   P RC+ CT G NS+TEPY+V HN++L HA A  RYR  YQA QKG+ GI+LD
Sbjct  222   GYDKGLNPPNRCTQCTAGGNSSTEPYIVVHNILLSHATAVARYRNKYQATQKGKVGIVLD  281

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
             F WYEP T S  D  AAQRARDFHIGWFL P++ G+YPK MQ+IV DRLP FTP++ KLV
Sbjct  282   FNWYEPFTNSTEDQKAAQRARDFHIGWFLDPLINGQYPKIMQDIVKDRLPSFTPEQAKLV  341

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVP  433
             KGS DY GINQYTT+Y+ D         +Y +DW V + + RNGV IG  A+S WLY+VP
Sbjct  342   KGSSDYFGINQYTTYYIADQQTPPQGPPSYSSDWGVQYYFQRNGVQIGQMAHSIWLYIVP  401

Query  432   WGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDD  253
              G+Y  V Y+KE+Y NP++ +SENGMD  GNLT  E ++D  RI +YK+YL ELKR +D 
Sbjct  402   SGMYGVVNYLKEKYHNPIIIISENGMDQPGNLTREEYVHDAVRIDFYKNYLTELKRGIDG  461

Query  252   GANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             GAN+ GYFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SAYWF++ L
Sbjct  462   GANVIGYFAWSLLDNFEWLSGYTSKFGIVYVDFATLKRYPKDSAYWFRDML  512



>ref|XP_003559510.1| PREDICTED: beta-glucosidase 8-like [Brachypodium distachyon]
Length=570

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/476 (62%), Positives = 362/476 (76%), Gaps = 3/476 (1%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             +   +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TPG    N  
Sbjct  35    QAAVDTGGLSRAAFPKGFVFGTAASAFQVEGM--AASGGRGPSIWDPFVHTPGNIAGNGN  92

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +V  D+YH YK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LI+Y+++
Sbjct  93    ADVTTDEYHHYKEDVELMKSLNFDAYRFSISWSRIFPDGEGRVNEEGVAYYNNLIDYVIK  152

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             KG+ PY NLNHYD+P AL+ +Y GWL  ++V  ++DYAEFCFK +GDRV+NWF+FNEPR+
Sbjct  153   KGLIPYVNLNHYDIPLALQKKYDGWLSPKIVNIFSDYAEFCFKTYGDRVQNWFTFNEPRI  212

Query  981   VAALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             VAALG+DTG   P RC+ C  G NSATEPY V HN++L HA A  RYR  YQA QKG+ G
Sbjct  213   VAALGFDTGIDPPNRCTKCAAGGNSATEPYTVVHNILLSHATAVARYRNKYQASQKGKIG  272

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I+LDF WYEPLT S  D  AAQRARDFH+GWFL P+V G+YPKTMQ+IV +RLP FT ++
Sbjct  273   IVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLVNGQYPKTMQDIVKERLPSFTSEQ  332

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
              KLVKGS DY GINQYT  Y+ D         +Y +DW+V F + RNG PIGP ANS WL
Sbjct  333   SKLVKGSADYFGINQYTASYMADQPTPQQAPTSYSSDWHVSFIFQRNGKPIGPLANSNWL  392

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR  265
             Y+VP G+Y  V Y+KE+Y NP + +SENGMD  GNLT  E L+DT R+ +YK+YL+ELK+
Sbjct  393   YIVPTGMYGCVNYIKEKYKNPTIIISENGMDQPGNLTREEFLHDTVRVEFYKNYLSELKK  452

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
              +DDGAN+  YFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SAYWF++ L 
Sbjct  453   AIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFKDMLH  508



>ref|XP_002464027.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
 gb|EER91025.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
Length=514

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/474 (63%), Positives = 366/474 (77%), Gaps = 5/474 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP GFVFGTA+SAYQVEGA   +  GRGPS WD F+ TPG    N T +VAVD
Sbjct  43    GGLSRPAFPRGFVFGTATSAYQVEGAASTN--GRGPSTWDPFVHTPGNIVGNQTADVAVD  100

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRY+ D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYY  LI+Y+L+KGITPY
Sbjct  101   QYHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYKNLISYLLQKGITPY  160

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
             ANL H DLP AL+++YGGWL  ++ + + DYA+FCFK FGD VK+WF+FNEPR+VA LGY
Sbjct  161   ANLYHSDLPLALQNKYGGWLNPKMAKLFTDYADFCFKSFGDHVKHWFTFNEPRIVALLGY  220

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  221   DGGSIPPQRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRNKYQAAQKGKVGIVLDFN  280

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYEPLT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ+IV +RLP+FTP + KLVKG
Sbjct  281   WYEPLTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQMMQDIVKERLPKFTPGQAKLVKG  340

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V +A  RNG PIGP+ANS WLY+VP G
Sbjct  341   SADYIGINQYTASYIKGQKLLQQKPTSYSADWQVQYALERNGKPIGPQANSNWLYIVPSG  400

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP +F++ENGMD  GNLT  + L+DT R+ +YK YLAELK+ +DDGA
Sbjct  401   MYGCVNYLKQKYGNPTVFITENGMDQPGNLTREQYLHDTTRVQFYKGYLAELKKAIDDGA  460

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT--LKRYPKMSAYWFQNFLRRN  91
             N+ GYFAWSLLDNFEW+ GYTS+FGIVYVDF T  L+R+PK SAYWF++ L+++
Sbjct  461   NVAGYFAWSLLDNFEWQSGYTSKFGIVYVDFSTPKLERHPKDSAYWFRDMLQKH  514



>ref|XP_008665263.1| PREDICTED: beta-glucosidase 7-like [Zea mays]
 tpg|DAA50883.1| TPA: hypothetical protein ZEAMMB73_196159 [Zea mays]
Length=506

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/474 (63%), Positives = 365/474 (77%), Gaps = 5/474 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGTA+SAYQVEGA   +  GRGPS WD F+ TPG    N T +VAVD
Sbjct  34    GGLSRAAFPKDFVFGTATSAYQVEGAASTN--GRGPSTWDAFVHTPGNIVYNQTADVAVD  91

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRY+ D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L KGITPY
Sbjct  92    QYHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLRKGITPY  151

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
             ANL H DLP AL+++YGGWL  ++ + + DYA+FCFK FGDRVK+WF+FNEPR+VA LGY
Sbjct  152   ANLYHSDLPLALQNKYGGWLNAKMAKLFTDYADFCFKTFGDRVKHWFTFNEPRIVALLGY  211

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C+  GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  212   DAGSIPPQRCTKCSAGGNSATEPYIVAHNFLLSHAAAVSRYRNKYQAAQKGKVGIVLDFN  271

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLP+FTP++ KLVKG
Sbjct  272   WYEALTNSTEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKFTPEQAKLVKG  331

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  YV           +Y  DW V +   RNG PIGP+ANS+WLY+VP G
Sbjct  332   SADYIGINQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQANSKWLYIVPEG  391

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K +YGNP +F++ENGMD  GNLT  + L+DT R+ +YK YLAEL++ +DDGA
Sbjct  392   MYGCVNYLKHKYGNPTVFITENGMDQPGNLTRGQYLHDTTRVQFYKGYLAELRKAIDDGA  451

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT--LKRYPKMSAYWFQNFLRRN  91
             ++ GYFAWSLLDNFEW+ GYTS+FGIVYVDF T  L+R+PK SAYWF++ L+++
Sbjct  452   DVAGYFAWSLLDNFEWQSGYTSKFGIVYVDFSTPKLERHPKASAYWFRDMLQKH  505



>ref|XP_004982055.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Setaria italica]
Length=503

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/473 (63%), Positives = 365/473 (77%), Gaps = 4/473 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDAFAHIPGKVAGNQNGDVAVD  90

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KG+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLQKGMTPY  150

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +Y +FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEQKYGGWLSSKMADLFTEYVDFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA AA RYR  YQA QKG+ GI+LDF 
Sbjct  211   DAGSNPPQRCTKCAAGGNSATEPYIVAHNFLLAHAAAAARYRTKYQAAQKGKIGIVLDFN  270

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYEPLT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEPLTNSTDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V +  ARNG PIGP+ANS WLY+VPWG
Sbjct  331   SADYIGINQYTASYMKGQKLLQQTPTSYSADWQVQYVLARNGKPIGPQANSNWLYIVPWG  390

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+KE+YGNP ++++ENGMD  GNLT  + L D  R+ +YKSYLA+LK+ +D GA
Sbjct  391   MYGCVNYLKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYLAQLKKAIDQGA  450

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT-LKRYPKMSAYWFQNFLRRN  91
             N+ GYFAWSLLDNFEW  GY+S+FGIVYVDF+  L+R+PK SAYWF++ L++N
Sbjct  451   NVAGYFAWSLLDNFEWLSGYSSKFGIVYVDFNNKLERHPKASAYWFRDMLKKN  503



>ref|NP_001051013.1| Os03g0703000 [Oryza sativa Japonica Group]
 sp|Q75I93.1|BGL07_ORYSJ RecName: Full=Beta-glucosidase 7; Short=Os3bglu7; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07254.1| beta-glucosidase (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|AAX95519.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
 gb|ABF98423.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12927.1| Os03g0703000 [Oryza sativa Japonica Group]
 dbj|BAG94472.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30396.1| beta-glucosidase [Oryza sativa]
Length=504

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/471 (61%), Positives = 360/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGTA+SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  36    GGLSRAAFPKRFVFGTATSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  93

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  94    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  153

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  154   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  213

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  214   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  273

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  274   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  333

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  334   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  393

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  394   MYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  453

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  454   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  504



>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGL|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Length=481

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/471 (61%), Positives = 359/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGM--AASGGRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>ref|XP_006651730.1| PREDICTED: beta-glucosidase 7-like, partial [Oryza brachyantha]
Length=467

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/469 (61%), Positives = 358/469 (76%), Gaps = 3/469 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR +FP GFVFGTA+SAYQVEG       GRGPSIWD F  TPG    N  G+VA DQY
Sbjct  1     LSRAAFPKGFVFGTATSAYQVEGM--AASGGRGPSIWDDFAHTPGNVAGNQNGDVATDQY  58

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L KGITPY N
Sbjct  59    HRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLLKGITPYVN  118

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLP ALE +YGGWL  ++ + + +YA+FCFK FGDRVK+WF+FNEPR+VA LGYD 
Sbjct  119   LYHYDLPLALEKKYGGWLSTKMADLFTEYADFCFKTFGDRVKHWFTFNEPRIVALLGYDQ  178

Query  957   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF WY
Sbjct  179   GTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQRGKVGIVLDFNWY  238

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             E L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS 
Sbjct  239   EALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSA  298

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y
Sbjct  299   DYIGINQYTASYMKGQQLIQQTPTSYSADWQVSYVFAKNGKPIGPQANSNWLYIVPWGMY  358

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
               V Y+K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL++LK+ +D+GAN+
Sbjct  359   GCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLSQLKKAIDEGANV  418

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
              GYFAWSLLDNFEW  GY S+FGIVYVDF TL+R+PK SAYWF++ L++
Sbjct  419   AGYFAWSLLDNFEWLSGYNSKFGIVYVDFKTLERHPKASAYWFRDMLKQ  467



>ref|XP_004982054.1| PREDICTED: beta-glucosidase 8-like [Setaria italica]
Length=566

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/474 (64%), Positives = 369/474 (78%), Gaps = 3/474 (1%)
 Frame = -3

Query  1518  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1339
             V  +TGGLSR++FP GFVFGTA+SA+QVEGA   +  GRGPSIWD F+ TPG    +A  
Sbjct  40    VGADTGGLSRDAFPKGFVFGTATSAFQVEGAASTN--GRGPSIWDPFVHTPGKIAGDANA  97

Query  1338  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1159
             +V  D+YHRYK D+DLM  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI++ML++
Sbjct  98    DVTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNEEGVQYYNNLIDHMLKQ  157

Query  1158  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  979
             G+TPYANLNHYDLP AL+ +Y GWLG ++V+ +ADYA+FCFK FGDRVKNWF+ NEPR+V
Sbjct  158   GLTPYANLNHYDLPLALQKKYKGWLGPKIVDIFADYADFCFKTFGDRVKNWFTLNEPRIV  217

Query  978   AALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
             + LGYD G   P RC+ C  G NSATEPY+V HN++L HA A  RYR  YQA QKG+ GI
Sbjct  218   SFLGYDKGLNPPNRCTQCAAGGNSATEPYIVVHNILLSHATAVARYRNKYQATQKGKVGI  277

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
             +LDF WYEPLT S AD  AAQRARDFH+GWF+ P++ G+YPKTMQ+IV DRLP FTP++ 
Sbjct  278   VLDFNWYEPLTNSTADQAAAQRARDFHVGWFMDPLINGQYPKTMQDIVKDRLPSFTPEQA  337

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             KLVKGS D  GINQYTT+Y+ D         +Y +DW V + + RNG+PIG  ANS WLY
Sbjct  338   KLVKGSSDCFGINQYTTYYISDEQTPQQATPSYSSDWGVQYNFERNGLPIGQLANSVWLY  397

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRV  262
             +VP G+Y  V Y+KE+Y NP + +SENGMD  GNLT  E L+DT R+ +YK+YL ELK+ 
Sbjct  398   IVPTGMYGVVNYLKEKYQNPTIIISENGMDQSGNLTRDEYLHDTVRVEFYKNYLTELKKG  457

Query  261   VDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             +D+GAN+  YFAWSLLDNFEW  GYTS+FGIVYVDF TLKRYPK SAYWF++ L
Sbjct  458   IDEGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFRDML  511



>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F4V|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3AHT|A Chain A, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHT|B Chain B, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHV|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
 pdb|3AHV|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
Length=481

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 359/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FN+PR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNQPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>gb|AAA84906.3| beta-glucosidase [Oryza sativa Japonica Group]
Length=504

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/471 (61%), Positives = 359/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  36    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  93

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  94    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  153

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  154   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  213

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  214   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  273

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  274   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  333

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  334   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  393

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  394   MYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  453

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  454   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  504



>ref|XP_004982056.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Setaria italica]
Length=502

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/473 (63%), Positives = 365/473 (77%), Gaps = 5/473 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR SFP GFVFGTA+SAYQVEGA   +  GRGPSIWD F   PG    N  G+VAVD
Sbjct  33    GGLSRASFPKGFVFGTATSAYQVEGAASTN--GRGPSIWDAFAHIPGKVAGNQNGDVAVD  90

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KG+TPY
Sbjct  91    QYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLQKGMTPY  150

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +Y +FCFK +GDRVK+WF+FNEPR+VA LGY
Sbjct  151   INLYHYDLPLALEQKYGGWLSSKMADLFTEYVDFCFKTYGDRVKHWFTFNEPRIVALLGY  210

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA AA RYR  YQA QKG+ GI+LDF 
Sbjct  211   DAGSNPPQRCTKCAAGGNSATEPYIVAHNFLLAHAAAAARYRTKYQAAQKGKIGIVLDFN  270

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYEPLT S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKG
Sbjct  271   WYEPLTNSTDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKG  330

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V +  +RNG PIGP+ANS WLY+VPWG
Sbjct  331   SADYIGINQYTASYMKGQKLLQQTPTSYSADWQVQYV-SRNGKPIGPQANSNWLYIVPWG  389

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+KE+YGNP ++++ENGMD  GNLT  + L D  R+ +YKSYLA+LK+ +D GA
Sbjct  390   MYGCVNYLKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYLAQLKKAIDQGA  449

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT-LKRYPKMSAYWFQNFLRRN  91
             N+ GYFAWSLLDNFEW  GY+S+FGIVYVDF+  L+R+PK SAYWF++ L++N
Sbjct  450   NVAGYFAWSLLDNFEWLSGYSSKFGIVYVDFNNKLERHPKASAYWFRDMLKKN  502



>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCR|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCS|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCS|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 358/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGM--AASGGRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITSNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCP|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCQ|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCQ|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 358/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGM--AASGGRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITANGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>gb|AAX95520.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
Length=603

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/519 (59%), Positives = 371/519 (71%), Gaps = 41/519 (8%)
 Frame = -3

Query  1536  DVSPERVRF---NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTP  1366
             D +  RVR    +TGGLSR +FP GFVFGTA+SA+QVEG       GRGPSIWD F+ TP
Sbjct  29    DRAGARVRAADDDTGGLSRAAFPKGFVFGTATSAFQVEGM--AASGGRGPSIWDPFVHTP  86

Query  1365  GLEPNNATGEVAVDQYHRYK-----------------------------------RDIDL  1291
             G    N   +V  D+YHRYK                                    D+DL
Sbjct  87    GNIAGNGNADVTTDEYHRYKLISIFVFNLKQAQPYSVFILYWAKIITYIVFLLAQEDVDL  146

Query  1290  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  1111
             +  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LI+Y++++G+ PY NLNHYDLP A
Sbjct  147   LKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYNNLIDYVIKQGLIPYVNLNHYDLPLA  206

Query  1110  LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  931
             L+ +Y GWL  ++V  ++DYAEFCFK +GDRVKNWF+FNEPR+VAALG+DTG   P RC+
Sbjct  207   LQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNWFTFNEPRIVAALGHDTGTDPPNRCT  266

Query  930   NCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKAD  754
              C  G NSATEPY+VAHN+IL HA A  RYR  +QA QKG+ GI+LDF WYEPLT S  D
Sbjct  267   KCAAGGNSATEPYIVAHNIILSHATAVDRYRNKFQASQKGKIGIVLDFNWYEPLTNSTED  326

Query  753   NYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYT  574
               AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLVKGS DY GINQYT
Sbjct  327   QAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLVKGSADYFGINQYT  386

Query  573   TFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKER  394
               Y+ D         +Y +DW+V F + RNGVPIG +ANS WLY+VP G+Y AV Y+KE+
Sbjct  387   ANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANSNWLYIVPTGMYGAVNYIKEK  446

Query  393   YGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLL  214
             Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL ELK+ +DDGAN+  YFAWSLL
Sbjct  447   YNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTELKKAIDDGANVVAYFAWSLL  506

Query  213   DNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             DNFEW  GYTS+FGIVYVDF TLKRYPK SA WF+N L+
Sbjct  507   DNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKNMLQ  545



>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCN|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCO|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCO|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCT|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCT|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCU|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
 pdb|3SCU|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
Length=481

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 358/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCV|B Chain B, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 358/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGMAASG--GRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYAADWQVTYVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCW|B Chain B, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 357/471 (76%), Gaps = 3/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGT +SAYQVEG       GRGPSIWD F  TPG    N  G+VA D
Sbjct  13    GGLSRAAFPKRFVFGTVTSAYQVEGM--AASGGRGPSIWDAFAHTPGNVAGNQNGDVATD  70

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY
Sbjct  71    QYHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPY  130

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGY
Sbjct  131   VNLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGY  190

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF 
Sbjct  191   DQGTNPPKRCTKCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFN  250

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE L+ S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKG
Sbjct  251   WYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKG  310

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V   +A+NG PIGP+ANS WLY+VPWG
Sbjct  311   SADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTAVFAKNGKPIGPQANSNWLYIVPWG  370

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GA
Sbjct  371   MYGCVNYIKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGA  430

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  431   NVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  481



>ref|XP_003559508.1| PREDICTED: beta-glucosidase 7-like [Brachypodium distachyon]
Length=511

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/474 (63%), Positives = 358/474 (76%), Gaps = 9/474 (2%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR SFP GFVFGTA+SAYQVEG       GRGPS+WD F  TPG    N   +V  D
Sbjct  41    GGLSRASFPKGFVFGTATSAYQVEGM--AFSGGRGPSVWDAFAHTPGNIVGNQNADVTTD  98

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYH YK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LI+Y+L+KGITPY
Sbjct  99    QYHHYKEDVNLMKGLNFDAYRFSISWSRIFPDGEGKVNEEGVAYYNNLIDYLLQKGITPY  158

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  + VE +ADYA+FCFK FG+RVK+WF+FNEPR+V   GY
Sbjct  159   INLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGNRVKHWFTFNEPRIVVLGGY  218

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN IL H  A  RYR  Y+A Q+G+ GI+LDF 
Sbjct  219   DVGSNPPQRCTKCAAGGNSATEPYIVAHNFILAHGYAVARYRNKYKAAQQGKVGIVLDFN  278

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFTPDE KLV G
Sbjct  279   WYEALTNSTDDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTPDETKLVNG  338

Query  606   SIDYVGINQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVP  433
             S DY+GINQYT  Y+      P+ P   +Y  DW V +A  RNG+PIGP+ANS WLY+VP
Sbjct  339   SADYIGINQYTANYIKGQKLVPQKP--TSYSADWQVTYASDRNGIPIGPKANSNWLYIVP  396

Query  432   WGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDD  253
              G+Y  V Y++E+YGNP + ++ENGMD  GNLT  E L+D  RI YY+SYLAELKR +D 
Sbjct  397   TGMYGCVNYLREKYGNPAVVITENGMDQPGNLTRDEYLHDITRIRYYRSYLAELKRAIDG  456

Query  252   GANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT--LKRYPKMSAYWFQNFLR  97
             GAN+ GYFAWSLLDNFEW  GYTS+FGIVYVDF++  L+R+PK SAYWF++ L+
Sbjct  457   GANVLGYFAWSLLDNFEWISGYTSKFGIVYVDFNSTKLERHPKASAYWFRDMLK  510



>gb|ADP02192.1| putative non-cyanogenic beta-glucosidase [Triticum aestivum]
Length=507

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 356/482 (74%), Gaps = 6/482 (1%)
 Frame = -3

Query  1530  SPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPN  1351
             SP R  +  GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F   PG    
Sbjct  29    SPRRPNW-LGGLSRASFPKGFVFGTATSAYQVEGM--AAGGGRGPSIWDAFAHVPGNIAG  85

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             N   +V  DQYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY
Sbjct  86    NQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNKEGVAYYNNLINY  145

