BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24351_g1_i1 len=4237 path=[5225:0-1705 529:1706-1775 6997:1776-1805
3210:1806-1959 7177:1960-2035 5118:2036-2082 7298:2083-2623
4916:2624-2649 7864:2650-2969 8184:2970-2999 8213:3000-3187
3744:3188-3211 14230:3212-3222 2146:3223-4236]

Length=4237
                                                                      Score     E

dbj|BAA83809.1|  24 kDa vacuolar protein VP24                          1206   0.0      Ipomoea batatas [batate]
ref|XP_009603698.1|  PREDICTED: endoplasmic reticulum metallopept...    963   0.0      
ref|XP_004237244.1|  PREDICTED: endoplasmic reticulum metallopept...    926   0.0      
ref|XP_002274159.1|  PREDICTED: endoplasmic reticulum metallopept...    920   0.0      Vitis vinifera
ref|XP_010253689.1|  PREDICTED: endoplasmic reticulum metallopept...    908   0.0      
ref|XP_011084327.1|  PREDICTED: endoplasmic reticulum metallopept...    906   0.0      
ref|XP_006354683.1|  PREDICTED: endoplasmic reticulum metallopept...    903   0.0      
ref|XP_008446885.1|  PREDICTED: endoplasmic reticulum metallopept...    902   0.0      
ref|XP_010253687.1|  PREDICTED: endoplasmic reticulum metallopept...    901   0.0      
ref|XP_002532753.1|  ATP binding protein, putative                      899   0.0      Ricinus communis
ref|XP_004142491.1|  PREDICTED: endoplasmic reticulum metallopept...    899   0.0      
ref|XP_007220266.1|  hypothetical protein PRUPE_ppa001092mg             896   0.0      
gb|KDP44365.1|  hypothetical protein JCGZ_20045                         895   0.0      
ref|XP_007009834.1|  Zn-dependent exopeptidases superfamily prote...    891   0.0      
ref|XP_008233324.1|  PREDICTED: endoplasmic reticulum metallopept...    889   0.0      
emb|CDO99744.1|  unnamed protein product                                882   0.0      
ref|XP_010253691.1|  PREDICTED: endoplasmic reticulum metallopept...    880   0.0      
ref|XP_010558756.1|  PREDICTED: endoplasmic reticulum metallopept...    879   0.0      
ref|XP_010067303.1|  PREDICTED: endoplasmic reticulum metallopept...    878   0.0      
ref|XP_010067302.1|  PREDICTED: endoplasmic reticulum metallopept...    878   0.0      
ref|XP_004308790.1|  PREDICTED: endoplasmic reticulum metallopept...    874   0.0      
ref|XP_002312017.2|  hypothetical protein POPTR_0008s03930g             872   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009764349.1|  PREDICTED: endoplasmic reticulum metallopept...    867   0.0      
ref|XP_008357256.1|  PREDICTED: endoplasmic reticulum metallopept...    867   0.0      
ref|XP_011031740.1|  PREDICTED: endoplasmic reticulum metallopept...    867   0.0      
ref|XP_009345384.1|  PREDICTED: endoplasmic reticulum metallopept...    865   0.0      
ref|XP_006414447.1|  hypothetical protein EUTSA_v10024352mg             863   0.0      
ref|XP_006436469.1|  hypothetical protein CICLE_v10030651mg             862   0.0      
ref|XP_010493169.1|  PREDICTED: endoplasmic reticulum metallopept...    858   0.0      
ref|XP_002871951.1|  hypothetical protein ARALYDRAFT_910108             858   0.0      
ref|XP_010667589.1|  PREDICTED: endoplasmic reticulum metallopept...    858   0.0      
ref|XP_010420911.1|  PREDICTED: endoplasmic reticulum metallopept...    857   0.0      
ref|XP_006287022.1|  hypothetical protein CARUB_v10000170mg             855   0.0      
ref|NP_197566.1|  Zn-dependent exopeptidases superfamily protein        855   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943482.1|  PREDICTED: endoplasmic reticulum metallopept...    851   0.0      
gb|KFK29147.1|  hypothetical protein AALP_AA7G095000                    850   0.0      
gb|KHG12605.1|  Endoplasmic reticulum metallopeptidase 1                848   0.0      
ref|XP_010253690.1|  PREDICTED: endoplasmic reticulum metallopept...    840   0.0      
ref|XP_004496278.1|  PREDICTED: endoplasmic reticulum metallopept...    840   0.0      
ref|XP_009146707.1|  PREDICTED: endoplasmic reticulum metallopept...    838   0.0      
emb|CDY22898.1|  BnaA01g18360D                                          837   0.0      
ref|XP_010943484.1|  PREDICTED: endoplasmic reticulum metallopept...    832   0.0      
ref|XP_003535531.1|  PREDICTED: endoplasmic reticulum metallopept...    832   0.0      
ref|XP_004496277.1|  PREDICTED: endoplasmic reticulum metallopept...    831   0.0      
ref|XP_010456605.1|  PREDICTED: endoplasmic reticulum metallopept...    817   0.0      
emb|CDY44178.1|  BnaC01g22280D                                          819   0.0      
ref|XP_006846783.1|  hypothetical protein AMTR_s00148p00042460          815   0.0      
ref|XP_007143703.1|  hypothetical protein PHAVU_007G094700g             812   0.0      
gb|AES62153.2|  endoplasmic reticulum metallopeptidase-like protein     811   0.0      
ref|XP_007009835.1|  Zn-dependent exopeptidases superfamily prote...    803   0.0      
ref|XP_006485690.1|  PREDICTED: endoplasmic reticulum metallopept...    806   0.0      
ref|XP_003591902.1|  Endoplasmic reticulum metallopeptidase             805   0.0      
ref|XP_008659368.1|  PREDICTED: endoplasmic reticulum metallopept...    805   0.0      
ref|XP_009400821.1|  PREDICTED: endoplasmic reticulum metallopept...    802   0.0      
dbj|BAJ94531.1|  predicted protein                                      797   0.0      
ref|XP_004976249.1|  PREDICTED: endoplasmic reticulum metallopept...    796   0.0      
ref|XP_003580148.1|  PREDICTED: endoplasmic reticulum metallopept...    796   0.0      
ref|XP_008785092.1|  PREDICTED: endoplasmic reticulum metallopept...    789   0.0      
emb|CAE05634.1|  OSJNBb0061C13.16                                       785   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ95764.1|  predicted protein                                      784   0.0      
ref|XP_006652525.1|  PREDICTED: endoplasmic reticulum metallopept...    774   0.0      
ref|XP_010943485.1|  PREDICTED: endoplasmic reticulum metallopept...    767   0.0      
gb|EMS48754.1|  Endoplasmic reticulum metallopeptidase 1                769   0.0      
gb|AFW86125.1|  hypothetical protein ZEAMMB73_851599                    753   0.0      
gb|EMT03309.1|  Endoplasmic reticulum metallopeptidase 1                723   0.0      
ref|XP_007009836.1|  Zn-dependent exopeptidases superfamily prote...    714   0.0      
ref|XP_004496279.1|  PREDICTED: endoplasmic reticulum metallopept...    710   0.0      
gb|EMS65901.1|  Endoplasmic reticulum metallopeptidase 1                707   0.0      
gb|KCW65410.1|  hypothetical protein EUGRSUZ_G02835                     699   0.0      
gb|KDO48806.1|  hypothetical protein CISIN_1g0024021mg                  696   0.0      
ref|XP_011031742.1|  PREDICTED: endoplasmic reticulum metallopept...    695   0.0      
ref|XP_007009837.1|  Zn-dependent exopeptidases superfamily prote...    659   0.0      
ref|XP_007009838.1|  Zn-dependent exopeptidases superfamily prote...    659   0.0      
gb|KDO48810.1|  hypothetical protein CISIN_1g0024021mg                  658   0.0      
ref|XP_001768589.1|  predicted protein                                  662   0.0      
gb|KDO48811.1|  hypothetical protein CISIN_1g0024021mg                  632   0.0      
ref|XP_002962285.1|  hypothetical protein SELMODRAFT_77473              633   0.0      
ref|XP_002965202.1|  hypothetical protein SELMODRAFT_83186              631   0.0      
gb|KDO48812.1|  hypothetical protein CISIN_1g0024021mg                  619   0.0      
ref|XP_004166768.1|  PREDICTED: endoplasmic reticulum metallopept...    615   0.0      
gb|KDO48813.1|  hypothetical protein CISIN_1g0024021mg                  590   0.0      
gb|EEE61353.1|  hypothetical protein OsJ_15486                          590   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003591903.1|  Endoplasmic reticulum metallopeptidase             578   0.0      
emb|CAN65299.1|  hypothetical protein VITISV_008131                     567   5e-180   Vitis vinifera
ref|XP_001757727.1|  predicted protein                                  563   9e-178   
gb|KDO44700.1|  hypothetical protein CISIN_1g0024293mg                  538   2e-172   
gb|KDO44702.1|  hypothetical protein CISIN_1g0024293mg                  536   9e-172   
gb|EYU39837.1|  hypothetical protein MIMGU_mgv1a0009862mg               467   9e-148   
gb|EYU39838.1|  hypothetical protein MIMGU_mgv1a0009861mg               459   9e-143   
gb|KDO44706.1|  hypothetical protein CISIN_1g0024293mg                  447   9e-140   
gb|EPS60097.1|  hypothetical protein M569_14706                         434   2e-136   
ref|XP_011084329.1|  PREDICTED: endoplasmic reticulum metallopept...    443   1e-132   
ref|XP_010104270.1|  Endoplasmic reticulum metallopeptidase 1           420   2e-127   
gb|KDO44701.1|  hypothetical protein CISIN_1g0024293mg                  402   2e-122   
ref|XP_006436428.1|  hypothetical protein CICLE_v10030885mg             384   1e-114   
ref|XP_006436429.1|  hypothetical protein CICLE_v10030885mg             384   3e-113   
gb|EPS57910.1|  hypothetical protein M569_16907                         345   1e-101   
ref|XP_008377574.1|  PREDICTED: endoplasmic reticulum metallopept...    306   1e-90    
ref|NP_001154727.1|  Zn-dependent exopeptidases superfamily protein     239   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437719.1|  hypothetical protein SORBIDRAFT_10g001320          237   7e-66    Sorghum bicolor [broomcorn]
emb|CAN83785.1|  hypothetical protein VITISV_008228                     225   3e-62    Vitis vinifera
ref|XP_002437720.1|  hypothetical protein SORBIDRAFT_10g001330          224   1e-61    Sorghum bicolor [broomcorn]
ref|XP_010456606.1|  PREDICTED: uncharacterized protein LOC104738067    223   2e-61    
ref|XP_002606922.1|  hypothetical protein BRAFLDRAFT_91691              219   2e-55    Branchiostoma floridae
ref|XP_001640905.1|  predicted protein                                  218   5e-55    Nematostella vectensis
ref|XP_005105979.1|  PREDICTED: endoplasmic reticulum metallopept...    216   2e-54    
ref|XP_007904725.1|  PREDICTED: endoplasmic reticulum metallopept...    215   5e-54    
ref|NP_725876.1|  CG11961, isoform A                                    210   2e-52    Drosophila melanogaster
ref|XP_009859475.1|  PREDICTED: endoplasmic reticulum metallopept...    210   2e-52    
ref|XP_004074949.1|  PREDICTED: endoplasmic reticulum metallopept...    209   5e-52    
ref|NP_611413.2|  CG11961, isoform B                                    208   6e-52    Drosophila melanogaster
ref|NP_001053331.1|  Os04g0519900                                       194   8e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002034573.1|  GM21951                                            207   1e-51    Drosophila sechellia
ref|XP_002082218.1|  GD11447                                            207   1e-51    Drosophila simulans
gb|EKC31796.1|  Endoplasmic reticulum metallopeptidase 1                205   4e-51    
ref|XP_003965609.1|  PREDICTED: endoplasmic reticulum metallopept...    206   5e-51    
ref|XP_001958900.1|  GF12330                                            206   5e-51    Drosophila ananassae
ref|XP_001974797.1|  GG21963                                            204   1e-50    Drosophila erecta
ref|XP_004538113.1|  PREDICTED: endoplasmic reticulum metallopept...    204   1e-50    
ref|XP_009097246.1|  PREDICTED: endoplasmic reticulum metallopept...    204   1e-50    
ref|XP_003453965.1|  PREDICTED: endoplasmic reticulum metallopept...    204   2e-50    
ref|XP_010865313.1|  PREDICTED: endoplasmic reticulum metallopept...    199   2e-50    
ref|XP_006788986.1|  PREDICTED: endoplasmic reticulum metallopept...    204   2e-50    
ref|XP_007230682.1|  PREDICTED: endoplasmic reticulum metallopept...    204   2e-50    
ref|XP_008101553.1|  PREDICTED: endoplasmic reticulum metallopept...    202   2e-50    
ref|XP_001365350.1|  PREDICTED: endoplasmic reticulum metallopept...    203   2e-50    Monodelphis domestica
ref|XP_005488226.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    203   3e-50    
ref|XP_007649811.1|  PREDICTED: endoplasmic reticulum metallopept...    202   3e-50    
ref|XP_010120214.1|  PREDICTED: endoplasmic reticulum metallopept...    195   3e-50    
ref|XP_008849413.1|  PREDICTED: endoplasmic reticulum metallopept...    203   3e-50    
ref|XP_006863819.1|  PREDICTED: endoplasmic reticulum metallopept...    203   3e-50    
ref|XP_008286026.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-50    
gb|EGW00424.1|  Endoplasmic reticulum metallopeptidase 1                201   3e-50    
ref|XP_010891145.1|  PREDICTED: endoplasmic reticulum metallopept...    203   3e-50    
ref|XP_010736608.1|  PREDICTED: endoplasmic reticulum metallopept...    203   4e-50    
ref|XP_002091797.1|  GE12041                                            202   4e-50    Drosophila yakuba
ref|XP_005941603.1|  PREDICTED: endoplasmic reticulum metallopept...    202   4e-50    
ref|XP_001947171.2|  PREDICTED: endoplasmic reticulum metallopept...    202   5e-50    Acyrthosiphon pisum
gb|EDL41687.1|  mCG124990, isoform CRA_a                                202   5e-50    
ref|NP_001074682.1|  endoplasmic reticulum metallopeptidase 1           202   5e-50    Mus musculus [mouse]
dbj|BAE23269.1|  unnamed protein product                                202   5e-50    Mus musculus [mouse]
ref|XP_006527053.1|  PREDICTED: endoplasmic reticulum metallopept...    202   5e-50    
ref|XP_005522813.1|  PREDICTED: endoplasmic reticulum metallopept...    202   6e-50    
dbj|BAC98257.1|  mKIAA1815 protein                                      202   6e-50    Mus musculus [mouse]
gb|EDL41688.1|  mCG124990, isoform CRA_b                                202   6e-50    
ref|XP_010619131.1|  PREDICTED: endoplasmic reticulum metallopept...    201   6e-50    
gb|ERE77128.1|  endoplasmic reticulum metallopeptidase 1-like pro...    201   7e-50    
gb|ERE77126.1|  endoplasmic reticulum metallopeptidase 1-like pro...    202   7e-50    
gb|ERE77125.1|  endoplasmic reticulum metallopeptidase 1-like pro...    202   8e-50    
ref|XP_003216612.1|  PREDICTED: endoplasmic reticulum metallopept...    201   8e-50    
ref|XP_004408048.1|  PREDICTED: endoplasmic reticulum metallopept...    202   8e-50    
ref|XP_010832132.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_005060943.1|  PREDICTED: endoplasmic reticulum metallopept...    202   1e-49    
ref|XP_005983899.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_001924252.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    Sus scrofa [pigs]
ref|XP_009978208.1|  PREDICTED: endoplasmic reticulum metallopept...    199   1e-49    
gb|KFV00106.1|  Endoplasmic reticulum metallopeptidase 1                199   1e-49    
ref|XP_003390642.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_007499610.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_007094234.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_008324132.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_006627062.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
ref|XP_008689229.1|  PREDICTED: endoplasmic reticulum metallopept...    201   1e-49    
gb|EFN89465.1|  Endoplasmic reticulum metallopeptidase 1                201   2e-49    
ref|XP_004373539.1|  PREDICTED: endoplasmic reticulum metallopept...    201   2e-49    
ref|XP_003312035.1|  PREDICTED: endoplasmic reticulum metallopept...    201   2e-49    
dbj|BAB47444.2|  KIAA1815 protein                                       201   2e-49    Homo sapiens [man]
ref|XP_007568786.1|  PREDICTED: endoplasmic reticulum metallopept...    201   2e-49    
ref|XP_008975268.1|  PREDICTED: endoplasmic reticulum metallopept...    201   2e-49    
ref|XP_003995403.1|  PREDICTED: endoplasmic reticulum metallopept...    200   2e-49    
gb|EHH57410.1|  Endoplasmic reticulum metallopeptidase 1                200   2e-49    
ref|XP_008193819.1|  PREDICTED: endoplasmic reticulum metallopept...    200   2e-49    
ref|XP_009242735.1|  PREDICTED: endoplasmic reticulum metallopept...    201   2e-49    
gb|EFA07296.1|  hypothetical protein TcasGA2_TC014536                   200   2e-49    
ref|NP_079172.2|  endoplasmic reticulum metallopeptidase 1              200   3e-49    Homo sapiens [man]
ref|XP_005251644.1|  PREDICTED: endoplasmic reticulum metallopept...    199   3e-49    
ref|XP_010363393.1|  PREDICTED: endoplasmic reticulum metallopept...    199   3e-49    
ref|XP_010156520.1|  PREDICTED: endoplasmic reticulum metallopept...    190   3e-49    
ref|XP_003472227.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    200   3e-49    
ref|XP_004047830.1|  PREDICTED: endoplasmic reticulum metallopept...    200   3e-49    
gb|KFO34702.1|  Endoplasmic reticulum metallopeptidase 1                199   3e-49    
ref|XP_008193818.1|  PREDICTED: endoplasmic reticulum metallopept...    200   3e-49    
ref|XP_003783088.1|  PREDICTED: endoplasmic reticulum metallopept...    200   3e-49    
gb|ERE77127.1|  endoplasmic reticulum metallopeptidase 1-like pro...    200   3e-49    
ref|XP_010785513.1|  PREDICTED: endoplasmic reticulum metallopept...    201   3e-49    
ref|XP_005683816.1|  PREDICTED: endoplasmic reticulum metallopept...    199   3e-49    
ref|XP_006918434.1|  PREDICTED: endoplasmic reticulum metallopept...    200   4e-49    
gb|ELR59520.1|  Endoplasmic reticulum metallopeptidase 1                199   4e-49    
ref|XP_009044249.1|  hypothetical protein LOTGIDRAFT_103045             200   4e-49    
ref|XP_008204688.1|  PREDICTED: endoplasmic reticulum metallopept...    199   4e-49    
ref|XP_007967512.1|  PREDICTED: endoplasmic reticulum metallopept...    201   4e-49    
gb|EHB04984.1|  Endoplasmic reticulum metallopeptidase 1                199   4e-49    
ref|XP_004363632.1|  conserved hypothetical protein                     200   5e-49    
ref|XP_001108869.2|  PREDICTED: endoplasmic reticulum metallopept...    199   5e-49    Macaca mulatta [rhesus macaque]
ref|XP_005891434.1|  PREDICTED: endoplasmic reticulum metallopept...    199   5e-49    
ref|XP_003488180.1|  PREDICTED: endoplasmic reticulum metallopept...    199   5e-49    
gb|ERL94535.1|  hypothetical protein D910_11812                         192   5e-49    
ref|XP_004887987.1|  PREDICTED: endoplasmic reticulum metallopept...    199   5e-49    
ref|XP_009490247.1|  PREDICTED: endoplasmic reticulum metallopept...    189   5e-49    
ref|XP_007568794.1|  PREDICTED: endoplasmic reticulum metallopept...    198   5e-49    
ref|XP_004766223.1|  PREDICTED: endoplasmic reticulum metallopept...    198   6e-49    
ref|XP_005803825.1|  PREDICTED: endoplasmic reticulum metallopept...    199   6e-49    
ref|XP_002806535.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    199   6e-49    Callithrix jacchus [common marmoset]
ref|XP_002192981.2|  PREDICTED: endoplasmic reticulum metallopept...    199   7e-49    Taeniopygia guttata
gb|EHH24122.1|  Endoplasmic reticulum metallopeptidase 1                199   7e-49    
ref|XP_004838305.1|  PREDICTED: endoplasmic reticulum metallopept...    199   7e-49    
gb|KFP74251.1|  Endoplasmic reticulum metallopeptidase 1                198   7e-49    
ref|XP_004838304.1|  PREDICTED: endoplasmic reticulum metallopept...    199   7e-49    
ref|XP_004838306.1|  PREDICTED: endoplasmic reticulum metallopept...    198   7e-49    
ref|XP_008253296.1|  PREDICTED: endoplasmic reticulum metallopept...    199   7e-49    
ref|XP_002923724.1|  PREDICTED: endoplasmic reticulum metallopept...    199   7e-49    
ref|XP_002708148.1|  PREDICTED: endoplasmic reticulum metallopept...    199   7e-49    Oryctolagus cuniculus [domestic rabbit]
ref|XP_002050780.1|  GJ20011                                            199   7e-49    Drosophila virilis
ref|XP_007536139.1|  PREDICTED: endoplasmic reticulum metallopept...    199   8e-49    
ref|XP_009022161.1|  hypothetical protein HELRODRAFT_176575             198   8e-49    
ref|XP_010363391.1|  PREDICTED: endoplasmic reticulum metallopept...    199   8e-49    
ref|XP_010363390.1|  PREDICTED: endoplasmic reticulum metallopept...    199   8e-49    
ref|XP_005388805.1|  PREDICTED: endoplasmic reticulum metallopept...    198   9e-49    
ref|XP_004317942.1|  PREDICTED: endoplasmic reticulum metallopept...    198   9e-49    
ref|XP_001958897.1|  GF12612                                            198   9e-49    Drosophila ananassae
ref|XP_004004415.1|  PREDICTED: endoplasmic reticulum metallopept...    199   9e-49    
gb|KDR16698.1|  Endoplasmic reticulum metallopeptidase 1                198   9e-49    
gb|KFV16877.1|  Endoplasmic reticulum metallopeptidase 1                197   1e-48    
ref|XP_009083093.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    197   1e-48    
ref|XP_010083619.1|  PREDICTED: endoplasmic reticulum metallopept...    197   1e-48    
gb|EFB13836.1|  hypothetical protein PANDA_012915                       197   1e-48    Ailuropoda melanoleuca
ref|XP_002689655.1|  PREDICTED: endoplasmic reticulum metallopept...    199   1e-48    
ref|XP_003762184.1|  PREDICTED: endoplasmic reticulum metallopept...    198   1e-48    
ref|XP_007428185.1|  PREDICTED: endoplasmic reticulum metallopept...    198   1e-48    
ref|XP_001864514.1|  conserved hypothetical protein                     198   1e-48    Culex quinquefasciatus
ref|XP_002705017.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    198   1e-48    
ref|XP_004766224.1|  PREDICTED: endoplasmic reticulum metallopept...    197   1e-48    
ref|XP_003397081.1|  PREDICTED: endoplasmic reticulum metallopept...    197   2e-48    
ref|XP_008539211.1|  PREDICTED: endoplasmic reticulum metallopept...    197   2e-48    
ref|XP_005581835.1|  PREDICTED: endoplasmic reticulum metallopept...    199   2e-48    
ref|XP_001851536.1|  conserved hypothetical protein                     197   2e-48    Culex quinquefasciatus
ref|XP_005425650.1|  PREDICTED: endoplasmic reticulum metallopept...    197   2e-48    
ref|XP_010723941.1|  PREDICTED: endoplasmic reticulum metallopept...    197   2e-48    
ref|XP_004677704.1|  PREDICTED: endoplasmic reticulum metallopept...    197   2e-48    
ref|XP_005616879.1|  PREDICTED: endoplasmic reticulum metallopept...    198   2e-48    
ref|XP_004591927.1|  PREDICTED: endoplasmic reticulum metallopept...    196   2e-48    
ref|XP_007450274.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
ref|XP_007108140.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
ref|XP_005173917.2|  PREDICTED: endoplasmic reticulum metallopept...    194   3e-48    