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +L+KGITPY NL HYDLP ALE +YGGWL  + V  +ADYA+FCFK FGDRVK+WF+FNE
Sbjct  146   LLQKGITPYINLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNE  205

Query  990   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             PR+VA LGYD G   P RCS C   GNSATEPY+VAHN +L H  A  RYR  YQA QKG
Sbjct  206   PRIVALLGYDVGSNPPQRCSKCAAGGNSATEPYIVAHNFLLAHGYAVARYRTKYQAAQKG  265

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             + GI+LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT
Sbjct  266   KVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFT  325

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
             PDE KLVKGS DY+GINQYT   +           +Y  DW V +A+ RNG PIGP+ANS
Sbjct  326   PDEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANS  385

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY+VP G+Y  V Y+ ++YGNP + ++ENGMD  G LT  + L D  R+ +Y+SYL+E
Sbjct  386   NWLYIVPSGMYGCVHYLSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRFYRSYLSE  445

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD--TLKRYPKMSAYWFQNFL  100
             LK+ +D GAN+ GYFAWSLLDNFEW  GY+S+FGIVYVDF+  TL R+PK SAYWF++ L
Sbjct  446   LKKAIDGGANVLGYFAWSLLDNFEWISGYSSKFGIVYVDFNSPTLDRHPKASAYWFRDLL  505

Query  99    RR  94
             + 
Sbjct  506   QH  507



>ref|XP_003559509.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Brachypodium distachyon]
 ref|XP_010230912.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Brachypodium distachyon]
Length=510

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/472 (62%), Positives = 352/472 (75%), Gaps = 5/472 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F   PG    N   +V  D
Sbjct  40    GGLSRASFPKGFVFGTATSAYQVEGM--AASGGRGPSIWDAFSHIPGNVVGNTNADVTTD  97

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L+KGITPY
Sbjct  98    QYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGEGKVNEEGVAYYNNLINYLLQKGITPY  157

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL H DLP ALE +YGGWL  + VE +ADYA+FCFK FG+RVK+WF+ NEPR+   LGY
Sbjct  158   INLYHADLPLALEKKYGGWLSAKTVELFADYADFCFKTFGNRVKHWFTLNEPRIACLLGY  217

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C   GNSATEPY+VAHN +L H  A  RYR  YQA Q+G+ GI+LDF 
Sbjct  218   DVGSTPPQRCTKCAAGGNSATEPYIVAHNFLLAHGYAVARYRNKYQAAQQGKIGIVLDFN  277

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT DEVK+VKG
Sbjct  278   WYEALTNSAEDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTSDEVKIVKG  337

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  Y+           +Y  DW V +A  RNG PIGP+ANS+WLY+VP G
Sbjct  338   SADYIGINQYTASYIKGQKLVQQAPTSYSADWQVTYASLRNGKPIGPKANSDWLYIVPTG  397

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y++ +YGNP + ++ENGMD  GNLT  E L D  R+ +Y+SYLAELK+ +D GA
Sbjct  398   MYGCVNYLRVKYGNPAIVITENGMDQPGNLTRDEYLRDVTRVRFYRSYLAELKKAIDGGA  457

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT--LKRYPKMSAYWFQNFLR  97
             N+ GYFAWSLLDNFEW  GYTS+FGIVYVDF++  L+R+PK SAYWF++ L+
Sbjct  458   NVLGYFAWSLLDNFEWGSGYTSKFGIVYVDFNSTKLERHPKASAYWFRDMLK  509



>dbj|BAJ90056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/473 (62%), Positives = 352/473 (74%), Gaps = 5/473 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F   PG    N   +V  D
Sbjct  31    GGLSRASFPKGFVFGTATSAYQVEGMATGG--GRGPSIWDAFAHVPGNIAGNQNADVTTD  88

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY+L+KGITPY
Sbjct  89    QYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNQEGVAYYNNLINYLLQKGITPY  148

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
              NL HYDLP ALE +YGGWL  + V  +ADYA+FCFK FGDRVK+WF+FNEPR+VA LGY
Sbjct  149   INLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNEPRIVALLGY  208

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RCS CT  GNSATEPY+VAHN +L H  A  RYR  YQA QKG+ GI+LDF 
Sbjct  209   DVGSNPPQRCSKCTAGGNSATEPYIVAHNFLLAHGYAVARYRTKYQAAQKGKVGIVLDFN  268

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+FTP E K+V G
Sbjct  269   WYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPKFTPAEAKMVMG  328

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT   +           +Y  DW V +A+ RNG PIGP+ANS WLY+VP G
Sbjct  329   SADYIGINQYTASLMKGQKLLQQTPTSYSADWQVTYAFERNGKPIGPKANSNWLYIVPSG  388

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+ ++YGNP + ++ENGMD  G LT  + L DT R+ +Y+SYL+ELK+ +D GA
Sbjct  389   MYGCVHYLSQKYGNPPIVITENGMDQPGGLTRDQYLRDTTRVRFYRSYLSELKKAIDGGA  448

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT--LKRYPKMSAYWFQNFLRR  94
             N+ GYFAWSLLDNFEW  GY+S+FGIVYVDF++  L R+PK SAYWF++ LR 
Sbjct  449   NVLGYFAWSLLDNFEWMSGYSSKFGIVYVDFNSPNLDRHPKASAYWFRDLLRH  501



>gb|EEC69164.1| hypothetical protein OsI_38122 [Oryza sativa Indica Group]
Length=492

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/480 (60%), Positives = 357/480 (74%), Gaps = 5/480 (1%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
             VS  R       L+RE+FPAGFVFGTASSAYQVEG  +  KYGRGP IWDTFL  PG+ P
Sbjct  14    VSLSRGNGEQTDLTRETFPAGFVFGTASSAYQVEG--NALKYGRGPCIWDTFLMQPGVTP  71

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             +N+T  V VD+YHRY  D+D MV++ FDAYRFSISW+RIFP+G GK+N  GV YY+RLI+
Sbjct  72    DNSTANVTVDEYHRYMDDVDNMVRVGFDAYRFSISWSRIFPSGLGKINKDGVDYYHRLID  131

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             YML   I PY  L HYDLPQ L D+Y GWL  ++V D+  YA+FCFK +G +VKNWF+ N
Sbjct  132   YMLANNIIPYVVLYHYDLPQVLHDQYKGWLHPRIVRDFVRYADFCFKTYGHKVKNWFTIN  191

Query  993   EPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             EPR++A  GY  GFF PGRC++C   GNSATEPY+ AHNL+L HA A + YR  YQA QK
Sbjct  192   EPRMMANHGYGDGFFPPGRCTSCQPGGNSATEPYIAAHNLLLSHAAAVRTYRDKYQAIQK  251

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             G+ GILLDFVWYEPLT  + D+ AA RAR+F +GW+LHPI+YG YP+TMQN V +RLP F
Sbjct  252   GKIGILLDFVWYEPLTDKEEDHAAAHRAREFTLGWYLHPIIYGHYPETMQNAVKERLPNF  311

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN  457
             T ++ +++KGS DY+ IN YTT+YV     KT    +Y NDW+V  +Y RNGVPIG +A 
Sbjct  312   TREQSEMIKGSADYIAINHYTTYYVSHHVNKTSI--SYLNDWDVKISYERNGVPIGKQAY  369

Query  456   SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLA  277
             S WLY+VPWG+YKAV +VKE+Y +P++ + ENG+D  GN TL  +L D  RI Y+  YL 
Sbjct  370   SNWLYVVPWGIYKAVMHVKEKYKDPIIIIGENGIDQPGNETLPGALYDFFRIQYFDQYLH  429

Query  276   ELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             ELKR + DGA + GYFAWSLLDNFEWR+G+TS+FGIVYVD  T  RYPK S  WF+  ++
Sbjct  430   ELKRAIKDGARVTGYFAWSLLDNFEWRLGFTSKFGIVYVDRSTFTRYPKDSTRWFRKMIK  489



>ref|XP_010237292.1| PREDICTED: beta-glucosidase 38-like [Brachypodium distachyon]
Length=494

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/473 (60%), Positives = 355/473 (75%), Gaps = 5/473 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             G L+R+SFP GFVFGTASSAYQVEG  +  KYGRGP IWDTFLK PG  P+NAT  V VD
Sbjct  26    GDLNRDSFPKGFVFGTASSAYQVEG--NALKYGRGPCIWDTFLKFPGATPDNATANVTVD  83

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             +YHRY  D+D MV++ FDAYRFSISW+RIFP+G G++N  GV YY+RLINYML   ITPY
Sbjct  84    EYHRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLINYMLANKITPY  143

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L HYDLP+ L ++Y GWL  +VV D+ ++A+FCFK +GDRVKNWF+ NEPR++A+ GY
Sbjct  144   VVLYHYDLPEVLNNQYNGWLSPRVVSDFGNFADFCFKTYGDRVKNWFTINEPRMMASHGY  203

Query  963   DTGFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
               GFFAPGRC+ C   GNSATEPY+  H+L+L HA A + YR  YQA QKG+ GILLDFV
Sbjct  204   GDGFFAPGRCTGCRFGGNSATEPYITGHHLLLSHAAAVKIYRDKYQAAQKGKIGILLDFV  263

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYEP   +  D YAA RAR+F +GWFLHPI YG YP+TMQ IVGDRLP F+P++  LV+G
Sbjct  264   WYEPYNYTIEDEYAAHRAREFTLGWFLHPITYGHYPETMQKIVGDRLPSFSPEQTALVQG  323

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GIN YT++YV   Y    ++ +Y NDW    +Y RNGV IG +A S WLY+VPWG
Sbjct  324   SADYIGINHYTSYYV-KHYVNLTHM-SYANDWQAKISYDRNGVLIGKQAFSNWLYVVPWG  381

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
              YKAV +VK+++ NP++ + ENG+D  GN TL  +L D  RI Y+  YL ELKR +DDGA
Sbjct  382   FYKAVMHVKDKFRNPVIVIGENGIDQAGNDTLPHALYDHFRIDYFDQYLHELKRAIDDGA  441

Query  246   NLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
              + GYFAWSLLDNFEWR+G+TS+FG+VYVD  T  RYPK S  WF+  ++  +
Sbjct  442   RVVGYFAWSLLDNFEWRMGFTSKFGLVYVDRKTFTRYPKDSTRWFRKMIKNEE  494



>ref|XP_006664007.1| PREDICTED: beta-glucosidase 38-like [Oryza brachyantha]
Length=498

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/468 (61%), Positives = 352/468 (75%), Gaps = 5/468 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+R SFP GFVFGTASSAYQVEG  +  KYGRGP IWDTFL  PG  P+NAT  V VD+Y
Sbjct  32    LTRASFPLGFVFGTASSAYQVEG--NALKYGRGPCIWDTFLLHPGKTPDNATANVTVDEY  89

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY  D+D MV++ FDAYRFSISW+RIFP+G G++N  GV YY+RLI+YML   ITPY  
Sbjct  90    HRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLIDYMLAHSITPYVA  149

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQ L D+Y GWL  +VV D+  +A+FCFK +G +VKNWF+ NEPR++A  GY  
Sbjct  150   LYHYDLPQVLHDQYNGWLHTRVVRDFVRFADFCFKTYGHKVKNWFTINEPRMMANHGYGD  209

Query  957   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             G+FAPGRC+ C   GNSATEPY+ AHNL+L HA A + YR  YQA QKG+ GILLDFVWY
Sbjct  210   GYFAPGRCTGCQFGGNSATEPYITAHNLLLSHAAAVKIYRDKYQATQKGKIGILLDFVWY  269

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT  + D  AA RAR+F +GWFLHPI YG YP+TMQNIV  RLP FT ++ +++KGS 
Sbjct  270   EPLTDREEDRAAAHRAREFTLGWFLHPITYGHYPETMQNIVMRRLPNFTREQSEMIKGSA  329

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             DY+GIN YTT+YV     KT    +Y NDW+V  +Y R+GVPIG +A S WLY+VPWG+Y
Sbjct  330   DYIGINHYTTYYVSHHVNKT--FMSYLNDWDVKISYERDGVPIGKQAYSNWLYVVPWGIY  387

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
             KAV +VKE+Y +P++ + ENG+D  GN TL  +L D+ RI Y+  YL ELKR + DGA +
Sbjct  388   KAVMHVKEKYKDPIIIIGENGIDQPGNDTLPGALYDSFRIEYFDQYLHELKRAITDGAKV  447

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
              GYFAWSLLDNFEWR+G+TS+FGIVYVD  T  RYPK S  WF+  ++
Sbjct  448   IGYFAWSLLDNFEWRLGFTSKFGIVYVDRQTFTRYPKDSTRWFRKVIK  495



>ref|NP_001066656.1| Os12g0420100 [Oryza sativa Japonica Group]
 sp|Q2QSR8.2|BGL38_ORYSJ RecName: Full=Beta-glucosidase 38; Short=Os12bglu38; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA97621.2| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29675.1| Os12g0420100 [Oryza sativa Japonica Group]
 dbj|BAG92285.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53109.1| hypothetical protein OsJ_35886 [Oryza sativa Japonica Group]
Length=492

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/468 (60%), Positives = 352/468 (75%), Gaps = 5/468 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+RE+FPAGFVFGTASSAYQVEG  +  +YGRGP IWDTFL  PG+ P+N+T  V VD+Y
Sbjct  26    LTRETFPAGFVFGTASSAYQVEG--NALQYGRGPCIWDTFLMQPGVTPDNSTANVTVDEY  83

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY  D+D MV++ FDAYRFSISW+RIFP+G GK+N  GV YY+RLI+YML   I PY  
Sbjct  84    HRYMDDVDNMVRVGFDAYRFSISWSRIFPSGLGKINKDGVDYYHRLIDYMLANNIIPYVV  143

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQ L D+Y GWL  ++V D+  +A+FCFK +G +VKNWF+ NEPR++A  GY  
Sbjct  144   LYHYDLPQVLHDQYKGWLHPRIVRDFVRFADFCFKTYGHKVKNWFTINEPRMMANHGYGD  203

Query  957   GFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             GFF PGRC+ C   GNSATEPY+ AHNL+L HA A + YR  YQA QKG+ GILLDFVWY
Sbjct  204   GFFPPGRCTGCQPGGNSATEPYIAAHNLLLSHAAAVRTYRDKYQAIQKGKIGILLDFVWY  263

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT  + D+ AA RAR+F +GW+LHPI YG YP+TMQN V +RLP FT ++ +++KGS 
Sbjct  264   EPLTDKEEDHAAAHRAREFTLGWYLHPITYGHYPETMQNAVKERLPNFTREQSEMIKGSA  323

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             DY+ IN YTT+YV     KT    +Y NDW+V  +Y RNGVPIG +A S WLY+VPWG+Y
Sbjct  324   DYIAINHYTTYYVSHHVNKTSI--SYLNDWDVKISYERNGVPIGKQAYSNWLYVVPWGIY  381

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
             KAV +VKE+Y +P++ + ENG+D  GN TL  +L D  RI Y+  YL ELKR + DGA +
Sbjct  382   KAVMHVKEKYKDPIIIIGENGIDQPGNETLPGALYDFFRIQYFDQYLHELKRAIKDGARV  441

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
              GYFAWSLLDNFEWR+G+TS+FGIVYVD  T  RYPK S  WF+  ++
Sbjct  442   TGYFAWSLLDNFEWRLGFTSKFGIVYVDRSTFTRYPKDSTRWFRKMIK  489



>emb|CDM83785.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/489 (59%), Positives = 358/489 (73%), Gaps = 6/489 (1%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             + V+    P R+R+  GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F  
Sbjct  18    ACVRATKEPGRLRW-LGGLSRASFPKGFVFGTATSAYQVEGMATGG--GRGPSIWDAFAH  74

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
             TPG    N   +V  DQYHRYK D++LM  LNF+AYRFSISW+RIFP+G GKVN +GVAY
Sbjct  75    TPGKVVGNQNADVTTDQYHRYKEDVNLMKGLNFEAYRFSISWSRIFPDGEGKVNEEGVAY  134

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YN LI+Y+L+KGITPY NL HYDLP ALE +YGGWL  + VE +ADYA+FCFK FGDRV 
Sbjct  135   YNNLIDYLLQKGITPYVNLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGDRVT  194

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +WF+FNEP  VA  GYD     P RC+ C+  GNSATEPYVV HN +L H  A  RYR  
Sbjct  195   HWFTFNEPSRVAIGGYDIATTPPQRCTKCSAGGNSATEPYVVGHNFLLAHGYAVARYRNK  254

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             YQA Q+G+ GI+LD  WYE L+ S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V 
Sbjct  255   YQAAQQGKVGIVLDVSWYEALSNSTEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVK  314

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP  475
             +RLPRFTPDE K+VKGS D++G+NQYTT +V           +Y  D  V +++ RNG P
Sbjct  315   ERLPRFTPDEAKVVKGSADWIGVNQYTTEFVKGQKLVLQRPTSYSADLQVTYSFERNGKP  374

Query  474   IGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISY  295
             IGPRA+S+WLY+VP G+Y  V Y+ ++YGNP M +++NGMD  GNLT  + L D  R+ Y
Sbjct  375   IGPRASSKWLYIVPRGMYGCVHYISQKYGNPPMLITKNGMDQPGNLTRDQYLRDATRVRY  434

Query  294   YKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD--TLKRYPKMSA  121
             Y+SYL ELK+ +D GAN+ GYFAWSLLDNFEW  GYTS+FGIVYV+F+  TL+R+PK SA
Sbjct  435   YRSYLCELKKAIDGGANVLGYFAWSLLDNFEWMYGYTSKFGIVYVNFNSPTLERHPKASA  494

Query  120   YWFQNFLRR  94
             YWF++ L+ 
Sbjct  495   YWFRDLLQH  503



>gb|KDO62882.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62883.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=405

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/370 (75%), Positives = 314/370 (85%), Gaps = 6/370 (2%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  465   RANSEWLYMV  436
             R     L+++
Sbjct  393   RVCLLQLHLL  402



>ref|XP_006451661.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64901.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=405

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/370 (75%), Positives = 313/370 (85%), Gaps = 6/370 (2%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYIGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHN IL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNSILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP  466
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGP
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGP  392

Query  465   RANSEWLYMV  436
             R     L+++
Sbjct  393   RVRLLQLHLL  402



>gb|ADP02193.1| Glyco_hydro_1 domain-containing protein [Triticum aestivum]
Length=587

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/505 (60%), Positives = 370/505 (73%), Gaps = 37/505 (7%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             +TGGLSR SFP GFVFGTA+SA+QVEGA       RGPSIWD F+ TPG    NA  +VA
Sbjct  25    DTGGLSRASFPKGFVFGTATSAFQVEGAAAAGG--RGPSIWDPFVHTPGNIAENANADVA  82

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
              D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI+Y+L++G+T
Sbjct  83    TDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNKEGVTYYNNLIDYVLKQGLT  142

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVV-----------------EDYADYAEFCFKIFGD  1021
             PY NLNHYD+P AL+ +Y G+L  ++                    +ADYAEFCFK +GD
Sbjct  143   PYVNLNHYDIPLALQKKYDGFLSPKIAFYKGQGALKHFSVFFCRNIFADYAEFCFKTYGD  202

Query  1020  RVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCHAVAAQRY  844
             R+KNWF+FNEPR+VAALG+DTG   P RC+ C  G NSATEPY V HN++L HA A  RY
Sbjct  203   RIKNWFTFNEPRIVAALGFDTGTNPPNRCTKCAAGGNSATEPYTVVHNILLSHATAVARY  262

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQA QKG+ GI+LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+
Sbjct  263   RNKYQASQKGKVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQYPKTMQD  322

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF----  499
             IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D P P+ P   +Y +DW+V +    
Sbjct  323   IVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPT-SYSSDWHVQYIFTQ  381

Query  498   -----------AYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMD  352
                        A  RNGVPIG +ANS WLY+VP G+Y  V Y++E+Y NP + +SENGMD
Sbjct  382   DTSLLTLSFKRAVQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTIIISENGMD  441

Query  351   YVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFG  172
                NLT  E L+D  R+ +Y++YLAELK+ +DDGAN+ GYFAWSLLDNFEW  GYTS+FG
Sbjct  442   QPANLTREEFLHDASRVEFYETYLAELKKAIDDGANVVGYFAWSLLDNFEWLSGYTSKFG  501

Query  171   IVYVDFDTLKRYPKMSAYWFQNFLR  97
             IVYVDF TLKRYPK SAYWF+N L+
Sbjct  502   IVYVDFTTLKRYPKDSAYWFKNMLQ  526



>ref|XP_008644990.1| PREDICTED: beta-glucosidase 38-like [Zea mays]
Length=552

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/468 (61%), Positives = 354/468 (76%), Gaps = 5/468 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+R+SFP GFVFGTASSAYQVEG T  H+YGRGP IWDTFLK PG  P+NAT +V VD+Y
Sbjct  86    LNRQSFPPGFVFGTASSAYQVEGNT--HRYGRGPCIWDTFLKYPGTTPDNATADVTVDEY  143

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             +RY  D+D MV++ FDAYRFSISW+RIFP+G G+VN  GV YY+RLINY+L   ITPY  
Sbjct  144   NRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLINYLLANHITPYVV  203

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQ L+D+Y GWL  +++ D+  +A+FCFK +GDRVKNWF+ NEPR++A  GY  
Sbjct  204   LYHYDLPQVLQDQYNGWLSPRILGDFTAFADFCFKTYGDRVKNWFTINEPRMMAQHGYGD  263

Query  957   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             GFF P RC+ C   GNSATEPY+  H+L+L HA A + YR+ Y+ +Q G+ GILLDFVWY
Sbjct  264   GFFPPARCTGCQFGGNSATEPYIAGHHLLLAHAAAVKLYRSKYKVRQAGKIGILLDFVWY  323

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT+S  D YAA RAR F +GWFLHPI YG YP+TMQ IV  RLP FT ++  +VKGS 
Sbjct  324   EPLTKSVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNFTFEQSAMVKGSA  383

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             DYV IN YTT+Y  +    T     Y+NDWN   +Y R+GVPIG RA S+WLY+VPWGLY
Sbjct  384   DYVAINHYTTYYASNFVNATE--TNYRNDWNAKISYERDGVPIGKRAYSDWLYVVPWGLY  441

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
             KA+ + KE++ +P+M + ENG+D  GN TL  +L D  RI Y++ YL EL+  + DGAN+
Sbjct  442   KALIWTKEKFNSPVMLIGENGIDQPGNETLPFALYDKFRIDYFEKYLYELQCAIRDGANV  501

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             FGYFAWSLLDNFEWR+G+TS+FGIVYVD +T  RYPK SA WF+  ++
Sbjct  502   FGYFAWSLLDNFEWRLGFTSKFGIVYVDRNTFVRYPKDSARWFRKVIK  549



>ref|XP_004963948.1| PREDICTED: beta-glucosidase 38-like [Setaria italica]
Length=499

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 356/471 (76%), Gaps = 7/471 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             G L+R++FP GFVFGTASSAYQVEG T   KYGRGP IWDTFLK PG  P+N+T  V VD
Sbjct  32    GNLTRQAFPPGFVFGTASSAYQVEGNT--LKYGRGPCIWDTFLKYPGTTPDNSTANVTVD  89

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             +Y+RY  D+D MV++ FDAYRFSISW+RIFP+G G++N  GV YY+RLINY++E  ITPY
Sbjct  90    EYNRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLINYLIESHITPY  149

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L HYDLPQ L+D+Y GWL  ++VED+  +A+FCFK +GDRVKNWF+ NEPR++AA GY
Sbjct  150   VVLYHYDLPQVLQDQYNGWLSPRIVEDFTKFADFCFKTYGDRVKNWFTINEPRMMAAHGY  209

Query  963   DTGFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
               GFF P RC+ C   GNSATEPY+ AH+L+L HA A + YR  YQA+Q G+ GILLDFV
Sbjct  210   GDGFFPPARCTGCHFGGNSATEPYIAAHHLLLAHASAVKLYREKYQAQQTGKIGILLDFV  269

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYEPLT S  D +AA RAR F +GWFLHPI +G YP+TM+ IV  RLP FT ++  +VKG
Sbjct  270   WYEPLTPSMDDEFAAHRARMFTLGWFLHPITFGHYPETMEKIVMGRLPNFTFEQSAMVKG  329

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPW  430
             S DY+ IN YTT+Y  +   +T   HT Y NDW+V  +Y RNGVPIG +  S+WLY+VPW
Sbjct  330   SADYIAINHYTTYYASNFANET---HTSYVNDWHVKLSYERNGVPIGKKGYSDWLYVVPW  386

Query  429   GLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDG  250
             GLYKA+ + KE++ NP+M + ENG+D  GN +L  +L D  RI Y++ YL EL+  + DG
Sbjct  387   GLYKALLWTKEKFNNPVMLIGENGIDQSGNDSLPGALYDKFRIDYFEKYLYELQCAIHDG  446

Query  249   ANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             AN+ GYFAWSLLDNFEWR+G+TS+FGIVYVD  T  RYPK SA WF+  ++
Sbjct  447   ANVIGYFAWSLLDNFEWRLGFTSKFGIVYVDRTTFARYPKDSARWFRKMIK  497



>gb|AFW69221.1| hypothetical protein ZEAMMB73_365784 [Zea mays]
Length=502

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/468 (61%), Positives = 354/468 (76%), Gaps = 5/468 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+R+SFP GFVFGTASSAYQVEG T  H+YGRGP IWDTFLK PG  P+NAT +V VD+Y
Sbjct  36    LNRQSFPPGFVFGTASSAYQVEGNT--HRYGRGPCIWDTFLKYPGTTPDNATADVTVDEY  93

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             +RY  D+D MV++ FDAYRFSISW+RIFP+G G+VN  GV YY+RLINY+L   ITPY  
Sbjct  94    NRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLINYLLANHITPYVV  153

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQ L+D+Y GWL  +++ D+  +A+FCFK +GDRVKNWF+ NEPR++A  GY  
Sbjct  154   LYHYDLPQVLQDQYNGWLSPRILGDFTAFADFCFKTYGDRVKNWFTINEPRMMAQHGYGD  213

Query  957   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             GFF P RC+ C   GNSATEPY+  H+L+L HA A + YR+ Y+ +Q G+ GILLDFVWY
Sbjct  214   GFFPPARCTGCQFGGNSATEPYIAGHHLLLAHAAAVKLYRSKYKVRQAGKIGILLDFVWY  273

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT+S  D YAA RAR F +GWFLHPI YG YP+TMQ IV  RLP FT ++  +VKGS 
Sbjct  274   EPLTKSVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNFTFEQSAMVKGSA  333

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             DYV IN YTT+Y  +    T     Y+NDWN   +Y R+GVPIG RA S+WLY+VPWGLY
Sbjct  334   DYVAINHYTTYYASNFVNATE--TNYRNDWNAKISYERDGVPIGKRAYSDWLYVVPWGLY  391

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
             KA+ + KE++ +P+M + ENG+D  GN TL  +L D  RI Y++ YL EL+  + DGAN+
Sbjct  392   KALIWTKEKFNSPVMLIGENGIDQPGNETLPFALYDKFRIDYFEKYLYELQCAIRDGANV  451

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             FGYFAWSLLDNFEWR+G+TS+FGIVYVD +T  RYPK SA WF+  ++
Sbjct  452   FGYFAWSLLDNFEWRLGFTSKFGIVYVDRNTFVRYPKDSARWFRKVIK  499



>gb|KEH16708.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=408

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/348 (78%), Positives = 298/348 (86%), Gaps = 6/348 (2%)
 Frame = -3

Query  1527  PERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN  1348
             PE V  +TGGLSR+ FP GFVFG A+SAYQVEG     K GRGPSIWD F+K PG+  NN
Sbjct  33    PETVHLDTGGLSRDVFPKGFVFGVATSAYQVEGMAS--KEGRGPSIWDVFIKKPGIVANN  90

Query  1347  ATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYM  1168
              TGEV+VDQYHRYK DIDL+ KLNFD YRFSISW+RIFPNGTGKVNWKGVAYYNRLI+Y+
Sbjct  91    GTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVNWKGVAYYNRLIDYL  150

Query  1167  LEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEP  988
             LEKGITPYANL HYDLP ALE +Y G L R VV+D+ADYA+FCFK FGDRVKNW +FNEP
Sbjct  151   LEKGITPYANLYHYDLPLALELKYNGLLSRNVVKDFADYADFCFKTFGDRVKNWMTFNEP  210

Query  987   RVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  820
             RVVAALGYD GFFAPGRCS    NCT GNS TEPY VAHNLIL HA AAQRYR  YQ KQ
Sbjct  211   RVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILSHAAAAQRYREKYQEKQ  270

Query  819   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  640
             KGR GILLDFVWYEPLTRSKADNYAAQRARDFHIGWF+HP+VYGEYP+TMQNIVG+RLP+
Sbjct  271   KGRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPRTMQNIVGNRLPK  330

Query  639   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFA  496
             FT +EVKLVKGSID+VGINQYTT+Y+YDP+ + P +  YQ+DWN GFA
Sbjct  331   FTKEEVKLVKGSIDFVGINQYTTYYMYDPHNQKPKVPGYQSDWNAGFA  378



>gb|KDO62884.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=411

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/350 (77%), Positives = 300/350 (86%), Gaps = 6/350 (2%)
 Frame = -3

Query  1533  VSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP  1354
               PE V F+TGGLSRES P GFVFGTA+SAYQVEG    HK GRGPSIWD F K PG+  
Sbjct  35    AQPETVHFDTGGLSRESLPNGFVFGTATSAYQVEGMA--HKDGRGPSIWDVFAKKPGIVA  92

Query  1353  NNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLIN  1174
             NNATG+V+VDQYHRYK D+D+M  LNFDAYRFSISW+RIFP GTGKVNWKGVAYYN+LIN
Sbjct  93    NNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLIN  152

Query  1173  YMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFN  994
             Y+L++GITPYANL HYDLP+ALE +Y G L ++VV+D+ADYA+FCFK FGDRVKNW +FN
Sbjct  153   YLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFN  212

Query  993   EPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQA  826
             EPRVVAALGYD GFFAPGRCS    NCT GNSATEPY+VAHNLIL HA A QRYR  Y+ 
Sbjct  213   EPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQ  272

Query  825   KQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRL  646
             KQKGR GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RL
Sbjct  273   KQKGRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRL  332

Query  645   PRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFA  496
             P+FT +EVK+VKGSID+VGINQYT +Y+YDP+ K P    YQ DWN GFA
Sbjct  333   PKFTKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFA  382



>gb|EMS48652.1| Beta-glucosidase 7 [Triticum urartu]
Length=498

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/488 (58%), Positives = 345/488 (71%), Gaps = 21/488 (4%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             + V+   +P R R+  GGLSR SFP GFVFGTA+SAYQVEG       GRGPSIWD F  
Sbjct  28    ACVRATKAPGRPRW-LGGLSRASFPKGFVFGTATSAYQVEGMATGG--GRGPSIWDAFAH  84

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
             TPG    N   +V  DQYHRYK D++LM  LNFDAYRFSISW+RIFP+  GKVN +GVAY
Sbjct  85    TPGKVVGNQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDSEGKVNEEGVAY  144

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YN LI+Y+L KGITPY NL HYDLP ALE +YGGWL  + VE +ADYA+FCFK FGDRV 
Sbjct  145   YNNLIDYLLHKGITPYVNLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGDRVT  204

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAI  835
             +WF+FNEP  VA  GYD     P RC+ C+  GNSATEPY+V HN +L H  A  RYR  
Sbjct  205   HWFTFNEPSRVAIGGYDIATTPPQRCTKCSAGGNSATEPYIVGHNFLLAHGYAVARYRNN  264

Query  834   YQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
             YQA Q+G+ GI+LD  WYE L+ S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V 
Sbjct  265   YQAAQQGKVGIVLDVSWYEALSNSTEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVK  324

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP  475
             +RLPRFTPDE K+VKGS D++G+NQYTT +V           +Y  D             
Sbjct  325   ERLPRFTPDEAKVVKGSADWIGVNQYTTEFVKGQKLVQQRPTSYSADL------------  372

Query  474   IGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISY  295
                +ANS+WLY+VP G+Y  V Y+ ++YGNP M ++ENGMD  GNLT  + L D  R+ Y
Sbjct  373   ---QANSKWLYVVPRGMYGCVHYISQKYGNPAMLITENGMDQPGNLTRDQYLRDATRVRY  429

Query  294   YKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD--TLKRYPKMSA  121
             Y+SYL ELK+ +D GAN+ GYFAWSLLDNFEW  GYTS+FGIVYVDF+  TL+R+PK SA
Sbjct  430   YRSYLRELKKAIDGGANVLGYFAWSLLDNFEWMYGYTSKFGIVYVDFNSPTLERHPKASA  489

Query  120   YWFQNFLR  97
             YWF++ L+
Sbjct  490   YWFRDLLQ  497



>gb|EMS63424.1| Beta-glucosidase 38 [Triticum urartu]
Length=490

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/472 (58%), Positives = 348/472 (74%), Gaps = 5/472 (1%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSR+SFP GFVFGTASSAYQVEG +   KYGRGP IWDTFLK PG  P+NAT  V VD+Y
Sbjct  23    LSRDSFPKGFVFGTASSAYQVEGNS--LKYGRGPCIWDTFLKYPGATPDNATANVTVDEY  80

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY  D+D MV++ FDAYRFSISW+RIFPNG G++N  GV YY+RLI+YML   ITPY  
Sbjct  81    HRYMDDVDNMVRVGFDAYRFSISWSRIFPNGIGRINKDGVDYYHRLIDYMLANNITPYVV  140

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLP+ L ++Y GWL  +VV D+  +A+FCFK +GDRVKNWF+ NEPR++A  GY  
Sbjct  141   LYHYDLPEVLNNQYNGWLSPRVVPDFTAFADFCFKTYGDRVKNWFTINEPRMMAWHGYGD  200

Query  957   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
             GFFAPGRC+ C   GNSATEPY+  H+L+L HA A + YR  YQ +Q G  GILLDFVWY
Sbjct  201   GFFAPGRCTGCRFGGNSATEPYIAGHHLLLAHAAAVKVYRDKYQRRQNGTIGILLDFVWY  260

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT ++ D YAA RAR+F +GW++HPI +G YP+TMQ +VG RLP FT ++ KL++GS 
Sbjct  261   EPLTYTEEDEYAAHRAREFTLGWYMHPITFGHYPETMQKLVGTRLPNFTAEQSKLLQGSA  320

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             D +GIN YTT+YV   + +     +   DW     + RNGVP+  +A S+WLY+VPWG Y
Sbjct  321   DIIGINHYTTYYV--RHQENLTRMSSATDWQAELLFERNGVPLRRQAFSKWLYVVPWGFY  378

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
             KAV +VK ++ +PL+ + ENG+D  G+ TL  +L DT RI Y+  YL ELKR + DGA +
Sbjct  379   KAVMHVKNKFRDPLILIGENGIDQSGSDTLPHALYDTFRIDYFDQYLHELKRAIADGARV  438

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRRNKH  85
              GYFAWSLLDNFEWR+G+TS+FG+VYVD  T  RYPK S  WF+  ++  ++
Sbjct  439   TGYFAWSLLDNFEWRMGFTSKFGLVYVDRKTFTRYPKDSTRWFRKVIKSEEY  490



>gb|KCW83985.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83986.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=386

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 296/356 (83%), Gaps = 6/356 (2%)
 Frame = -3

Query  1551  SIVQCDVSPERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLK  1372
             ++ +  V  E   F+TGGLSR +FP GFV+GTA+SAYQVEG  D  K GRGPSIWD F+K
Sbjct  22    TMAEETVIHETTSFDTGGLSRSAFPKGFVWGTATSAYQVEGMAD--KEGRGPSIWDVFVK  79

Query  1371  TPGLEPNNATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAY  1192
              PG+   NATGEV+VDQYHRYK D+DLM KLNFDAYRFSISW+RIFP+GTGKVNWKGVAY
Sbjct  80    IPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAY  139

Query  1191  YNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVK  1012
             YNRLI+Y+L KGITPYANL HYDLP+ALE +Y G L   VV+D+ADYA+FCFK FGDRVK
Sbjct  140   YNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKTFGDRVK  199

Query  1011  NWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRY  844
             NW +FNEPRVVAALGYD GFFAPGRCS    NCT GNS TEPY+VAH+LIL HA A QRY
Sbjct  200   NWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILSHAAAVQRY  259

Query  843   RAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQN  664
             R  YQ KQKG  GILLDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQN
Sbjct  260   REKYQEKQKGSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQN  319

Query  663   IVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFA  496
             IVGDRLP+FT +EVK+VKGS+D+VGINQYT +Y+ DP      +  YQ DWN GFA
Sbjct  320   IVGDRLPKFTKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFA  375



>gb|EMT31426.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=509

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/443 (60%), Positives = 323/443 (73%), Gaps = 7/443 (2%)
 Frame = -3

Query  1404  RGPSIWDTFLKTPGLEPNNATG----EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRI  1237
             +G   W      P   P N  G    +V  DQYHRYK D++LM  LNFDAYRFSISW+RI
Sbjct  66    KGKEPWQLTTTAPPDFPRNIAGNQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRI  125

Query  1236  FPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYA  1057
             FP+G GKVN +GVAYYN LINY+L+KGITPY NL HYDLP ALE +YGGWL  + V  +A
Sbjct  126   FPDGDGKVNQEGVAYYNNLINYLLQKGITPYINLYHYDLPLALEKKYGGWLNAKTVGLFA  185

Query  1056  DYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHN  880
             DYA+FCFK FGDRVK+WF+FNEPR+VA LGYD G   P RCS C   GNSATEPY+VAHN
Sbjct  186   DYADFCFKTFGDRVKHWFTFNEPRIVALLGYDVGSNPPQRCSKCAAGGNSATEPYIVAHN  245

Query  879   LILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHP  700
              +L H  A  RYR  YQA QKG+ GI+LDF WYE LT S  D  AAQRARDFH+GWF+ P
Sbjct  246   FLLAHGYAVARYRNKYQAAQKGKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDP  305

Query  699   IVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQ  520
             ++ G YP+ MQ++V +RLPRFTP E KLVKGS DY+GINQYT   +           +Y 
Sbjct  306   LINGHYPQIMQDLVKERLPRFTPSEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYS  365

Query  519   NDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN  340
              DW V +A+ RNG PIGP+ANS WLY+VP G+Y  V Y+ ++YGNP + ++ENGMD  G 
Sbjct  366   ADWQVTYAFERNGKPIGPKANSNWLYIVPSGMYGCVHYLSQKYGNPAIVITENGMDQPGG  425

Query  339   LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYV  160
             LT  + L D  R+ +Y+SYL+ELK+ +D GAN+ GYFAWSLLDNFEW  GY+S+FGIVYV
Sbjct  426   LTRDQYLRDATRVRFYRSYLSELKKAIDGGANVLGYFAWSLLDNFEWISGYSSKFGIVYV  485

Query  159   DFD--TLKRYPKMSAYWFQNFLR  97
             DF+  TL R+PK SAYWF++ L+
Sbjct  486   DFNSPTLDRHPKASAYWFRDLLQ  508



>gb|EMS62097.1| Beta-glucosidase 7 [Triticum urartu]
Length=531

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 317/421 (75%), Gaps = 3/421 (1%)
 Frame = -3

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             N   +V  DQYHRYK D++LM  LNFDAYRFSISW+RIFP+G GKVN +GVAYYN LINY
Sbjct  110   NQNADVTTDQYHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNQEGVAYYNNLINY  169

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +L+KGITPY NL HYDLP ALE +YGGWL  + V  +ADYA+FCFK FGDRVK+WF+FNE
Sbjct  170   LLQKGITPYINLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNE  229

Query  990   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             PR+VA LGYD G   P RCS C   GNSATEPY+VAHN +L H  A  RYR  YQA QKG
Sbjct  230   PRIVALLGYDVGSNPPQRCSKCAAGGNSATEPYIVAHNFLLAHGYAVARYRTKYQAAQKG  289

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             + GI+LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT
Sbjct  290   KVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFT  349

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANS  454
             PDE KLVKGS DY+GINQYT   +           +Y  DW V +A+ RNG PIGP+ANS
Sbjct  350   PDEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANS  409

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAE  274
              WLY+VP G+Y  V Y+ ++YGNP + ++ENGMD  G LT  + L D  R+ YY+SYL E
Sbjct  410   NWLYIVPSGMYGCVHYLSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRYYRSYLGE  469

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDT--LKRYPKMSAYWFQNFL  100
             LK+ +D GAN+ GYFAWSLLDNFEW  GY+S+FGIVYVDF++  L R+PK SAYWF++ L
Sbjct  470   LKKAIDGGANVLGYFAWSLLDNFEWISGYSSKFGIVYVDFNSPNLDRHPKASAYWFRDLL  529

Query  99    R  97
             +
Sbjct  530   Q  530



>gb|ACG44181.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=466

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/422 (62%), Positives = 320/422 (76%), Gaps = 3/422 (1%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGLSR +FP  FVFGTA+SAYQVEGA   +  GRGPS WD F+ TPG    N T +VAVD
Sbjct  34    GGLSRAAFPKDFVFGTATSAYQVEGAASTN--GRGPSTWDAFVHTPGNIVYNQTADVAVD  91

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHRY+ D+DLM  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L KGITPY
Sbjct  92    QYHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLRKGITPY  151

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
             ANL H DLP AL+++YGGWL  ++ + + DYA+FCFK FGDRVK+WF+FNEPR+VA LGY
Sbjct  152   ANLYHSDLPLALQNKYGGWLNAKMAKLFTDYADFCFKTFGDRVKHWFTFNEPRIVALLGY  211

Query  963   DTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFV  787
             D G   P RC+ C+  GNSATEPY+VAHN +L HA A  RYR  YQA QKG+ GI+LDF 
Sbjct  212   DAGSIPPQRCTKCSAGGNSATEPYIVAHNFLLSHAAAVSRYRNKYQAAQKGKVGIVLDFN  271

Query  786   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKG  607
             WYE LT S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLP+FTP++ KLVKG
Sbjct  272   WYEALTNSTEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKFTPEQAKLVKG  331

Query  606   SIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWG  427
             S DY+GINQYT  YV           +Y  DW V +   RNG PIGP+ANS+WLY+VP G
Sbjct  332   SADYIGINQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQANSKWLYIVPEG  391

Query  426   LYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGA  247
             +Y  V Y+K +YGNP +F++ENGMD  GNLT  + L+DT R+ +YK YLAEL++ +DDGA
Sbjct  392   MYGCVNYLKHKYGNPTVFITENGMDQPGNLTRGQYLHDTTRVQFYKGYLAELRKAIDDGA  451

Query  246   NL  241
             ++
Sbjct  452   DV  453



>ref|XP_002438912.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
 gb|EER90279.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
Length=480

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/468 (58%), Positives = 334/468 (71%), Gaps = 33/468 (7%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             LSRE+FP GFVFGTASSAYQVEG T   K+GRGPSIWDTFLK PG  P+NAT +V+VD+Y
Sbjct  42    LSRETFPPGFVFGTASSAYQVEGNT--RKFGRGPSIWDTFLKYPGTTPDNATADVSVDEY  99

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
              RY  D+D MV++ FDAYRFSISW+RIFP+G G+VN  GV YY+RLI+YML   ITPY  
Sbjct  100   DRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLIDYMLANHITPYVV  159

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L HYDLPQ L+D+Y GWL  ++V D+  +A+FCFK +GDRVK WF+ NEP++VA+ GY  
Sbjct  160   LYHYDLPQVLQDQYNGWLSPRIVPDFTAFADFCFKTYGDRVKFWFTINEPQMVASHGYGD  219