ref|XP_008422503.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
ref|XP_001493226.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    Equus caballus [domestic horse]
ref|XP_007182259.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
ref|XP_008143280.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
ref|XP_004279161.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
gb|KDO44694.1|  hypothetical protein CISIN_1g0024292mg                  185   3e-48    
ref|XP_009569921.1|  PREDICTED: endoplasmic reticulum metallopept...    196   3e-48    
gb|EYC07718.1|  hypothetical protein Y032_0069g362                      197   3e-48    
ref|XP_002091795.1|  GE13851                                            196   3e-48    Drosophila yakuba
ref|XP_005328018.1|  PREDICTED: endoplasmic reticulum metallopept...    197   3e-48    
gb|KFO71686.1|  Endoplasmic reticulum metallopeptidase 1                196   4e-48    
ref|XP_005861395.1|  PREDICTED: endoplasmic reticulum metallopept...    196   4e-48    
gb|KFZ49351.1|  Endoplasmic reticulum metallopeptidase 1                194   5e-48    
ref|XP_004949127.1|  PREDICTED: endoplasmic reticulum metallopept...    195   5e-48    
ref|XP_006152562.1|  PREDICTED: endoplasmic reticulum metallopept...    196   5e-48    
gb|KFZ46595.1|  Endoplasmic reticulum metallopeptidase 1                195   5e-48    
gb|KFP02723.1|  Endoplasmic reticulum metallopeptidase 1                195   6e-48    
ref|XP_010163531.1|  PREDICTED: endoplasmic reticulum metallopept...    195   6e-48    
ref|XP_006080672.1|  PREDICTED: endoplasmic reticulum metallopept...    196   6e-48    
ref|XP_005013130.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    195   6e-48    
ref|XP_006563910.1|  PREDICTED: endoplasmic reticulum metallopept...    196   6e-48    
ref|XP_005155164.1|  PREDICTED: endoplasmic reticulum metallopept...    196   6e-48    
ref|XP_005352179.1|  PREDICTED: endoplasmic reticulum metallopept...    196   6e-48    
ref|XP_003693282.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    196   6e-48    
ref|XP_006607462.1|  PREDICTED: endoplasmic reticulum metallopept...    196   6e-48    
ref|XP_002082220.1|  GD25326                                            196   7e-48    Drosophila simulans
ref|XP_008494476.1|  PREDICTED: endoplasmic reticulum metallopept...    195   7e-48    
ref|NP_611415.2|  CG9416, isoform A                                     196   7e-48    Drosophila melanogaster
ref|XP_008561204.1|  PREDICTED: endoplasmic reticulum metallopept...    196   7e-48    
ref|XP_001655226.1|  hypothetical protein AaeL_AAEL002408               195   7e-48    Aedes aegypti
gb|ERL92929.1|  hypothetical protein D910_10234                         196   8e-48    
gb|KFW79084.1|  Endoplasmic reticulum metallopeptidase 1                195   8e-48    
gb|KFQ79504.1|  Endoplasmic reticulum metallopeptidase 1                194   9e-48    
ref|XP_002156518.2|  PREDICTED: endoplasmic reticulum metallopept...    188   1e-47    
ref|XP_010991726.1|  PREDICTED: endoplasmic reticulum metallopept...    194   1e-47    
ref|XP_008919948.1|  PREDICTED: endoplasmic reticulum metallopept...    195   1e-47    
ref|XP_009934344.1|  PREDICTED: endoplasmic reticulum metallopept...    194   1e-47    
ref|XP_010391181.1|  PREDICTED: endoplasmic reticulum metallopept...    194   1e-47    
ref|XP_424271.3|  PREDICTED: endoplasmic reticulum metallopeptida...    195   1e-47    
ref|XP_004803164.1|  PREDICTED: endoplasmic reticulum metallopept...    197   1e-47    
gb|KFO58223.1|  Endoplasmic reticulum metallopeptidase 1                194   1e-47    
ref|XP_001688330.2|  AGAP003422-PA                                      195   2e-47    
ref|XP_004653054.1|  PREDICTED: endoplasmic reticulum metallopept...    194   2e-47    
ref|XP_006208228.1|  PREDICTED: endoplasmic reticulum metallopept...    193   2e-47    
ref|XP_008630800.1|  PREDICTED: endoplasmic reticulum metallopept...    194   2e-47    
ref|XP_004457442.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    194   2e-47    
ref|XP_010958942.1|  PREDICTED: endoplasmic reticulum metallopept...    194   2e-47    
ref|XP_006094195.1|  PREDICTED: endoplasmic reticulum metallopept...    193   2e-47    
ref|XP_003273900.1|  PREDICTED: endoplasmic reticulum metallopept...    195   2e-47    
ref|XP_003703433.1|  PREDICTED: endoplasmic reticulum metallopept...    194   2e-47    
gb|KFV94941.1|  Endoplasmic reticulum metallopeptidase 1                193   2e-47    
ref|XP_009581859.1|  PREDICTED: endoplasmic reticulum metallopept...    193   2e-47    
ref|XP_006004697.1|  PREDICTED: endoplasmic reticulum metallopept...    194   2e-47    
ref|XP_010286022.1|  PREDICTED: endoplasmic reticulum metallopept...    193   3e-47    
gb|KFQ75611.1|  Endoplasmic reticulum metallopeptidase 1                193   3e-47    
ref|XP_004436875.1|  PREDICTED: endoplasmic reticulum metallopept...    193   3e-47    
gb|EDM13100.1|  rCG48104                                                193   3e-47    
gb|KFO06536.1|  Endoplasmic reticulum metallopeptidase 1                193   3e-47    
gb|KFQ13888.1|  Endoplasmic reticulum metallopeptidase 1                193   3e-47    
ref|XP_002050777.1|  GJ22338                                            194   3e-47    
ref|XP_009971801.1|  PREDICTED: endoplasmic reticulum metallopept...    193   3e-47    
gb|KFR11847.1|  Endoplasmic reticulum metallopeptidase 1                193   3e-47    
gb|KFV59399.1|  Endoplasmic reticulum metallopeptidase 1                193   3e-47    
ref|XP_008164239.1|  PREDICTED: endoplasmic reticulum metallopept...    193   3e-47    
ref|NP_908939.2|  endoplasmic reticulum metallopeptidase 1              194   4e-47    
ref|XP_006231303.1|  PREDICTED: endoplasmic reticulum metallopept...    193   4e-47    
ref|XP_001958899.1|  GF12331                                            193   4e-47    
ref|XP_002034575.1|  GM19836                                            193   5e-47    
gb|EYC07720.1|  hypothetical protein Y032_0069g362                      193   5e-47    
ref|XP_010007712.1|  PREDICTED: endoplasmic reticulum metallopept...    192   5e-47    
gb|EYC07719.1|  hypothetical protein Y032_0069g362                      193   5e-47    
gb|KFQ91924.1|  Endoplasmic reticulum metallopeptidase 1                192   5e-47    
gb|KFP09375.1|  Endoplasmic reticulum metallopeptidase 1                192   6e-47    
ref|XP_008936041.1|  PREDICTED: endoplasmic reticulum metallopept...    192   6e-47    
gb|KFQ27340.1|  Endoplasmic reticulum metallopeptidase 1                192   6e-47    
ref|XP_008253310.1|  PREDICTED: endoplasmic reticulum metallopept...    192   6e-47    
ref|XP_002005481.1|  GI19043                                            193   6e-47    
gb|KFW96967.1|  Endoplasmic reticulum metallopeptidase 1                192   6e-47    
ref|XP_004436874.1|  PREDICTED: endoplasmic reticulum metallopept...    193   6e-47    
ref|XP_009507309.1|  PREDICTED: endoplasmic reticulum metallopept...    192   7e-47    
ref|XP_002016519.1|  GL10445                                            192   7e-47    
ref|XP_001360845.2|  GA21772                                            192   7e-47    
ref|XP_010186479.1|  PREDICTED: endoplasmic reticulum metallopept...    191   8e-47    
ref|XP_008195647.1|  PREDICTED: endoplasmic reticulum metallopept...    192   8e-47    
gb|KFQ27613.1|  Endoplasmic reticulum metallopeptidase 1                191   9e-47    
ref|XP_010584364.1|  PREDICTED: endoplasmic reticulum metallopept...    191   1e-46    
ref|XP_009636443.1|  PREDICTED: endoplasmic reticulum metallopept...    192   1e-46    
ref|XP_001974799.1|  GG20912                                            191   1e-46    
gb|KFM04143.1|  Endoplasmic reticulum metallopeptidase 1                191   1e-46    
ref|XP_009888969.1|  PREDICTED: endoplasmic reticulum metallopept...    191   1e-46    
gb|EFN65481.1|  Endoplasmic reticulum metallopeptidase 1                191   2e-46    
gb|KFW61999.1|  Endoplasmic reticulum metallopeptidase 1                191   2e-46    
ref|XP_009272579.1|  PREDICTED: endoplasmic reticulum metallopept...    192   2e-46    
ref|XP_006816631.1|  PREDICTED: endoplasmic reticulum metallopept...    190   2e-46    
gb|KDO44693.1|  hypothetical protein CISIN_1g0024292mg                  180   2e-46    
gb|KGL97795.1|  Endoplasmic reticulum metallopeptidase 1                190   2e-46    
ref|XP_007944516.1|  PREDICTED: endoplasmic reticulum metallopept...    191   2e-46    
ref|XP_009331831.1|  PREDICTED: endoplasmic reticulum metallopept...    192   2e-46    
ref|XP_008164240.1|  PREDICTED: endoplasmic reticulum metallopept...    190   2e-46    
ref|XP_002114321.1|  hypothetical protein TRIADDRAFT_28009              191   2e-46    
ref|XP_004910853.1|  PREDICTED: endoplasmic reticulum metallopept...    191   2e-46    
gb|KFO90336.1|  Endoplasmic reticulum metallopeptidase 1                190   2e-46    
gb|ELW63066.1|  Endoplasmic reticulum metallopeptidase 1                190   3e-46    
gb|KFV45957.1|  Endoplasmic reticulum metallopeptidase 1                190   3e-46    
ref|XP_010135420.1|  PREDICTED: endoplasmic reticulum metallopept...    190   3e-46    
ref|XP_002061297.1|  GK20800                                            190   3e-46    
gb|EZA53278.1|  Endoplasmic reticulum metallopeptidase                  191   3e-46    
gb|KFP63009.1|  Endoplasmic reticulum metallopeptidase 1                189   4e-46    
ref|NP_001082713.1|  endoplasmic reticulum metallopeptidase 1           190   4e-46    
ref|XP_005177922.1|  PREDICTED: endoplasmic reticulum metallopept...    190   4e-46    
emb|CAF99206.1|  unnamed protein product                                190   4e-46    
gb|KFQ45909.1|  Endoplasmic reticulum metallopeptidase 1                189   5e-46    
ref|XP_001986159.1|  GH20679                                            190   5e-46    
ref|XP_001986157.1|  GH21200                                            190   5e-46    
gb|KFU91885.1|  Endoplasmic reticulum metallopeptidase 1                189   7e-46    
ref|XP_002061295.1|  GK20842                                            189   7e-46    
ref|XP_009998954.1|  PREDICTED: endoplasmic reticulum metallopept...    189   8e-46    
ref|XP_010215450.1|  PREDICTED: endoplasmic reticulum metallopept...    189   8e-46    
gb|EMP30479.1|  Endoplasmic reticulum metallopeptidase 1                188   1e-45    
ref|XP_004535852.1|  PREDICTED: endoplasmic reticulum metallopept...    188   1e-45    
ref|XP_311708.5|  AGAP003423-PA                                         188   1e-45    
ref|XP_004535853.1|  PREDICTED: endoplasmic reticulum metallopept...    188   2e-45    
ref|XP_002005478.1|  GI20486                                            188   2e-45    
gb|KFV76004.1|  Endoplasmic reticulum metallopeptidase 1                187   2e-45    
ref|XP_009907280.1|  PREDICTED: endoplasmic reticulum metallopept...    187   3e-45    
gb|ENN78074.1|  hypothetical protein YQE_05228                          187   4e-45    
ref|XP_001655212.1|  hypothetical protein AaeL_AAEL002432               186   7e-45    
ref|XP_008182239.1|  PREDICTED: endoplasmic reticulum metallopept...    186   7e-45    
ref|XP_006268965.1|  PREDICTED: endoplasmic reticulum metallopept...    186   8e-45    
gb|ETN60827.1|  hypothetical protein AND_007540                         186   1e-44    
ref|XP_002428233.1|  conserved hypothetical protein                     186   1e-44    
gb|AFW86127.1|  hypothetical protein ZEAMMB73_851599                    172   1e-44    
gb|KGL78977.1|  Endoplasmic reticulum metallopeptidase 1                185   1e-44    
gb|EFA06886.1|  hypothetical protein TcasGA2_TC009831                   184   2e-44    
gb|ETN60826.1|  hypothetical protein AND_007541                         184   3e-44    
gb|KFB42756.1|  AGAP003423-PA-like protein                              184   3e-44    
ref|XP_001974800.1|  GG21965                                            184   4e-44    
ref|XP_011068760.1|  PREDICTED: endoplasmic reticulum metallopept...    184   4e-44    
gb|EFZ11366.1|  hypothetical protein SINV_08957                         184   4e-44    
ref|XP_008253302.1|  PREDICTED: endoplasmic reticulum metallopept...    184   4e-44    
ref|XP_002091794.1|  GE12043                                            184   4e-44    
gb|EGI69280.1|  Endoplasmic reticulum metallopeptidase 1                184   5e-44    
ref|XP_002034576.1|  GM21953                                            183   5e-44    
gb|ACV41098.1|  AT01381p                                                183   7e-44    
ref|XP_005182756.1|  PREDICTED: endoplasmic reticulum metallopept...    183   8e-44    
ref|XP_002082221.1|  GD11449                                            183   8e-44    
ref|XP_004637281.1|  PREDICTED: endoplasmic reticulum metallopept...    183   1e-43    
ref|XP_005177919.1|  PREDICTED: endoplasmic reticulum metallopept...    182   1e-43    
gb|EJW86570.1|  hypothetical protein WUBG_02516                         182   1e-43    
gb|KHJ92280.1|  peptidase, M28 family                                   177   1e-43    
ref|XP_002006814.1|  GI18384                                            182   1e-43    
ref|XP_008389846.1|  PREDICTED: endoplasmic reticulum metallopept...    182   2e-43    
gb|KDO48801.1|  hypothetical protein CISIN_1g0024022mg                  169   2e-43    
ref|XP_312763.5|  AGAP003078-PA                                         182   2e-43    
gb|ETL91133.1|  hypothetical protein, variant                           180   3e-43    
gb|ETP42472.1|  hypothetical protein, variant                           180   3e-43    
ref|NP_001261089.1|  CG10062, isoform C                                 181   3e-43    
gb|ETK84580.1|  hypothetical protein, variant                           180   3e-43    
ref|NP_611416.2|  CG10062, isoform A                                    181   3e-43    
ref|XP_008906676.1|  hypothetical protein, variant                      180   3e-43    
gb|EGT55768.1|  hypothetical protein CAEBREN_09548                      181   5e-43    
gb|ETI44595.1|  hypothetical protein, variant                           179   5e-43    
ref|XP_002005477.1|  GI19045                                            180   5e-43    
gb|ETM44448.1|  hypothetical protein, variant                           179   5e-43    
emb|CDQ04318.1|  Protein Bm1828, isoform b                              181   5e-43    
gb|ETL91132.1|  hypothetical protein L917_10295                         180   6e-43    
ref|XP_001986154.1|  GH20684                                            178   6e-43    
gb|KFB43336.1|  AGAP003422-PA-like protein                              180   6e-43    
ref|XP_001902098.1|  FXNA                                               180   7e-43    
gb|ETP42471.1|  hypothetical protein F442_10617                         180   7e-43    
gb|ETK84579.1|  hypothetical protein L915_10470                         180   7e-43    
ref|XP_008906675.1|  hypothetical protein PPTG_12411                    180   7e-43    
ref|XP_001986156.1|  GH20682                                            180   8e-43    
ref|XP_001864515.1|  conserved hypothetical protein                     180   9e-43    
gb|EGT31581.1|  hypothetical protein CAEBREN_32515                      180   9e-43    
gb|EYB98034.1|  hypothetical protein Y032_0134g1817                     180   9e-43    
gb|ETM44447.1|  hypothetical protein L914_10327                         179   1e-42    
ref|XP_003102468.1|  hypothetical protein CRE_04118                     179   1e-42    
gb|EYB98032.1|  hypothetical protein Y032_0134g1817                     179   1e-42    
gb|KFB46687.1|  AGAP003078-PA-like protein                              179   1e-42    
ref|XP_311719.5|  AGAP003432-PA                                         179   1e-42    
gb|ETI44594.1|  hypothetical protein F443_10719                         179   1e-42    
gb|EYB98035.1|  hypothetical protein Y032_0134g1817                     179   1e-42    
gb|EYU42098.1|  hypothetical protein MIMGU_mgv1a001167mg                179   1e-42    
gb|KHJ91725.1|  peptidase, M28 family                                   177   1e-42    
gb|EYB98033.1|  hypothetical protein Y032_0134g1817                     179   1e-42    
ref|XP_006343167.1|  PREDICTED: endoplasmic reticulum metallopept...    179   1e-42    
ref|XP_009411850.1|  PREDICTED: endoplasmic reticulum metallopept...    179   2e-42    
ref|XP_001975933.1|  GG20284                                            179   2e-42    
ref|XP_002061300.1|  GK20846                                            179   2e-42    
ref|XP_002061301.1|  GK20847                                            179   2e-42    
emb|CDJ82714.1|  Peptidase M28 domain containing protein                171   2e-42    
ref|XP_009786921.1|  PREDICTED: endoplasmic reticulum metallopept...    178   2e-42    
ref|XP_010314174.1|  PREDICTED: endoplasmic reticulum metallopept...    177   2e-42    
ref|XP_010314173.1|  PREDICTED: endoplasmic reticulum metallopept...    177   2e-42    
ref|XP_005063763.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    178   3e-42    
ref|XP_001958898.1|  GF12332                                            178   3e-42    
ref|XP_006018440.1|  PREDICTED: endoplasmic reticulum metallopept...    177   3e-42    
gb|ETN60828.1|  hypothetical protein AND_007539                         178   3e-42    
ref|XP_002016520.1|  GL11618                                            177   4e-42    
gb|ETN83043.1|  hypothetical protein NECAME_01842                       178   4e-42    
ref|XP_002138478.1|  GA24794                                            177   4e-42    
gb|KHN85097.1|  Uncharacterized protein Tcan_07888                      178   4e-42    
emb|CDP19896.1|  unnamed protein product                                177   4e-42    
ref|XP_002005471.1|  GI19051                                            177   4e-42    
ref|XP_010314172.1|  PREDICTED: endoplasmic reticulum metallopept...    177   4e-42    
ref|XP_002630446.1|  Hypothetical protein CBG11179                      178   4e-42    
ref|XP_010314171.1|  PREDICTED: endoplasmic reticulum metallopept...    177   4e-42    
ref|XP_001958896.1|  GF12333                                            177   5e-42    
emb|CAP30374.2|  Protein CBG11179                                       177   5e-42    
ref|XP_007428186.1|  PREDICTED: endoplasmic reticulum metallopept...    176   7e-42    
gb|KHJ90704.1|  peptidase, M28 family                                   176   7e-42    
gb|KDO48800.1|  hypothetical protein CISIN_1g0024022mg                  164   9e-42    
ref|XP_003113839.1|  hypothetical protein CRE_26207                     177   1e-41    
ref|XP_006848399.1|  hypothetical protein AMTR_s00013p00220950          176   1e-41    
ref|XP_004310069.1|  PREDICTED: endoplasmic reticulum metallopept...    176   1e-41    
ref|XP_001958895.1|  GF12334                                            176   1e-41    
gb|EPY49730.1|  peptidase                                               175   2e-41    
ref|XP_002138479.1|  GA24796                                            176   2e-41    
ref|XP_009372299.1|  PREDICTED: endoplasmic reticulum metallopept...    175   2e-41    
ref|XP_004926224.1|  PREDICTED: endoplasmic reticulum metallopept...    175   2e-41    
ref|XP_009516567.1|  hypothetical protein PHYSODRAFT_358661             175   2e-41    
ref|XP_002630542.1|  Hypothetical protein CBG12983                      175   2e-41    
gb|AAL39872.1|  LP03135p                                                174   3e-41    
ref|NP_001163202.2|  CG10062, isoform D                                 174   3e-41    
ref|XP_009187070.1|  PREDICTED: endoplasmic reticulum metallopept...    175   3e-41    
ref|XP_002016517.1|  GL11616                                            175   4e-41    
ref|XP_002050776.1|  GJ20013                                            174   4e-41    
ref|XP_001360841.2|  GA11297                                            174   5e-41    
gb|KDO81924.1|  hypothetical protein CISIN_1g002858mg                   172   5e-41    
emb|CEF70846.1|  Endoplasmic reticulum metallopeptidase 1               174   5e-41    
ref|XP_008222148.1|  PREDICTED: endoplasmic reticulum metallopept...    174   6e-41    
ref|XP_001651013.1|  hypothetical protein AaeL_AAEL000778               174   6e-41    
ref|XP_002016527.1|  GL11625                                            174   6e-41    
pir||D88216  protein B0495.7 [imported] - Caenorhabditis elegans        174   6e-41 
ref|XP_007225300.1|  hypothetical protein PRUPE_ppa001242mg             172   6e-41    
gb|EGT46125.1|  hypothetical protein CAEBREN_07327                      167   7e-41    
ref|NP_495410.4|  Protein C44B7.11                                      174   7e-41    
gb|KDE09627.1|  hypothetical protein MVLG_00034                         174   7e-41    
ref|NP_495618.1|  Protein B0495.7                                       174   8e-41    
ref|XP_002005475.1|  GI19047                                            173   9e-41    
gb|KDO81925.1|  hypothetical protein CISIN_1g002858mg                   170   9e-41    
ref|XP_001986150.1|  GH20688                                            173   9e-41    
ref|XP_001863980.1|  conserved hypothetical protein                     173   1e-40    
emb|CDH49522.1|  endoplasmic reticulum metallopeptidase 1               173   1e-40    
ref|XP_002091075.1|  GE12444                                            173   1e-40    
emb|CEF66358.1|  Endoplasmic reticulum metallopeptidase 1               173   1e-40    
ref|XP_004535858.1|  PREDICTED: endoplasmic reticulum metallopept...    172   1e-40    
ref|XP_009337494.1|  PREDICTED: endoplasmic reticulum metallopept...    173   1e-40    
ref|XP_003139037.1|  hypothetical protein LOAG_03452                    172   2e-40    
ref|XP_003561257.1|  PREDICTED: endoplasmic reticulum metallopept...    172   2e-40    
ref|XP_004535857.1|  PREDICTED: endoplasmic reticulum metallopept...    173   2e-40    
gb|EEC81886.1|  hypothetical protein OsI_25697                          172   2e-40    
ref|XP_001360848.2|  GA15600                                            172   2e-40    
gb|EGT59645.1|  hypothetical protein CAEBREN_28952                      173   2e-40    
ref|XP_002049213.1|  GJ21460                                            172   2e-40    