Query  957   GFFAPGRCSNCT-QGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWY  781
              FF PGRC+ C   GNSATEPY+  H+L+L HA A + YR  Y+  Q G+ GILLDFVWY
Sbjct  220   AFFPPGRCTGCYFGGNSATEPYIAGHHLLLSHAAAVKLYREKYKVHQGGKIGILLDFVWY  279

Query  780   EPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI  601
             EPLT+S  D +AA RAR F +GWFLHPI YG YP+TM+ IV  RLP FT ++  +VKGS 
Sbjct  280   EPLTKSIEDEFAAHRARMFTLGWFLHPITYGHYPETMEKIVMGRLPNFTFEQSAMVKGSA  339

Query  600   DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLY  421
             DY+ IN YTT+Y                  N G+              S+WLY+VPWGLY
Sbjct  340   DYIAINHYTTYYAS----------------NFGY--------------SDWLYVVPWGLY  369

Query  420   KAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  241
             KA+ + KE++ NP+M + ENG+D  GN TL  +L D  RI Y++ YL EL+  + DGAN+
Sbjct  370   KALIWTKEKFNNPVMLIGENGIDQSGNETLPHALYDKFRIDYFQKYLQELQYAIRDGANV  429

Query  240   FGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             FGYF WSLLDNFEWR+GYTSRFGIV+VD  T  RYPK SA WF+  ++
Sbjct  430   FGYFVWSLLDNFEWRLGYTSRFGIVHVDRSTFVRYPKDSARWFRKVIK  477



>gb|EMS62098.1| Beta-glucosidase 8 [Triticum urartu]
Length=554

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/435 (62%), Positives = 331/435 (76%), Gaps = 18/435 (4%)
 Frame = -3

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NA  +VA D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI+Y
Sbjct  59    NANADVATDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNKEGVTYYNNLIDY  118

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             +L++G+TPY NLNHYD+P AL+ +Y G+L  ++   +ADYAEFCFK +GDR+KNWF+FNE
Sbjct  119   ILKQGLTPYVNLNHYDIPLALQKKYDGFLSPKIANIFADYAEFCFKTYGDRIKNWFTFNE  178

Query  990   PRVVAALGYDTGFFAPGRCSNCTQ-GNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
             PR+VAALG+DTG   P RC+ C   GNSATEPY V HN++L HA A  RYR  YQA QKG
Sbjct  179   PRIVAALGFDTGTNPPNRCTKCAAGGNSATEPYTVVHNILLSHATAVARYRNKYQASQKG  238

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
             + GI+LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+IV +RLP FT
Sbjct  239   KVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQYPKTMQDIVKERLPSFT  298

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWNVGF--------------  499
             P++ KLVKGS+DY+GINQYT  Y+ D P P+ P   +Y +DW+V +              
Sbjct  299   PEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPT-SYSSDWHVQYIFTQDTSLLTLSFT  357

Query  498   -AYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAES  322
              A  RNGVPIG +ANS WLY+VP G+Y  V Y++E+Y NP + +SENGMD   NLT  E 
Sbjct  358   HAVQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTIIISENGMDQPANLTREEF  417

Query  321   LNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLK  142
             L+D  R+ +YK+YLAELK+ +DDGAN+ GYFAWSLLDNFEW  GYTS+FGIVYVDF TLK
Sbjct  418   LHDASRVEFYKTYLAELKKAIDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLK  477

Query  141   RYPKMSAYWFQNFLR  97
             RYPK SAYWF+  L+
Sbjct  478   RYPKDSAYWFKKMLQ  492



>gb|ABF98424.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
Length=400

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/400 (61%), Positives = 310/400 (78%), Gaps = 1/400 (0%)
 Frame = -3

Query  1290  MVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQA  1111
             M  LNFDAYRFSISW+RIFP+G G+VN +GVAYYN LINY+L+KGITPY NL HYDLP A
Sbjct  1     MKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYVNLYHYDLPLA  60

Query  1110  LEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS  931
             LE +YGGWL  ++ + + +YA+FCFK FG+RVK+WF+FNEPR+VA LGYD G   P RC+
Sbjct  61    LEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYDQGTNPPKRCT  120

Query  930   NCTQG-NSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKAD  754
              C  G NSATEPY+VAHN +L HA A  RYR  YQA Q+G+ GI+LDF WYE L+ S  D
Sbjct  121   KCAAGGNSATEPYIVAHNFLLSHAAAVARYRTKYQAAQQGKVGIVLDFNWYEALSNSTED  180

Query  753   NYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYT  574
               AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GINQYT
Sbjct  181   QAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGINQYT  240

Query  573   TFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKER  394
               Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y+K++
Sbjct  241   ASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNYIKQK  300

Query  393   YGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLL  214
             YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFAWSLL
Sbjct  301   YGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFAWSLL  360

Query  213   DNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLRR  94
             DNFEW  GYTS+FGIVYVDF+TL+R+PK SAYWF++ L+ 
Sbjct  361   DNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLKH  400



>gb|EMT00720.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=545

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/452 (60%), Positives = 332/452 (73%), Gaps = 35/452 (8%)
 Frame = -3

Query  1350  NATGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINY  1171
             NA  +VA D+YHRYK D+DL+  LNFDAYRFSISW+RIFP+G GKVN +GV YYN LI+Y
Sbjct  34    NANADVATDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNKEGVTYYNNLIDY  93

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVV-----------------EDYADYAEF  1042
             +L++G+TPY NLNHYD+P AL+ +Y G+L  ++                    +ADYAEF
Sbjct  94    VLKQGLTPYVNLNHYDIPLALQKKYDGFLSPKIAFYKGQGALKHFSVFFCRNIFADYAEF  153

Query  1041  CFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQG-NSATEPYVVAHNLILCH  865
             CFK +GDR+KNWF+FNEPR+VAALG+DTG   P RC+ C  G NSATEPY V HN++L H
Sbjct  154   CFKTYGDRIKNWFTFNEPRIVAALGFDTGTNPPNRCTKCAAGGNSATEPYTVVHNILLSH  213

Query  864   AVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGE  685
             A A  RYR  YQA QKG+ GI+LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+
Sbjct  214   ATAVARYRNKYQASQKGKVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQ  273

Query  684   YPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PYPKTPYIHTYQNDWN  508
             YPKTMQ+IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D P P+ P   +Y +DW+
Sbjct  274   YPKTMQDIVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPT-SYSSDWH  332

Query  507   VGF---------------AYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  373
             V +               A  RNGVPIG +ANS WLY+VP G+Y  V Y++E+Y NP + 
Sbjct  333   VQYIFTQDTSLLTLSFKRAVQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTII  392

Query  372   LSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRI  193
             +SENGMD   NLT  E L+D  R+ +YK+YLAELK+ +DDGAN+ GYFAWSLLDNFEW  
Sbjct  393   ISENGMDQPANLTREEFLHDASRVEFYKTYLAELKKAIDDGANVVGYFAWSLLDNFEWLS  452

Query  192   GYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
             GYTS+FGIVYVDF TLKRYPK SAYWF+N L+
Sbjct  453   GYTSKFGIVYVDFTTLKRYPKDSAYWFKNMLQ  484



>ref|NP_001064347.1| Os10g0323500 [Oryza sativa Japonica Group]
 sp|Q339X2.1|BGL34_ORYSJ RecName: Full=Beta-glucosidase 34; Short=Os10bglu34; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABB47155.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26261.1| Os10g0323500 [Oryza sativa Japonica Group]
 dbj|BAG92457.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50740.1| hypothetical protein OsJ_31060 [Oryza sativa Japonica Group]
Length=510

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/482 (55%), Positives = 332/482 (69%), Gaps = 18/482 (4%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGL+R+SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAV
Sbjct  30    TGGLTRKSFPNGFVFGTASSAYQYEGA--VKEDGRGPTIWDKFAHTFGKIIDFSNADVAV  87

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYHR++ DI LM  +  DAYRFSISW+RIFPNGTG+VN  G+ +YN+LIN +L KGI P
Sbjct  88    DQYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  147

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             Y  L H+DLPQALED+Y GWL RQ++ DYA YAE CF+ FGDRVK+W +FNEP  VA   
Sbjct  148   YVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQA  207

Query  966   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
             YD+G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI
Sbjct  208   YDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGELGI  267

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
               D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E 
Sbjct  268   SFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTEKEA  327

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRANS  454
              LV GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG RANS
Sbjct  328   ALVNGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDRANS  385

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN---LTLAESLNDTKRISYYKSY  283
              WLY+VP  +   + YVK+RY  P ++++ENGMD  GN   ++L  +L D KR  Y+  Y
Sbjct  386   IWLYIVPRSMRILMNYVKDRYNKPTVYITENGMD-DGNSPFISLKNALKDDKRTKYHNDY  444

Query  282   LAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             L  L   + +DG ++ GYFAWSLLDN+EW  GYTSRFG+ YVD+   KRYPK S  WF+N
Sbjct  445   LTNLADSIREDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYYVDYKNRKRYPKNSVQWFKN  504

Query  105   FL  100
              L
Sbjct  505   LL  506



>gb|EEC66726.1| hypothetical protein OsI_33062 [Oryza sativa Indica Group]
Length=510

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/482 (55%), Positives = 332/482 (69%), Gaps = 18/482 (4%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGL+R+SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAV
Sbjct  30    TGGLTRKSFPNGFVFGTASSAYQYEGA--VKEDGRGPTIWDKFAHTFGKIIDFSNADVAV  87

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYHR++ DI LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L KGI P
Sbjct  88    DQYHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  147

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             Y  L H+DLPQALED+Y GWL RQ++ DYA YAE CF+ FGDRVK+W +FNEP  VA   
Sbjct  148   YVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQA  207

Query  966   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
             YD+G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI
Sbjct  208   YDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGELGI  267

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
               D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E 
Sbjct  268   SFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTEKEA  327

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRANS  454
              LV GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG RANS
Sbjct  328   ALVNGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDRANS  385

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN---LTLAESLNDTKRISYYKSY  283
              WLY+VP  +   + YVK+RY  P ++++ENGMD  GN   ++L  +L D KR  Y+  Y
Sbjct  386   IWLYIVPRSMRILMNYVKDRYNKPTVYITENGMD-DGNSPFISLKNALKDDKRTKYHNDY  444

Query  282   LAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQN  106
             L  L   + +DG ++ GYFAWSLLDN+EW  GYTSRFG+ YVD+   KRYPK S  WF+N
Sbjct  445   LTNLADSIREDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYYVDYKNRKRYPKNSVQWFKN  504

Query  105   FL  100
              L
Sbjct  505   LL  506



>ref|XP_004985213.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=520

 Score =   527 bits (1358),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 259/480 (54%), Positives = 330/480 (69%), Gaps = 18/480 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQY
Sbjct  42    LTRGSFPKGFVFGTAAAAYQYEGAVKVD--GRGQTIWDTFAHTFGKISDFSNADVAVDQY  99

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HR++ D+ LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN++IN +L KGI PY  
Sbjct  100   HRFQEDVQLMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKVINALLSKGIQPYVT  159

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GYD 
Sbjct  160   LYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITINEPHTVAVQGYDA  219

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G+ GI  D
Sbjct  220   GLHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSDIYRRKYKATQNGQLGIAFD  279

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  V +RLP+FT +E  LV
Sbjct  280   VIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRTRVAERLPKFTAEEAALV  339

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANSEW  448
             KG++D+VGIN YTTFY    +  T  I    ND       +   + +NG PIG RANS W
Sbjct  340   KGALDFVGINHYTTFYTR--HNDTNIIGVLLNDTLADTGTISLPFDKNGKPIGDRANSIW  397

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE  274
             LY+VP G+ K + YVKERY +P ++++ENGMD   N   ++ ++L D+KRI Y+  YL  
Sbjct  398   LYIVPSGMRKLMNYVKERYNSPPVYITENGMDDSNNPFTSIKDALKDSKRIKYHNDYLTN  457

Query  273   L-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
             L   + +DG ++ GYFAWSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  WF++ L
Sbjct  458   LAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNSVQWFKSLL  517



>ref|XP_006661692.1| PREDICTED: beta-glucosidase 34-like [Oryza brachyantha]
Length=509

 Score =   526 bits (1355),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 330/479 (69%), Gaps = 16/479 (3%)
 Frame = -3

Query  1500  GLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQ  1321
             GL+R SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAVDQ
Sbjct  31    GLTRGSFPKGFVFGTASSAYQYEGA--VKEDGRGPAIWDKFAHTFGKIIDFSNADVAVDQ  88

Query  1320  YHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYA  1141
             YHR++ DI LM  +  DAYRFSI+W+RIFPNGTG++N  G+ +YN+LIN +L KGI PY 
Sbjct  89    YHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGQINQAGIDHYNKLINALLAKGIEPYV  148

Query  1140  NLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYD  961
              L H+DLPQALED+Y GWL RQ++ DYA YAE CFK FGDRVK+W +FNEP  VA   YD
Sbjct  149   TLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFKAFGDRVKHWITFNEPHTVAVQAYD  208

Query  960   TGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
             +G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI  
Sbjct  209   SGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGSLGISF  268

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E  L
Sbjct  269   DVIWYEPMSNSTADVEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTTTEAAL  328

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRANSEW  448
             V GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG +ANS W
Sbjct  329   VTGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDKANSIW  386

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE  274
             LY+VP  +   + YVK+RY  P ++++ENGMD   +  ++L ++L D KRI Y+  YL  
Sbjct  387   LYIVPRSMRILMNYVKDRYNKPTVYITENGMDDSNSPFISLKDALKDNKRIKYHNDYLTS  446

Query  273   LKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             L   + +DG ++ GYFAWSLLDN+EW  GYTSRFG+ +VD+   KR+PK S  WF+N L
Sbjct  447   LADSIWEDGCDVRGYFAWSLLDNWEWSAGYTSRFGLYFVDYKDQKRHPKNSVKWFKNLL  505



>ref|XP_009406318.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=506

 Score =   525 bits (1353),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 261/488 (53%), Positives = 333/488 (68%), Gaps = 17/488 (3%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             R     GGLSR SFP GFVFGTASS+YQ EGA  V + G+G ++WD F  T G   + + 
Sbjct  21    RCLAQGGGLSRSSFPEGFVFGTASSSYQYEGA--VEEDGKGRTVWDVFAHTFGKVIDFSN  78

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +VAVDQYHR+  DI LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L 
Sbjct  79    ADVAVDQYHRFDEDILLMKDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLA  138

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
              GI PY  L H+DLPQALEDRY GW+  ++++DYADYAE CFK FGDRVK+W +FNEP  
Sbjct  139   NGIEPYVTLYHWDLPQALEDRYDGWIDPRIIQDYADYAETCFKAFGDRVKHWMTFNEPHT  198

Query  981   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
              A  GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+ KQ+
Sbjct  199   FAIQGYDVGLQAPGRCSAFLRLLCRAGNSATEPYIVAHNVLLSHATVSDIYRRKYKQKQQ  258

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             G  GI  D +WYEP+T S  D  A QRA+DF  GWF+ P+ +G+YP +M+  VG+RLPRF
Sbjct  259   GSLGIAFDVMWYEPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRKRVGNRLPRF  318

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIG  469
             T  E  LVKGS+D+VG+N YTT+Y    +  T  I    ND            +NG  IG
Sbjct  319   TTAEAALVKGSLDFVGVNHYTTYYA--KHNSTNIIGILLNDTLADSGAMTLPFKNGKAIG  376

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISY  295
              RA+S WLY+VP GL   + ++K++YGNP++ ++ENGMD   N  +++  +LND KRI Y
Sbjct  377   DRASSIWLYIVPQGLRSLMNHIKQKYGNPVVIITENGMDDFNNPFISIKHALNDDKRIRY  436

Query  294   YKSYLAE-LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSA  121
             +  YL   L  + +DG N+ GYFAWSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S 
Sbjct  437   HNDYLLNLLASIREDGCNVQGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKKSV  496

Query  120   YWFQNFLR  97
              WF+N L+
Sbjct  497   TWFKNLLK  504



>ref|XP_002465651.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
 gb|EER92649.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
Length=508

 Score =   525 bits (1353),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/483 (54%), Positives = 332/483 (69%), Gaps = 20/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVD
Sbjct  28    GGLTRGSFPKGFVFGTAAAAYQYEGA--VTTDGRGRTIWDTFAHTFGKISDFSNADVAVD  85

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ D+ LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN +L KGI PY
Sbjct  86    QYHRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPY  145

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GY
Sbjct  146   VTLYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAIQGY  205

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G  GI 
Sbjct  206   DAGLHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSDIYRRKYKAAQNGELGIA  265

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  VG+RLP+FT DE  
Sbjct  266   FDVIWYEPMTNSTIDIEATKRAQEFQLGWFAEPFFFGDYPATMRTRVGERLPKFTADEAT  325

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             LVKG++D++GIN YTTFY    + +T  I    ND       +   + +NG PIG RANS
Sbjct  326   LVKGALDFMGINHYTTFYTR--HNETNIIGRLLNDTLADTGTISLPFDKNGKPIGDRANS  383

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN---LTLAESLNDTKRISYYKSY  283
              WLY+VP G+ K + YVKERY +P ++++ENGMD  GN    ++ ++L D KRI Y+  Y
Sbjct  384   IWLYIVPSGIRKLMNYVKERYNSPTVYITENGMD-DGNSPFTSIQDALKDKKRIKYHNDY  442

Query  282   LAEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQ  109
             L+ +   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+
Sbjct  443   LSNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFK  502

Query  108   NFL  100
               L
Sbjct  503   TLL  505



>ref|XP_010551390.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
 ref|XP_010551391.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
Length=515

 Score =   525 bits (1352),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 264/484 (55%), Positives = 334/484 (69%), Gaps = 27/484 (6%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             + R SFP GFVFGTASSA+Q EGA  V + GRGPS+WDTF    G   +++  +VAVDQY
Sbjct  35    IGRGSFPEGFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHAFGKIVDSSNADVAVDQY  92

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY+ D+ LM  +  DAYRFSISW+RIFPNGTG++N  G+ +YN+LIN +L KGI PY  
Sbjct  93    HRYEEDVQLMKNMGMDAYRFSISWSRIFPNGTGQINQAGIDHYNKLINALLAKGIQPYVT  152

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALEDRY GWL  Q++ D+A YAE CFK FGDRVK+W +FNEP   A  GYD 
Sbjct  153   LYHWDLPQALEDRYNGWLSPQIINDFAIYAEVCFKNFGDRVKHWITFNEPHNFAIQGYDV  212

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNS+TEPY+VAHN++L HA  +  YR  Y+  Q G  GI LD
Sbjct  213   GLQAPGRCSILLKLFCRVGNSSTEPYIVAHNVLLSHATVSDIYRKKYKGNQGGSLGIALD  272

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              VWYEP T +  D  AAQRA+DF +GWFL P+++G+YP +M+  VG RLP+FT  +  L+
Sbjct  273   VVWYEPETNTTEDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRTRVGKRLPKFTQSQTDLL  332

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGV---------PIGPRA  460
             KGS+D+VGIN YTT Y  +   KT  I T  ND     A A +G          PIG RA
Sbjct  333   KGSLDFVGINHYTTNYARN--NKTNLIGTLLND-----AIADSGTSTGPLKGLQPIGDRA  385

Query  459   NSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAE--SLNDTKRISYYKS  286
             NS WLY+VP G+   + Y+K+RYGNPL+ ++ENGMD   ++ ++   +L D KRI Y+  
Sbjct  386   NSIWLYIVPRGMRSLMNYIKQRYGNPLVIITENGMDDPNSILISRENALKDEKRIKYHHD  445

Query  285   YLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWF  112
             YL+ L+  + +DG N+ GYFAWSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S +WF
Sbjct  446   YLSSLQAAIKEDGCNVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYNDNLKRYPKHSVHWF  505

Query  111   QNFL  100
               FL
Sbjct  506   TTFL  509



>ref|XP_010910029.1| PREDICTED: beta-glucosidase 25 isoform X1 [Elaeis guineensis]
Length=497

 Score =   524 bits (1350),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 258/484 (53%), Positives = 333/484 (69%), Gaps = 13/484 (3%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             +T  L+R  FP+ FVFGTASSA+Q EGA +  K  RG SIWDTF + PG   + +  E+A
Sbjct  16    STEALTRADFPSDFVFGTASSAFQFEGAVNEGK--RGDSIWDTFTRRPGRILDFSNAEIA  73

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
             VDQYHRYK D+DLM  +  DAYRFSISW+RIFPNGTG+ N +G+++YN LI+ +LEKG+ 
Sbjct  74    VDQYHRYKTDVDLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PY  L H+DLPQ+LEDRY GWL RQ+VED+  YA  CF+ FGDRVK+W +FNEP   +  
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQ  193

Query  969   GYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             GYDTG  APGRCS      C +G S+TEPY+VAHN++L HA A   Y+  ++AKQ G  G
Sbjct  194   GYDTGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAAFHTYKRNFKAKQDGAIG  253

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I LD  WYEP++ +  D  AA RA DF +GWFL P+++G YP++MQNIVG RLP  T   
Sbjct  254   IALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNITSKM  313

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPK--TPYIHTYQNDWNVGFAYARNGVPIGPRANSE  451
              K + G++D+VGIN YTT YV +   +     +     D  V     R+G  IG RA S 
Sbjct  314   SKSLAGTLDFVGINHYTTLYVRNDRIRIWNLVLDDASTDAGVIATSFRHGEMIGERAASH  373

Query  450   WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLA  277
             WL++VPWG+ K + Y+KE+YGNPL+ ++ENGMD   N   TL ++L D KRI Y+  YL+
Sbjct  374   WLHIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIHYHNDYLS  433