>dbj|BAA83809.1| 24 kDa vacuolar protein VP24 [Ipomoea batatas]
Length=893

 Score =  1206 bits (3121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/904 (75%), Positives = 776/904 (86%), Gaps = 16/904 (2%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             MAERSGYEI+VLF FV+CGTW V++ QFKVLPE LS E+AG TGFSE AAM H KALS L
Sbjct  1     MAERSGYEILVLFAFVICGTWGVYHYQFKVLPEALSPEDAGVTGFSEEAAMAHDKALSSL  60

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHPLGS  LDTALQYVL+ A+ I+EEA+GDVNV+V+ FHAN+GVNTL GG Y+GKT VY
Sbjct  61    GPHPLGSAVLDTALQYVLKAAKTIEEEAYGDVNVEVQCFHANTGVNTLSGGSYYGKTLVY  120

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SD+KHV++R+S KS A KLR GE E++AILVSAHVDTVFAAEGAGDDSSNVAVMLE+ARG
Sbjct  121   SDMKHVLIRISSKSAATKLRSGE-EDNAILVSAHVDTVFAAEGAGDDSSNVAVMLELARG  179

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             LSKQA+GFKN SVIFLFNTGEEEGL+G+HSFVTQHPWINTVRVA++LEAMGIGGKSGIFQ
Sbjct  180   LSKQASGFKN-SVIFLFNTGEEEGLDGSHSFVTQHPWINTVRVAVNLEAMGIGGKSGIFQ  238

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGPDPWAIQNFAKVAK PSGQ+VSQDLF SGVIKS+TDFQVYKE+AGLSG+DFAFTDHTA
Sbjct  239   AGPDPWAIQNFAKVAKRPSGQIVSQDLFGSGVIKSTTDFQVYKEIAGLSGMDFAFTDHTA  298

Query  2121  VYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDE-DTVVYFD  2297
             VYHTKNDK ALLKPGSLQHLGEN+LPFLL  A+S D PT   TLS G SE+E DTVVYFD
Sbjct  299   VYHTKNDKHALLKPGSLQHLGENMLPFLLHVATSPDFPTGKNTLSQGDSEEEVDTVVYFD  358

Query  2298  ILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvs  2477
             ILGR+MVVYP+S ADM + +VI L+L +  A L  GGLS+L+SL  S LSIVLMWI S+ 
Sbjct  359   ILGRFMVVYPQSLADMINTSVIALALFLWSALLNQGGLSSLVSLALSVLSIVLMWICSLG  418

Query  2478  lsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSER  2657
             LS+LVAYVLPS+S +PVPF+ASPWL IGLFAAPALLGAF+GQHVVYL LHKFLSYTFSE 
Sbjct  419   LSILVAYVLPSISESPVPFIASPWLVIGLFAAPALLGAFIGQHVVYLLLHKFLSYTFSET  478

Query  2658  KRSFILFVQ-DDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPA  2834
             K    L +Q D+EDV+   L++E+WMFKAGLLQWLLVL VG YL +G+SY AL W++SPA
Sbjct  479   KGFLPLSLQGDEEDVA--VLDSEKWMFKAGLLQWLLVLVVGNYLNVGASYFALFWMISPA  536

Query  2835  LAYVLLEAPAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
             +AY L E  A+STKPL+PLT+ IGLTVPL +SSGVFV LVNTLIG LVRFVSNPGEQADW
Sbjct  537   VAYFLFEVLAESTKPLNPLTAAIGLTVPLVVSSGVFVQLVNTLIGNLVRFVSNPGEQADW  596

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             I TAIVA LIAAIVCLTM YVLPYIHNSGAK  F+ TTC++F+VSLG+V   MVP F++D
Sbjct  597   ISTAIVAALIAAIVCLTMVYVLPYIHNSGAKYQFITTTCIVFLVSLGVVVENMVPTFIED  656

Query  3195  TARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKL-GGFVCGRDKAFDFVTFSVK  3371
             TARAVNIVQVV+ TGN + VSHIS+FSTTPG LDVEAE L GG VCGR+KAFDFV+F+  
Sbjct  657   TARAVNIVQVVNKTGNGT-VSHISMFSTTPGGLDVEAELLGGGLVCGREKAFDFVSFTAY  715

Query  3372  YSCWTEPTAKLGWKESRIPALRVGRDME--GDTRATLIHIDTAYSTRWSLGINTNEIKDF  3545
             YSCW   TA++GW  ++IPA RVG D E  GD RATL+HI T  +TRW LGINTNEI+DF
Sbjct  716   YSCW---TAEVGWNNAQIPAPRVGGDSEENGD-RATLVHITTEDATRWCLGINTNEIQDF  771

Query  3546  ELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGEN  3725
             +LKDESG L+S  GEKNGVDGWH++RFAGGKNSPT+F+LTL WHKNSSGKR++EGSEGE 
Sbjct  772   QLKDESGELIS-RGEKNGVDGWHIMRFAGGKNSPTKFDLTLHWHKNSSGKRVVEGSEGEE  830

Query  3726  LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVDSKPSLRMGssvs  3905
             +L+KLRADVN  TPE+  +LEK+ SW SQYGKS+SPFTLAYLD + V + PSL MGSS+S
Sbjct  831   VLVKLRADVNATTPELDKILEKMPSWLSQYGKSASPFTLAYLDTLYV-ADPSLTMGSSIS  889

Query  3906  vasE  3917
             VASE
Sbjct  890   VASE  893



>ref|XP_009603698.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009603699.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Nicotiana 
tomentosiformis]
Length=907

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/891 (60%), Positives = 670/891 (75%), Gaps = 21/891 (2%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             +A+RS Y I+ LF  V  GTW V+  QF  LP+PL AEE G+ GFSE  A+ HVKAL+QL
Sbjct  29    VAKRSKYVILALFVLVTYGTWSVYQHQFLNLPKPLGAEEVGKRGFSEHEAIKHVKALTQL  88

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHP+GS ALD ALQYVLQ  E IKE+A  +V+V++++FHA SG N +VGGL+ GKT VY
Sbjct  89    GPHPVGSDALDHALQYVLQATETIKEKAHWEVDVELDLFHAKSGANLMVGGLFKGKTLVY  148

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SDL HVV+R+SPK         E  E+AILVS+H+DTVF+AEGAGD SS VAVMLE+ARG
Sbjct  149   SDLNHVVLRISPKYAP------EATENAILVSSHIDTVFSAEGAGDCSSCVAVMLELARG  202

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             +S+ A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW +TV +AIDLEAMG+GGKSGIFQ
Sbjct  203   VSQWAHGFKS-AVIFLFNTGEEEGLNGAHSFITQHPWSDTVTMAIDLEAMGVGGKSGIFQ  261

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGP PWAI+NFA  AKYPSGQ+V+QD+F SG IKS+TDFQVY+E+AGLSGLDFA+ D+TA
Sbjct  262   AGPQPWAIENFALAAKYPSGQIVAQDVFKSGAIKSATDFQVYQELAGLSGLDFAYADNTA  321

Query  2121  VYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDI  2300
             VYHTKNDK+ LLKPGSLQHLGEN+L FLL+ A+S+ LP    T S GKS D+DT +YFDI
Sbjct  322   VYHTKNDKLKLLKPGSLQHLGENMLAFLLKVATSAHLPKGKATDSRGKS-DQDTAIYFDI  380

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YMVV+ + FA M + +VI+ S+LI   SL+MGG SA++SL  S+LS++LMWI ++  
Sbjct  381   LGTYMVVFRQRFARMLYNSVILQSILIWTTSLFMGGYSAMVSLALSSLSLILMWICAIGF  440

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
             S+LVA+VLP VSS+P+PFV+SPWL +GLF APA+LGAF GQHV YL L K+L+ TFS R 
Sbjct  441   SLLVAFVLPLVSSSPIPFVSSPWLVVGLFGAPAVLGAFTGQHVGYLILVKYLTKTFSRRN  500

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
              +    VQDD      +L+AERW+FKAGL+QWL++L +G + KIGSSYLALVWL SPA A
Sbjct  501   VNLSFVVQDD----LAKLDAERWLFKAGLMQWLVLLIMGNFYKIGSSYLALVWLASPAFA  556

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   PA+  KPL  +T LIGL+VP  +SSG+ + LV TLIG  VR   +PG   +
Sbjct  557   YGLLEATLSPARLPKPLKTVTLLIGLSVPFLLSSGIIIHLVATLIGSAVRLERSPGSNPE  616

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   I+AVLIAAI CLT+ Y+L YIH SGAK P +  TC+LF +SL MV + +VP F +
Sbjct  617   WLGNIIIAVLIAAIACLTLVYLLSYIHISGAKVPLITVTCILFGISLAMVQLGVVPPFTE  676

Query  3192  DTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD  G        VS ISLFS TPGNL  E E++G GFVCG D+  DFV
Sbjct  677   DTARAVNVVHVVDMRGANGKKQEPVSRISLFSATPGNLIKEVEQIGEGFVCGTDEPLDFV  736

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TFSVKY CW++  A +GW E  IP + V  D +GD R T + IDT  STRW+LGINT+EI
Sbjct  737   TFSVKYGCWSDKNANIGWHELDIPLIHVENDTKGDNRVTHVSIDTKVSTRWTLGINTDEI  796

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             +DF+LKD +  LV + G+K+  DGWH+++F+GGK +P +F+LTL W  N + K   + S 
Sbjct  797   EDFQLKDGTEELVPI-GDKSNADGWHIIQFSGGKKAPRKFSLTLFWANNHTHKSQKKDSN  855

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              E  LLKLR DV+  T     VL+KL  WCS +GKS+SP TLA+L ++S+D
Sbjct  856   IEQPLLKLRTDVDRITSPTETVLKKLPRWCSLFGKSTSPLTLAFLSSLSID  906



>ref|XP_004237244.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Solanum 
lycopersicum]
Length=891

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/891 (58%), Positives = 660/891 (74%), Gaps = 24/891 (3%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             +A+RS Y I+ LF   V G+W V+  Q+  LP PL A+  G+ GFSE  A+ HV AL+Q 
Sbjct  16    VAKRSNYVILALFVAAVYGSWFVYEQQYLNLPTPLGAQHVGKRGFSEHEAIQHVIALTQF  75

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHP+GS AL+ ALQYVLQ AE IKE A  +V+V++++FHA SG N +VGGL+ GKT VY
Sbjct  76    GPHPVGSPALNHALQYVLQAAENIKETAHWEVDVELDLFHAKSGANHMVGGLFKGKTLVY  135

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SDL H+++R+SPK         E  E+AILVS+H+DTVF+AEGAGD SS VAVMLE+ARG
Sbjct  136   SDLNHIILRISPKYAP------EATENAILVSSHIDTVFSAEGAGDCSSCVAVMLELARG  189

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             +S+ A GFKN +VIFLFNTGEEEGLNGAHSF+TQHPW +T+ +AIDLEAMG+GGKSGIFQ
Sbjct  190   VSQWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQHPWSDTLTMAIDLEAMGVGGKSGIFQ  248

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGP PWAI+NFA  A+YPSGQ+V+QDLF SG +KS+TDFQVY+E+AGLSGLDFA+ D+TA
Sbjct  249   AGPQPWAIENFALAAQYPSGQIVAQDLFKSGAVKSATDFQVYQELAGLSGLDFAYADNTA  308

Query  2121  VYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDI  2300
             VYHTKNDK+ LLKPGSLQHLGEN+L FLL+A +S++LP    T S+GKS  +DT +YFDI
Sbjct  309   VYHTKNDKLKLLKPGSLQHLGENMLAFLLKAGTSTNLPKGKGTNSSGKS-GQDTAIYFDI  367

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YMVV+ + FA + +  VI+ +LLI   S+ MGG SA++SL  S+LS+VLMW+ ++  
Sbjct  368   LGTYMVVFRQYFASLLYNTVIVQALLIWTTSVIMGGRSAMVSLALSSLSLVLMWMCAIGF  427

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
             SV VA+VLP VSS+P+P+V+SPWL +GLF APA+LGAF+GQH+ YL L K+L+ TFS R 
Sbjct  428   SVFVAFVLPLVSSSPIPYVSSPWLVVGLFGAPAVLGAFIGQHLGYLILLKYLTKTFSRRN  487

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
              +  L VQ+D      +L+AERW+FKAGLLQWL++L VG + KIGSSYLAL WL SPA A
Sbjct  488   ANLPLVVQED----LAKLDAERWLFKAGLLQWLVLLIVGNFYKIGSSYLALAWLASPAFA  543

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   PA+  KPL  +T LIG +VP  +SSG+ +  V+TLIG  VR   +PG   +
Sbjct  544   YGLLEATLSPARLPKPLKTVTLLIGSSVPCLLSSGIIIHSVSTLIGSSVRLERSPGSNPE  603

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   IVA+ IAAI CLT+ Y+L YIH SGAK P +ITTC+LF +SL ++ + +VP F +
Sbjct  604   WLGNVIVAMFIAAIACLTLVYLLSYIHISGAKVPLIITTCLLFGISLTVIQLGVVPPFTE  663

Query  3192  DTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD  G         S+ISLFSTTPGNL  E E++G GF CG  K  DFV
Sbjct  664   DTARAVNVVHVVDMAGANGKKQEPASYISLFSTTPGNLVKEVEQIGEGFTCGTVKPLDFV  723

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TFSVKY CW++  A +GW E+ IP + V  D+ GD R T + IDT  STRW+LGINT+E+
Sbjct  724   TFSVKYGCWSDKNANIGWHETDIPLIHVENDINGDNRVTHVSIDTKLSTRWTLGINTDEV  783

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             +DF+LKD    LV + G+K+  D WH+++F+GG  +P +F+LTL W  N + K+    S 
Sbjct  784   EDFQLKDGPEELVPI-GDKSNADSWHIIQFSGGNKAPRKFSLTLFWANNQTHKK---DSN  839

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              +  LLKLR DV+  T     VL KL  WCS +GKS+SP TLA+L ++ VD
Sbjct  840   TKQPLLKLRTDVDRITSPTETVLGKLPQWCSLFGKSTSPLTLAFLTSLPVD  890



>ref|XP_002274159.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Vitis vinifera]
 emb|CBI31456.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/890 (57%), Positives = 649/890 (73%), Gaps = 24/890 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS    + LF  ++  +W V Y QF  +P PL A+ AG+ GFSEV A+ HV+AL+Q+GP
Sbjct  23    KRSALVWLALFVVIIYFSWAVHYYQFDNMPAPLGADHAGKRGFSEVEAIRHVRALTQVGP  82

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS ALD ALQYVL  AE IK+ A  +V+V V+ FHA SG N +V GL+ GKT +YSD
Sbjct  83    HSIGSDALDDALQYVLAEAEKIKKMAHWEVDVQVDFFHAKSGANRMVSGLFVGKTLIYSD  142

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+++R+ PK  +      E E++AILVS+H+DTVF+ EGAGD SS VAVMLE+ARG+S
Sbjct  143   LYHIILRILPKYAS------EAEDNAILVSSHIDTVFSTEGAGDCSSCVAVMLELARGVS  196

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN +VIFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMGIGGKS IFQAG
Sbjct  197   QWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQHPWSSTIRMAIDLEAMGIGGKSSIFQAG  255

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P P AI+NFAK AKYP+GQ+VSQD+FSSGVIKS+TDFQVY+EVAGLSGLDFA+TD++AVY
Sbjct  256   PHPLAIENFAKAAKYPNGQIVSQDIFSSGVIKSATDFQVYQEVAGLSGLDFAYTDNSAVY  315

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ LLKPGSLQHLG+N+L FLLQ A  S+LP   K +   +    +T ++FDILG
Sbjct  316   HTKNDKLELLKPGSLQHLGDNMLAFLLQTA-PSNLPK-GKAMEAEEKTGHETAIFFDILG  373

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YMVVY + FA++ H +VI+ S+LI + SL MGG  A +SL  S LS++LMWI S+S S+
Sbjct  374   TYMVVYRQRFANLLHNSVIMQSILIWVTSLLMGGYPAAVSLALSCLSVILMWIFSLSFSI  433

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              V ++LP +SS+PVPFVA+PWL +GLFAAPA LGA  GQH+ YL LH +LS+  S+R ++
Sbjct  434   PVGFLLPLISSSPVPFVANPWLVVGLFAAPAFLGALTGQHLGYLILHSYLSHASSKRMQN  493

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +Q D      + EAERW+FKAG +QW ++L VG Y KIGSSY+ALVWLVSPA AY 
Sbjct  494   LSPVIQAD----VIKFEAERWLFKAGFVQWFVLLMVGNYYKIGSSYVALVWLVSPAFAYG  549

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   P +  +PL  +T L+G+++P+ +S+G+F+ +  TLIG  VRF  NPG   +W+
Sbjct  550   FLEATLSPVRLPRPLKIVTLLMGISLPILLSAGMFIRMAGTLIGTAVRFDRNPGSTPEWL  609

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                I+A+ IAA++CLT+AY+L Y H SGAK   V++TC+LF +SL +V    VP+F +DT
Sbjct  610   GNVIIAIYIAAVICLTLAYLLSYFHLSGAKKSIVLSTCMLFGLSLAVVLSGTVPSFTEDT  669

Query  3198  ARAVNIVQVVDHTGNSSVV----SHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             ARAVN+V VVD T     +    S+IS+FSTTPGNL  E E++  GFVCGRDK  DFVTF
Sbjct  670   ARAVNVVHVVDTTEKYGEMQDPRSYISIFSTTPGNLIKEVEQINEGFVCGRDKVLDFVTF  729

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             SVKY C T      GW +S IP L V  D EGD R T I IDT  STRWSL INT EI+D
Sbjct  730   SVKYGCLTNDDIGGGWSKSDIPVLHVDSDTEGDGRTTQISIDTKVSTRWSLAINTQEIED  789

Query  3543  FELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSS-GKRIMEGSEG  3719
             F  K+ S  LV +GG K   +GWH+ +F+GGKNSPT F+LTL W KNS+      +G   
Sbjct  790   FLFKENSDELVPLGG-KGSNNGWHIFQFSGGKNSPTRFDLTLFWRKNSTKSAHNADGQRA  848

Query  3720  ENL-LLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
             E   LLKLR DVN  TP+   VL KL SWCSQ+GKS+SP+ LA+L ++ V
Sbjct  849   EQRPLLKLRTDVNRLTPKAARVLTKLPSWCSQFGKSTSPYNLAFLTSLPV  898



>ref|XP_010253689.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Nelumbo nucifera]
Length=916

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/900 (57%), Positives = 646/900 (72%), Gaps = 33/900 (4%)
 Frame = +3

Query  1212  EGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKAL  1391
              G   +RS +  + LF  ++  +W V Y QF+ +P  L+A +AG+ GFSE  AM HVKAL
Sbjct  35    RGESPKRSAFLWLALFAVILNCSWGVHYYQFENMPRSLNANQAGKRGFSEQQAMEHVKAL  94

Query  1392  SQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKT  1571
             ++LGPHP+GS ALD ALQ+VL  +E IK+ A  +V+V V++FHA SG N LV GL+ GKT
Sbjct  95    TELGPHPVGSDALDLALQHVLAASEEIKKMAHWEVDVQVDIFHAKSGANRLVSGLFKGKT  154

Query  1572  PVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEV  1751
              +YSDLKHVV+R+ PK  +      E EE+AILVS+H+DTVF+ EGAGD SS VAVMLE+
Sbjct  155   LLYSDLKHVVLRILPKYGS------EAEENAILVSSHIDTVFSTEGAGDCSSCVAVMLEL  208

Query  1752  ARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSG  1931
             ARG+S+ A GFKN +VIFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMGIGGKS 
Sbjct  209   ARGISQWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQHPWRHTIRLAIDLEAMGIGGKSS  267

Query  1932  IFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTD  2111
             IFQ GPDP AI+NFAKVAKYPSGQ+++QDLF SG++KS+TDFQVYKEVAGLSGLDFA+ D
Sbjct  268   IFQGGPDPLAIENFAKVAKYPSGQIIAQDLFLSGLVKSATDFQVYKEVAGLSGLDFAYGD  327

Query  2112  HTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVY  2291
               AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQ A SSDL   N T +    ED D  ++
Sbjct  328   AGAVYHTKNDKLKLLKPGSLQHLGENMLAFLLQIARSSDL--VNGT-AMQTREDNDHAIF  384

Query  2292  FDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGs  2471
             FDILG YMVVY +  A M   +VI+ +LLI   SL MGG  A  SL  S LS++LMWI S
Sbjct  385   FDILGTYMVVYRQRLASMLQNSVIMQALLIWTMSLLMGGFPAAASLGLSCLSVLLMWIFS  444

Query  2472  vslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFS  2651
             +S S+LVA++LP + S+PVP++A+PWL IGLF APA+LGA  GQHV +  L K+L +  S
Sbjct  445   LSFSILVAFLLPLICSSPVPYIANPWLIIGLFVAPAVLGALTGQHVGFRILQKYLQHASS  504

Query  2652  E--RKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLV  2825
             +  +KRS ++           +LE ERW+FKAG +QWL++L VG++ KIGSSYLALVWLV
Sbjct  505   KGGQKRSHVV------QAELIKLETERWLFKAGFVQWLVLLMVGSFYKIGSSYLALVWLV  558

Query  2826  SPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNP  2996
             SPA AY L+EA   P +S KPL   T L+GLTVP+ +S+G+F+ LV T+ G +VRF  NP
Sbjct  559   SPAFAYGLIEATLSPVRSPKPLKIATLLLGLTVPVLVSAGIFIRLVATMTGMMVRFDRNP  618

Query  2997  GEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMV  3176
             G   +W+ + +VAVL+AAI+CLT+ Y+  Y+H SGAK  FV   C LF ++L  V   +V
Sbjct  619   GSTPEWLGSIMVAVLVAAIICLTLVYLFSYVHLSGAKRSFVYANCALFCLALTAVVSGIV  678

Query  3177  PAFVDDTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG--GFVCGRD  3338
             P F +D ARAVN+V VV+ TG    N S VS+ISLFSTTPG L  E E L   GF CGR+
Sbjct  679   PPFTEDVARAVNVVHVVETTGRYGENRSPVSYISLFSTTPGKLTKEVEYLKEEGFTCGRE  738

Query  3339  KAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLG  3518
             K  DFVTF+V Y CW+    + GW ES IP L+V  D  G+ R T I IDT  STRWSL 
Sbjct  739   KTLDFVTFTVNYGCWSSEDTESGWMESDIPTLKVENDKRGNNRITQISIDTKDSTRWSLA  798

Query  3519  INTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKR  3698
             INT EI+DF  +  S  LV V G KNGV+GWH+++F+GGK SP  FN+TL W  NS+  R
Sbjct  799   INTEEIEDFIFEGNSEELVPV-GNKNGVNGWHIIQFSGGKISPRMFNVTLFWLNNST--R  855

Query  3699  IMEGSEGEN---LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             +   S+ E     LLKLR DV+  TP+   +L KL  WCS +GKS+SP TLA+L  + VD
Sbjct  856   LTNKSDTEKKDPYLLKLRTDVDRLTPKAKRILMKLPPWCSLFGKSTSPHTLAFLSKLPVD  915



>ref|XP_011084327.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Sesamum indicum]
 ref|XP_011084328.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Sesamum indicum]
Length=924

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/892 (58%), Positives = 660/892 (74%), Gaps = 23/892 (3%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             +A+RS Y I  LF   + G W V++ QF+ LP PL+ ++ G+ GFSE  AM HV+AL++L
Sbjct  45    VAKRSSYVIFTLFVLAIYGAWGVYHYQFESLPVPLTLDQVGKRGFSEHEAMKHVEALTRL  104

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHP+GS  L++AL+YV +  E IK++A  +V+++V++FHA  G N LVGGL+ GKT VY
Sbjct  105   GPHPVGSDTLESALKYVTEAIETIKKKAHWEVDMEVDLFHAKHGANNLVGGLFKGKTLVY  164

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SDL HVV+R+ PK  +      E  E+AILVS+H+DTVFAAEGAGD SS VAVMLE+ARG
Sbjct  165   SDLNHVVLRIMPKYAS------EAGENAILVSSHIDTVFAAEGAGDCSSCVAVMLELARG  218

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             +S+ A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW +TVR+AIDLEAMGIGGKSGIFQ
Sbjct  219   VSQWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSDTVRIAIDLEAMGIGGKSGIFQ  277

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGP PWAI+NFA VAKYPS Q+V+QD+F SG IKS+TDFQVYKE+AGLSGLDFA+ D+TA
Sbjct  278   AGPHPWAIENFALVAKYPSAQIVAQDIFLSGAIKSATDFQVYKELAGLSGLDFAYADNTA  337

Query  2121  VYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDI  2300
             VYHTKNDK+ LLKPGSLQHLGEN+L FLL AA+SS LP    T S  +S  +D  +YFD+
Sbjct  338   VYHTKNDKLKLLKPGSLQHLGENMLAFLLHAAASSSLPKGKATESDIESS-QDKAIYFDV  396

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YM+ + +  A+M + +VI+ SLL+   SL MGG SA +SL+ S LS+VLMWI S+S 
Sbjct  397   LGTYMITFRQRLANMLYNSVILQSLLLWSTSLLMGGYSAALSLLLSCLSLVLMWIFSISF  456

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
             S +VA++LP +SS+PVPF++SPWL +GLF APALLGAF+GQ V ++ L  +L  T  ER+
Sbjct  457   SSVVAFILPLISSSPVPFISSPWLVVGLFGAPALLGAFLGQLVGFIVLESYLFRTLPERR  516

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
             ++    +Q     S  +L+AERW++KAGLLQWL++L VG Y +IGS+YLAL WLV PA A
Sbjct  517   KNLPANLQS----SVAKLDAERWLYKAGLLQWLVLLMVGNYYRIGSTYLALAWLVCPAFA  572

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   PA+  KPL  LT LIGL VP  +SSG+ + L  T+IG  VRFV  PG   +
Sbjct  573   YGLLEATLSPARLPKPLKTLTLLIGLFVPFLLSSGMVIRLSATIIGTAVRFVRYPGTTPE  632

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   IVAV IAAIVCLT+ Y+L YIH SGAK   +I T ++FVVS+G V   + P F +
Sbjct  633   WMGNVIVAVFIAAIVCLTLVYLLSYIHISGAKMSIIIATSIVFVVSVGAVWAGVFPPFTE  692

Query  3192  DTARAVNIVQVVDHTGNS----SVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD T  +      VS+ISLFSTTPGNL  EA+ +G GFVCG D+  DFV
Sbjct  693   DTARAVNVVHVVDETRTNGEKLEPVSYISLFSTTPGNLIKEADHIGEGFVCGTDRHLDFV  752

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TFSV YSC T+  A  GW ES IPA+ V +D++G++R T I IDT  STRWSL INT EI
Sbjct  753   TFSVNYSCSTDKGAATGWLESDIPAIHVDKDVKGESRETQISIDTRASTRWSLAINTREI  812

Query  3537  KDFELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEG  3710
              DF LK  D S  L+ + GEK+ VDGWH ++F+GG+ +PT+FNL+L W KN +       
Sbjct  813   DDFRLKDTDSSEELIPL-GEKSSVDGWHTIQFSGGRKAPTKFNLSLFWLKNRTQTTTGGV  871

Query  3711  SEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
                + LLL+LR DV+  TP M  +L+KL  WCSQ+GKS+SP TLA+L ++S+
Sbjct  872   KNNDRLLLRLRTDVDRSTPPMKTILQKLPPWCSQFGKSTSPHTLAFLTSLSI  923



>ref|XP_006354683.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Solanum 
tuberosum]
Length=894

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/891 (59%), Positives = 666/891 (75%), Gaps = 21/891 (2%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             +A+RS Y I+ LF   V G+W V+  Q+  LP+PL A++ G+ GFSE  A+ HV AL+Q 
Sbjct  16    VAKRSNYVILALFVVAVYGSWFVYEQQYLNLPKPLGAQQVGKRGFSEHEAIQHVIALTQF  75

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHP+GS ALD ALQYVLQ  E IKE A  +V+V++++FHA SG N +VGGL+ GKT VY
Sbjct  76    GPHPVGSPALDHALQYVLQAIENIKETAHWEVDVELDLFHAKSGANHMVGGLFKGKTLVY  135

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SDL H+V+R+SPK  A      E  E+AILVS+H+DTVF+AEGAGD SS VAVMLE+ARG
Sbjct  136   SDLNHIVLRISPKYAA------EATENAILVSSHIDTVFSAEGAGDCSSCVAVMLELARG  189

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             +S+ A GFKN +VIFLFNTGEEEGLNGAHSF+TQHPW +TV +AIDLEAMG+GGKSGIFQ
Sbjct  190   VSQWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQHPWSDTVTMAIDLEAMGVGGKSGIFQ  248

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGP PWAI+NFA  AKYPSGQ+V+QDLF SG IKS+TDFQVY+E+AGLSGLDFA+ D+TA
Sbjct  249   AGPQPWAIENFALAAKYPSGQIVAQDLFKSGAIKSATDFQVYQELAGLSGLDFAYADNTA  308

Query  2121  VYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDI  2300
             VYHTKNDK+ LLKPGSLQHLGEN+L FLL+A +S++LP    T S+GKS  +DT +YFDI
Sbjct  309   VYHTKNDKLKLLKPGSLQHLGENMLAFLLKAGTSTNLPKGKGTNSSGKS-GQDTAIYFDI  367

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YMVV+ + FA + +  VI+ +LLI   S+ MGG SA++SL  S+LS+VLMW+ ++  
Sbjct  368   LGTYMVVFRQYFASLLYNTVILQALLIWTTSVIMGGHSAMVSLALSSLSLVLMWMCAIGF  427

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
             SV VA+VLP VSS+P+P+++SPWL +GLF+APA+LGAF GQHV YL L K+L+ TFS R 
Sbjct  428   SVFVAFVLPLVSSSPIPYISSPWLVVGLFSAPAVLGAFTGQHVGYLILLKYLTKTFSGRN  487

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
              +  L VQ+D      +L+AERW+FKAGLLQWL++L VG + KIGSSYLAL WL +PA A
Sbjct  488   ANLPLVVQED----LAKLDAERWLFKAGLLQWLILLIVGNFYKIGSSYLALAWLAAPAFA  543

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   PA+  KPL  +T LIG +VP  +SSG+ +  V+TLIG  VR   +PG   +
Sbjct  544   YGLLEATLSPARLPKPLKTVTLLIGSSVPCLLSSGIIIHSVSTLIGSAVRLERSPGSNPE  603

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   IVA+ IAAI CLT+ Y+L YIH SGAK P +ITTC+LF +SL ++ + +VP F +
Sbjct  604   WLGNVIVAIFIAAIACLTLVYLLSYIHISGAKVPLIITTCLLFGISLAVIQLGVVPPFTE  663

Query  3192  DTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD TG         S+ISLFSTTPGNL  E E++G  F CG DK  DFV
Sbjct  664   DTARAVNVVHVVDMTGANGKKQEPASYISLFSTTPGNLVKEVEQIGEEFTCGTDKPLDFV  723

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TFSVKY CW++  A +GW E+ IP +RV  D++GD R T + IDT  STRW+LGINT+E+
Sbjct  724   TFSVKYGCWSDKNANIGWHETDIPLIRVENDIKGDNRVTHVSIDTKLSTRWTLGINTDEV  783

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             +DF+LKD    LV + G+K+  D WH+++F+GGK +P +F+LTL W  N + K   + S 
Sbjct  784   EDFQLKDGPEELVPI-GDKSNADSWHIIQFSGGKKAPRKFSLTLFWANNQTHKSYKKDSN  842

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              E  LLKLR DV+  T     VL KL  WCS +GKS+SP TLA+L ++ VD
Sbjct  843   TEQPLLKLRTDVDRITSPTETVLGKLPQWCSLFGKSTSPLTLAFLTSLPVD  893



>ref|XP_008446885.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Cucumis 
melo]
Length=910

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/889 (57%), Positives = 640/889 (72%), Gaps = 25/889 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS Y  + L  F + G   V+  QF+ LP PL AE+AG+ GFSE  A+ HVKAL+ LGP
Sbjct  38    QRSLYVWLSLLLFTIYGFRAVYQQQFEKLPIPLGAEKAGKRGFSEAEALKHVKALTSLGP  97

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS ALD AL+YVL+ AE IK+ A  +V+V+V+ FHA SG N L GGL+ GKT +YSD
Sbjct  98    HPVGSDALDFALEYVLKAAEKIKKTAHWEVDVEVQKFHAQSGANRLSGGLFRGKTLMYSD  157

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L HV++R+ PK  AD     E  E+ ILVS+H+DTVF+ EGAGD SS +AVMLE+ARG+S
Sbjct  158   LYHVILRVLPK-YAD-----EAGENTILVSSHIDTVFSTEGAGDCSSCIAVMLELARGIS  211

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEA+G GGKSGIFQ G
Sbjct  212   QWAHGFKSG-VIFLFNTGEEEGLNGAHSFMTQHPWSKTIRLAVDLEAIGTGGKSGIFQTG  270

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
              +PWA++ FA VAKYPS Q+VS++LF+SG IKS TDFQVY+E+AGLSGLDFA+ D+TAVY
Sbjct  271   SNPWAVETFASVAKYPSAQIVSEELFTSGAIKSGTDFQVYRELAGLSGLDFAYADNTAVY  330

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK  LLKPGSLQHLGEN+L FLL AASSS LPT N  +  G++ D+D  VYFDILG
Sbjct  331   HTKNDKFELLKPGSLQHLGENMLAFLLHAASSSKLPTDN-LIKGGQNSDQDKAVYFDILG  389

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YM+VY + FA + H +VII SL+I   SL MGG  A +SL  S LS+VLMWI S+S S 
Sbjct  390   TYMIVYRQRFASLLHNSVIIQSLMIWTTSLVMGGFPAAVSLALSCLSLVLMWIFSLSFSA  449

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LP +S++PVP+VASPWL +GLF APA LGA  GQ+V +L L  +LS  +S+R++ 
Sbjct  450   SVAFILPVISASPVPYVASPWLVVGLFVAPAFLGALAGQYVGFLILQTYLSNVYSKREQ-  508

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
              +L     E +    LEAERW+FKAG  QWL+ L +G Y KIGSSYLALVWLVSPA AY 
Sbjct  509   -LLPAIRAELI---RLEAERWLFKAGSFQWLIFLIIGNYYKIGSSYLALVWLVSPAFAYG  564

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   PA+  KPL   T LIGLTVPL +S+G  + L ++LIG  VRF  NPG   DW+
Sbjct  565   LLEATLTPARFPKPLKLATLLIGLTVPLLVSAGTIIRLASSLIGSAVRFDRNPGSTPDWL  624

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
              + IVAV +A I+CLT  Y+L Y+H S AK   +  TC+LF  SL  VA  +VP F D T
Sbjct  625   GSVIVAVFVAIILCLTSVYLLSYLHLSDAKRSIIFATCILFGFSLAAVAFGIVPPFTDLT  684

Query  3198  ARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             AR VN+V VVD T    G    VS++SLFSTTPG L  E E +  GF CGRDK  D+VTF
Sbjct  685   ARTVNVVHVVDTTEKYGGERDPVSYVSLFSTTPGKLTREIEHINEGFTCGRDKPIDYVTF  744

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             SV Y CWT    + GW  S IP+L V  ++  + R T I IDT  STRWSLGINT+EI+D
Sbjct  745   SVNYGCWTHEDGEDGWDMSDIPSLLVDSNVSNNGRITNILIDTKGSTRWSLGINTDEIED  804

Query  3543  FELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGE  3722
             F+ K E  ++ +  G+K+ VDGWH ++F+GGK++PT F LTL W KNS+  R ++G++  
Sbjct  805   FKFKGEEELVPT--GDKSSVDGWHTIQFSGGKDAPTSFALTLFWKKNST--RSVKGNKVP  860

Query  3723  NLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
               LLKLR D N  TP+   V+ KL SWCS +GKS+SP+TLA+L A+ V+
Sbjct  861   PPLLKLRTDFNRLTPKAERVISKLPSWCSLFGKSTSPYTLAFLTALPVN  909



>ref|XP_010253687.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Nelumbo nucifera]
 ref|XP_010253688.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Nelumbo nucifera]
Length=924

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/908 (57%), Positives = 646/908 (71%), Gaps = 41/908 (5%)
 Frame = +3

Query  1212  EGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKAL  1391
              G   +RS +  + LF  ++  +W V Y QF+ +P  L+A +AG+ GFSE  AM HVKAL
Sbjct  35    RGESPKRSAFLWLALFAVILNCSWGVHYYQFENMPRSLNANQAGKRGFSEQQAMEHVKAL  94

Query  1392  SQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKT  1571
             ++LGPHP+GS ALD ALQ+VL  +E IK+ A  +V+V V++FHA SG N LV GL+ GKT
Sbjct  95    TELGPHPVGSDALDLALQHVLAASEEIKKMAHWEVDVQVDIFHAKSGANRLVSGLFKGKT  154

Query  1572  PVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEV  1751
              +YSDLKHVV+R+ PK  +      E EE+AILVS+H+DTVF+ EGAGD SS VAVMLE+
Sbjct  155   LLYSDLKHVVLRILPKYGS------EAEENAILVSSHIDTVFSTEGAGDCSSCVAVMLEL  208

Query  1752  ARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSG  1931
             ARG+S+ A GFKN +VIFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMGIGGKS 
Sbjct  209   ARGISQWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQHPWRHTIRLAIDLEAMGIGGKSS  267

Query  1932  IFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTD  2111
             IFQ GPDP AI+NFAKVAKYPSGQ+++QDLF SG++KS+TDFQVYKEVAGLSGLDFA+ D
Sbjct  268   IFQGGPDPLAIENFAKVAKYPSGQIIAQDLFLSGLVKSATDFQVYKEVAGLSGLDFAYGD  327

Query  2112  HTAVYHTK--------NDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
               AVYHTK        NDK+ LLKPGSLQHLGEN+L FLLQ A SSDL   N T +    
Sbjct  328   AGAVYHTKAFDDSTTQNDKLKLLKPGSLQHLGENMLAFLLQIARSSDL--VNGT-AMQTR  384

Query  2268  EDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALS  2447
             ED D  ++FDILG YMVVY +  A M   +VI+ +LLI   SL MGG  A  SL  S LS
Sbjct  385   EDNDHAIFFDILGTYMVVYRQRLASMLQNSVIMQALLIWTMSLLMGGFPAAASLGLSCLS  444

Query  2448  IVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLH  2627
             ++LMWI S+S S+LVA++LP + S+PVP++A+PWL IGLF APA+LGA  GQHV +  L 
Sbjct  445   VLLMWIFSLSFSILVAFLLPLICSSPVPYIANPWLIIGLFVAPAVLGALTGQHVGFRILQ  504

Query  2628  KFLSYTFSE--RKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSS  2801
             K+L +  S+  +KRS ++           +LE ERW+FKAG +QWL++L VG++ KIGSS
Sbjct  505   KYLQHASSKGGQKRSHVV------QAELIKLETERWLFKAGFVQWLVLLMVGSFYKIGSS  558

Query  2802  YLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGY  2972
             YLALVWLVSPA AY L+EA   P +S KPL   T L+GLTVP+ +S+G+F+ LV T+ G 
Sbjct  559   YLALVWLVSPAFAYGLIEATLSPVRSPKPLKIATLLLGLTVPVLVSAGIFIRLVATMTGM  618

Query  2973  LVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSL  3152
             +VRF  NPG   +W+ + +VAVL+AAI+CLT+ Y+  Y+H SGAK  FV   C LF ++L
Sbjct  619   MVRFDRNPGSTPEWLGSIMVAVLVAAIICLTLVYLFSYVHLSGAKRSFVYANCALFCLAL  678

Query  3153  GMVAMQMVPAFVDDTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-  3317
               V   +VP F +D ARAVN+V VV+ TG    N S VS+ISLFSTTPG L  E E L  
Sbjct  679   TAVVSGIVPPFTEDVARAVNVVHVVETTGRYGENRSPVSYISLFSTTPGKLTKEVEYLKE  738

Query  3318  -GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTA  3494
              GF CGR+K  DFVTF+V Y CW+    + GW ES IP L+V  D  G+ R T I IDT 
Sbjct  739   EGFTCGREKTLDFVTFTVNYGCWSSEDTESGWMESDIPTLKVENDKRGNNRITQISIDTK  798

Query  3495  YSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQW  3674
              STRWSL INT EI+DF  +  S  LV V G KNGV+GWH+++F+GGK SP  FN+TL W
Sbjct  799   DSTRWSLAINTEEIEDFIFEGNSEELVPV-GNKNGVNGWHIIQFSGGKISPRMFNVTLFW  857

Query  3675  HKNSSGKRIMEGSEGEN---LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLA  3845
               NS+  R+   S+ E     LLKLR DV+  TP+   +L KL  WCS +GKS+SP TLA
Sbjct  858   LNNST--RLTNKSDTEKKDPYLLKLRTDVDRLTPKAKRILMKLPPWCSLFGKSTSPHTLA  915

Query  3846  YLDAISVD  3869
             +L  + VD
Sbjct  916   FLSKLPVD  923



>ref|XP_002532753.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF29630.1| ATP binding protein, putative [Ricinus communis]
Length=921

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/917 (54%), Positives = 647/917 (71%), Gaps = 41/917 (4%)
 Frame = +3

Query  1164  NNIVLWDCPHLKSYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAG  1343
             NN+VL          I G+   RSG+  +++F   +  +W V+  QF+ LP PL+ E+AG
Sbjct  30    NNVVL----------INGSTIRRSGFVWLIIFGLTIYSSWAVYTYQFQNLPVPLTPEQAG  79

Query  1344  ETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHA  1523
             + GFSEVAAM H++AL+QLGPHP+GS +LD ALQYVL+ AE IK+ A  +V+V V++FH 
Sbjct  80    KRGFSEVAAMKHIRALTQLGPHPVGSDSLDLALQYVLEAAENIKKTAHWEVDVQVDLFHT  139

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
              SG N L  GL+ GKT VYSDL H+++R+ PK  +      E  E+AIL+S+H+DTVF+ 
Sbjct  140   KSGSNRLASGLFKGKTLVYSDLNHILLRILPKYAS------EAGENAILISSHIDTVFST  193

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
             EGAGD SS VAVMLE+ARG+S+ A GFKN  +IFLFNTGEEEGLNGAHSF+TQHPW  T+
Sbjct  194   EGAGDCSSCVAVMLELARGISQWAHGFKNG-IIFLFNTGEEEGLNGAHSFITQHPWSTTI  252

Query  1884  RVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
             R+A+DLEAMGIGGKSGIFQAGPDPW I+N+A  AKYPSG V++QDLF+SGVIKS+TDFQV
Sbjct  253   RMAVDLEAMGIGGKSGIFQAGPDPWVIENYATAAKYPSGNVLAQDLFASGVIKSATDFQV  312

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             YKEVAGLSGLDFA+TD++ VYHTKNDK+ LLKPGSLQHLGEN+L FLLQ   +S LP   
Sbjct  313   YKEVAGLSGLDFAYTDNSGVYHTKNDKLELLKPGSLQHLGENMLAFLLQIGPASHLPKDK  372

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALI  2423
             +T+  GKS   DT V+FDILG YM+VY + FA M   +VI+ SLLI  ASL MGG SA I
Sbjct  373   RTVEEGKSS-RDTAVFFDILGTYMIVYNQRFASMLQNSVIMQSLLIWAASLLMGGYSAAI  431

Query  2424  SLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQ  2603
             SL  S LS +L  + S+S SV VA++LP VSS+PVP+VA+PWL +GLF APAL+GA  GQ
Sbjct  432   SLGLSCLSAILTLVFSISFSVFVAFILPQVSSSPVPYVANPWLVVGLFGAPALIGAMTGQ  491

Query  2604  HVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTY  2783
             H  Y  L  +LS  +S+RK+     +Q D      +LE ERW+FK+G LQWL++L +G Y
Sbjct  492   HFGYFILRMYLSSVYSKRKQ-LSSVIQAD----VVKLETERWLFKSGFLQWLVLLILGNY  546

Query  2784  LKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLV  2954
              +I SSY+AL WLV PA AY LLEA   PA+  +PL   T L+GL VP+ IS+G F+ L 
Sbjct  547   YRIVSSYMALFWLVPPAFAYGLLEATLTPARLPRPLKLATLLMGLAVPIVISAGTFIRLA  606