Query  276   ELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNF  103
              L   V +DG N+ GYF WSLLDN+EW  GYT RFG+ +VD+ D LKR PK S  WF++F
Sbjct  434   NLSAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKASVKWFKHF  493

Query  102   LRRN  91
             L+R 
Sbjct  494   LQRQ  497



>gb|AAK92581.1|AC074354_15 Putative beta-glucosidase [Oryza sativa Japonica Group]
Length=515

 Score =   525 bits (1351),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 261/486 (54%), Positives = 330/486 (68%), Gaps = 21/486 (4%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             TGGL+R+SFP GFVFGTASSAYQ EGA  V + GRGP+IWD F  T G   + +  +VAV
Sbjct  30    TGGLTRKSFPNGFVFGTASSAYQYEGA--VKEDGRGPTIWDKFAHTFGKIIDFSNADVAV  87

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYHR++ DI LM  +  DAYRFSISW+RIFPNGTG+VN  G+ +YN+LIN +L KGI P
Sbjct  88    DQYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  147

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             Y  L H+DLPQALED+Y GWL RQ++ DYA YAE CF+ FGDRVK+W +FNEP  VA   
Sbjct  148   YVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQA  207

Query  966   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
             YD+G  APGRCS      C +GNS TEPY+VAHN+IL HA  +  YR  Y+A Q G  GI
Sbjct  208   YDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQNGELGI  267

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
               D +WYEP++ S AD  AA+RA++F +GWF  P  +G+YP TM++ VG RLP+FT  E 
Sbjct  268   SFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPKFTEKEA  327

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPIGPRANS  454
              LV GS+D++GIN YTTFY  D   ++  I    N+     A      RNG PIG RANS
Sbjct  328   ALVNGSLDFMGINHYTTFYTKD--DQSTVIEKLLNNTLADTATISVPFRNGQPIGDRANS  385

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMD-------YVGNLTLAESLNDTKRISY  295
              WLY+VP  +   + YVK+RY  P ++++ENG         ++  ++L  +L D KR  Y
Sbjct  386   IWLYIVPRSMRILMNYVKDRYNKPTVYITENGKCTYVICDLFLPFISLKNALKDDKRTKY  445

Query  294   YKSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             +  YL  L   + +DG ++ GYFAWSLLDN+EW  GYTSRFG+ YVD+   KRYPK S  
Sbjct  446   HNDYLTNLADSIREDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYYVDYKNRKRYPKNSVQ  505

Query  117   WFQNFL  100
             WF+N L
Sbjct  506   WFKNLL  511



>ref|XP_010910030.1| PREDICTED: beta-glucosidase 25 isoform X2 [Elaeis guineensis]
Length=492

 Score =   523 bits (1348),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 258/482 (54%), Positives = 336/482 (70%), Gaps = 14/482 (3%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             +T  L+R  FP+ FVFGTASSA+Q EGA +  K  RG SIWDTF + PG   + +  E+A
Sbjct  16    STEALTRADFPSDFVFGTASSAFQFEGAVNEGK--RGDSIWDTFTRRPGRILDFSNAEIA  73

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
             VDQYHRYK D+DLM  +  DAYRFSISW+RIFPNGTG+ N +G+++YN LI+ +LEKG+ 
Sbjct  74    VDQYHRYKTDVDLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PY  L H+DLPQ+LEDRY GWL RQ+VED+  YA  CF+ FGDRVK+W +FNEP   +  
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQ  193

Query  969   GYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             GYDTG  APGRCS      C +G S+TEPY+VAHN++L HA A   Y+  ++AKQ G  G
Sbjct  194   GYDTGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAAFHTYKRNFKAKQDGAIG  253

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I LD  WYEP++ +  D  AA RA DF +GWFL P+++G YP++MQNIVG RLP  T   
Sbjct  254   IALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNITSKM  313

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWL  445
              K + G++D+VGIN YTT YV +   +    +   +D +   A+ R+G  IG RA S WL
Sbjct  314   SKSLAGTLDFVGINHYTTLYVRN--DRIRIWNLVLDDASTDAAF-RHGEMIGERAASHWL  370

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAEL  271
             ++VPWG+ K + Y+KE+YGNPL+ ++ENGMD   N   TL ++L D KRI Y+  YL+ L
Sbjct  371   HIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIHYHNDYLSNL  430

Query  270   KRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLR  97
                V +DG N+ GYF WSLLDN+EW  GYT RFG+ +VD+ D LKR PK S  WF++FL+
Sbjct  431   SAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKASVKWFKHFLQ  490

Query  96    RN  91
             R 
Sbjct  491   RQ  492



>ref|XP_008789189.1| PREDICTED: beta-glucosidase 25 isoform X1 [Phoenix dactylifera]
Length=497

 Score =   524 bits (1349),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 257/484 (53%), Positives = 338/484 (70%), Gaps = 13/484 (3%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             +T  LSR  FP+GFVFGTASSAYQ EGA +  K  RG SIWDTF + PG   + +  E+A
Sbjct  16    STKALSRADFPSGFVFGTASSAYQFEGAVNEGK--RGDSIWDTFTRRPGRILDFSNAEIA  73

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
             VDQYHRYK D DLM  +  DAYRFSISW+RIFPNGTG+ N +G+++YN LI+ +LEKG+ 
Sbjct  74    VDQYHRYKTDADLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PY  L H+DLPQ+LEDRY GWL RQ+VED+  YA  CF+ FGDRVK+W +FNEP   +  
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYACTCFEAFGDRVKHWITFNEPHGFSIQ  193

Query  969   GYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             GYD G  APGRCS      C +G S+TEPY+VAHN++L HA     Y+ +++AKQ G  G
Sbjct  194   GYDLGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAVFHTYKRLFKAKQGGSIG  253

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I LD  WYEP++ +  D+ AA RA DF +GWFL P+++G YP++MQNIVG RLP+ T + 
Sbjct  254   IALDSKWYEPISDADEDHDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPKITSEM  313

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPK--TPYIHTYQNDWNVGFAYARNGVPIGPRANSE  451
              K + G++D+VGIN YTT YV +   +     +     D  V     R+G  IG +A S 
Sbjct  314   SKSLAGTLDFVGINHYTTLYVRNDRIRIWNLVMDDASTDAGVITTSFRHGEMIGEKAASH  373

Query  450   WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLA  277
             WL++VPWG  K + YVKE+YGNPL+ ++ENGMD + N   TL ++L D KRI Y++ YL+
Sbjct  374   WLHIVPWGFRKLMRYVKEKYGNPLVIITENGMDDLNNPFATLDKALEDNKRIHYHRDYLS  433

Query  276   ELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNF  103
              L  V+ +DG ++ GYF WSLLDN+EW  GYT RFG+ +VD+ + L R PK SA WF++F
Sbjct  434   NLSAVIREDGCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRIPKASAKWFRHF  493

Query  102   LRRN  91
             L+R+
Sbjct  494   LQRH  497



>gb|KDO50113.1| hypothetical protein CISIN_1g0406882mg, partial [Citrus sinensis]
Length=331

 Score =   517 bits (1331),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 278/331 (84%), Gaps = 4/331 (1%)
 Frame = -3

Query  1068  EDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCS----NCTQGNSATE  901
             +DYADYA+FCFK FGDRVKNWF+FNEPRV+AALG+D G   P RCS    NCT GNS+TE
Sbjct  1     KDYADYADFCFKTFGDRVKNWFTFNEPRVIAALGFDNGINPPSRCSKGMGNCTAGNSSTE  60

Query  900   PYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFH  721
             PY+ AHN+IL HA A +R+R  YQ  QKG+ GILLDFVWYEPLTRSKADN AAQRARDFH
Sbjct  61    PYIAAHNMILSHAAAVERFREKYQETQKGKIGILLDFVWYEPLTRSKADNLAAQRARDFH  120

Query  720   IGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKT  541
             IGWFLHPI YGEYP+TMQ IVG+RLP+FT  EV++VKGSIDY+G+NQYTTFY++DP    
Sbjct  121   IGWFLHPITYGEYPRTMQEIVGERLPKFTDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPK  180

Query  540   PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSEN  361
             P I  YQNDWNVGFAY R GVP+GPRANS WLY+VPWG+YKA+TYVKERY NP M L+EN
Sbjct  181   PNITGYQNDWNVGFAYDRKGVPVGPRANSGWLYIVPWGIYKAITYVKERYQNPTMILAEN  240

Query  360   GMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTS  181
             GMD  GN+T  ++L+D  R++Y++ YL+ LK+ VDDGANL GYFAWSLLDNFEW  GYTS
Sbjct  241   GMDDPGNVTFPQALHDATRVNYFRDYLSYLKKAVDDGANLIGYFAWSLLDNFEWLSGYTS  300

Query  180   RFGIVYVDFDTLKRYPKMSAYWFQNFLRRNK  88
             RFGIVYVD+D LKRYPKMSAYWFQ  L+R++
Sbjct  301   RFGIVYVDYDNLKRYPKMSAYWFQKLLKRDQ  331



>ref|XP_003517829.1| PREDICTED: beta-glucosidase 40-like [Glycine max]
Length=495

 Score =   523 bits (1348),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 249/480 (52%), Positives = 342/480 (71%), Gaps = 10/480 (2%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
             +++     ++R+SFP GFVFGTA+SA+Q EGA  V + GRG S+WDTF  + G   + + 
Sbjct  19    QIQICLSEINRQSFPKGFVFGTAASAFQYEGA--VKEGGRGLSVWDTFSHSFGKIQDGSN  76

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +VAV+QYHRY  D+ LM ++  DAYRFSISW+RIFPNGT  +N +G+ +YN+LIN +L 
Sbjct  77    ADVAVNQYHRYDEDVQLMKEMGMDAYRFSISWSRIFPNGTRDINQEGIDHYNKLINALLA  136

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             KGI PY  L H+DLPQALED+Y GWL   +++D+A YAE CF+ FGDRVK+W +FNEP  
Sbjct  137   KGIEPYVTLYHWDLPQALEDKYNGWLSSLIIKDFATYAEICFQKFGDRVKHWITFNEPHT  196

Query  981   VAALGYDTGFFAPGRCSNCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
              A +GYD G  APGRCS C  GNSATEPY+VAHN+++ HA+ A  YR  Y+  Q G  G+
Sbjct  197   FAMMGYDLGLEAPGRCSVCGNGNSATEPYIVAHNVLISHAIVADVYRKKYKKIQGGSIGM  256

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
              LD +W+EP T SK D  A  RA DF +GWFL P+++G+YP +M++ VG+RLP+F+  + 
Sbjct  257   SLDVMWFEPATSSKEDIEATHRALDFQLGWFLDPLIFGDYPTSMRSRVGNRLPKFSKSQA  316

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVP-IGPRANSEWL  445
              L+KGS+D+VGIN YTTFY ++  P++ Y H Y  D  V F +  NG   IG +ANS WL
Sbjct  317   SLLKGSLDFVGINHYTTFYAFN-IPRSSY-HDYIADSGV-FTFPFNGTNFIGEKANSIWL  373

Query  444   YMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAEL  271
             Y+VP G+   + Y+K  YGNP++ ++ENGMD   +  +++ ++L D KRI Y+  YL  L
Sbjct  374   YIVPHGMRNTMNYIKHTYGNPIVIVTENGMDDPNDPLISIKDALKDEKRIKYHNDYLINL  433

Query  270   K-RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLR  97
             +  + +DG N+ GYF WSLLDN+EW+ G+TSRFG+ ++D+ D LKRYPK S  WF+NFL+
Sbjct  434   QASITEDGCNVQGYFVWSLLDNWEWQSGFTSRFGLYFIDYKDNLKRYPKHSVEWFKNFLK  493



>ref|XP_009356385.1| PREDICTED: beta-glucosidase 40 [Pyrus x bretschneideri]
Length=511

 Score =   523 bits (1348),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 266/484 (55%), Positives = 337/484 (70%), Gaps = 19/484 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPSIWDTF  T G   +++  +VAVD+Y
Sbjct  30    INRGSFPKGFVFGTASSAFQYEGA--VKEDGRGPSIWDTFSHTFGKIADSSNADVAVDEY  87

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK D+  M  +  DAYRFSISWTRIFPNGTG +N  GV YYNRLI+ +L KGI PY  
Sbjct  88    HRYKEDVQRMKDMGMDAYRFSISWTRIFPNGTGHINQAGVDYYNRLIDALLAKGIEPYVT  147

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALED+Y GWL  QV++D+A YAE CF+ FGDRVK+W +FNEP   +  GYD 
Sbjct  148   LYHWDLPQALEDKYRGWLNPQVIKDFATYAEACFQNFGDRVKHWITFNEPHTFSIQGYDV  207

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+VAHN+IL H  AA  YR  Y++KQ+G  G   D
Sbjct  208   GLEAPGRCSIPLLLFCRAGNSATEPYIVAHNVILSHGTAADIYRRKYKSKQRGSVGASFD  267

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYE  T S AD  A + A+DF +GWFL P ++G+YP +M++ VG RLP F+  E  L+
Sbjct  268   VIWYESATNSTADVIATKIAQDFQLGWFLDPFMFGDYPSSMRSRVGSRLPTFSKSESALI  327

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIGPRANSEW  448
             KGS+D+VGIN YTTFY  +    T  I    ND ++  + A     ++G PIG RANS W
Sbjct  328   KGSLDFVGINHYTTFYGSN--DTTDIIGHLLND-SLADSGAITLPFKDGKPIGDRANSIW  384

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE  274
             LY+VP G+ K + Y+K++YGNPL+ ++ENGMD   +  ++L ++L DTKRI Y+  YL  
Sbjct  385   LYIVPEGMRKLMNYIKKKYGNPLVIITENGMDDPNSPFISLKDALKDTKRIKYHHDYLTN  444

Query  273   -LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
              L  + +DG N+ GYFAWSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  WF NFL
Sbjct  445   LLASIKEDGCNVKGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDQLKRYPKDSVQWFTNFL  504

Query  99    RRNK  88
                +
Sbjct  505   NSTQ  508



>ref|XP_010521462.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 266/484 (55%), Positives = 336/484 (69%), Gaps = 27/484 (6%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTAS+A+Q EGA  V + GRGPS+WDTF  T G   + +  +VAVDQY
Sbjct  28    INRASFPNGFVFGTASAAFQYEGA--VKEDGRGPSVWDTFSHTLGKIADFSNADVAVDQY  85

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY+ DI LM  +  DAYRFSISWTRIFPNGTG++N  G+ +YN+LIN +L +GI PY  
Sbjct  86    HRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGIQPYVT  145

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQAL DRY GWL  Q++ DYA YAE CF+ FGDRVK+W +FNEP   A  GYD 
Sbjct  146   LYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAIQGYDV  205

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+AKQ G  GI  D
Sbjct  206   GLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWLGIAFD  265

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP T ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG RLPRFT  E  +V
Sbjct  266   VIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTASEAAMV  325

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG---VP------IGPRA  460
             KGS+D+VGIN YTT+Y  +   KT  I T  ND     A A +G   VP      IG RA
Sbjct  326   KGSLDFVGINHYTTYYARN--NKTNLIGTLLND-----AIADSGAFTVPFKGLQTIGDRA  378

Query  459   NSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAE--SLNDTKRISYYKS  286
             NS WLY+VP G+   + Y++ RYGNP + ++ENGMD   N+ ++   +L D KRI Y+  
Sbjct  379   NSIWLYIVPQGMRNLMNYIRIRYGNPPVIITENGMDDPNNILISRENALKDEKRIRYHHD  438

Query  285   YLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWF  112
             YL+ L+  + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  WF
Sbjct  439   YLSNLQAAISEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNSVRWF  498

Query  111   QNFL  100
              +FL
Sbjct  499   TSFL  502



>ref|XP_006437961.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
 gb|ESR51201.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
Length=506

 Score =   521 bits (1343),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 332/491 (68%), Gaps = 19/491 (4%)
 Frame = -3

Query  1518  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1339
             ++  +  ++R SFP GFVFGTASSA+Q EGA  V + GRGP++WDTF  T G   +N+  
Sbjct  21    IQTCSSQINRASFPKGFVFGTASSAFQYEGA--VKEDGRGPTVWDTFSHTFGKILDNSNA  78

Query  1338  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1159
             +VAVDQYHRY  D+ LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN+LI+ +L K
Sbjct  79    DVAVDQYHRYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAK  138

Query  1158  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  979
             GI PY  L H+DLPQAL+D+Y GWL RQ++ D+A YAE CF+ FGDRVK+W +FNEP   
Sbjct  139   GIEPYVTLYHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTF  198

Query  978   AALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
                GYD G  APGRCS      C  GNSATEPY+VAHN +L HA  A  YR  Y+AKQ G
Sbjct  199   TIQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGG  258

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
               GI  D +WYE  + S  D  A QRA+DF +GWFL P+++G+YP +M+N VG RLPRFT
Sbjct  259   SLGIAFDVIWYESASNSTEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFT  318

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIG  469
               E  L+KGS+D+VGIN YTTFY       T  I    ND ++  A A     +NG PI 
Sbjct  319   SSEAALLKGSLDFVGINHYTTFYA--QRNATNLIGVVLND-SLADAGALTIPFKNGKPIA  375

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISY  295
              RANS WLY+VP G+   + Y+K++Y NP + ++ENGMD   N    + E+L D KRI Y
Sbjct  376   DRANSIWLYIVPRGMRSLMNYIKQKYRNPTVIITENGMDDPNNRFTPIKEALKDDKRIKY  435

Query  294   YKSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSA  121
             +  YL  L   + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D  KRYPK S 
Sbjct  436   HNDYLTNLLAAIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNQKRYPKNSV  495

Query  120   YWFQNFLRRNK  88
              WF+NFL   K
Sbjct  496   QWFKNFLNSTK  506



>ref|XP_011012221.1| PREDICTED: beta-glucosidase 40 [Populus euphratica]
Length=508

 Score =   521 bits (1343),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 259/489 (53%), Positives = 335/489 (69%), Gaps = 17/489 (3%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
              ++ +   ++R SFP GFVFGTASSA+Q EGA  V   GRGPS+WD F  T G   + + 
Sbjct  19    EIQTSLSQINRASFPEGFVFGTASSAFQYEGA--VKADGRGPSVWDAFSHTFGKIIDFSN  76

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +VAVDQYH +  DI LM  +  DAYRFSISW+RI+PNGTGK+N  GV +YN+ IN +L 
Sbjct  77    ADVAVDQYHLFDEDIKLMKDMGMDAYRFSISWSRIYPNGTGKINQAGVDHYNKFINALLA  136

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             +GI PY  L H+DLPQAL+DRY GWL  Q+++D+A +AE CF+I+GDRVK+W +FNEP  
Sbjct  137   QGIEPYVTLYHWDLPQALQDRYNGWLSPQIIKDFATFAETCFEIYGDRVKHWITFNEPHT  196

Query  981   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
             VA  GYD G  APGRCS      C  GNSATEPY+VAHN++L H  AA  YR  Y+AKQ+
Sbjct  197   VAIQGYDVGLQAPGRCSIFLHIFCRAGNSATEPYIVAHNILLSHGTAADIYRKKYKAKQR  256

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             G  GI LD +W+EP T +  D  AAQRA+DF +GWF+ P++ G YP TM+N VGDRLP F
Sbjct  257   GSLGISLDVIWFEPATNTTNDTEAAQRAQDFQLGWFIEPLILGNYPITMRNRVGDRLPNF  316

Query  636   TPDEVKLVKGSIDYVGINQYTTFY------VYDPYPKTPYIHTYQNDWNVGFAYARNGVP  475
             T ++V LVKGS D+VGIN YTTFY      ++          +  +   +   +  N  P
Sbjct  317   TENDVALVKGSFDFVGINHYTTFYARSNDSLFGDLIGKVLNDSLADSGAITLPFGENLKP  376

Query  474   IGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN-LT-LAESLNDTKRI  301
             IG RA+S WLY+VP G+   + Y++++YGNP + ++ENGMD   N LT + ++L D KRI
Sbjct  377   IGDRASSIWLYIVPRGMRSLMNYIRQKYGNPPVIITENGMDDPNNALTPIKDALKDEKRI  436

Query  300   SYYKSYLAE-LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKM  127
              Y+K YLA  L  + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK 
Sbjct  437   KYHKDYLASLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKD  496

Query  126   SAYWFQNFL  100
             S  WF+ FL
Sbjct  497   SVQWFKKFL  505



>ref|XP_004985214.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   521 bits (1342),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 258/488 (53%), Positives = 334/488 (68%), Gaps = 16/488 (3%)
 Frame = -3

Query  1512  FNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             +  G L+R SFP GFVFGTA+SAYQ EGA  V + GRG +IWDTF  T G   + +  +V
Sbjct  27    YGGGELTRGSFPEGFVFGTAASAYQYEGA--VKEDGRGQTIWDTFAHTLGKISDFSNADV  84

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYHR++ DI+LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LI+ +L K I
Sbjct  85    AVDQYHRFEDDIELMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKLIDALLSKEI  144

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PY  L H+DLPQALEDRY GWL R +VED+A YAE CFK FGDRVK+W + NEP  VA 
Sbjct  145   EPYVTLYHWDLPQALEDRYKGWLNRTIVEDFAVYAETCFKAFGDRVKHWITLNEPHTVAT  204

Query  972   LGYDTGFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
             +GYDTG  APGRCS     +C  G+S TEPY+V HN IL HA  A  YR  Y+A Q+G+ 
Sbjct  205   MGYDTGLEAPGRCSVLLHLHCRSGDSHTEPYIVGHNFILAHATVADIYRRKYKATQRGQL  264

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GI L+ VWYEP+T ++ D  AA+RA++F +GWF  P  +G+YP++M+  +GDRLP+FT D
Sbjct  265   GIALNVVWYEPMTNTRTDIEAAKRAQEFQLGWFADPFFFGDYPESMRARIGDRLPKFTAD  324