Query  2955  NTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCV  3134
              TLIG +VRF  NPG   +W+   I++V +A ++C T++Y++ Y+H S AK   ++ T V
Sbjct  607   GTLIGIVVRFDRNPGGTPEWLGNVIISVFVAVVICFTLSYIISYVHLSDAKRSIILATSV  666

Query  3135  LFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVE  3302
             LF +S   +   ++P F  D ARAVN+V VVD TG+        S++SLFS TPG L  E
Sbjct  667   LFGLSFIFILSGILPPFTGDAARAVNVVHVVDTTGSYGNKQDPSSYVSLFSATPGKLTKE  726

Query  3303  AEKLG-GFVCGRDKAFDFVTFSVKYSCWT--EPTAKLGWKESRIPALRVGRDMEGDTRAT  3473
             AE++  G  CGRDK  DFVTFSV+Y CWT  +P  K GW ++ +P L+V  D + D R T
Sbjct  727   AEEIDEGLSCGRDKVVDFVTFSVEYGCWTYEDPKTKGGWGDADVPTLQVNSDTKEDKRMT  786

Query  3474  LIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTE  3653
             L+ IDT  S RWSL INT+EI+DF L   S  LV   G K+ +DGWH+++F+GGK +P  
Sbjct  787   LVSIDTKASMRWSLAINTDEIEDFILTGNSEELVP-SGNKSSIDGWHIIQFSGGKEAPRN  845

Query  3654  FNLTLQWHKNSSGKRIMEGSEGENL-----LLKLRADVNTKTPEMVAVLEKLLSWCSQYG  3818
             F LTL W K   GK+     +G+ +     LLKLR DV+  TP+  ++L+KL  WCSQ+G
Sbjct  846   FELTLLWAKK--GKKFTHSVDGQTMKDKRPLLKLRTDVDRITPKAESILKKLPQWCSQFG  903

Query  3819  KSSSPFTLAYLDAISVD  3869
             KS+SP+ LA+L ++ VD
Sbjct  904   KSTSPYNLAFLSSVPVD  920



>ref|XP_004142491.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Cucumis 
sativus]
 gb|KGN52269.1| hypothetical protein Csa_5G622840 [Cucumis sativus]
Length=908

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/898 (57%), Positives = 642/898 (71%), Gaps = 31/898 (3%)
 Frame = +3

Query  1206  TIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVK  1385
             TI     +RS Y  + L  F + G   V+  QF+ LP PLSAE+AG+ GFSE  A+ HVK
Sbjct  31    TISVVRPQRSLYVWLSLLVFTIYGFRAVYQQQFEKLPIPLSAEKAGKRGFSEAEALKHVK  90

Query  1386  ALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFG  1565
             AL+ LGPHP+GS ALD AL+YVL+ AE IK+ A  +V+V+V+ FHA SGVN L GGL+ G
Sbjct  91    ALTSLGPHPVGSDALDLALEYVLKTAEKIKKTAHWEVDVEVQKFHAKSGVNRLSGGLFRG  150

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
             KT +YSDL HV++R+ PK  AD     E  E+ ILVS+H+DTVF+ EGAGD SS +AVML
Sbjct  151   KTLMYSDLYHVILRVLPK-YAD-----EAGENTILVSSHIDTVFSTEGAGDCSSCIAVML  204

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+ARG+S+ A GFK+  VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEA+GIGGK
Sbjct  205   ELARGISQWAHGFKSG-VIFLFNTGEEEGLNGAHSFMTQHPWSKTIRLAVDLEAIGIGGK  263

Query  1926  SGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
             SGIFQ G  PWA++ FA VAKYPS Q+VS+DLF+SG IKS TDFQ+Y+E+AGLSGLDFA+
Sbjct  264   SGIFQTGSHPWAVETFASVAKYPSAQIVSEDLFTSGAIKSGTDFQIYRELAGLSGLDFAY  323

Query  2106  TDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--DED  2279
              D+TAVYHTKNDK  LLKPGSLQHLGEN+L FLL AA     P+P  + +  KS+  D+D
Sbjct  324   ADNTAVYHTKNDKFELLKPGSLQHLGENMLAFLLHAA-----PSPKLSENVIKSQHADQD  378

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
               VYFDILG YM+VY + FA + H +VII SL+I I SL MGG  A +SL  S LS+VLM
Sbjct  379   KAVYFDILGTYMIVYRQRFATLLHNSVIIQSLMIWITSLVMGGFPAAVSLALSCLSLVLM  438

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
             WI S+S S  VA++LP +SS+PVP+VASPWLA+GLF APA LGA  GQ+V +L LH +LS
Sbjct  439   WIFSLSFSASVAFILPVISSSPVPYVASPWLAVGLFVAPAFLGALAGQYVGFLILHTYLS  498

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               +S+R++  +L     E +    LEAERW+FKAG  QWL+ L +G Y KIGSSYLALVW
Sbjct  499   NVYSKREQ--LLPATRAELI---RLEAERWLFKAGSFQWLIFLIIGNYYKIGSSYLALVW  553

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LVSPA AY LLEA   PA+  KPL   T LIGLTVPL +S+G  + L ++LIG  VRF  
Sbjct  554   LVSPAFAYGLLEATLTPARFPKPLKLATLLIGLTVPLLVSAGTIIRLASSLIGSAVRFDR  613

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQ  3170
             NPG   DW+ + IVAV +A I+CLT  Y+L Y+H S AK   +  TC+LF  SL  VA  
Sbjct  614   NPGSTPDWLGSVIVAVFVAIILCLTSVYLLSYLHLSDAKRSIIFATCILFGFSLAAVASG  673

Query  3171  MVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGR  3335
             +VP F D TAR VN+V V+D T    G    VS++SLFSTTPG L  E E +  GF CGR
Sbjct  674   IVPPFTDLTARTVNVVHVIDTTTEYGGERDPVSYVSLFSTTPGKLTREIEHINEGFTCGR  733

Query  3336  DKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSL  3515
             DK  D+VTFSV Y CWT    + GW +S IP L V  D+  + R T I IDT  STRWSL
Sbjct  734   DKPIDYVTFSVNYGCWTHEDGEDGWDKSDIPLLLVDSDVSNNGRITNILIDTKGSTRWSL  793

Query  3516  GINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGK  3695
             GINT+EI+DF+ K E  ++ +  G K+ VDGWH ++F+GGK++PT F LTL W KNS+  
Sbjct  794   GINTDEIEDFKFKGEDELVPT--GNKSSVDGWHTIQFSGGKDAPTSFALTLLWKKNST--  849

Query  3696  RIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             R ++G+     LLKLR D N  TP+   V+ KL SWCS +GKS+SP+TLA+L A+ V+
Sbjct  850   RWVKGNTVPPPLLKLRTDFNRLTPKAERVISKLPSWCSLFGKSTSPYTLAFLTALPVN  907



>ref|XP_007220266.1| hypothetical protein PRUPE_ppa001092mg [Prunus persica]
 gb|EMJ21465.1| hypothetical protein PRUPE_ppa001092mg [Prunus persica]
Length=911

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/895 (56%), Positives = 647/895 (72%), Gaps = 30/895 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS +  + LF  +  G+W VF+ QF+ LP PL+AE+AG+ GFSE +A+ HVKAL+QLGP
Sbjct  32    QRSPFVWLTLFLAIAYGSWSVFHYQFESLPAPLTAEQAGKRGFSEFSALEHVKALTQLGP  91

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS AL  ALQYVL  AE IK+ A  +V+V+V+ F A SG N + GGL+ G+T VYSD
Sbjct  92    HSVGSDALHLALQYVLAEAEKIKKTAHWEVDVEVDSFTAKSGANRMAGGLFKGRTLVYSD  151

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+++R+ PK   + +      ++AILVS+H+DTVF+  GAGD SS VAVMLE+ARG+S
Sbjct  152   LNHIIIRILPKYAPEAV------DNAILVSSHIDTVFSTGGAGDCSSCVAVMLELARGIS  205

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW  ++R+AIDLEAMGIGGKSGIFQAG
Sbjct  206   QWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSKSIRLAIDLEAMGIGGKSGIFQAG  264

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             PDPW I+ FA VAKYPSGQ+++QD+FSSG IKS+TDFQVY+EVAGLSGLDFA+ D+TAVY
Sbjct  265   PDPWPIETFAAVAKYPSGQIIAQDIFSSGAIKSATDFQVYREVAGLSGLDFAYADNTAVY  324

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ LLK GSLQHLGEN+L FLL+ A+SS LP  N T+    ++ + T VYFDILG
Sbjct  325   HTKNDKLELLKLGSLQHLGENMLAFLLKIAASSHLPKVN-TMVEEDNKGQSTAVYFDILG  383

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YMVVY + FA+M HK+VI  SLLI   SL MGG  A ISL  S  S++LMWI ++S SV
Sbjct  384   TYMVVYRQHFANMLHKSVIAQSLLIWTTSLLMGGYPAAISLALSCFSVILMWIFALSFSV  443

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             L A+++P +SS+PVP+VA+PWL +GLFAAPALLGA  GQ++ YL LH  LS  ++++K+ 
Sbjct  444   LAAFIIPLISSSPVPYVANPWLVVGLFAAPALLGALTGQYLGYLILHTHLSNVYTKKKQ-  502

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +Q D   S    EAERW++K+G LQWL++L +GTY KIGSSYLAL WLV PA AY 
Sbjct  503   ISPVIQADLIKS----EAERWLYKSGSLQWLILLILGTYYKIGSSYLALFWLVPPAFAYG  558

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   PA+  KPL   T LIGL VP+ IS+G F+ L  T+IG +VR   NPG   DW+
Sbjct  559   FLEATLTPARFPKPLKLATLLIGLAVPILISAGGFIRLAGTIIGTVVRLDRNPGGTPDWL  618

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                IVA  +AA++CLT+ Y+L YIH  GAK   V++TC+LF +SL +V++ ++P F  DT
Sbjct  619   GNVIVATYVAAVMCLTLVYLLSYIHLPGAKKSIVLSTCLLFGLSLAVVSLGIIPPFTKDT  678

Query  3198  ARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             +RAVN+V VVD T +        S++SLFS+TPG L  E E++  GF CGRDK  D VTF
Sbjct  679   SRAVNVVHVVDMTRSFDEKQDPRSYVSLFSSTPGKLTKEVEQINEGFRCGRDKVVDLVTF  738

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             SVKYSCWT      GW ES +P + V  D  GD R T + IDT  STRW+L IN +EI+D
Sbjct  739   SVKYSCWTFDDTDNGWSESDVPTMHVDSDTHGDERITRVLIDTKGSTRWTLAINADEIED  798

Query  3543  FELKD----ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSG-KRIME  3707
             F  KD    E  VLV   G+ + VDGWH+++F+GGKN+PT F+LTL W KNS+     +E
Sbjct  799   FTFKDAGSSEELVLV---GDMSSVDGWHIMQFSGGKNAPTRFDLTLFWMKNSTRLDHKVE  855

Query  3708  GSEGENL-LLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             G   E   LLKLR D++  TP++  VL KL  WCSQ+GKS+SP T A+L  + V+
Sbjct  856   GKREEGTPLLKLRTDMDIVTPKVDRVLSKLPPWCSQFGKSTSPHTFAFLSNLPVN  910



>gb|KDP44365.1| hypothetical protein JCGZ_20045 [Jatropha curcas]
Length=928

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/898 (56%), Positives = 644/898 (72%), Gaps = 33/898 (4%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             + RSG+  ++LF  +V  +W V+Y QF+ LP PL+A +AG+ GFSEV AM HV+AL+QLG
Sbjct  47    SRRSGFVWLILFGVLVYSSWAVYYYQFESLPSPLTAGQAGKRGFSEVEAMKHVRALTQLG  106

Query  1404  PHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYS  1583
             PHP+GS ALD ALQYVL  AE IK+ A  +V+V V++FHA SG N LV GL+ GKT VYS
Sbjct  107   PHPVGSDALDLALQYVLAAAENIKKTAHWEVDVQVDLFHAKSGANRLVSGLFKGKTLVYS  166

Query  1584  DLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGL  1763
             DL H+V+R+ PK  +      E  E+AILVS+H+DTVF+ EGAGD SS VAVMLE++RG+
Sbjct  167   DLNHIVLRILPKYAS------EAGENAILVSSHIDTVFSTEGAGDCSSCVAVMLELSRGI  220

Query  1764  SKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQA  1943
             S+ A GFKN ++IFLFNTGEEEGLNGAHSF+TQHPW  T+R+AIDLEAMG+GGKSGIFQA
Sbjct  221   SQWAHGFKN-AIIFLFNTGEEEGLNGAHSFMTQHPWNATIRMAIDLEAMGVGGKSGIFQA  279

Query  1944  GPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
             GP PWAI+N+A  AKYPSG +V+QDLFSSG+IKS+TDFQVYKEVAGLSGLDFA+TD++ V
Sbjct  280   GPHPWAIENYASAAKYPSGHIVAQDLFSSGIIKSATDFQVYKEVAGLSGLDFAYTDNSGV  339

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
             YHTKNDK+ LLK GSLQHLGEN+L FLLQ A +  LP   K +   +    DT ++FDIL
Sbjct  340   YHTKNDKIDLLKSGSLQHLGENMLAFLLQVAPTPHLPK-GKAMGEEEKNGHDTAIFFDIL  398

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsls  2483
             G YM++Y + FA M H +VI+ SLLI  ASL+MGG  A++SL  S LS +LM + S+  +
Sbjct  399   GTYMIIYSQRFASMLHNSVILQSLLIWTASLFMGGYPAVVSLGLSCLSAILMLVFSIGFA  458

Query  2484  vlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR  2663
              L A++LP +SS+PVP+VASPWL +GLFAAPA++GA  GQH  YL L  +LS  +S+RK 
Sbjct  459   FLAAFILPLISSSPVPYVASPWLVVGLFAAPAIIGALTGQHFGYLILQMYLSNVYSKRK-  517

Query  2664  SFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAY  2843
               +L   +  D+   +LEAERW+FKAG +QWL++L +G Y KIGSSY+AL WLV PA AY
Sbjct  518   --LLSSVNQADL--IKLEAERWLFKAGFVQWLVLLILGNYYKIGSSYMALFWLVPPAFAY  573

Query  2844  VLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
              LLEA   PA+  +PL   T L+GL VP+ ISSG F+ L  T+IG +VRF  NPG   +W
Sbjct  574   GLLEATLTPARLPRPLKLATLLMGLAVPIVISSGTFIRLTATIIGIMVRFDRNPGSTPEW  633

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             +  AI++V IA IVC T+ YVL Y+H SGAK   ++ T VLF VSL  V+  ++P F  D
Sbjct  634   LGNAILSVFIAVIVCFTLIYVLSYVHLSGAKRSIILATSVLFGVSLIFVSSGIIPPFTGD  693

Query  3195  TARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVT  3359
              ARA+N+V VVD TG+       +S++SLFS+TPGNL  E E++  GF CGR+K  DFVT
Sbjct  694   AARALNVVHVVDTTGSYGNKQDPISYLSLFSSTPGNLMKEVEQIKEGFSCGREKIVDFVT  753

Query  3360  FSVKYSCWT--EPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNE  3533
             FSV+Y C T  +     GW ++ IP+L V  D   + R T + IDT  S RWSL INT E
Sbjct  754   FSVEYGCLTYEDLDNGRGWSDADIPSLHVDSDTNAEERITKVAIDTKASIRWSLAINTEE  813

Query  3534  IKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHK------NSSGK  3695
             IKDF    +S  L+ + G K  +DGWH+++F+GGK +P +F LTL W K       S+ +
Sbjct  814   IKDFIFTGDSEELIPL-GNKTSIDGWHIIQFSGGKEAPRKFELTLFWAKESMKSSRSADR  872

Query  3696  RIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             R M   E +  LLKLR DV+  TP++  V +KL  WCSQ+GKS+SP+ LA+L  + VD
Sbjct  873   RQM---EDQLPLLKLRTDVDRLTPKVERVYKKLPKWCSQFGKSTSPYNLAFLSNLPVD  927



>ref|XP_007009834.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY18644.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
Length=937

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/891 (56%), Positives = 644/891 (72%), Gaps = 23/891 (3%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             A RSG+  + LF  +V  +W V Y QF+ LP PL+A +AG+ GFSEV AM HVK L++LG
Sbjct  40    ATRSGFVWLTLFVVIVYSSWTVHYYQFESLPVPLTAVQAGKRGFSEVEAMKHVKGLTELG  99

Query  1404  PHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYS  1583
             PHP+GS ALD ALQYVL  +E IK+ A  +V+V+V+ FH NSGV  L+ GL+ G+T VYS
Sbjct  100   PHPVGSDALDLALQYVLAASETIKKTAHWEVDVEVDFFHVNSGVIRLLTGLFVGRTIVYS  159

Query  1584  DLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGL  1763
             DL H+++R+ PK         E  E+AILVS+H+DTVF+ EGAGD SS VAVMLE+ARG+
Sbjct  160   DLNHIILRILPKYVP------EAGENAILVSSHIDTVFSTEGAGDCSSCVAVMLELARGI  213

Query  1764  SKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQA  1943
             S+ A GFKN +VIFLFNTGEEEGL GAHSF+TQHPW +T+R+AIDLEAMGIGGKS IFQA
Sbjct  214   SQWAHGFKN-AVIFLFNTGEEEGLTGAHSFITQHPWSSTIRMAIDLEAMGIGGKSSIFQA  272

Query  1944  GPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
             GP P A++NFA VAKYPSG +++QDLFSSG IKS+TDFQVYKEVAGLSGLDF +TD+ AV
Sbjct  273   GPHPLAVENFAAVAKYPSGLIIAQDLFSSGAIKSATDFQVYKEVAGLSGLDFVYTDNGAV  332

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
             YHTKNDK+ LLK GSLQHLGEN+L FLLQ ASSS L    KT+  G   + DT V+FDIL
Sbjct  333   YHTKNDKLELLKSGSLQHLGENMLSFLLQIASSSHL-LKAKTMDGGGKPNHDTAVFFDIL  391

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsls  2483
             G+YMVVY    A+M   +VI+ SLLI   SL MGG +A +SL FS LSI+LMWI S+S S
Sbjct  392   GQYMVVYHVRLANMLQYSVIVQSLLIWTTSLLMGGYTAAVSLFFSCLSIILMWIFSISFS  451

Query  2484  vlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR  2663
              +VA++LP +SS+PVP++ASPWL +GLFAAPA LGA  GQH+ YL L +++S  +++RK+
Sbjct  452   AVVAFILPLISSSPVPYIASPWLMVGLFAAPACLGALTGQHLGYLVLQRYISNIYAKRKQ  511

Query  2664  SFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAY  2843
                  +Q D      +LE ERW+FKAG +QWL++L +GTY KIGSSY+ALVWLV PA AY
Sbjct  512   -LSPVIQAD----LIKLETERWLFKAGFVQWLVLLIIGTYYKIGSSYVALVWLVPPAFAY  566

Query  2844  VLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
              LLEA   P +  +PL   T L+GL +P+ +S+G+F+   N +IG +VRF  NPG+  +W
Sbjct  567   GLLEATLTPVRLPRPLKLATLLMGLAIPILVSAGIFIRFANVIIGLIVRFDRNPGDTPEW  626

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             + + ++++ IA ++CLT+ Y+L YIH SGAK+  V++TC+LFV+SL +V   ++P F +D
Sbjct  627   LASVVLSIFIAVVICLTLVYLLSYIHLSGAKTSVVLSTCILFVLSLAVVFSGIIPPFTED  686

Query  3195  TARAVNIVQVVDHTGN--SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFS  3365
              ARAVN+V VVD TG      +S +SL S TPG L  E +++  GFVCGR K  DFVTFS
Sbjct  687   FARAVNVVHVVDTTGRFGEKPISFVSLSSITPGKLTKEIDQVREGFVCGRHKVIDFVTFS  746

Query  3366  VKYSCWTEPTAKLGWKESRIPALRVGRDM-EGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             VKY C T    + GW ES IP L V  D   G  R T + IDT  S RW L INT EI D
Sbjct  747   VKYGCLTFDETEGGWNESDIPMLDVVYDTNNGVRRITQVAIDTKRSIRWFLAINTEEIDD  806

Query  3543  FELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRI-MEGSE-  3716
             F  K +S  +V   G K+  DGWH+++ +GGKN+PT F+LTL W K +  +   M G E 
Sbjct  807   FMFKADSMEVVPADG-KSSKDGWHIIQVSGGKNAPTRFDLTLFWVKKTEQQSYKMPGQEA  865

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             G+  LLKLR D+N  TP+   VL+KL +WCS +GKS+SP+TL++L ++ V+
Sbjct  866   GQRPLLKLRTDLNELTPKAERVLKKLPAWCSLFGKSTSPYTLSFLSSLPVN  916



>ref|XP_008233324.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Prunus mume]
Length=911

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/895 (56%), Positives = 645/895 (72%), Gaps = 30/895 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS +  + LF  +  G+W VF+ QF+ LP PL+AE+AG+ GFSE +A+ HVKAL+QLGP
Sbjct  32    QRSPFVWLTLFLAIAYGSWGVFHYQFESLPAPLTAEQAGKRGFSEFSALEHVKALTQLGP  91

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS AL  ALQYVL  AE IK+ A  +V+V+V+ F A SG N +  GL+ G+T VYSD
Sbjct  92    HSVGSDALHLALQYVLAEAEKIKKTAHWEVDVEVDSFTAKSGANRMADGLFKGRTLVYSD  151

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+++R+ PK   + +      ++AILVS+H+DTVF+  GAGD SS VAVMLE+ARG+S
Sbjct  152   LNHIIIRILPKYAPEAV------DNAILVSSHIDTVFSTGGAGDCSSCVAVMLELARGIS  205

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW  ++R+AIDLEAMGIGGKSGIFQAG
Sbjct  206   QWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSKSIRLAIDLEAMGIGGKSGIFQAG  264

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             PDPW I+ FA VAKYPSGQ+++QD+FSSG IKS+TDFQVY+EVAGLSGLDFA+ D+TAVY
Sbjct  265   PDPWPIETFAAVAKYPSGQIIAQDIFSSGAIKSATDFQVYREVAGLSGLDFAYADNTAVY  324

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ LLK GSLQHLGEN+L FLL+ A+SS LP  N T+    ++ + T VYFDILG
Sbjct  325   HTKNDKLELLKLGSLQHLGENMLAFLLKIAASSHLPKVN-TMVEEDNKGQSTAVYFDILG  383

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YMVVY + FA+M HK+VI  SLLI   SL MGG  A ISL  S  S++LMWI ++S SV
Sbjct  384   TYMVVYRQHFANMLHKSVIAQSLLIWTTSLLMGGYPAAISLALSCFSVILMWIFALSFSV  443

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             L A+++P +SS+PVP+VA+PWL +GLFAAPALLGA  GQ++ YL LH  LS  ++++K+ 
Sbjct  444   LAAFIIPLISSSPVPYVANPWLVVGLFAAPALLGALTGQYLGYLILHTHLSNVYAKKKQ-  502

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +Q D   S    EAERW++K+G LQWL++L +GTY KIGSSYLAL WLV PA AY 
Sbjct  503   ISPVIQADLIKS----EAERWLYKSGSLQWLILLILGTYYKIGSSYLALFWLVPPAFAYG  558

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   PA+  KPL   T LIGL VP+ IS+G F+ L  T+IG +VR   NPG   DW+
Sbjct  559   FLEATLTPARFPKPLKLATLLIGLAVPILISAGGFIRLAGTIIGTVVRLDRNPGGTPDWL  618

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                IVA  +AA++CLT+ Y+L YIH  GAK   V++TC+LF +SL +V++ +VP F  DT
Sbjct  619   GNVIVATYVAAVMCLTLVYLLSYIHLPGAKKSIVLSTCLLFGLSLAVVSLGIVPPFTKDT  678

Query  3198  ARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             +RAVN+V VVD T +        S++SLFS+TPG L  E E++  GF CGRDK  D VTF
Sbjct  679   SRAVNVVHVVDMTRSFDEKQDPRSYVSLFSSTPGKLTKEVEQINEGFRCGRDKVVDLVTF  738

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             SVKYSCWT      GW ES +P + V  D  GD R T + IDT  STRW+L IN +EI+D
Sbjct  739   SVKYSCWTFDDTDSGWSESDVPTMHVDSDTRGDERITRVLIDTKGSTRWTLAINADEIED  798

Query  3543  FELKD----ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSG-KRIME  3707
             F  KD    E  VLV   G+ + VDGWH+++F+GGKN+ T F+LTL W KNS+     +E
Sbjct  799   FTFKDAGSSEELVLV---GDMSSVDGWHIMQFSGGKNALTRFDLTLFWMKNSTRLDHKVE  855

Query  3708  GSEGENL-LLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             G   E   LLKLR D++  TP++  VL KL  WCSQ+GKS+SP T A+L  + V+
Sbjct  856   GKREEGTPLLKLRTDMDIVTPKVDRVLSKLPPWCSQFGKSTSPHTFAFLINLPVN  910



>emb|CDO99744.1| unnamed protein product [Coffea canephora]
Length=916

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/892 (58%), Positives = 653/892 (73%), Gaps = 25/892 (3%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             A+RS + ++ LF  VV G+W +++ QF+ LP PLSA + G+ GFSE+ A+ HVKAL+Q G
Sbjct  37    AKRSTFVVLTLFVLVVNGSWAIYHYQFETLPAPLSAVQVGKRGFSELEAIKHVKALTQFG  96

Query  1404  PHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYS  1583
             PHP+GS ALD ALQYVL  +E IK+ A  +V+V+++ FH   G N LV GL+ GKT VYS
Sbjct  97    PHPVGSDALDRALQYVLAASESIKKTAHWEVDVEIDFFHTKYGANRLVSGLFKGKTLVYS  156

Query  1584  DLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGL  1763
             DL HV MR+ PK         E  E+AILVS+H+DTVF+ EGAGD SS VAVMLE+ARG+
Sbjct  157   DLNHVAMRILPKYAT------EAGENAILVSSHIDTVFSGEGAGDCSSCVAVMLELARGI  210

Query  1764  SKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQA  1943
             S+ A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW +TVR+AIDLEAMGIGGKS IFQA
Sbjct  211   SQWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSDTVRMAIDLEAMGIGGKSTIFQA  269

Query  1944  GPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
             GP+PWAI+NFA VAKYPS Q+V+QDLFSSG IKS+TDFQ+YKEVAGLSGLDFAF D TAV
Sbjct  270   GPNPWAIKNFAAVAKYPSAQIVAQDLFSSGAIKSATDFQIYKEVAGLSGLDFAFLDDTAV  329

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
             YHTKNDK+ LLKPGSLQHLGEN+L FLLQAA+SS LP        G S   D  +YFDIL
Sbjct  330   YHTKNDKLKLLKPGSLQHLGENMLAFLLQAAASSHLPLGKAEEQDGNSS-RDAAIYFDIL  388

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsls  2483
             G Y+VV+ +  A+MF+ + I+ SLLI + S+ MGG SALISL  S+LSI+ MWI S++ +
Sbjct  389   GTYIVVFRQRLANMFYNSTIMQSLLIWVTSIMMGGSSALISLALSSLSIIFMWISSIAFA  448

Query  2484  vlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR  2663
              + A+ LP VS++PVP+V++PWL +GLF  PALLGAF+GQH+ Y+ L ++LS  +S R R
Sbjct  449   AVAAFCLPLVSASPVPYVSNPWLVVGLFGVPALLGAFIGQHLGYMILRRYLSAVYSTRYR  508

Query  2664  SFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAY  2843
                  VQ D      +L++ERW+FKAGL+QWLL+L +G Y KIGS+YLALVWLVSPA AY
Sbjct  509   DLSSSVQAD----IAKLDSERWLFKAGLIQWLLLLILGNYYKIGSTYLALVWLVSPAFAY  564

Query  2844  VLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
              LLEA   PA+  KPL  LT +IGL+ P  +SSG+ + L + ++G  VR   NPG   +W
Sbjct  565   GLLEATLSPARLPKPLKTLTLVIGLSFPFLLSSGMIIRLTSIMVGSTVRLERNPGSNPEW  624

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             I   +VA+LIAAIVCLT+ Y+L YIH SGAK P +I T +LF +S+  V +  + AF +D
Sbjct  625   IGNIVVAILIAAIVCLTLVYLLSYIHISGAKVPIIIITSILFGLSICSV-VGFLEAFTED  683

Query  3195  TARAVNIVQVVD----HTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVT  3359
             TARAVN+V VVD    H G     S++SLFSTTPGNL  EAEK+G   VCG+DK  DFV+
Sbjct  684   TARAVNVVHVVDTTGKHGGKQEPDSYVSLFSTTPGNLIKEAEKIGKKMVCGKDKMPDFVS  743

Query  3360  FSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIK  3539
             FSV YSCW +     GW +S IPA+ V RDM  + R T I +DT +STRW+LGIN  EI+
Sbjct  744   FSVNYSCWIDEDVLAGWDKSDIPAIHVERDMMDENRITEISLDTKFSTRWTLGINMEEIE  803

Query  3540  DFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIM-EG  3710
             DF+LKD  ES  L+ +GG K  VDGWH+++F+GGK +PT+F+LTL W     G     EG
Sbjct  804   DFQLKDVGESEELIPLGG-KTIVDGWHIIQFSGGKKAPTKFSLTLSWINEKHGPMTRNEG  862

Query  3711  SEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
             S GE  LLKLR DV+  TP+   VL KL  WCS +GKS+SP TLA+L ++ +
Sbjct  863   SRGERPLLKLRTDVDRLTPQTQDVLTKLPPWCSLFGKSTSPHTLAFLSSLPI  914



>ref|XP_010253691.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X4 
[Nelumbo nucifera]
Length=895

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/871 (58%), Positives = 627/871 (72%), Gaps = 41/871 (5%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNV  1502
             L+A +AG+ GFSE  AM HVKAL++LGPHP+GS ALD ALQ+VL  +E IK+ A  +V+V
Sbjct  43    LNANQAGKRGFSEQQAMEHVKALTELGPHPVGSDALDLALQHVLAASEEIKKMAHWEVDV  102

Query  1503  DVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAH  1682
              V++FHA SG N LV GL+ GKT +YSDLKHVV+R+ PK  +      E EE+AILVS+H
Sbjct  103   QVDIFHAKSGANRLVSGLFKGKTLLYSDLKHVVLRILPKYGS------EAEENAILVSSH  156

Query  1683  VDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQ  1862
             +DTVF+ EGAGD SS VAVMLE+ARG+S+ A GFKN +VIFLFNTGEEEGLNGAHSF+TQ
Sbjct  157   IDTVFSTEGAGDCSSCVAVMLELARGISQWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQ  215

Query  1863  HPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             HPW +T+R+AIDLEAMGIGGKS IFQ GPDP AI+NFAKVAKYPSGQ+++QDLF SG++K
Sbjct  216   HPWRHTIRLAIDLEAMGIGGKSSIFQGGPDPLAIENFAKVAKYPSGQIIAQDLFLSGLVK  275

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTK--------NDKVALLKPGSLQHLGENLLP  2198
             S+TDFQVYKEVAGLSGLDFA+ D  AVYHTK        NDK+ LLKPGSLQHLGEN+L 
Sbjct  276   SATDFQVYKEVAGLSGLDFAYGDAGAVYHTKAFDDSTTQNDKLKLLKPGSLQHLGENMLA  335

Query  2199  FLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsll  2378
             FLLQ A SSDL   N T +    ED D  ++FDILG YMVVY +  A M   +VI+ +LL
Sbjct  336   FLLQIARSSDL--VNGT-AMQTREDNDHAIFFDILGTYMVVYRQRLASMLQNSVIMQALL  392

Query  2379  isiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlai  2558
             I   SL MGG  A  SL  S LS++LMWI S+S S+LVA++LP + S+PVP++A+PWL I
Sbjct  393   IWTMSLLMGGFPAAASLGLSCLSVLLMWIFSLSFSILVAFLLPLICSSPVPYIANPWLII  452

Query  2559  glfaapallgafVGQHVVYLFLHKFLSYTFSE--RKRSFILFVQDDEDVSECELEAERWM  2732
             GLF APA+LGA  GQHV +  L K+L +  S+  +KRS ++           +LE ERW+
Sbjct  453   GLFVAPAVLGALTGQHVGFRILQKYLQHASSKGGQKRSHVV------QAELIKLETERWL  506

Query  2733  FKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLI  2903
             FKAG +QWL++L VG++ KIGSSYLALVWLVSPA AY L+EA   P +S KPL   T L+
Sbjct  507   FKAGFVQWLVLLMVGSFYKIGSSYLALVWLVSPAFAYGLIEATLSPVRSPKPLKIATLLL  566

Query  2904  GLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLP  3083
             GLTVP+ +S+G+F+ LV T+ G +VRF  NPG   +W+ + +VAVL+AAI+CLT+ Y+  
Sbjct  567   GLTVPVLVSAGIFIRLVATMTGMMVRFDRNPGSTPEWLGSIMVAVLVAAIICLTLVYLFS  626

Query  3084  YIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTG----NSSV  3251
             Y+H SGAK  FV   C LF ++L  V   +VP F +D ARAVN+V VV+ TG    N S 
Sbjct  627   YVHLSGAKRSFVYANCALFCLALTAVVSGIVPPFTEDVARAVNVVHVVETTGRYGENRSP  686

Query  3252  VSHISLFSTTPGNLDVEAEKLG--GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRI  3425
             VS+ISLFSTTPG L  E E L   GF CGR+K  DFVTF+V Y CW+    + GW ES I
Sbjct  687   VSYISLFSTTPGKLTKEVEYLKEEGFTCGREKTLDFVTFTVNYGCWSSEDTESGWMESDI  746

Query  3426  PALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVD  3605
             P L+V  D  G+ R T I IDT  STRWSL INT EI+DF  +  S  LV V G KNGV+
Sbjct  747   PTLKVENDKRGNNRITQISIDTKDSTRWSLAINTEEIEDFIFEGNSEELVPV-GNKNGVN  805

Query  3606  GWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGEN---LLLKLRADVNTKTPEMV  3776
             GWH+++F+GGK SP  FN+TL W  NS+  R+   S+ E     LLKLR DV+  TP+  
Sbjct  806   GWHIIQFSGGKISPRMFNVTLFWLNNST--RLTNKSDTEKKDPYLLKLRTDVDRLTPKAK  863

Query  3777  AVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              +L KL  WCS +GKS+SP TLA+L  + VD
Sbjct  864   RILMKLPPWCSLFGKSTSPHTLAFLSKLPVD  894



>ref|XP_010558756.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010558757.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Tarenaya hassleriana]
 ref|XP_010558758.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010558759.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Tarenaya hassleriana]
Length=897

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/886 (55%), Positives = 636/886 (72%), Gaps = 24/886 (3%)
 Frame = +3

Query  1215  GNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALS  1394
             G ++ R    + +    +   TW V+  Q  +LP PLS+E+AG+ GFSEV AM HV+ L+
Sbjct  26    GAISPRRSGIVWLALCLLAYSTWTVYNYQHVILPPPLSSEQAGKRGFSEVEAMKHVEELT  85

Query  1395  QLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTP  1574
             QLGPHP+ S  LD A+QYV ++AE IK+ A  +V+VDVE+F A +G N +V GL+ GKT 
Sbjct  86    QLGPHPVSSDGLDDAVQYVFEMAEKIKKTAHWEVDVDVELFQAKTGANRMVSGLFKGKTL  145

Query  1575  VYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVA  1754
              YSDL H+++R+ PK  +D        E+AILVS+H+DTVF+  GAGD SS VAVMLE+A
Sbjct  146   AYSDLGHIIIRILPKYESDA------GENAILVSSHIDTVFSTGGAGDCSSCVAVMLELA  199

Query  1755  RGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGI  1934
             R LS+ A GFKN SVIFLFNTGEEEGL+GAHSF+TQHP  +T+R+A+DLEAMG+GGKS I
Sbjct  200   RSLSQWAHGFKN-SVIFLFNTGEEEGLSGAHSFITQHPLNSTIRLALDLEAMGVGGKSAI  258

Query  1935  FQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDH  2114
             FQAGPDPWAI+NFA VAKYPSGQ++ QDLF+SGVIKSSTDFQVY+EV+GLSGLDFA+ D+
Sbjct  259   FQAGPDPWAIENFASVAKYPSGQIIGQDLFASGVIKSSTDFQVYQEVSGLSGLDFAYADN  318

Query  2115  TAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYF  2294
             TAVYHTKNDK+ LLKPGSLQHLGEN+L FL++AASSS+LP  NK L   +  + D+ +YF
Sbjct  319   TAVYHTKNDKIELLKPGSLQHLGENVLAFLIRAASSSNLPN-NKELQGEEKSNPDSAIYF  377

Query  2295  DILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsv  2474
             DILG+YMVVY +SF  M H +VI+ SLLI + SL+MGG SA+ISL+ S LSI+   I SV
Sbjct  378   DILGKYMVVYRQSFGTMLHNSVIMQSLLILVTSLFMGGYSAVISLLLSCLSIIFALIFSV  437

Query  2475  slsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSE  2654
             + SV VA++LP +SS+PVPF + PWLA+GLF +P++LG+  GQH+ +L L K  S  +S+
Sbjct  438   AFSVSVAFILPLISSSPVPFASHPWLAVGLFVSPSILGSITGQHLTFLLLQKNASRVYSK  497

Query  2655  RKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPA  2834
             RK+   +   D       +L+AERW+FKAG +QWL++LA+GTY KIGS+YLALVWLV PA
Sbjct  498   RKQLSPVVRAD-----LAKLDAERWLFKAGSIQWLVLLALGTYYKIGSAYLALVWLVPPA  552

Query  2835  LAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQ  3005
              AY LLEA   PA+  +PL  +T L GL VP+ +SS  F+ L  T+IG L+RF  NPG  
Sbjct  553   FAYGLLEATLTPARLPRPLKFVTLLFGLAVPVLVSSASFIRLAGTMIGMLIRFDRNPGGT  612

Query  3006  ADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAF  3185
              +W+ + +VAV+IA  V LTM Y+L Y+H+SGAK   V   C++  +SL +V+   +PAF
Sbjct  613   PEWLGSVMVAVIIATFVTLTMVYLLSYVHHSGAKRSVVAMLCIITGLSLALVSSGTIPAF  672

Query  3186  VDDTARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
              +DTARAVN+V VVD T     +S++SLFS TPGNL++EAEK+G GF CG+++  DFV F
Sbjct  673   TEDTARAVNVVHVVDTTKGQDPISYVSLFSYTPGNLNMEAEKIGEGFTCGKERNTDFVGF  732

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
                YSC TE  A +GW E  IP +RV      D  A+ + IDT  S+RW L IN  EI+D
Sbjct  733   EATYSCVTEEGAGVGWDEGNIPTMRV-----LDDDASGVSIDTRGSSRWVLAINMEEIED  787

Query  3543  FELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGE  3722
             F L+ E  VLV  GG+K  VDGWH ++FAGG+ +P  F   L+  K   G+        +
Sbjct  788   FTLEAEDEVLVPRGGKKASVDGWHTVQFAGGRKAPRRF--VLRVLKGRKGEESEPEKRKK  845

Query  3723  NLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
               LLKLR D N  TP++  VL KL  WCS +GKS+SP+TLA+L ++
Sbjct  846   RPLLKLRTDFNRATPKVEDVLRKLPPWCSLFGKSTSPYTLAFLASL  891



>ref|XP_010067303.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Eucalyptus grandis]
 ref|XP_010067304.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Eucalyptus grandis]
 gb|KCW65409.1| hypothetical protein EUGRSUZ_G02835 [Eucalyptus grandis]
Length=914

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/888 (56%), Positives = 636/888 (72%), Gaps = 22/888 (2%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS +  + LF  V   +W V+  QF+ LP PL+AE+AG+ GFSEV AM HVKAL  +GP
Sbjct  41    RRSPFVCLALFGVVTYCSWAVYRYQFESLPAPLTAEQAGKRGFSEVEAMKHVKALIDVGP  100

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S ALD A+QYVL+ +E IK+ A  +V+V V+VFHA SG N LVGGL+ G+T VYSD
Sbjct  101   HPVRSDALDEAIQYVLEASEKIKKIAHWEVDVQVDVFHAQSGTNRLVGGLFRGRTLVYSD  160

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+V+++SPK  A      E  + AILVS+H+DTVF+ EGAGD SS VAVMLE+AR +S
Sbjct  161   LHHIVLKVSPKYVA------EAGDSAILVSSHIDTVFSTEGAGDCSSCVAVMLELARAVS  214

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ SVIFLFNTGEEEGLNGAHSF+TQHPW  ++ +A+DLEAMGIGGKS IFQAG
Sbjct  215   QWAHGFKS-SVIFLFNTGEEEGLNGAHSFITQHPWSKSIHLAVDLEAMGIGGKSSIFQAG  273

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P+PWAI+NFA  AKYPSG V++QDLF+SG IKS+TDFQVYKEVAGLSGLDFA+TD++AVY
Sbjct  274   PNPWAIENFASAAKYPSGHVIAQDLFASGAIKSATDFQVYKEVAGLSGLDFAYTDNSAVY  333

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ LLK GSLQHLGEN+L FLLQ ASS DL     T   G S    + +YFDILG
Sbjct  334   HTKNDKLELLKSGSLQHLGENMLAFLLQIASSPDLSGVQGTKDEGISAS-SSAIYFDILG  392

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YMV+Y + FA+M H +V + SLLI   SL MGG  A +SLV S LSI+LMWI S+S S+
Sbjct  393   MYMVLYHQGFANMLHNSVALQSLLIWSTSLLMGGYPAAVSLVLSCLSIILMWIFSLSFSL  452

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             L A++LP +S++PVP+VASPWL IGLFAAPALLGA  GQH+ +L L  +LS  +S+R++ 
Sbjct  453   LSAFILPLLSTSPVPYVASPWLVIGLFAAPALLGALTGQHLGFLILQMYLSNEYSKREQ-  511

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +      +  +LEAERW++KAG +QWL++L +G Y +IGSSYLALVWLV PA +Y 
Sbjct  512   ----LSPLTQSTLIKLEAERWLYKAGSVQWLILLVIGNYYRIGSSYLALVWLVPPAFSYG  567

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   PA+  KPL   T L GL+VP+ +S+GVF+ LV T+IG  VRF  NPG+  +W+
Sbjct  568   FLEATLTPARFPKPLKLATLLFGLSVPIVVSAGVFIRLVGTIIGMAVRFDRNPGDTPEWM  627

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                IVAV IA ++ LTM Y+L Y+H SGAK   V+    LF +SL  V   + P F +DT
Sbjct  628   VNVIVAVFIALVISLTMVYLLSYVHLSGAKKSIVLAALALFGLSLAAVLSGVAPPFTEDT  687

Query  3198  ARAVNIVQVVDHTGNSSVV--SHISLFSTTPGNLDVEAEKL-GGFVCGRDKAFDFVTFSV  3368
             ARAVN+V +VD T +      S++S FSTTPG L  E E++ GGF CGRDK  D VT SV
Sbjct  688   ARAVNVVHIVDATTSKQEQPDSYVSFFSTTPGKLTKEVEQIGGGFTCGRDKIVDLVTLSV  747

Query  3369  KYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFE  3548
             KY CW+    + GW ++ IP L V +D +GD R T + +DT  STRW L +N   I+DF+
Sbjct  748   KYGCWSYDDTEGGWSKTDIPTLAVIKDDKGDKRITEVLLDTKSSTRWVLAVNAEYIEDFK  807

Query  3549  LKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE-GEN  3725
             L+  S  L+ +  +K+ VDGWHV++F+GGK SPT F++TL W  NS+     EGS+  + 
Sbjct  808   LEGNSEELIPL-DDKSSVDGWHVIQFSGGKKSPTRFDMTLVW-ANSTQIAHGEGSQKNQQ  865

Query  3726  LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              LLKLR D++  TP+   VL KL SWCS +GKS+SP TLA+L  + V+
Sbjct  866   PLLKLRTDMDRLTPKAEKVLMKLPSWCSLFGKSTSPQTLAFLRDLPVE  913



>ref|XP_010067302.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Eucalyptus grandis]
Length=918

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/888 (56%), Positives = 636/888 (72%), Gaps = 22/888 (2%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS +  + LF  V   +W V+  QF+ LP PL+AE+AG+ GFSEV AM HVKAL  +GP
Sbjct  45    RRSPFVCLALFGVVTYCSWAVYRYQFESLPAPLTAEQAGKRGFSEVEAMKHVKALIDVGP  104

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S ALD A+QYVL+ +E IK+ A  +V+V V+VFHA SG N LVGGL+ G+T VYSD
Sbjct  105   HPVRSDALDEAIQYVLEASEKIKKIAHWEVDVQVDVFHAQSGTNRLVGGLFRGRTLVYSD  164

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+V+++SPK  A      E  + AILVS+H+DTVF+ EGAGD SS VAVMLE+AR +S
Sbjct  165   LHHIVLKVSPKYVA------EAGDSAILVSSHIDTVFSTEGAGDCSSCVAVMLELARAVS  218

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ SVIFLFNTGEEEGLNGAHSF+TQHPW  ++ +A+DLEAMGIGGKS IFQAG
Sbjct  219   QWAHGFKS-SVIFLFNTGEEEGLNGAHSFITQHPWSKSIHLAVDLEAMGIGGKSSIFQAG  277

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P+PWAI+NFA  AKYPSG V++QDLF+SG IKS+TDFQVYKEVAGLSGLDFA+TD++AVY
Sbjct  278   PNPWAIENFASAAKYPSGHVIAQDLFASGAIKSATDFQVYKEVAGLSGLDFAYTDNSAVY  337

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ LLK GSLQHLGEN+L FLLQ ASS DL     T   G S    + +YFDILG
Sbjct  338   HTKNDKLELLKSGSLQHLGENMLAFLLQIASSPDLSGVQGTKDEGISAS-SSAIYFDILG  396