Query  627   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARN-----GVPIGPR  463
             E  LVKGS+D+VGIN YTT Y  D    +        D  +    A +       P G R
Sbjct  325   EAALVKGSLDFVGINHYTTHYTMDSNTVSSTAMGLLLDGTMADTGAVSVPFDIKNPTGDR  384

Query  462   ANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYK  289
             ANS WLY+VPWG+ K + YVKERY +P ++++ENGMD   N  +   E+L D+KRI Y+ 
Sbjct  385   ANSLWLYIVPWGMRKVMNYVKERYKSPPVYITENGMDDSNNPLIPKEEALKDSKRIKYHH  444

Query  288   SYLAEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFD-TLKRYPKMSAYW  115
              YL  L   + +DG ++ GYF WSLLDN+EW  GYTSRFG+ +VD++  L+R PK S  W
Sbjct  445   DYLTNLAASIKEDGCDVRGYFVWSLLDNWEWIAGYTSRFGLYFVDYENNLERCPKSSVQW  504

Query  114   FQNFLRRN  91
             F+  LR +
Sbjct  505   FKTLLRSS  512



>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
 pdb|3GNP|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-Glucosidase 
With Octyl-Beta- D-Thio-Glucoside
 pdb|3GNR|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase 
With Covalently Bound 2-deoxy-2-fluoroglucoside To The Catalytic 
Nucleophile E396
Length=488

 Score =   520 bits (1340),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 259/483 (54%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  10    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  67

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  68    QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  127

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  128   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  187

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  188   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  247

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  248   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  307

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG RANS
Sbjct  308   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  364

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYL  280
              WLY+VP G+   + YVKERY +P ++++ENGMD   N  +++ ++L D+KRI Y+  YL
Sbjct  365   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  424

Query  279   AEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQN  106
               L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+ 
Sbjct  425   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKA  484

Query  105   FLR  97
              L+
Sbjct  485   LLK  487



>dbj|BAK07108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   519 bits (1337),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 305/393 (78%), Gaps = 6/393 (2%)
 Frame = -3

Query  1260  FSISWTRIF---PNGTGKVNWKGVAYYNRLINYMLEKGITPYANLNHYDLPQALEDRYGG  1090
             FS+ +T  F    +G GKVN +GV YYN LI+Y++++G+TPY NLNHYD+P AL+ +Y G
Sbjct  15    FSVCFTDAFWFDSDGEGKVNKEGVTYYNNLIDYVIKQGLTPYVNLNHYDIPLALQKKYDG  74

Query  1089  WLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSNCTQG-N  913
             +L  ++V  +ADYAEFCFK +GDR+KNWF+FNEPR+VAALG+DTG   P RC+ C  G N
Sbjct  75    FLSPKIVNIFADYAEFCFKTYGDRIKNWFTFNEPRIVAALGFDTGTNPPNRCTKCAAGGN  134

Query  912   SATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDFVWYEPLTRSKADNYAAQRA  733
             SATEPY V HN++LCHA A  RYR  YQA QKG+ GI+LDF WY+  T S AD  AAQRA
Sbjct  135   SATEPYTVVHNILLCHATAVARYRNKYQASQKGKVGIVLDFNWYDAATDSPADKAAAQRA  194

Query  732   RDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-  556
             RDFH+GWFL P++ G+YPKTMQ+IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D 
Sbjct  195   RDFHVGWFLDPLLNGQYPKTMQDIVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQ  254

Query  555   PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLM  376
             P  + P   +Y +DW+V + + RNGVPIG +ANS WLY+VP G+Y  V Y++E+Y NP +
Sbjct  255   PTLQQPPT-SYSSDWHVQYIFQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTI  313

Query  375   FLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWR  196
              +SENGMD   NLT  E L+D  R+ +YK+YLAELK+ +DDGAN+ GYFAWSLLDNFEW 
Sbjct  314   IISENGMDQPANLTREEFLHDASRVEFYKTYLAELKKAIDDGANVVGYFAWSLLDNFEWL  373

Query  195   IGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFLR  97
              GYTS+FGIVYVDF TLKRYPK SAYWF+N L+
Sbjct  374   SGYTSKFGIVYVDFTTLKRYPKDSAYWFKNMLQ  406



>ref|XP_006484173.1| PREDICTED: beta-glucosidase 40-like [Citrus sinensis]
Length=506

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 331/491 (67%), Gaps = 19/491 (4%)
 Frame = -3

Query  1518  VRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATG  1339
             ++  +  ++R SFP GFVFGTASSA+Q EGA  V + GRGP++WDTF  T G   +N+  
Sbjct  21    IQTCSSQINRASFPKGFVFGTASSAFQYEGA--VKEDGRGPTVWDTFSHTFGKILDNSNA  78

Query  1338  EVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEK  1159
             +VAVDQYHRY  D+ LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN+LI+ +L K
Sbjct  79    DVAVDQYHRYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAK  138

Query  1158  GITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVV  979
             GI PY  L H+DLPQAL+D+Y GWL RQ++ D+A YAE CF+ FGDRVK+W +FNEP   
Sbjct  139   GIEPYVTLYHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTF  198

Query  978   AALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKG  814
                GYD G  APGRCS      C  GNSATEPY+VAHN +L HA  A  YR  Y+AKQ G
Sbjct  199   TIQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGG  258

Query  813   RFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFT  634
               GI  D +WYE  + S  D  A QRA+DF +GWFL P+++G+YP +M+N VG RLPRFT
Sbjct  259   SLGIAFDVIWYESASNSTEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFT  318

Query  633   PDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIG  469
               E  L+KGS+D+VGIN YTTFY       T  I    ND ++  A A     +NG PI 
Sbjct  319   SSEAALLKGSLDFVGINHYTTFYA--QRNATNLIGVVLND-SLADAGALTIPFKNGKPIA  375

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISY  295
              RANS WLY+VP G+   + Y+K++Y NP + ++ENGMD   N      E+L D KRI Y
Sbjct  376   DRANSIWLYIVPRGMRSLMNYIKQKYRNPTVIITENGMDDPNNRFTPTKEALKDDKRIKY  435

Query  294   YKSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSA  121
             +  YL  L   + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D  KRYPK S 
Sbjct  436   HNDYLTNLLAAIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNQKRYPKNSV  495

Query  120   YWFQNFLRRNK  88
              WF+NFL   K
Sbjct  496   QWFKNFLNSTK  506



>ref|XP_003607794.1| Beta-glucosidase [Medicago truncatula]
 gb|AES89991.1| beta-glucosidase [Medicago truncatula]
Length=505

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 333/483 (69%), Gaps = 12/483 (2%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             +  +SR +FP GF+FGTASSA+Q EGA  V + GRGPS+WDTF  T G   + +  +VAV
Sbjct  25    SAEISRANFPHGFIFGTASSAFQYEGA--VKEDGRGPSVWDTFSHTFGKVTDFSNADVAV  82

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             DQYHRY+ DI LM  L  DAYRFSISW+RI+PNG+G +N  G+ +YN+ IN +L KGI P
Sbjct  83    DQYHRYEEDIQLMKDLGMDAYRFSISWSRIYPNGSGAINQAGIDHYNKFINALLAKGIEP  142

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             Y  L H+DLPQAL+D+Y GWL   +++D+A YAE CF+ FGDRVK+W +FNEP      G
Sbjct  143   YVTLYHWDLPQALDDKYKGWLSTDIIKDFATYAETCFQKFGDRVKHWITFNEPHTFTTQG  202

Query  966   YDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGI  802
             YD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+  Q G  GI
Sbjct  203   YDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLTHAAVADIYRKKYKNTQGGSLGI  262

Query  801   LLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEV  622
               D +WYEP T +K D  AAQRA+DF +GWFL P+++G+YP +M++ VG+RLP+F+  E 
Sbjct  263   AFDVIWYEPATNTKEDIAAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSSSEA  322

Query  621   KLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVG-FAYARNGV-PIGPRANSEW  448
              LVKGS+D+VGIN YTTFY  +       I  + +  + G      NG   I  RANS W
Sbjct  323   ALVKGSLDFVGINHYTTFYARNNSTNLIGILLHDSIADSGAITLPFNGTKAIAERANSIW  382

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLA--ESLNDTKRISYYKSYLAE  274
             LY+VP  +   + Y+K++YGNP +F++ENGMD   N+ ++  ++L D KRI Y+  YL+ 
Sbjct  383   LYIVPQSMRTLMNYIKQKYGNPPVFITENGMDDPNNIFISKKDALKDEKRIRYFSGYLSY  442

Query  273   LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLR  97
             L+  + DG N+ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+NFL+
Sbjct  443   LQASIKDGCNVKGYFAWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKQSVQWFKNFLK  502

Query  96    RNK  88
               K
Sbjct  503   PAK  505



>ref|XP_008644530.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=523

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 259/481 (54%), Positives = 328/481 (68%), Gaps = 20/481 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+R SFP GFVFGTA++AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQY
Sbjct  45    LTRGSFPKGFVFGTAAAAYQYEGA--VKTDGRGQTIWDTFAHTFGKISDFSNADVAVDQY  102

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HR++ D+ LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN +L KGI PY  
Sbjct  103   HRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVT  162

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALEDRY GWL RQ+V D+A YAE CFK FGDRVK+W + NEP  VA  GYD 
Sbjct  163   LYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDA  222

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNS TEPY+VAHN IL HA  +  YR  Y+A Q G  GI  D
Sbjct  223   GLHAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILAHATVSDMYRRKYKAAQNGELGIAFD  282

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP+T S  D  A +RA++F +GWF  P  +G+YP TM+  VG+RLP+FT DE  LV
Sbjct  283   VIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKFTADEAALV  342

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANSEW  448
             KG++D++GIN YTTFY    +  T  I    ND       +   + +NG PIG RANS W
Sbjct  343   KGALDFMGINHYTTFYTR--HNDTNIIGRLLNDTLADTGTISLPFDKNGKPIGDRANSIW  400

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN---LTLAESLNDTKRISYYKSYLA  277
             LY+VP G+ K + YVKERY +P ++++ENGMD  GN    +L  +L D+KRI Y+  YL 
Sbjct  401   LYIVPSGIRKLMNYVKERYNSPTVYITENGMD-DGNSPFTSLQNALKDSKRIKYHNGYLN  459

Query  276   EL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNF  103
              +   + +DG ++ GYFAWSLLDN+EW  GYTSRFG+ +VD+ D LKR+PK S  WF+  
Sbjct  460   NVAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRHPKNSVQWFKTL  519

Query  102   L  100
             L
Sbjct  520   L  520



>ref|XP_007045907.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
 gb|EOY01739.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
Length=506

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 260/480 (54%), Positives = 334/480 (70%), Gaps = 19/480 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             +SR SFP GFVFGTASS++Q EGA  V + GRGP+IWD F  T G   + +  +VAVDQY
Sbjct  29    ISRASFPKGFVFGTASSSFQYEGA--VKEDGRGPTIWDKFSHTFGKIIDGSNADVAVDQY  86

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY  DI LM  +  DAYRFSI+W+RIFPNGTG++N  GV +YN LIN +L KGI PY  
Sbjct  87    HRYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIEPYVT  146

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALEDRY GWL  Q+++D+A +AE CF+IFGDRVK+W +FNEP      GYD 
Sbjct  147   LYHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQGYDV  206

Query  957   GFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+AKQ G  G+  D
Sbjct  207   GLQAPGRCSIILRLICKAGNSATEPYIVAHNVLLSHATVADIYRKKYKAKQHGSVGVSFD  266

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP T S  +  AAQRA+DF +GWFL P+++G+YP +M + VG+RLPRF+  E  L+
Sbjct  267   VMWYEPETNSTENTEAAQRAQDFQLGWFLDPLIFGDYPSSMISRVGNRLPRFSKAESALL  326

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIGPRANSEW  448
             KGS+D+VGIN YTT+Y       T  + T  ND ++  + A     +NG PIG +ANS W
Sbjct  327   KGSLDFVGINHYTTYYAR--ANATNALGTILND-SIADSGAFTAPFKNGKPIGDKANSIW  383

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNL--TLAESLNDTKRISYYKSYLAE  274
             LY+VP G+   + Y+KE+YGNP + ++ENGMD   ++  ++ ++L D KRI Y+  YL  
Sbjct  384   LYIVPSGMRSLMNYIKEKYGNPPVIITENGMDDSNSIFNSIKDALKDEKRIKYHNDYLTN  443

Query  273   LKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
             L   + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRY K S  WF+NFL
Sbjct  444   LLAAIKEDGCNVKGYFVWSLLDNWEWGAGYTSRFGLYFVDYKDNLKRYAKDSVQWFKNFL  503



>ref|NP_001049358.1| Os03g0212800 [Oryza sativa Japonica Group]
 sp|Q8L7J2.1|BGL06_ORYSJ RecName: Full=Beta-glucosidase 6; Short=Os3bglu6; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAN01354.1| beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF94615.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11272.1| Os03g0212800 [Oryza sativa Japonica Group]
 dbj|BAG99682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 259/483 (54%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  43    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  100

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  101   QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  160

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  161   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  220

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  221   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  280

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  281   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  340

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG RANS
Sbjct  341   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  397

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYL  280
              WLY+VP G+   + YVKERY +P ++++ENGMD   N  +++ ++L D+KRI Y+  YL
Sbjct  398   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  457

Query  279   AEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQN  106
               L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+ 
Sbjct  458   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKA  517

Query  105   FLR  97
              L+
Sbjct  518   LLK  520



>pdb|3WBE|A Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant In A Covalent 
Complex With Glc From Ga4ge.
Length=489

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  11    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  68

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  69    QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  128

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + N+P  VA  GY
Sbjct  129   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGY  188

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  189   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  248

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  249   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  308

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG RANS
Sbjct  309   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  365

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYL  280
              WLY+VP G+   + YVKERY +P ++++ENGMD   N  +++ ++L D+KRI Y+  YL
Sbjct  366   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  425

Query  279   AEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQN  106
               L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+ 
Sbjct  426   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKA  485

Query  105   FLR  97
              L+
Sbjct  486   LLK  488



>pdb|3WBA|A Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl Moiety From 
P-nitrophenyl Glucopyranoside.
Length=489

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  11    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  68

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  69    QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  128

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + N+P  VA  GY
Sbjct  129   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGY  188

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  189   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  248

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  249   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  308

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG RANS
Sbjct  309   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  365

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYL  280
              WLY+VP G+   + YVKERY +P ++++ENGMD   N  +++ ++L D+KRI Y+  YL
Sbjct  366   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  425

Query  279   AEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQN  106
               L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+ 
Sbjct  426   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKA  485

Query  105   FLR  97
              L+
Sbjct  486   LLK  488



>ref|XP_010109366.1| Beta-glucosidase 40 [Morus notabilis]
 gb|EXC22071.1| Beta-glucosidase 40 [Morus notabilis]
Length=500

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 336/477 (70%), Gaps = 17/477 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTASSAYQ EGA  V + GRGPS+WDTF  T G   + +  +VAVDQY
Sbjct  27    INRGSFPKGFVFGTASSAYQYEGA--VKEDGRGPSVWDTFAHTFGKIIDLSNADVAVDQY  84

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY+ D+ LM  +  DAYRFSISW+RIFPNGTG++N  GV YYN+LIN +L KGI PY  
Sbjct  85    HRYEEDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDYYNKLINALLAKGIEPYVT  144

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALED+Y GWL RQV++D+A +AE CF+ FGDRVK+W +FNE   VA  GYD 
Sbjct  145   LYHWDLPQALEDKYKGWLDRQVIKDFALFAETCFQQFGDRVKHWITFNEAYTVAVQGYDV  204

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNS+TEPY+V HN++L HAVA   YR  Y++KQKG  G+   
Sbjct  205   GLQAPGRCSILLHLLCRAGNSSTEPYIVGHNILLSHAVAVDIYRKKYKSKQKGSIGMSQS  264

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +W+ P + S AD  AAQRA+DF +GWFL P+++G+YP  M+ +VG+RLP F+  E  L+
Sbjct  265   VIWFIPASNSTADIEAAQRAQDFQLGWFLDPLMFGDYPSAMRKLVGNRLPTFSKSESALL  324

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPY--IHTYQNDWNVGFAYARNGVPIGPRANSEWLYM  439
             KGS D+VGIN YTTFY ++    T Y    TYQ+   +   + RN  PI  +A+S WLY+
Sbjct  325   KGSFDFVGINHYTTFYAFNV---TLYGLNDTYQDSAALTTPF-RNFKPIADKASSIWLYI  380

Query  438   VPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAE-LK  268
             VP G+   + Y+K++YGNP + ++ENGMD   N+   L ++L D KRI Y+  YL   L 
Sbjct  381   VPEGMRHLMNYIKQKYGNPPVIITENGMDDPNNILIPLKQALKDEKRIKYHNDYLTNLLA  440

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
              + +DG N+ GYF WSLLDN+EW  G+TSRFG+ +VD+ D LKRYPK SA WF+NFL
Sbjct  441   SIKEDGCNVKGYFVWSLLDNWEWAAGFTSRFGLYFVDYNDKLKRYPKDSAKWFKNFL  497



>ref|XP_004505367.1| PREDICTED: beta-glucosidase 40-like [Cicer arietinum]
Length=499

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 254/480 (53%), Positives = 332/480 (69%), Gaps = 10/480 (2%)
 Frame = -3

Query  1506  TGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAV  1327
             +  +SR  FP GF FGTA+SA+Q EGA  V + GRGPS+WDTF  T G   + +  +VAV
Sbjct  23    SAAISRADFPNGFQFGTATSAFQYEGA--VKEDGRGPSVWDTFSHTFGKISDFSNADVAV  80

Query  1326  DQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITP  1147
             D YHRY+ DI LM  L  DAYRFSISW+RIFP+G+G++N  GV +YN++IN +L  GI P
Sbjct  81    DHYHRYEEDIQLMKDLGVDAYRFSISWSRIFPSGSGQINQAGVDHYNKVINSLLANGIEP  140

Query  1146  YANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALG  967
             Y  L H+DLPQALED+Y GWL  ++++D++ YAE CF+ FGDRVK+W +FNEP      G
Sbjct  141   YVTLYHWDLPQALEDKYTGWLSTEIIKDFSTYAETCFQKFGDRVKHWMTFNEPHTFTTQG  200

Query  966   YDTGFFAPGRCSN--CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             YD G  APGRCS   C  GNS TEPY+VAHN++L HA  A  YR  Y+  Q G  GI  +
Sbjct  201   YDLGIQAPGRCSILFCRAGNSTTEPYIVAHNVLLSHAAVADIYRKKYKNIQGGSLGIAFN  260

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP T ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG+RLP+F+P E  LV
Sbjct  261   VIWYEPATNTQKDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSPSEAALV  320

Query  612   KGSIDYVGINQYTTFYVYDPYPK-TPYIHTYQNDWNVGFAYARNGV-PIGPRANSEWLYM  439
             KGS+D+VGIN YTTFY  D        +H+   D     A   NG  PIG +ANS WLY+
Sbjct  321   KGSLDFVGINHYTTFYARDNSTNLLGALHSAIADSGT-IALPFNGTKPIGEKANSIWLYI  379

Query  438   VPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKR  265
             VP  +   + Y+K++YGNP +F++ENGMD   +  + + ++L D KRI YY  YL+ L  
Sbjct  380   VPQSMRTLMNYIKQKYGNPPVFITENGMDDPNSIYIPIKDALKDEKRIRYYNGYLSYLLA  439

Query  264   VVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLRRNK  88
              + DG N+ GYFAWSLLDN+EW  GYTSRFG+ Y+D+ D LKRYPK S  WF+NFL+  K
Sbjct  440   SIKDGCNVKGYFAWSLLDNWEWSSGYTSRFGLFYIDYRDNLKRYPKQSVQWFKNFLKPTK  499



>gb|EEC74750.1| hypothetical protein OsI_10506 [Oryza sativa Indica Group]
Length=521

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  43    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  100

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  101   QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  160

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  161   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  220

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  221   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  280

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  VG+RLPRFT DE  
Sbjct  281   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAA  340

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             +VKG++D+VG+N YTT+Y    +  T  I T  N+       V   + +NG PIG RANS
Sbjct  341   VVKGALDFVGVNHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  397

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYL  280
              WLY+VP G+   + YVKERY +P ++++ENGMD   N  +++ ++L D+KRI Y+  YL
Sbjct  398   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  457

Query  279   AEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQN  106
               L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+ 
Sbjct  458   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKA  517

Query  105   FLR  97
              L+
Sbjct  518   LLK  520



>gb|EEE58575.1| hypothetical protein OsJ_09895 [Oryza sativa Japonica Group]
Length=521

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = -3

Query  1503  GGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVD  1324
             GGL+R SFP GFVFGTAS+AYQ EGA  V + GRG +IWDTF  T G   + +  +VAVD
Sbjct  43    GGLTRGSFPEGFVFGTASAAYQYEGA--VKEDGRGQTIWDTFAHTFGKITDFSNADVAVD  100

Query  1323  QYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPY  1144
             QYHR++ DI LM  +  DAYRFSI+W+RI+PNG G+VN  G+ +YN+LI+ +L KGI PY
Sbjct  101   QYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPY  160

Query  1143  ANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGY  964
               L H+DLPQALED+Y GWL RQ+V+D+A YAE CF+ FGDRVK+W + NEP  VA  GY
Sbjct  161   VTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGY  220

Query  963   DTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGIL  799
             D G  APGRCS      C  GNS TEPYVVAH+ IL HA AA  YR  Y+A Q G+ GI 
Sbjct  221   DAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIA  280

Query  798   LDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVK  619
              D +W+EP++ +  D  AA+RA++F +GWF  P  +G+YP TM+  +G+RLPRFT DE  
Sbjct  281   FDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARLGERLPRFTADEAA  340

Query  618   LVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANS  454
             +VKG++D+VGIN YTT+Y    +  T  I T  N+       V   + +NG PIG RANS
Sbjct  341   VVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPIGDRANS  397

Query  453   EWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYL  280
              WLY+VP G+   + YVKERY +P ++++ENGMD   N  +++ ++L D+KRI Y+  YL
Sbjct  398   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  457

Query  279   AEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQN  106
               L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYPK S  WF+ 
Sbjct  458   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKA  517

Query  105   FLR  97
              L+
Sbjct  518   LLK  520



>ref|XP_008389423.1| PREDICTED: beta-glucosidase 40-like [Malus domestica]
Length=511

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 331/481 (69%), Gaps = 13/481 (3%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPSIWDTF  T G   +++  +VAVD+Y
Sbjct  30    INRGSFPKGFVFGTASSAFQYEGA--VKEDGRGPSIWDTFSHTFGKIADSSNADVAVDEY  87

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRYK D+  M  +  DAYRFSISWTRIFPNGTG +N  GV YYNRLI+ +L KGI PY  
Sbjct  88    HRYKEDVQRMKDMGMDAYRFSISWTRIFPNGTGHINQAGVDYYNRLIDALLAKGIEPYVT  147

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALED+Y GWL  QV++D+A YA+ CF+ FGDRVK+W +FNEP   +  GYD 
Sbjct  148   LYHWDLPQALEDKYSGWLNPQVIKDFATYADACFQNFGDRVKHWITFNEPHTFSIQGYDV  207

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+VAHN+IL H  AA  YR  Y++KQ+G  G   D
Sbjct  208   GLEAPGRCSIPLFLFCRAGNSATEPYMVAHNVILSHGTAADIYRRKYKSKQRGSVGASFD  267

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYE  T S AD  A + A+DF +GWFL P ++G+YP +M++ VG RLP F+  E  L+
Sbjct  268   VIWYESATNSTADVXATKIAQDFQLGWFLDPFMFGDYPSSMRSRVGSRLPTFSKSESALI  327

Query  612   KGSIDYVGINQYTTFYVYDPYPKT--PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYM  439
             KGS+D+VGIN YTTFY  +         ++    D        ++G PIG RANS WLY+
Sbjct  328   KGSLDFVGINHYTTFYGSNDTADIIGHLLNDSLADSGAITLPFKDGKPIGDRANSIWLYI  387

Query  438   VPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE-LK  268
             VP G+ K + Y+K++YGNPL+ ++ENGMD   +  ++L ++L DTKRI Y+  YL   L 
Sbjct  388   VPEGMRKLMNYIKKKYGNPLVIITENGMDDPNSPFISLKDALKDTKRIKYHHDYLKNLLA  447

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFLRRN  91
              + +DG N+ GYFAWSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  WF  FL   
Sbjct  448   SIKEDGCNVKGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFTXFLNST  507

Query  90    K  88
             +
Sbjct  508   Q  508



>gb|KFK44575.1| hypothetical protein AALP_AA1G275600 [Arabis alpina]
Length=501

 Score =   517 bits (1331),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 257/477 (54%), Positives = 328/477 (69%), Gaps = 13/477 (3%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             +SR SFP GFVFGTASSA+Q EGA  V   GRGP+IWDTF  T GL  + +  +VAVDQY
Sbjct  23    ISRGSFPNGFVFGTASSAFQHEGA--VKAEGRGPTIWDTFSHTFGLITDFSNADVAVDQY  80

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HRY+ D+ LM  +  DAYRFSISWTRIFPNG G++N  G+ +YN+LIN +L KGI PY  
Sbjct  81    HRYEEDVQLMKNMGMDAYRFSISWTRIFPNGVGQINEAGIDHYNKLINALLAKGIEPYVT  140

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQAL DRY GWL  Q++ D+A YAE CF+ FGDRVK+W +FNEP   A  GYD 
Sbjct  141   LYHWDLPQALHDRYLGWLNPQIINDFAAYAELCFQRFGDRVKHWITFNEPHTFAIQGYDV  200

Query  957   GFFAPGRCS-----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRC+      C  GNS+TEPY+V HN+IL HA  +  YR  Y+AKQ G  GI  D
Sbjct  201   GLQAPGRCTILFKLTCRAGNSSTEPYIVGHNVILTHATVSNIYRKNYKAKQGGSLGIAFD  260

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP +    D  AAQRA+DF +GWFL P+++G+YP +M++ VG RLP FT  +  LV
Sbjct  261   VMWYEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGSQPALV  320

Query  612   KGSIDYVGINQYTTFYVYDPYPKT--PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYM  439
             KGS+D+VGIN YTT+Y  +         +H   +D        +    IG RANS WLY+
Sbjct  321   KGSLDFVGINHYTTYYARNNATNLIGTLLHDAISDSGTVTLPFKGLSTIGDRANSIWLYI  380

Query  438   VPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLA--ESLNDTKRISYYKSYLAELK-  268
             VP G+   + Y+K RYGNP +F++ENGMD   ++ ++  E+L DTKRI Y+  YL+ L+ 
Sbjct  381   VPRGMRSLMNYIKHRYGNPPVFITENGMDDPNSILISRKEALKDTKRIRYHHDYLSSLQA  440

Query  267   RVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
              + +DG N+ GYF WSLLDN+EW  GY+SRFG+ +VDF D LKRYPK S +WF +FL
Sbjct  441   SIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDFRDKLKRYPKDSVHWFTSFL  497



>ref|XP_007224102.1| hypothetical protein PRUPE_ppa015619mg [Prunus persica]
 gb|EMJ25301.1| hypothetical protein PRUPE_ppa015619mg [Prunus persica]
Length=516

 Score =   517 bits (1331),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 332/480 (69%), Gaps = 19/480 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPS WDTF  T G   + +  +VAVDQY
Sbjct  39    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPSTWDTFSHTFGKISDFSNADVAVDQY  96

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             H Y  D+ LM  +  DAYRFSISW+RIFPNGTG++N  GV +YN LIN +L KGI PY  
Sbjct  97    HLYNGDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDHYNNLINSLLAKGIEPYVT  156

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALED+Y GWL  Q+++DYA YA+ CF+ FGDRVK+W +FNEP   +  GYD 
Sbjct  157   LYHWDLPQALEDKYNGWLNPQIIKDYATYADTCFQKFGDRVKHWITFNEPHTFSIQGYDV  216

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+V HN+IL HA  A  YR  Y++KQ G  G   D
Sbjct  217   GLQAPGRCSILLHLFCRAGNSATEPYIVGHNVILSHATVADIYRRKYKSKQHGSVGASFD  276

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP T S AD  AA+RA+DF +GWFL P ++G+YP +M++ VG RLP F+  E  L+
Sbjct  277   VIWYEPETNSTADVEAAKRAQDFQLGWFLEPFIFGDYPSSMRSRVGSRLPTFSKSEAALL  336

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA-----RNGVPIGPRANSEW  448
             KGS+D+VGIN YTTFY  +    T +I    ND ++  + A     +NG PIG RANS W
Sbjct  337   KGSLDFVGINHYTTFYARN--DTTDFIGGLLND-SLADSGAITLPFKNGKPIGDRANSIW  393

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE  274
             LY+VP G+ K + Y+K +YGNP + ++ENGMD   +  ++L ++L D KRI Y+  YL  
Sbjct  394   LYIVPEGMRKLMNYIKHKYGNPPVIITENGMDDPNSPFISLKDALKDAKRIKYHHGYLTN  453

Query  273   -LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
              L  + +DG N+ GYFAWSLLDN+EW  G++SRFG+ +VD+ D LKRYPK S  WF NFL
Sbjct  454   LLASIKEDGCNVKGYFAWSLLDNWEWAAGFSSRFGLYFVDYKDKLKRYPKDSVQWFTNFL  513



>ref|XP_011018305.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Populus euphratica]
Length=507

 Score =   516 bits (1330),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 257/481 (53%), Positives = 330/481 (69%), Gaps = 17/481 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPS+WD F  T G   + +  +VAVDQ+
Sbjct  26    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPSVWDKFSHTFGKIIDFSNADVAVDQF  83

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             H +  DI LM  +  DAYRFSISWTRI+PNGTGK+N  GV +Y + IN +L +GI PY  
Sbjct  84    HHFDEDIKLMKDMGMDAYRFSISWTRIYPNGTGKINQAGVDHYKKFINALLAQGIEPYVT  143

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQAL DRY GWL  Q+++D+A +AE CF+ +GDRVKNW +FNEP  V+  GYD 
Sbjct  144   LFHWDLPQALHDRYSGWLSPQIIKDFATFAETCFQNYGDRVKNWITFNEPHTVSIQGYDV  203

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+VAHN++L H  AA  YR  Y+AKQ+G  GI LD
Sbjct  204   GLQAPGRCSILLHLFCRAGNSATEPYIVAHNMLLSHGAAADIYRKKYKAKQQGSVGISLD  263

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +W+EP T S  D  AAQRA+DF +GWF+ P++ G+YP +M+N VGDRLP+FT ++  LV
Sbjct  264   VIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNRVGDRLPKFTKNDAALV  323

Query  612   KGSIDYVGINQYTTFYV-YDPYPKTPYIHTYQND-----WNVGFAYARNGVPIGPRANSE  451
             KGS+D+VGIN YTTFY   +       I    ND       +   +  N  PIG RANS 
Sbjct  324   KGSLDFVGINHYTTFYARSNDSLLGDVIDKVLNDSVADSGAITLPFGENKKPIGDRANSI  383

Query  450   WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN-LT-LAESLNDTKRISYYKSYLA  277
             WLY+VP G+   + +++++YGNP + ++ENGMD   N LT + ++L D KRI Y+  YL 
Sbjct  384   WLYIVPQGMRSLMNHIRQKYGNPPVIITENGMDDPNNALTPIKDALKDRKRIRYHNDYLT  443

Query  276   E-LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNF  103
               L  + +DG N+ GYF WSLLDN+EW  GYTSR G+ +VD+ D LKRYPK SA WF+ F
Sbjct  444   NLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRLGLCFVDYKDKLKRYPKDSAQWFKKF  503

Query  102   L  100
             L
Sbjct  504   L  504



>ref|XP_003556662.1| PREDICTED: beta-glucosidase 40 [Glycine max]
Length=503

 Score =   516 bits (1329),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 257/490 (52%), Positives = 334/490 (68%), Gaps = 16/490 (3%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
              ++  +  ++R +FP GFVFGTASSA+Q EGA  V + GRGPS+WDTF  T G   + + 
Sbjct  18    EIQICSSEINRGNFPNGFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHTFGKIIDFSN  75

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +VAVDQYHRY+ DI LM  +  DAYRFSISW+RIFPNG G++N  GV +YN+LIN +L 
Sbjct  76    ADVAVDQYHRYEEDIQLMKDMGMDAYRFSISWSRIFPNGYGQINQAGVDHYNKLINALLA  135

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             KGI PY  L H+DLPQALE++Y GWL   ++ D+A YAE CF+ FGDRVK+W +FNEP  
Sbjct  136   KGIEPYVTLYHWDLPQALENKYSGWLNASIIMDFATYAETCFQKFGDRVKHWITFNEPHT  195

Query  981   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
              A  GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+  Q 
Sbjct  196   FATQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHATVADIYRKKYKKIQG  255

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             G  G+  D +WYEPLT +K D  AAQRA+DF +GWFL P+++G+YP +M+  VG RLP+F
Sbjct  256   GSLGVAFDVIWYEPLTNTKEDIDAAQRAQDFQLGWFLDPLMFGDYPSSMRTRVGSRLPKF  315

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW---NVGFAYARNGV-PIG  469
             +  E  LVKGS+D+VGIN YTTFY  D    T  I T  +D    +       NG   I 
Sbjct  316   SQSEAALVKGSLDFVGINHYTTFYAKD--NSTNLIGTLLHDSIADSGAVTLPFNGTKAIS  373

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISY  295
              RA+S WLY+VP  +   + Y+K++YGNP ++++ENGMD   +  +++ ++L D KRI Y
Sbjct  374   ERASSIWLYIVPQSMKSLMIYIKQKYGNPPVYITENGMDDPNSIFISIKDALKDEKRIRY  433

Query  294   YKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAY  118
             +  YL+ L   + DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  
Sbjct  434   HTGYLSYLLASIKDGCNVKGYFVWSLLDNWEWSAGYTSRFGLYFVDYKDNLKRYPKQSVE  493

Query  117   WFQNFLRRNK  88
             WF+NFL+  K
Sbjct  494   WFKNFLKPTK  503



>ref|XP_010521461.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Tarenaya hassleriana]
Length=512

 Score =   516 bits (1330),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 266/489 (54%), Positives = 336/489 (69%), Gaps = 32/489 (7%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQ-----VEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEV  1333
             ++R SFP GFVFGTAS+A+Q      EGA  V + GRGPS+WDTF  T G   + +  +V
Sbjct  28    INRASFPNGFVFGTASAAFQGNLLQYEGA--VKEDGRGPSVWDTFSHTLGKIADFSNADV  85

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYHRY+ DI LM  +  DAYRFSISWTRIFPNGTG++N  G+ +YN+LIN +L +GI
Sbjct  86    AVDQYHRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGI  145

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PY  L H+DLPQAL DRY GWL  Q++ DYA YAE CF+ FGDRVK+W +FNEP   A 
Sbjct  146   QPYVTLYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAI  205

Query  972   LGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
              GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  +  YR  Y+AKQ G  
Sbjct  206   QGYDVGLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWL  265

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GI  D +WYEP T ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG RLPRFT  
Sbjct  266   GIAFDVIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTAS  325

Query  627   EVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNG---VP------  475
             E  +VKGS+D+VGIN YTT+Y  +   KT  I T  ND     A A +G   VP      
Sbjct  326   EAAMVKGSLDFVGINHYTTYYARN--NKTNLIGTLLND-----AIADSGAFTVPFKGLQT  378

Query  474   IGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAE--SLNDTKRI  301
             IG RANS WLY+VP G+   + Y++ RYGNP + ++ENGMD   N+ ++   +L D KRI
Sbjct  379   IGDRANSIWLYIVPQGMRNLMNYIRIRYGNPPVIITENGMDDPNNILISRENALKDEKRI  438

Query  300   SYYKSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKM  127
              Y+  YL+ L+  + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK 
Sbjct  439   RYHHDYLSNLQAAISEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKN  498

Query  126   SAYWFQNFL  100
             S  WF +FL
Sbjct  499   SVRWFTSFL  507



>gb|KHN20526.1| Beta-glucosidase 40 [Glycine soja]
Length=503

 Score =   516 bits (1328),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 257/490 (52%), Positives = 334/490 (68%), Gaps = 16/490 (3%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNAT  1342
              ++  +  ++R +FP GFVFGTASSA+Q EGA  V + GRGPS+WDTF  T G   + + 
Sbjct  18    EIQICSSEINRGNFPNGFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHTFGKIIDFSN  75

Query  1341  GEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLE  1162
              +VAVDQYHRY+ DI LM  +  DAYRFSISW+RIFPNG G++N  GV +YN+LIN +L 
Sbjct  76    ADVAVDQYHRYEEDIQLMKDMGMDAYRFSISWSRIFPNGYGQINQAGVDHYNKLINALLA  135

Query  1161  KGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRV  982
             KGI PY  L H+DLPQALE++Y GWL   ++ D+A YAE CF+ FGDRVK+W +FNEP  
Sbjct  136   KGIEPYVTLYHWDLPQALENKYSGWLNASIIMDFATYAETCFQKFGDRVKHWITFNEPHT  195

Query  981   VAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQK  817
              A  GYD G  APGRCS      C  GNSATEPY+VAHN++L HA  A  YR  Y+  Q 
Sbjct  196   FATQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHATVADIYRKKYKKIQG  255

Query  816   GRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRF  637
             G  G+  D +WYEPLT +K D  AAQRA+DF +GWFL P+++G+YP +M+  VG RLP+F
Sbjct  256   GSLGVAFDVIWYEPLTNTKEDIDAAQRAQDFQLGWFLDPLMFGDYPSSMRTRVGSRLPKF  315

Query  636   TPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW---NVGFAYARNGV-PIG  469
             +  E  LVKGS+D+VGIN YTTFY  D    T  I T  +D    +       NG   I 
Sbjct  316   SQSEAALVKGSLDFVGINHYTTFYAKD--NSTNLIGTLLHDSIADSGAVTLPFNGTKAIS  373

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISY  295
              RA+S WLY+VP  +   + Y+K++YGNP ++++ENGMD   +  +++ ++L D KRI Y
Sbjct  374   ERASSIWLYIVPQSMRSLMIYIKQKYGNPPVYITENGMDDPNSIFISIKDALKDEKRIRY  433

Query  294   YKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAY  118
             +  YL+ L   + DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  
Sbjct  434   HTGYLSYLLASIKDGCNVKGYFVWSLLDNWEWSAGYTSRFGLYFVDYKDNLKRYPKQSVE  493

Query  117   WFQNFLRRNK  88
             WF+NFL+  K
Sbjct  494   WFKNFLKPTK  503



>ref|XP_003561900.1| PREDICTED: beta-glucosidase 6 [Brachypodium distachyon]
Length=519

 Score =   516 bits (1329),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 261/491 (53%), Positives = 335/491 (68%), Gaps = 39/491 (8%)
 Frame = -3

Query  1500  GLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQ  1321
             GL+R SFP GFVFGTAS+AYQ EGA  V   GRG +IWDTF  T G   + +  +VAVDQ
Sbjct  41    GLTRGSFPKGFVFGTASAAYQYEGA--VKADGRGQTIWDTFAHTFGKITDFSNADVAVDQ  98

Query  1320  YHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYA  1141
             YHR++ DI LM  +  DAYRFSI+W RI PNG G+VN  G+ +YN+LIN +L KGI PY 
Sbjct  99    YHRFEEDIQLMADMGMDAYRFSIAWARILPNGVGQVNQAGIDHYNKLINALLAKGIQPYV  158

Query  1140  NLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYD  961
              L H+DLPQALED+Y GWL RQ+V+D+A YAE CF  FGDRVK+W + NEP  V+  GYD
Sbjct  159   TLYHWDLPQALEDKYNGWLNRQIVDDFAGYAETCFAAFGDRVKHWITVNEPHTVSVQGYD  218

Query  960   TGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILL  796
              G  APGRCS      C  GNS TEPY+VAHN IL HA  ++ YR  Y+A QKG+ G+  
Sbjct  219   AGLQAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSRIYRNKYRATQKGQLGMAF  278

Query  795   DFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKL  616
             D +WYEP+T    D  AA+RA++F +GWF  P  +G+YP+TM+  VG+RLPRFTP+E +L
Sbjct  279   DVMWYEPMTSRAVDVEAAKRAQEFQLGWFADPFFFGDYPETMRKRVGERLPRFTPEEAEL  338

Query  615   VKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWN-VGFAYA-------------RNGV  478
             VKG++D+VGIN YTT+Y            T QND N +G  +              RNG 
Sbjct  339   VKGALDFVGINHYTTYY------------TRQNDTNIIGKLFNDTLADTGTISLPFRNGK  386

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN---LTLAESLNDTK  307
              IG RANS WLY+VP G+   + YVK+RY +P ++++ENGMD  GN   ++L ++L D+K
Sbjct  387   AIGDRANSIWLYIVPRGMRSLMNYVKDRYNSPPVYITENGMD-DGNSPFISLKDALKDSK  445

Query  306   RISYYKSYLAEL-KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYP  133
             RI Y+  YL  L   + +DG ++ GYFAWSLLDN+EW  GY+SRFG+ +VD+ D LKRYP
Sbjct  446   RIKYHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYNDNLKRYP  505

Query  132   KMSAYWFQNFL  100
             K S  WF++ L
Sbjct  506   KNSVQWFKSLL  516



>ref|XP_010936327.1| PREDICTED: beta-glucosidase 6 isoform X2 [Elaeis guineensis]
Length=504

 Score =   516 bits (1328),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 255/492 (52%), Positives = 336/492 (68%), Gaps = 23/492 (5%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             +R   + GGLSR SFP GF+FGTASSAYQ EGA  V + GRGP++WDTF  + G   + +
Sbjct  18    KRCSSDNGGLSRGSFPEGFIFGTASSAYQYEGA--VKEAGRGPTVWDTFAHSFGKVIDFS  75

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
               +VAVDQYHR+  D+ LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L
Sbjct  76    NADVAVDQYHRFVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALL  135

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
              KGI PY  L H+DLPQAL+D+Y GWL RQ+++DYA+YAE CF+ FGDRV +W +FNEP 
Sbjct  136   AKGIEPYVTLYHWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPH  195

Query  984   VVAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  820
               A  GYD G  APGRCS      C  GNSATEPY+V HN++L HA  A  YR  Y+A Q
Sbjct  196   TFAIQGYDVGLQAPGRCSIILRLFCRAGNSATEPYIVGHNVLLSHATVADIYRRKYKATQ  255

Query  819   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  640
              G  GI  D +W+ P+T S  D  A QRA+DF  GWF+ P+ +G+YP +M+  VG+RLP+
Sbjct  256   HGTVGIAFDVMWFIPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPK  315

Query  639   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND-------WNVGFAYARNG  481
             F+  E  LVKGS+D+VGIN YTT+  Y  +  +  I+   ND        ++ F Y   G
Sbjct  316   FSTAEAALVKGSLDFVGINHYTTY--YSKHNSSNIINILLNDTLADSGAISLPFKY---G  370

Query  480   VPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTK  307
              PIG +A+S WLY+VP G    + Y+K++YGNP + ++ENGMD   +  +++ ++L D K
Sbjct  371   KPIGDKASSIWLYIVPQGFRSLMNYIKQKYGNPPVIITENGMDDPNDPFISIKDALKDDK  430

Query  306   RISYYKSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYP  133
             RI Y+  YL+ L   +  DG ++ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYP
Sbjct  431   RIKYHHDYLSNLSAAIRKDGCDVRGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRYP  490