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YMV+Y + FA+M H +V + SLLI   SL MGG  A +SLV S LSI+LMWI S+S S+
Sbjct  397   MYMVLYHQGFANMLHNSVALQSLLIWSTSLLMGGYPAAVSLVLSCLSIILMWIFSLSFSL  456

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             L A++LP +S++PVP+VASPWL IGLFAAPALLGA  GQH+ +L L  +LS  +S+R++ 
Sbjct  457   LSAFILPLLSTSPVPYVASPWLVIGLFAAPALLGALTGQHLGFLILQMYLSNEYSKREQ-  515

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +      +  +LEAERW++KAG +QWL++L +G Y +IGSSYLALVWLV PA +Y 
Sbjct  516   ----LSPLTQSTLIKLEAERWLYKAGSVQWLILLVIGNYYRIGSSYLALVWLVPPAFSYG  571

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   PA+  KPL   T L GL+VP+ +S+GVF+ LV T+IG  VRF  NPG+  +W+
Sbjct  572   FLEATLTPARFPKPLKLATLLFGLSVPIVVSAGVFIRLVGTIIGMAVRFDRNPGDTPEWM  631

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                IVAV IA ++ LTM Y+L Y+H SGAK   V+    LF +SL  V   + P F +DT
Sbjct  632   VNVIVAVFIALVISLTMVYLLSYVHLSGAKKSIVLAALALFGLSLAAVLSGVAPPFTEDT  691

Query  3198  ARAVNIVQVVDHTGNSSVV--SHISLFSTTPGNLDVEAEKL-GGFVCGRDKAFDFVTFSV  3368
             ARAVN+V +VD T +      S++S FSTTPG L  E E++ GGF CGRDK  D VT SV
Sbjct  692   ARAVNVVHIVDATTSKQEQPDSYVSFFSTTPGKLTKEVEQIGGGFTCGRDKIVDLVTLSV  751

Query  3369  KYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFE  3548
             KY CW+    + GW ++ IP L V +D +GD R T + +DT  STRW L +N   I+DF+
Sbjct  752   KYGCWSYDDTEGGWSKTDIPTLAVIKDDKGDKRITEVLLDTKSSTRWVLAVNAEYIEDFK  811

Query  3549  LKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE-GEN  3725
             L+  S  L+ +  +K+ VDGWHV++F+GGK SPT F++TL W  NS+     EGS+  + 
Sbjct  812   LEGNSEELIPL-DDKSSVDGWHVIQFSGGKKSPTRFDMTLVW-ANSTQIAHGEGSQKNQQ  869

Query  3726  LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              LLKLR D++  TP+   VL KL SWCS +GKS+SP TLA+L  + V+
Sbjct  870   PLLKLRTDMDRLTPKAEKVLMKLPSWCSLFGKSTSPQTLAFLRDLPVE  917



>ref|XP_004308790.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Fragaria 
vesca subsp. vesca]
Length=907

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/895 (55%), Positives = 650/895 (73%), Gaps = 36/895 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS +  + LF  ++  ++ V++ QF+ LP PL+A++AG+ GFSE +A  HV+AL++LGP
Sbjct  34    HRSPFVCLTLFAVLIYSSYGVYHYQFESLPVPLTADQAGKRGFSEFSARKHVRALTELGP  93

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS A+  ALQYVL   E IK+ A  +V V+V+ F A +G N +V GL+ GKT VYSD
Sbjct  94    HPVGSDAITLALQYVLSEVEEIKKTAHWEVEVEVDEFVAKTGANQMVSGLFKGKTLVYSD  153

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+V+R+SPK  AD +      ++A+LVS+H+DTVF+  GAGD SS VAVMLE+ARG+S
Sbjct  154   LSHIVVRVSPKYAADSV------DNAVLVSSHIDTVFSTGGAGDCSSCVAVMLELARGVS  207

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ +VIFLFNTGEEEGL+GAHSF+TQHPW  T+R+AIDLEAMGIGGKSGIFQAG
Sbjct  208   QWAHGFKH-AVIFLFNTGEEEGLSGAHSFITQHPWRKTIRLAIDLEAMGIGGKSGIFQAG  266

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+N+A  AKYPSG ++ QD+FSSG IKS+TDFQVYKE+AGLSGLDFA+T++ AVY
Sbjct  267   PLPWAIENYAAAAKYPSGHIIGQDIFSSGAIKSATDFQVYKELAGLSGLDFAYTENGAVY  326

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDE---DTVVYFD  2297
             HTKNDK  LL+ GSLQHLGEN+L FLL+ A+SS LP  N      + ED+      +YFD
Sbjct  327   HTKNDKFELLQLGSLQHLGENMLAFLLRVAASSYLPKAN----VMQEEDKTGLSAAIYFD  382

Query  2298  ILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvs  2477
             ILG YM+VY + FA M + +VI  SLLI   SL MGG  A +SLV S LS++LMW  ++S
Sbjct  383   ILGWYMIVYRQRFARMLYNSVIAQSLLIWTTSLLMGGYPAAVSLVLSCLSVILMWTFALS  442

Query  2478  lsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSER  2657
              SV+VA+++P +SS+PVP++A+PWL +GLFAAPALLGA  GQ++ YL LHK+L+ T+S++
Sbjct  443   FSVIVAFIIPLISSSPVPYIANPWLVVGLFAAPALLGALTGQYLGYLVLHKYLANTYSKK  502

Query  2658  KRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPAL  2837
             K+     +         +LEAERW++KAG +QWL++L++GTY +IGSSYLAL WLV PA 
Sbjct  503   KQ-----LSPAIRTDLVKLEAERWLYKAGSIQWLILLSLGTYYRIGSSYLALAWLVPPAF  557

Query  2838  AYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQA  3008
             AY  LEA   PA+S KPL   T LIGL +P+ +S+GVF+ L  T+IG +VRF  NPG   
Sbjct  558   AYGFLEATLSPARSPKPLKLATLLIGLAIPVILSAGVFIRLAGTIIGGMVRFDRNPGGTP  617

Query  3009  DWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFV  3188
             DW+   I+AV +A ++CLT+ Y+L YIH SGAK   +++TC +F +SL +V    VPAF 
Sbjct  618   DWLGNVILAVFVATVMCLTLVYLLSYIHLSGAKRLIILSTCAMFGLSLALVLSGTVPAFT  677

Query  3189  DDTARAVNIVQVVDHTGN-SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             +DT+RAVN+V VVD T +     S++SLFS TPG L  E E++  GF CGRD+ FDFVTF
Sbjct  678   NDTSRAVNVVHVVDTTRSIEDPRSYVSLFSLTPGKLTKEVEQIKEGFRCGRDQVFDFVTF  737

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             +VKY CWTE  +  GW E+ IP + V  D +G  R T + IDT  S RW+L INTNEI+D
Sbjct  738   TVKYGCWTEDDSDSGWSEADIPVMHVQSDTQGIERTTEVIIDTKGSIRWALAINTNEIRD  797

Query  3543  FELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSS----GKRIM  3704
             +   D   S  LVSV G+K+  DGWHV++FAGG NSP  F LTL W K+S+    GKR  
Sbjct  798   YAFTDAGNSEELVSV-GDKSNADGWHVIQFAGGNNSPRTFGLTLFWTKSSTLKADGKR--  854

Query  3705  EGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                +G+  LLKLR D++  TP++  VL KL +WCS +GKS+SP+TLA+L ++ VD
Sbjct  855   ---DGQAPLLKLRTDMDIVTPKVERVLSKLPTWCSLFGKSTSPYTLAFLSSLPVD  906



>ref|XP_002312017.2| hypothetical protein POPTR_0008s03930g [Populus trichocarpa]
 gb|EEE89384.2| hypothetical protein POPTR_0008s03930g [Populus trichocarpa]
Length=916

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/894 (55%), Positives = 627/894 (70%), Gaps = 30/894 (3%)
 Frame = +3

Query  1230  RSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPH  1409
             RSG   ++L   ++   + V Y QF+ LP PL+AE+AG+ GFSE+ A+ HVKAL+  GPH
Sbjct  38    RSGSVWIILSAVIIYSCYSVHYYQFENLPSPLTAEQAGKRGFSEIQAIKHVKALTDFGPH  97

Query  1410  PLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDL  1589
             P+GS +LD ALQYVL   E IK+ A+ +V+V+V+ FHA +G N L  GL+ GKT VY+DL
Sbjct  98    PVGSDSLDLALQYVLAEVENIKKNAYYEVDVEVDFFHAKTGANRLTSGLFRGKTLVYADL  157

Query  1590  KHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSK  1769
             KHVV+R+ PK T +     +  ++ ILVS+H+DTVF+  GAGD SS VAVMLE+ARG+S+
Sbjct  158   KHVVLRILPKFTPN-----QAADNTILVSSHIDTVFSTGGAGDCSSCVAVMLELARGISQ  212

Query  1770  QATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP  1949
              A GFKN  VIFLFNTGEEEGL+GAHSF+TQHPW  T+R+A+DLEAMG+GGKSGIFQAGP
Sbjct  213   WAHGFKNG-VIFLFNTGEEEGLSGAHSFITQHPWSKTIRLAVDLEAMGVGGKSGIFQAGP  271

Query  1950  DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYH  2129
              PWAI+NFA  AKYPSG +++QDLFS+GVIKS+TDFQVYKEVAGLSGLDFAFTD+ AVYH
Sbjct  272   HPWAIENFASAAKYPSGNIIAQDLFSAGVIKSATDFQVYKEVAGLSGLDFAFTDNGAVYH  331

Query  2130  TKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP---NKTLSTGKSEDEDTVVYFDI  2300
             TKNDK+ LLK GSLQHLGEN+L FLL+ ASS  LP     +K L TG     DT ++FDI
Sbjct  332   TKNDKLDLLKSGSLQHLGENMLAFLLRIASSPHLPKSKDMDKELKTG----HDTAIFFDI  387

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YM+VY + FA M H +VI+ SLLI  ASL+MGG SA ISL  S LS +LM + S+S 
Sbjct  388   LGTYMIVYSQRFASMLHNSVILQSLLIWAASLFMGGSSATISLGLSCLSAILMLLFSISF  447

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
             SV  A+++P +S +PVP+VA+P L +GLFAAPALLGA  GQH+ YL L K+L   +S++K
Sbjct  448   SVFAAFIVPQISPSPVPYVANPLLVLGLFAAPALLGALTGQHLGYLILKKYLLNVYSKKK  507

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
             +   + + D       +LEAERW++KAG +QWL++L +G Y KIGSSYLA+ WLV PA A
Sbjct  508   QLSSVIIAD-----LVKLEAERWLYKAGFVQWLVLLIIGNYYKIGSSYLAVFWLVPPAFA  562

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   PA+  KPL   T ++GL VP+ ISSG F+    T+IG  VRF  NPG   +
Sbjct  563   YGLLEATLTPARLPKPLKLATLMMGLAVPILISSGTFIRFAGTIIGMAVRFDRNPGGTPE  622

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   I+++ IA  +CLT  YVL Y+H SGAK   ++ T +LF +SL +V    +  F +
Sbjct  623   WLWNIIISIFIAVCICLTFIYVLSYVHLSGAKRSIILATSILFGLSLILVLSGFIQPFTE  682

Query  3192  DTARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD +G        +S+ISLFS TPG L+ E E++  GF CG+DK  DFV
Sbjct  683   DTARAVNVVHVVDASGRYGEKQDPLSYISLFSNTPGKLEKEVEQIKEGFTCGKDKVVDFV  742

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TFSV Y CWT    + GW ES IP L V  D +G  R T + IDT  S RWSL INT EI
Sbjct  743   TFSVNYGCWTHDDTESGWSESDIPTLHVDSDTKGGERITRVLIDTKSSVRWSLAINTKEI  802

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKN---SSGKRIME  3707
             +DF LK  S  L+   G K  VDGWH ++F+GGK SP +F LTL W      S+      
Sbjct  803   EDFILKGNSEELIPY-GNKTSVDGWHHIQFSGGKESPRKFELTLFWSVKTMPSADNVDRT  861

Query  3708  GSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
               + +  LLKLR DVN  TP+   VL KL +WCS +GKS+SP TLA+L ++ V+
Sbjct  862   VIQDQRPLLKLRTDVNRLTPKAERVLAKLPTWCSLFGKSTSPLTLAFLSSLPVN  915



>ref|XP_009764349.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Nicotiana 
sylvestris]
 ref|XP_009764350.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Nicotiana 
sylvestris]
Length=826

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/786 (62%), Positives = 599/786 (76%), Gaps = 20/786 (3%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             +A+RS Y I+ LF  V  GTW V+  QF  LP+PL AEE G+ GFSE  A+ HVKAL+QL
Sbjct  29    VAKRSKYVILALFVLVAYGTWSVYQHQFLNLPKPLGAEEVGKRGFSEHEAIKHVKALTQL  88

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHP+GS ALD ALQYVLQ  E IKE+A  +V+V++++FHA SG N +VGGL+ GKT VY
Sbjct  89    GPHPVGSDALDHALQYVLQATETIKEKAHWEVDVELDLFHAKSGANLMVGGLFKGKTLVY  148

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SDL H+V+R+SPK  +      E  E+AILVS+H+DTVF+AEGAGD SS VAVMLE+ARG
Sbjct  149   SDLNHIVLRISPKYAS------EATENAILVSSHIDTVFSAEGAGDCSSCVAVMLELARG  202

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             +S+ A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW +TV +AIDLEAMG+GGKSGIFQ
Sbjct  203   VSQWAHGFKS-AVIFLFNTGEEEGLNGAHSFITQHPWSDTVTMAIDLEAMGVGGKSGIFQ  261

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGP PWAI+NFA  AKYPSGQ+V+QD+F SG IKS+TDFQVY+E+AGLSGLDFA+ D+TA
Sbjct  262   AGPQPWAIENFALAAKYPSGQIVAQDVFKSGAIKSATDFQVYQELAGLSGLDFAYADNTA  321

Query  2121  VYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDI  2300
             VYHTKNDK+ LLKPGSLQHLGEN+L FLL+ A+S+ LP    T S GKS  +DT +YFDI
Sbjct  322   VYHTKNDKLKLLKPGSLQHLGENMLAFLLKVATSAHLPKGKATDSRGKS-GQDTAIYFDI  380

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YMVV+ + FA M + +VI+ S+LI   SL+MGG SA++SL  S+LS++LMWI ++  
Sbjct  381   LGAYMVVFRQRFARMLYNSVILQSILIWTTSLFMGGYSAMVSLALSSLSLILMWICAIGF  440

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
             S+LVA+VLP VSS+P+PFV+SPWL +GLF APA+LGAF GQHV YL L K+L+ TFS R 
Sbjct  441   SLLVAFVLPLVSSSPIPFVSSPWLVVGLFGAPAVLGAFTGQHVGYLILVKYLTKTFSRRN  500

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
              +    VQDD      +L+AERW+FKAGL+QW ++L VG + KIGSSYLALVWL SPA A
Sbjct  501   VNLPFVVQDD----LAKLDAERWLFKAGLMQWFVLLIVGNFYKIGSSYLALVWLASPAFA  556

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   PA+  KPL  +T LIGL+VP  +SSG+ V LV TLIG  VR   NPG   +
Sbjct  557   YGLLEATLSPARLPKPLKTVTLLIGLSVPFLLSSGIIVHLVATLIGSAVRLERNPGSNPE  616

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   I+AVLIAAI CLT+ Y+L YIH SGAK P +  TC+LF +SL MV + +VP F +
Sbjct  617   WLGNVIIAVLIAAIACLTLVYLLSYIHISGAKVPLITVTCILFGISLTMVQLGVVPPFTE  676

Query  3192  DTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD  G        VS ISLFSTTPGNL  E E++G GFVCG D+  DFV
Sbjct  677   DTARAVNVVHVVDMGGANDKKQEPVSRISLFSTTPGNLIKEVEQIGEGFVCGTDEPLDFV  736

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TFSVKY CW++  A +GW E  IP + V  D +GD R T + IDT  STRW+LGINT+EI
Sbjct  737   TFSVKYGCWSDKNANIGWHELDIPLIHVENDTKGDNRVTHVSIDTKVSTRWTLGINTDEI  796

Query  3537  KDFELK  3554
             +DF LK
Sbjct  797   EDFHLK  802



>ref|XP_008357256.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Malus 
domestica]
Length=911

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/895 (55%), Positives = 638/895 (71%), Gaps = 33/895 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS +  + LF  +   ++ V+  QF+ LPEPL+A++AG+ GFSE +A+ HV+AL+QLGP
Sbjct  35    QRSPFVWLTLFLAIGYCSYGVYQYQFESLPEPLTADQAGKRGFSEFSALKHVEALTQLGP  94

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS AL+ ALQYVL  AE IK+ A  +V V+V+ FH  SG N +VGGL+ G+T VY+D
Sbjct  95    HSVGSDALNLALQYVLAEAEKIKKTAHWEVXVEVDSFHVESGANRMVGGLFKGRTLVYAD  154

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+V+R+ PK         E  ++AILVS+H+DTVF+  GAGD SS VAVMLE+ARG+S
Sbjct  155   LNHIVVRVLPKYAP------ESVDNAILVSSHIDTVFSTGGAGDCSSCVAVMLELARGVS  208

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEAMGIGGKSGIFQA 
Sbjct  209   QWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSTTIRLAVDLEAMGIGGKSGIFQA-  266

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
              D W+I+NFA VAKYPSGQ++ QD+FSSG IKS+TDFQVYKEVAGL GLDFA+TD+TAVY
Sbjct  267   -DAWSIENFASVAKYPSGQIIGQDIFSSGAIKSATDFQVYKEVAGLPGLDFAYTDNTAVY  325

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L   GSLQHLGEN+L FLL+ A+SS LP  +  +   K   E  V+YFDILG
Sbjct  326   HTKNDKIELHTLGSLQHLGENMLAFLLKIAASSHLPKASAVVEENKG--ETAVIYFDILG  383

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YM+VY + FA+M H +VI  SLLI   SL MGG  A ISL  S LSI+LMWI ++S ++
Sbjct  384   SYMIVYRQRFANMLHNSVIAQSLLIWTTSLLMGGYPAAISLALSCLSIILMWIFAISFAL  443

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             L A+++  +SS+PVP+VA+PWL IGLF APAL+GA  GQ++ YL LH +LS  ++++K+ 
Sbjct  444   LPAFIISLLSSSPVPYVANPWLVIGLFGAPALIGALSGQYLGYLGLHTYLSKAYAKKKQ-  502

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +  D      +LEAERW++K+G LQWL++L +GTY KIGS+YLAL WLV PA AY 
Sbjct  503   ----LSADIQAGLVKLEAERWLYKSGSLQWLILLILGTYYKIGSTYLALAWLVPPAFAYG  558

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   PA+  KPL   T LIGL VP+ ISSG F+ L   +IG +VR   NPG   +W+
Sbjct  559   FLEATLTPARFPKPLRLATLLIGLAVPIVISSGGFIRLAGMVIGTVVRLDRNPGGTPEWL  618

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                IVAV +A +VCLT+ Y+L YIH SGAK   V++TC+LF +SL +V + +VP F  DT
Sbjct  619   ANVIVAVFVAVVVCLTLVYLLSYIHLSGAKRSIVLSTCMLFGLSLAVVLLGIVPPFTADT  678

Query  3198  ARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             +RAVN+V VVD T    GN    S++SLFS TPG L  EAE++  GF CGRDK  D VTF
Sbjct  679   SRAVNVVHVVDTTGSVDGNQDPRSYVSLFSFTPGKLTEEAEQINEGFRCGRDKVVDLVTF  738

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             S KYSCWT      GW +S IP + VG D  G+ R T + +DT  STRW+L IN ++I+D
Sbjct  739   SAKYSCWTYDDGDSGWXKSDIPTMNVGSDTHGNERTTRVLLDTKGSTRWTLAINADDIED  798

Query  3543  FELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             F  K    S  L S+ G+ + VDGWH+++++GG+N+PT F+L L W +NS+  R+    E
Sbjct  799   FTFKVAGSSEELASL-GDMSSVDGWHIIQYSGGQNAPTRFDLALFWSQNST--RLAHNVE  855

Query  3717  GEN----LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             G+      LLKLR DV+  TP++  VL KL  WCS +GKS+SP TLA+L  + V+
Sbjct  856   GKRDEHAPLLKLRTDVDIVTPKVERVLSKLPPWCSLFGKSTSPHTLAFLSNLPVN  910



>ref|XP_011031740.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Populus euphratica]
Length=915

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/895 (55%), Positives = 625/895 (70%), Gaps = 29/895 (3%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             + RSG   ++L   ++   + V Y QF+ LP PL+AE+AG+ GFSE+ A+ HVKAL+  G
Sbjct  36    STRSGSVWIILSAVIIYSCYSVHYYQFENLPSPLTAEQAGKRGFSEIQAIKHVKALTDFG  95

Query  1404  PHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYS  1583
             PHP+GS +LD ALQYVL   E IK+ A+ +V+V+V+ FHA +G N L  GL+ GKT VY+
Sbjct  96    PHPVGSDSLDLALQYVLAEVENIKKNAYYEVDVEVDFFHAKTGANRLTSGLFRGKTLVYA  155

Query  1584  DLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGL  1763
             DLKHVV+R+ PK T +     +  ++ ILVS+H+DTVF+  GAGD SS VAVMLE+ARG+
Sbjct  156   DLKHVVLRILPKFTPN-----QAADNTILVSSHIDTVFSTGGAGDCSSCVAVMLELARGI  210

Query  1764  SKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQA  1943
             S+ A GFKN  VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEAMG+GGKSGIFQA
Sbjct  211   SQWAHGFKNG-VIFLFNTGEEEGLNGAHSFITQHPWSKTIRLAVDLEAMGVGGKSGIFQA  269

Query  1944  GPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
             GP PWAI+NFA  AKYPSG +++QDLFS+GVIKS+TDFQVYKE AGLSGLDFAFTD+ AV
Sbjct  270   GPHPWAIENFASAAKYPSGNIIAQDLFSAGVIKSATDFQVYKEDAGLSGLDFAFTDNGAV  329

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP---NKTLSTGKSEDEDTVVYF  2294
             YHTKNDK+ LLK GSLQHLGEN+L FLL+ ASS  LP     +K L TG     DT ++F
Sbjct  330   YHTKNDKLDLLKSGSLQHLGENMLAFLLRIASSPHLPKSKDMDKELKTG----HDTAIFF  385

Query  2295  DILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsv  2474
             DILG YM+VY + FA M H +VI+ SLLI  ASL+MGG SA ISL  S LS +LM   SV
Sbjct  386   DILGTYMIVYSQRFASMLHNSVILQSLLIWAASLFMGGSSATISLGLSCLSAILMLSFSV  445

Query  2475  slsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSE  2654
             S SV  A+++P +S +PVP+VA+P L +GLFAAPALLGA  GQH+ YL L K+L   +S+
Sbjct  446   SFSVFAAFIVPQISPSPVPYVANPLLVLGLFAAPALLGALTGQHLGYLILKKYLLNVYSK  505