Query  132   KMSAYWFQNFLR  97
             K S  WFQN L+
Sbjct  491   KNSVQWFQNLLK  502



>gb|KHG17589.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=381

 Score =   511 bits (1315),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 245/370 (66%), Positives = 286/370 (77%), Gaps = 11/370 (3%)
 Frame = -3

Query  1170  MLEKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNE  991
             ++E GITPY NL H DLP AL+++Y G+L  Q VEDY DY EFCFK FGDRVKNWF+FNE
Sbjct  14    IVEIGITPYGNLYHSDLPLALQEKYNGFLNHQFVEDYVDYVEFCFKTFGDRVKNWFTFNE  73

Query  990   PRVVAALGYDTGFFAPGRCS----NCTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQ--  829
             PR+VAALG+D G   P RCS    NCT GN A EPY+V HNLIL HA   ++YR  YQ  
Sbjct  74    PRIVAALGFDNGVIPPLRCSKEVGNCTAGNLAFEPYIVGHNLILSHAKVVKKYREKYQIY  133

Query  828   --AKQKGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVG  655
               A QKGR GILLDF W EPLTRSK DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG
Sbjct  134   LQANQKGRIGILLDFNWCEPLTRSKIDNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVG  193

Query  654   DRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPY-IHTYQNDWNVGFAYARNGV  478
             +RLP+FT +EVK+V GS DYVGINQYTT Y+  P  +TP  I +YQ DWN  FA  +NGV
Sbjct  194   ERLPKFTEEEVKMVNGSFDYVGINQYTTRYISSP--ETPSNITSYQIDWNATFATTKNGV  251

Query  477   PIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRIS  298
              IG RANS WLY+VPWG+YKAVTYVKERYGN  + +SENGMD  GN TL   L DT RI 
Sbjct  252   QIGLRANSGWLYIVPWGMYKAVTYVKERYGNLNIIISENGMDNPGNATLPNGLKDTTRIK  311

Query  297   YYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAY  118
             ++K Y+ +LK+ +D+GAN+ GYFAWSL+DNFEW +GYTSRFGI+YVD+  LKRYPKMSAY
Sbjct  312   FFKDYMTQLKKAIDEGANVTGYFAWSLVDNFEWSLGYTSRFGIIYVDYKNLKRYPKMSAY  371

Query  117   WFQNFLRRNK  88
             WF+  L + +
Sbjct  372   WFKQLLEKKQ  381



>ref|NP_001268161.1| beta-glucosidase precursor [Vitis vinifera]
 gb|ADD17684.1| beta-glucosidase [Vitis vinifera]
Length=505

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 253/478 (53%), Positives = 332/478 (69%), Gaps = 14/478 (3%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             ++R SFP GFVFGTASSA+Q EGA  V + GRG ++WD F  T G   + +  +VAVD Y
Sbjct  27    ITRGSFPKGFVFGTASSAFQYEGA--VKEDGRGLTVWDNFSHTAGKILDFSNADVAVDHY  84

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             H Y  DI LM  +  DAYRFSISW+RIFP+GTGK+N  GV +YNRLIN ++ KGI PYA 
Sbjct  85    HLYPDDIQLMKNMGMDAYRFSISWSRIFPDGTGKINQAGVDHYNRLINALIAKGIEPYAT  144

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQ LED+Y GWL  Q+++D+A YAE CF+ FGDRVK+W +FNEP      GYD 
Sbjct  145   LYHWDLPQTLEDKYNGWLDPQIIKDFALYAETCFQQFGDRVKHWITFNEPHTFTVQGYDI  204

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C  GNSATEPY+VAH+++L HA  A  Y   Y+AKQ+G  G+  D
Sbjct  205   GLQAPGRCSIPLFLFCRAGNSATEPYIVAHHVLLSHATVADIYHKKYKAKQQGSLGVAFD  264

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +W+EP T S  D  A QRA+DF +GWF+ P++YG+YPK++++ VG RLP FT DE  L+
Sbjct  265   VIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMYGDYPKSLKDGVGSRLPNFTRDESALL  324

Query  612   KGSIDYVGINQYTTFYV-YDPYPKTPYI--HTYQNDWNVGFAYARNGVPIGPRANSEWLY  442
             KGS+D+VGIN YTTFY  YD    T  +   +  +   +   ++++G PIG RANS WLY
Sbjct  325   KGSLDFVGINHYTTFYAEYDANNLTGMLLNDSLADSRAITLPFSKDGQPIGDRANSIWLY  384

Query  441   MVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE-L  271
             +VP G+ + + Y+K++YGNP + ++ENGMD   N  + + ++L D KRI Y+  YL   L
Sbjct  385   IVPRGMRRLMNYIKQKYGNPPIIITENGMDDANNPFIPIKDALKDEKRIKYHNDYLQSLL  444

Query  270   KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
               + +DG N+ GYF WSLLDN+EW  G+TSRFG+ +VD+ D LKRYPK S  WF+NFL
Sbjct  445   ASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWFKNFL  502



>ref|XP_002979904.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii]
 gb|EFJ18774.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii]
Length=497

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 249/472 (53%), Positives = 329/472 (70%), Gaps = 9/472 (2%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             + R  FP  FVFGTA+++YQVEGA D  + GRG SIWDTF KTPG   + + G++AVDQY
Sbjct  21    IQRRDFPHRFVFGTATASYQVEGAFD--EGGRGLSIWDTFCKTPGRILDASNGDLAVDQY  78

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGK-VNWKGVAYYNRLINYMLEKGITPYA  1141
             HRYK D+D M ++  DAYRFS++W RI+P+G  K VN +GV YYN+LI+Y+LEKGI PY 
Sbjct  79    HRYKEDVDNMAEMGVDAYRFSVAWARIYPDGLEKGVNKEGVTYYNKLIDYLLEKGIKPYV  138

Query  1140  NLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYD  961
              L H+DLPQ L D +GGW  +++V+ +A YAE CF  FGDRVK+W +FNEP   + LGY 
Sbjct  139   TLYHWDLPQKLHDSFGGWTSQEIVKHFAAYAETCFAAFGDRVKHWITFNEPLQFSVLGYG  198

Query  960   TGFFAPGRCSN---CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLDF  790
              G  APGRCS+   C  G+SATEPY+  HN+IL HA A + YR  ++A Q G  GI +D 
Sbjct  199   LGIHAPGRCSDRRYCKAGDSATEPYLAGHNVILSHAAAVKIYREKFKALQGGVVGITVDA  258

Query  789   VWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVK  610
              W EP+T S  D  A+QR  +F +GWFL P  +G+YP TM+  VGDRLP+FTP+E K V+
Sbjct  259   EWAEPMTDSVDDKVASQRRLEFQLGWFLDPFFFGDYPATMREYVGDRLPKFTPEEQKSVR  318

Query  609   GSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPW  430
             GS+++VGIN Y++ +V       P    Y  D  +  +  RNG  IG +A S WLY+VPW
Sbjct  319   GSVEFVGINHYSSRFVTPALYAKP-SDNYHQDQRILTSAVRNGAVIGDKAASPWLYIVPW  377

Query  429   GLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVD  256
             GL++ + +V ERY  P ++++ENGMD   N  LTL E L+D KRI +Y+ YL  + +   
Sbjct  378   GLHRVLKWVSERYNRPPIYVTENGMDEENNSTLTLDEQLDDLKRIHFYQDYLTAVLQATR  437

Query  255   DGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDFDTLKRYPKMSAYWFQNFL  100
             +G ++ GYFAWSL+DNFEW +GYT RFG+ YVD++TLKRYPK SA WF+ FL
Sbjct  438   EGMDIRGYFAWSLVDNFEWAMGYTKRFGLYYVDYETLKRYPKRSARWFKRFL  489



>ref|XP_002311330.1| hydroxyisourate hydrolase family protein [Populus trichocarpa]
 gb|EEE88697.1| hydroxyisourate hydrolase family protein [Populus trichocarpa]
Length=512

 Score =   514 bits (1325),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 259/486 (53%), Positives = 331/486 (68%), Gaps = 22/486 (5%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNN-----ATGEV  1333
             ++R SFP GFVFGTASSA+Q EGA  V + GRGPS+WD F  T  + P       +  +V
Sbjct  26    INRASFPKGFVFGTASSAFQYEGA--VKEDGRGPSVWDKFSHTFVIGPAGKIIDFSNADV  83

Query  1332  AVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGI  1153
             AVDQYH +  DI LM  +  DAYRFSISWTRI+PNGTGK+N  GV +YN+ IN +L +GI
Sbjct  84    AVDQYHHFDEDIKLMKDMGMDAYRFSISWTRIYPNGTGKINQAGVDHYNKFINALLAQGI  143

Query  1152  TPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAA  973
              PY  L H+DLPQAL DRY GWL  Q+++D+A +AE CF+ +GDRVKNW +FNEP  V+ 
Sbjct  144   EPYVTLFHWDLPQALHDRYNGWLSPQIIKDFATFAETCFQNYGDRVKNWITFNEPHTVSI  203

Query  972   LGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRF  808
              GYD G  APGRCS      C  GNSATEPY+VAHN++L H  AA  YR  Y+AKQ+G  
Sbjct  204   QGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNMLLSHGAAADIYRKKYKAKQQGSV  263

Query  807   GILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPD  628
             GI LD +W+EP T S  D  AAQRA+DF +GWF+ P++ G+YP +M+N VGDRLP+FT +
Sbjct  264   GISLDVIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNRVGDRLPKFTEN  323

Query  627   EVKLVKGSIDYVGINQYTTFYV-YDPYPKTPYIHTYQND-----WNVGFAYARNGVPIGP  466
             +  LVKGS+D+VGIN YTTFY   +       I    ND       +   +  N  PIG 
Sbjct  324   DAALVKGSLDFVGINHYTTFYARSNDSLLGDVIGKVLNDSVADSGAITLPFGENKKPIGD  383

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN-LT-LAESLNDTKRISYY  292
             RANS WLY+VP G+   + +++++YGNP + ++ENGMD   N LT + ++L D KRI Y+
Sbjct  384   RANSIWLYIVPQGMRSLMNHIRQKYGNPPVIITENGMDDPNNALTPIKDALKDGKRIKYH  443

Query  291   KSYLAE-LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAY  118
               YL   L  + +DG N+ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  
Sbjct  444   NDYLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQ  503

Query  117   WFQNFL  100
             WF+ FL
Sbjct  504   WFKKFL  509



>ref|XP_003574944.1| PREDICTED: beta-glucosidase 34-like [Brachypodium distachyon]
Length=515

 Score =   514 bits (1324),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 253/480 (53%), Positives = 331/480 (69%), Gaps = 19/480 (4%)
 Frame = -3

Query  1497  LSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVAVDQY  1318
             L+R SFP GFVFGTA+SAYQ EGA  V + GRGP+IWD F  T G   + +  +VAVD Y
Sbjct  38    LTRGSFPKGFVFGTAASAYQYEGA--VKEDGRGPAIWDKFAHTFGKILDFSNADVAVDHY  95

Query  1317  HRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGITPYAN  1138
             HR++ DI+LM  +  DAYRFSI+W+RI PNGTG+VN  G+ +YN++IN ++ KGI PY  
Sbjct  96    HRFEEDIELMADMGLDAYRFSIAWSRILPNGTGEVNQAGIDHYNKVINALIAKGIEPYVT  155

Query  1137  LNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAALGYDT  958
             L H+DLPQALED+Y G L RQ++ DY  YAE CF+ FGDRVK+W +FNEP  V   GYD+
Sbjct  156   LYHWDLPQALEDKYMGLLDRQIINDYLAYAETCFEAFGDRVKHWITFNEPHTVTVQGYDS  215

Query  957   GFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFGILLD  793
             G  APGRCS      C QG+S TEPY+VAHN+IL HA  +  YR  Y+AKQ G  G+ LD
Sbjct  216   GIHAPGRCSVLRHLYCKQGSSGTEPYIVAHNIILAHATVSDMYRTKYKAKQNGELGMSLD  275

Query  792   FVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLV  613
              +WYEP + S AD  A +RA++F +GWF  P  +G+YP TM++ VG RLPRFT  E  LV
Sbjct  276   VIWYEPASNSTADVEATKRAQEFQLGWFADPFFFGDYPVTMRSRVGVRLPRFTTKEADLV  335

Query  612   KGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANSEW  448
             KGS+D++GIN YTTFY  D    + YI  + ND      ++   + R+G PIG +ANS W
Sbjct  336   KGSLDFMGINHYTTFYTKD--DNSTYIKKFLNDTLADSGSISLPF-RDGKPIGDKANSIW  392

Query  447   LYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAE  274
             LY+VP  +   + YVK+RY  P ++++ENGMD   +  ++L ++L D KRI Y+  Y+  
Sbjct  393   LYIVPGSMRSLMNYVKDRYNTPTVYITENGMDDSNSPFISLKKALKDRKRIKYHNDYMTN  452

Query  273   LKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAYWFQNFL  100
             L   + +DG ++ GYF WSLLDN+EW  GYTSRFG+ YVD+ D LKRYPK S  WF++ L
Sbjct  453   LADSIREDGCDVRGYFVWSLLDNWEWTAGYTSRFGLYYVDYRDNLKRYPKNSVQWFKDLL  512



>ref|XP_009416570.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=505

 Score =   514 bits (1323),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 254/489 (52%), Positives = 332/489 (68%), Gaps = 17/489 (3%)
 Frame = -3

Query  1524  ERVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNA  1345
             E+    +GGLSR SFP GFVFGTASS+YQ EGA  V + GRG ++WD F  + G   + +
Sbjct  19    EKSLAQSGGLSRGSFPKGFVFGTASSSYQYEGA--VKEDGRGRTVWDAFAHSFGKVIDFS  76

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
               +VAVDQYHRY  DI LM  +  DAYRFSI+W+RIFPNGTG VN  G+ +YN+LI+ +L
Sbjct  77    NADVAVDQYHRYHEDIQLMKDMGMDAYRFSIAWSRIFPNGTGVVNQAGIDHYNKLIDALL  136

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
               GI PY  L H+DLPQAL DRY GWL RQ++EDYA+YAE CFK FGDRVK+W + NEP 
Sbjct  137   ANGIEPYVTLYHWDLPQALADRYNGWLDRQIIEDYANYAETCFKAFGDRVKHWMTLNEPH  196

Query  984   VVAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  820
               A  G+D G  APGRCS      C  GNSATEPYVVAHN++L HA  +  YR  Y+  Q
Sbjct  197   TFAVQGFDVGLQAPGRCSIPLLLFCRAGNSATEPYVVAHNVLLSHATVSDIYRRKYKQNQ  256

Query  819   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  640
             +G  GI  D +W+EP++ S  D  A QRA+DF  GWF+ P+ +G+YP +M+  VG+RLP+
Sbjct  257   QGSVGIAFDAMWFEPMSDSPTDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPK  316

Query  639   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYA----RNGVPI  472
             F+  E  LVKGS+D+VG+N YTT+Y    +  T  I    ND            ++G  I
Sbjct  317   FSTAEAALVKGSLDFVGVNHYTTYYA--KHNSTNIIGILLNDTLADSGAITLPFKDGKAI  374

Query  471   GPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRIS  298
             G RA+S WLY+VP G+ + + Y+K+RYGNP++ ++ENGMD   N  +++ ++L D KRI 
Sbjct  375   GDRASSIWLYIVPQGIRRLMNYIKQRYGNPVVIITENGMDDFNNPFISIKDALKDDKRIR  434

Query  297   YYKSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMS  124
             Y+  YL+ L   +  DG N+ GYFAWSLLDN+EW  GYTSRFG+ ++D+ D LKRYPK S
Sbjct  435   YHNDYLSNLSASIRQDGCNVQGYFAWSLLDNWEWAAGYTSRFGLYFIDYNDNLKRYPKNS  494

Query  123   AYWFQNFLR  97
               WF+  L+
Sbjct  495   VDWFKKLLK  503



>ref|XP_004490145.1| PREDICTED: beta-glucosidase 40-like [Cicer arietinum]
Length=501

 Score =   513 bits (1322),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 253/487 (52%), Positives = 335/487 (69%), Gaps = 16/487 (3%)
 Frame = -3

Query  1521  RVRFNTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEP-NNA  1345
             ++R     ++R+SFP  FVFGTASSA+Q EGA  V + GRGPS+WDTF  + G +   N+
Sbjct  17    KIRMCVSQINRQSFPKDFVFGTASSAFQYEGA--VKEDGRGPSVWDTFSHSNGGKILRNS  74

Query  1344  TGEVAVDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYML  1165
               +VAVDQYHR++ D+ +M  +  DAYRFSISWTRIFPNG G VN  GV +YN+LI+ +L
Sbjct  75    NADVAVDQYHRFEGDVHIMKDMGMDAYRFSISWTRIFPNGFGVVNQAGVDHYNKLIDALL  134

Query  1164  EKGITPYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPR  985
              KGI PY  L H+DLPQALED+Y GWL   +++D+A YAE CF+ FGDRVK+W +FNEP 
Sbjct  135   AKGIEPYVTLYHWDLPQALEDKYKGWLSPLIIKDFATYAEICFQKFGDRVKHWITFNEPH  194

Query  984   VVAALGYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQ  820
                 +GYD G   PGRCS      C+ GNS+TEPY+VAHN+++ HAV A  YR  Y+  Q
Sbjct  195   TFCMMGYDVGLQPPGRCSILLHKLCSSGNSSTEPYIVAHNVLISHAVVADIYRKKYKKIQ  254

Query  819   KGRFGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPR  640
              G  GI LD +W+E  T SK D  A QRA DF +GWFL P+++G+YPK+M++ VG RLP+
Sbjct  255   GGSVGISLDVIWFESATNSKEDIEATQRALDFTLGWFLDPLIFGDYPKSMKSRVGSRLPK  314

Query  639   FTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYI--HTYQNDWNVGFAYARNGVP-IG  469
             F+  +  LVKGS+D+VGIN YTTFY          +  H Y +D +       NG   IG
Sbjct  315   FSKSQTSLVKGSLDFVGINHYTTFYAMHNGSDLLQVALHDYISD-SAALTLPFNGTEIIG  373

Query  468   PRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISY  295
              RANS WLY+VP G+   + Y+K++YGNPL+ ++ENGMD   +  +++ ++L D KRI Y
Sbjct  374   ERANSLWLYIVPQGMRSTMNYIKQKYGNPLLIITENGMDDPNDPSISINDALKDDKRIRY  433

Query  294   YKSYLAE-LKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSA  121
             +  YL   L  + +DG N+ GYF WSLLDN+EW+ GYTSRFG+ ++D+ D LKRYPK S 
Sbjct  434   HNDYLNNLLASIKEDGCNVKGYFVWSLLDNWEWQAGYTSRFGLYFIDYNDNLKRYPKKSV  493

Query  120   YWFQNFL  100
              WF+NFL
Sbjct  494   EWFKNFL  500



>ref|XP_010936326.1| PREDICTED: beta-glucosidase 6 isoform X1 [Elaeis guineensis]
Length=504

 Score =   513 bits (1322),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 254/487 (52%), Positives = 334/487 (69%), Gaps = 23/487 (5%)
 Frame = -3

Query  1509  NTGGLSRESFPAGFVFGTASSAYQVEGATDVHKYGRGPSIWDTFLKTPGLEPNNATGEVA  1330
             + GGLSR SFP GFVFGTASS+YQ EGA  V + GRGP++WDTF  + G   + +  +VA
Sbjct  23    DDGGLSRGSFPEGFVFGTASSSYQYEGA--VKEAGRGPTVWDTFAHSFGKVIDFSNADVA  80

Query  1329  VDQYHRYKRDIDLMVKLNFDAYRFSISWTRIFPNGTGKVNWKGVAYYNRLINYMLEKGIT  1150
             VDQYHR+  D+ LM  +  DAYRFSI+W+RIFPNGTG+VN  G+ +YN+LIN +L KGI 
Sbjct  81    VDQYHRFVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIE  140

Query  1149  PYANLNHYDLPQALEDRYGGWLGRQVVEDYADYAEFCFKIFGDRVKNWFSFNEPRVVAAL  970
             PY  L H+DLPQAL+D+Y GWL RQ+++DYA+YAE CF+ FGDRV +W +FNEP   A  
Sbjct  141   PYVTLYHWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPHTFAIQ  200

Query  969   GYDTGFFAPGRCSN-----CTQGNSATEPYVVAHNLILCHAVAAQRYRAIYQAKQKGRFG  805
             GYD G  APGRCS      C  GNSATEPY+V HN++L HA  A  YR  Y+A Q G  G
Sbjct  201   GYDVGLQAPGRCSIILRLFCRAGNSATEPYIVGHNVLLSHATVADIYRRKYKATQHGTVG  260

Query  804   ILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDE  625
             I  D +W+ P+T S  D  A QRA+DF  GWF+ P+ +G+YP +M+  VG+RLP+F+  E
Sbjct  261   IAFDVMWFIPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPKFSTAE  320

Query  624   VKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQND-------WNVGFAYARNGVPIGP  466
               LVKGS+D+VGIN YTT+  Y  +  +  I+   ND        ++ F Y   G PIG 
Sbjct  321   AALVKGSLDFVGINHYTTY--YSKHNSSNIINILLNDTLADSGAISLPFKY---GKPIGD  375

Query  465   RANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYY  292
             +A+S WLY+VP G    + Y+K++YGNP + ++ENGMD   +  +++ ++L D KRI Y+
Sbjct  376   KASSIWLYIVPQGFRSLMNYIKQKYGNPPVIITENGMDDPNDPFISIKDALKDDKRIKYH  435

Query  291   KSYLAELKRVV-DDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYVDF-DTLKRYPKMSAY  118
               YL+ L   +  DG ++ GYF WSLLDN+EW  GYTSRFG+ +VD+ D LKRYPK S  
Sbjct  436   HDYLSNLSAAIRKDGCDVRGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRYPKNSVQ  495

Query  117   WFQNFLR  97
             WFQN L+
Sbjct  496   WFQNLLK  502



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4686029124156