Query  2655  RKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPA  2834
             +K+   + + D       +LEAERW++KAG +QWL++L VG Y KIGSSYLA+ WLV PA
Sbjct  506   KKQLSSVIIAD-----VVKLEAERWLYKAGFVQWLVLLIVGNYYKIGSSYLAVFWLVPPA  560

Query  2835  LAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQ  3005
              AY LLEA   PA+  KPL   T L+GL VP+ ISSG F+ L  T+IG  VRF  NPG  
Sbjct  561   FAYGLLEATLTPARLPKPLKLATLLMGLAVPILISSGTFIRLAGTIIGMAVRFDRNPGGT  620

Query  3006  ADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAF  3185
              +W+   I+++ IA  +CLT  YVL Y+H SGAK   ++ T +LF +SL +V    +  F
Sbjct  621   PEWLWNIIISIFIAVCICLTFIYVLSYVHLSGAKRSIILATSILFGLSLILVLSGRIQPF  680

Query  3186  VDDTARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFD  3350
              +DTARAVN+V VVD +G        +S+ISLFS TPG L+ E E++  GF CG+DK  D
Sbjct  681   TEDTARAVNVVHVVDASGRYGEKQDPLSYISLFSNTPGKLEKEVEQIKEGFTCGKDKVVD  740

Query  3351  FVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTN  3530
             FVTFSV Y C T    + GW ES IP L V  D +G  R T + IDT  S RWSL INT 
Sbjct  741   FVTFSVNYGCLTHDDTESGWSESDIPTLHVDSDTKGGERITRVSIDTKSSMRWSLAINTK  800

Query  3531  EIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS--SGKRIM  3704
             EI+DF LK     L+   G K  VDGWH ++F+GGK SP +F LTL W   S  S   + 
Sbjct  801   EIEDFILKGNLEELIPY-GNKTSVDGWHHIQFSGGKESPRKFELTLFWPVKSMPSADNVD  859

Query  3705  EGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                  +  LLKLR DV+  TP+   VL KL +WCS +GKS+SP TLA+L ++ V+
Sbjct  860   RTIRDQRPLLKLRTDVDRLTPKAERVLAKLPTWCSLFGKSTSPLTLAFLSSLPVN  914



>ref|XP_009345384.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Pyrus x 
bretschneideri]
Length=911

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/895 (54%), Positives = 637/895 (71%), Gaps = 33/895 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS +  + LF  +   ++ V+  QF+ LPEPL+A++AG+ GFSE +A+ HV+AL+QLGP
Sbjct  35    RRSPFVWLTLFLAIGYCSYGVYQYQFESLPEPLTADQAGKRGFSEFSALKHVEALTQLGP  94

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS AL+ ALQYVL  AE IK+ A  +V+V+V+ FH  SG N +VGGL+ G+T VY+D
Sbjct  95    HSVGSNALNLALQYVLAEAEKIKKTAHWEVDVEVDSFHVESGANRMVGGLFKGRTLVYAD  154

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+V+R+ PK         E  ++AILVS+H+DTVF+  GAGD SS VAVMLE+ARG+S
Sbjct  155   LNHIVVRVLPKYAP------ESVDNAILVSSHIDTVFSTGGAGDCSSCVAVMLELARGVS  208

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEAMGIGGKSGIFQA 
Sbjct  209   QWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSTTIRLAVDLEAMGIGGKSGIFQA-  266

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
              D W+I+NFA VAKYPSGQ++ QD+FSSG IKS+TDFQVYKEVAGL GLDFA+TD+TAVY
Sbjct  267   -DAWSIENFASVAKYPSGQIIGQDIFSSGAIKSATDFQVYKEVAGLPGLDFAYTDNTAVY  325

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L   GSLQHLGEN+L FLL+ A+SS LP  +  +   K   E   +YFDILG
Sbjct  326   HTKNDKIELHTLGSLQHLGENMLAFLLKIAASSHLPKASAVVEENKG--ETAAIYFDILG  383

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
              YM+VY + FA+M H +VI  SLLI   SL MGG  A ISL  S LSI+LMWI ++S ++
Sbjct  384   SYMIVYRQRFANMLHNSVIAQSLLIWTTSLLMGGYPAAISLALSCLSIILMWIFAISFAL  443

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             L A+++  +SS+PVP+VA+PWL IGLF APAL+GA  GQ++ YL LH +LS  ++++K+ 
Sbjct  444   LPAFIISLISSSPVPYVANPWLVIGLFGAPALIGALSGQYLGYLGLHTYLSKVYAKKKQ-  502

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +  D      +LEAERW++K+G LQWL++L +GTY KIGS+YLAL WLV PA AY 
Sbjct  503   ----LSPDIQAGLVKLEAERWLYKSGSLQWLILLILGTYYKIGSTYLALAWLVPPAFAYG  558

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   PA+  KPL   T LIGL VP+ ISSG F+ L   +IG +VR   NPG   +W+
Sbjct  559   FLEATLTPARFPKPLRLATLLIGLAVPIVISSGGFIRLAGMVIGTVVRLDRNPGGTPEWL  618

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                I+AV +A +VCLT+ Y+L YIH SGAK   V++TC+LF +SL +V + +VP F  DT
Sbjct  619   ANVILAVFVATVVCLTLVYLLSYIHLSGAKRSIVLSTCMLFSLSLAVVLLGIVPPFTADT  678

Query  3198  ARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTF  3362
             +RAVN+V VVD T    GN    S++SLFS TPG L  EAE++  GF CGRDK  D VTF
Sbjct  679   SRAVNVVHVVDTTGSVDGNQDPRSYVSLFSFTPGKLTEEAEQINEGFRCGRDKVVDLVTF  738

Query  3363  SVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             S KYSCWT   +  GW +S IP + VG D  G+ R T + +DT  STRW+L IN  +I+D
Sbjct  739   SAKYSCWTYDDSDSGWSKSDIPTMNVGSDTHGNERTTRVLLDTKGSTRWTLAINAGDIED  798

Query  3543  FELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             F  K    S  L S+ G+ + VDGWHV++++GG+N+PT F+L L W +NS+  R+    E
Sbjct  799   FTFKVAGSSEELASL-GDMSSVDGWHVIQYSGGQNAPTRFDLALFWSQNSN--RLAHDVE  855

Query  3717  GEN----LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             G+      LLKLR D++  TP++  VL KL  WCS +GKS+SP TL++L  + V+
Sbjct  856   GKRDEHAPLLKLRTDMDIVTPKVERVLSKLPPWCSLFGKSTSPHTLSFLSNLPVN  910



>ref|XP_006414447.1| hypothetical protein EUTSA_v10024352mg [Eutrema salsugineum]
 gb|ESQ55900.1| hypothetical protein EUTSA_v10024352mg [Eutrema salsugineum]
Length=909

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/886 (55%), Positives = 639/886 (72%), Gaps = 25/886 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RSG   + +   +   +W V+  Q   LP PL+A++AG+ GFSE+ AM HV AL+Q GP
Sbjct  37    RRSGKVWLSVLILITYSSWAVYNYQHGNLPRPLTAQQAGKRGFSEIQAMKHVTALTQFGP  96

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL+  E +KE A  +V+V+V++F + SGVN LVGGL+ GK+ VYSD
Sbjct  97    HPVSSDALVHALEYVLEAVEKVKETAHWEVDVNVDLFESKSGVNRLVGGLFKGKSLVYSD  156

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK  +D        ++AILVS+H+DTVF+  GAGD SS VAVMLE+AR +S
Sbjct  157   ISHIVLRILPKYESDA------GDNAILVSSHIDTVFSTGGAGDCSSCVAVMLELARSVS  210

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN SVIFLFNTGEEEGLNGAHSF+TQHPW +TVR+AIDLEAMG GGKSGIFQAG
Sbjct  211   QSAHGFKN-SVIFLFNTGEEEGLNGAHSFITQHPWSSTVRLAIDLEAMGTGGKSGIFQAG  269

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+TAVY
Sbjct  270   PSPWAIENFALAAKYPSGQIIGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNTAVY  329

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FLL+ ASSSDLP   KTL   +    D+ VYFDILG
Sbjct  330   HTKNDKIELIKPGSLQHLGENMLAFLLRVASSSDLPK-EKTLQGEEKSKADSAVYFDILG  388

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YM+VY +SFA M + +VI+ S+LI + SL MGG  A++SL+ S LSI+L WI SV+ SV
Sbjct  389   KYMIVYRQSFATMLYVSVIMQSILIWVMSLIMGGYPAVVSLMLSCLSIILSWIFSVAFSV  448

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LP +SS+PVP+ ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  + S
Sbjct  449   AVAFILPLISSSPVPYASNPWMTVGLFVSPAVLGSISGQHVAFMFLRK-----KSSNRNS  503

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
               + V      +  +LEAERW+FKAG +QWL++LA+GTY K+GS+YLALVWLV PA AY 
Sbjct  504   NKMQVSPRLRDNLAKLEAERWLFKAGFIQWLVLLALGTYYKLGSTYLALVWLVPPAFAYG  563

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T +I L VP+ +SSG F+ L  T+IG L+RF  NPG   +W+
Sbjct  564   LLEATLTPIRLPKPLKLATLVISLAVPVLVSSGSFIRLAGTMIGMLIRFDRNPGGTPEWL  623

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                ++AV+IA  + LTM Y+L YIH SGAK   V   C++  +SL +V+  ++PAF +DT
Sbjct  624   GNVMIAVVIATFISLTMVYLLAYIHLSGAKRSIVTALCIITALSLSLVSSGVLPAFTEDT  683

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
             ARAVN+V VVD +G    VS ISLFS TPGNL++EAE++  GF CGRD   DFV+F  KY
Sbjct  684   ARAVNVVHVVDTSGEDP-VSFISLFSNTPGNLNMEAEQIKEGFKCGRDNKVDFVSFEAKY  742

Query  3375  SCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELK  3554
             SC T+  A+ GW ++ IP LRV  D E   R   + +DT  STRW+LGI+  EI+DF L+
Sbjct  743   SCVTKKNAEAGWDKNDIPVLRVVDDKE---RVIAVSMDTGGSTRWTLGIDMEEIEDFTLQ  799

Query  3555  --DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTL--QWHKNSSGKRIMEGSEGE  3722
               +E  ++++ G + +  +GWH ++F+GGK +PT F L L  +  + S  K+  +  + +
Sbjct  800   VGEEEELMIARGEKSSNEEGWHQIQFSGGKKAPTRFVLKLYEKKEEVSVEKKKKKEEKKQ  859

Query  3723  NLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
               LLKLR D +  TP++  VL+KL S+CS +GKS+SPFTLA+L ++
Sbjct  860   RPLLKLRTDFDRITPQVERVLQKLPSFCSLFGKSTSPFTLAFLASL  905



>ref|XP_006436469.1| hypothetical protein CICLE_v10030651mg [Citrus clementina]
 ref|XP_006485613.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Citrus 
sinensis]
 gb|ESR49709.1| hypothetical protein CICLE_v10030651mg [Citrus clementina]
Length=926

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/907 (55%), Positives = 641/907 (71%), Gaps = 31/907 (3%)
 Frame = +3

Query  1200  SYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNH  1379
             S  I    A+RSG    V F   V  T+ V+Y Q++ +P PL+A++AG+ GFSE  A+ H
Sbjct  33    SNDIHVRSAKRSGLAWTVAFAAFVYATYGVYYYQYEHMPPPLTADQAGKRGFSEFEAIKH  92

Query  1380  VKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLY  1559
             VKAL++LGPHP+GS ALD ALQYVL  A+ IKE    +V+V+V+ FHA SG N LV G +
Sbjct  93    VKALTELGPHPVGSDALDRALQYVLAAAQKIKETKHWEVDVEVDFFHAKSGANRLVSGAF  152

Query  1560  FGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAV  1739
              G+T +YSDL H+V+R+ PK  +      E  E+AILVS+H+DTVFAAEGAGD SS VAV
Sbjct  153   MGRTLIYSDLNHIVLRIQPKYAS------EAAENAILVSSHIDTVFAAEGAGDCSSCVAV  206

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+AR +S+ A GFKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+RVAIDLEAMGIG
Sbjct  207   MLELARAMSQWAHGFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTIRVAIDLEAMGIG  265

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKSG+FQAGP PWA++NFA  AKYPSGQV +QDLF+SG I S+TDFQVYKEVAGLSGLDF
Sbjct  266   GKSGLFQAGPHPWAVENFAAAAKYPSGQVTAQDLFASGAITSATDFQVYKEVAGLSGLDF  325

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
             A+TD +AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQAASS+ LP  N     GK+  E 
Sbjct  326   AYTDKSAVYHTKNDKLDLLKPGSLQHLGENMLAFLLQAASSTSLPKGNAMEKEGKTVHE-  384

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
             T VYFDILG YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +SL  + LS +LM
Sbjct  385   TAVYFDILGTYMVLYRQGFANMLHNSVIVQSLLIWTASLVMGGYPAAVSLALTCLSAILM  444

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
              + S+S +V+VA++LP +SS+PVP+VA+PWLA+GLFAAPA LGA  GQH+ Y+ L  +L+
Sbjct  445   LVFSISFAVVVAFILPQISSSPVPYVANPWLAVGLFAAPAFLGALTGQHLGYIILKAYLA  504

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               FS+R +     VQ D      +LEAERW+FKAG LQWL++LA+G + KIGS+++AL W
Sbjct  505   NMFSKRMQ-LSPIVQAD----LIKLEAERWLFKAGFLQWLILLALGNFYKIGSTFIALFW  559

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LV PA AY  LEA   P +  +PL   T L+GL VP+ +S+G F+ L N ++  +VRF  
Sbjct  560   LVPPAFAYGFLEATLTPVRFPRPLKLATLLLGLAVPVLVSAGNFIRLANVIVAIVVRFDR  619

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQ  3170
             NPG   +W+   I+AV IA ++CLT+ Y+L Y+H SGAK P  I +CVLFV+SL +V   
Sbjct  620   NPGGTPEWLGNVILAVFIAVVLCLTLVYLLSYVHLSGAKRPIAIASCVLFVLSLILVLSG  679

Query  3171  MVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGR  3335
              VP F +DTARAVN+V VVD +    G     S I+L+STTPG L  E E++  GFVCGR
Sbjct  680   TVPPFSEDTARAVNVVHVVDASGKFGGKQEPSSFIALYSTTPGKLTKEVEQIKEGFVCGR  739

Query  3336  DKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR------DMEGDT--RATLIHIDT  3491
             D   DFVT S++Y C T    + GW +S +P + V        D +G+   R T + ID 
Sbjct  740   DNVVDFVTLSMEYGCLTYDGTEGGWSQSDVPTIHVESEGFGIMDTKGNDNGRITKVSIDM  799

Query  3492  AYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQ  3671
               S RWSL I+  EI+DF  K+ S  LV    EK+G+DGWH+++F+GGKN+ ++F+L L 
Sbjct  800   KGSVRWSLAIDAEEIEDFTFKEGSEELVP-RDEKSGMDGWHIIQFSGGKNAVSKFDLDLY  858

Query  3672  WHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAY  3848
             W KNS+         E +  LLKLR D +  TP+   VL KL +WCS +GKS+SP TL++
Sbjct  859   WAKNSTESYHNANRKEKQRPLLKLRTDFDRLTPKTERVLSKLPAWCSLFGKSTSPQTLSF  918

Query  3849  LDAISVD  3869
             L+++ V+
Sbjct  919   LNSLPVN  925



>ref|XP_010493169.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Camelina 
sativa]
Length=910

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/888 (54%), Positives = 639/888 (72%), Gaps = 31/888 (3%)
 Frame = +3

Query  1227  ERSG---YEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQ  1397
             +RSG   + +++L T+    +W V+  Q+  LP+PL+A++AG+ GFSE+ AM HVKAL+Q
Sbjct  40    QRSGKVWFSVLILVTYF---SWAVYSYQYGNLPKPLTAKQAGKRGFSEIEAMKHVKALTQ  96

Query  1398  LGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPV  1577
              GPHP+ S AL  AL+YVL   E IKE A  +V+V+V+ F +  GVN LVGG + GK+ V
Sbjct  97    FGPHPVSSDALVHALEYVLGEVEKIKETAHWEVDVNVDFFESKFGVNRLVGGSFKGKSLV  156

Query  1578  YSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVAR  1757
             YSD+ H+V+R+ PK  +D        ++AILVS+H+DTVF   GAGD SS VAVMLE+AR
Sbjct  157   YSDISHIVLRILPKYESDA------GDNAILVSSHIDTVFTTGGAGDCSSCVAVMLELAR  210

Query  1758  GLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIF  1937
              +S+ A GFKN S+IFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMG GGKS +F
Sbjct  211   SVSQSAHGFKN-SIIFLFNTGEEEGLNGAHSFITQHPWSSTIRLAIDLEAMGAGGKSSVF  269

Query  1938  QAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHT  2117
             QAGP PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+T
Sbjct  270   QAGPSPWAIENFALAAKYPSGQIIGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNT  329

Query  2118  AVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFD  2297
             AVYHTKNDK+ L+KPGSLQHLGEN+L FLL+ ASSSDLP  +KTL   +  + D+ VYFD
Sbjct  330   AVYHTKNDKIELIKPGSLQHLGENMLAFLLRVASSSDLPK-DKTLQDEEKANPDSAVYFD  388

Query  2298  ILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvs  2477
             +LG+YM+VY +SFA M + +VI+ SLLI + S++MGG  A++SL+ S LSI+L WI SV+
Sbjct  389   VLGKYMIVYRQSFATMLYVSVIMQSLLIWVLSVFMGGYPAVVSLILSCLSIILSWIFSVA  448

Query  2478  lsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSER  2657
              SV VA++LP +SS+PVP+ ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  
Sbjct  449   FSVAVAFILPWISSSPVPYASNPWMVVGLFVSPAVLGSISGQHVAFIFLRK-----KSSN  503

Query  2658  KRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPAL  2837
             + S  L V      +   LEAERW+FKAG +QWL++LA+GTY K+GS+YLALVWLV PA 
Sbjct  504   RNSNKLQVSPRLRDNLARLEAERWLFKAGFIQWLVLLAIGTYYKLGSTYLALVWLVPPAF  563

Query  2838  AYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQA  3008
             AY LLEA   P +  KPL   T  I L VP+ +SSG F+ L  T+IG L+RF S PG   
Sbjct  564   AYGLLEATLSPIRLPKPLKLATLFISLAVPILVSSGSFIQLTGTMIGMLIRFESTPGGTP  623

Query  3009  DWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFV  3188
             +W+  A++AV+IA  V LTM Y+L YIH SGAK+  V   C++  +SL +VA  + PAF 
Sbjct  624   EWLGNALIAVVIATFVSLTMVYLLSYIHLSGAKTLLVTALCIITALSLSLVASGVFPAFT  683

Query  3189  DDTARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFS  3365
             +DT+RAVN+V VVD +G    V+ ISLFS TPGNL++EAE++  GF CGRD   DFV+F 
Sbjct  684   EDTSRAVNVVHVVDTSGQDQ-VAFISLFSNTPGNLNMEAEQIKEGFKCGRDNKIDFVSFE  742

Query  3366  VKYSCWTEPTAKLGWKESRIPALRVGRDMEGDT-RATLIHIDTAYSTRWSLGINTNEIKD  3542
              KYSC T+  A++GW +  IP L V  D E D  R T + +DT  S+RW+L I+  EI+D
Sbjct  743   AKYSCVTKKDAEVGWDKHNIPVLSVINDKERDEGRVTAVSMDTGGSSRWTLRIDMEEIED  802

Query  3543  FELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             F ++  ++  ++++ G + +   GWH ++FAGGK +PT F L L   K    + + +  +
Sbjct  803   FTMQVSEDEELMIARGEKSSNEHGWHQIQFAGGKKAPTSFVLKLYKKK----EEVSDEKK  858

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
              +  LLKLR D N  TP++  VLE+L  +CS +GKS+SPFTLA+L ++
Sbjct  859   KQRPLLKLRTDFNRLTPQVHRVLERLPPFCSLFGKSTSPFTLAFLASL  906



>ref|XP_002871951.1| hypothetical protein ARALYDRAFT_910108 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48210.1| hypothetical protein ARALYDRAFT_910108 [Arabidopsis lyrata subsp. 
lyrata]
Length=911

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/887 (54%), Positives = 640/887 (72%), Gaps = 27/887 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RSG     +   V    W+V+  Q   LP+PL+A++AG+ GFSE  A+NHVKAL+Q GP
Sbjct  39    KRSGKVWFSVLILVTYSAWVVYNYQLGNLPKPLTAKQAGKRGFSEFEAINHVKALTQFGP  98

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL   E +KE A  +V+V+V+ F +  GVN LVGGL+ GK+ VYSD
Sbjct  99    HPVSSDALVLALEYVLAEVEKVKETAHWEVDVNVDFFESKFGVNRLVGGLFKGKSLVYSD  158

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK  +D        ++AILVS+H+DTVF   GAGD SS VAVMLE+AR +S
Sbjct  159   ISHIVLRILPKYESDA------GDNAILVSSHIDTVFTTGGAGDCSSCVAVMLELARSVS  212

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN S+IFLFNTGEEEGLNGAHSFVTQHPW +TVR+AIDLEAMG GGKS IFQAG
Sbjct  213   QSAHGFKN-SIIFLFNTGEEEGLNGAHSFVTQHPWSSTVRLAIDLEAMGTGGKSSIFQAG  271

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+TAVY
Sbjct  272   PSPWAIENFALAAKYPSGQIIGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNTAVY  331

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FLL+ ASSSDLP  + TL   +    D+ VYFDILG
Sbjct  332   HTKNDKIELIKPGSLQHLGENMLAFLLRVASSSDLPK-DDTLQGEEKSTPDSAVYFDILG  390

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YM+VY +S A M + +VI+ S+LI + S++MGG  A++SL+ S LSI+L WI SV+ SV
Sbjct  391   KYMIVYRQSLATMLYVSVIMQSILIWVLSVFMGGYPAVVSLILSCLSIILSWIFSVAFSV  450

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LPS+SS+PVP+ ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  + S
Sbjct  451   AVAFILPSISSSPVPYASNPWMVVGLFVSPAILGSISGQHVAFIFLRK-----KSSNRNS  505

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
               + V      +   LEAERW+FKAG +QWL++LA+GTY K+GS+YLALVWLV PA AY 
Sbjct  506   NKMQVSPRLRDNLARLEAERWLFKAGFIQWLVLLALGTYYKLGSTYLALVWLVPPAFAYG  565

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T LI L VP+ +SSG F+ L  T+IG L+RF SNPG   +W+
Sbjct  566   LLEATLSPIRLPKPLKLATLLISLAVPILVSSGSFIQLTATMIGMLIRFDSNPGGTPEWL  625

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
              +A++AV+IA  + LT  Y+L YIH SGAK   V   C++  +SL +V+  ++PAF +DT
Sbjct  626   GSALIAVVIATFISLTSVYLLAYIHLSGAKKSIVSALCIITALSLALVSSGVLPAFTEDT  685

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
             ARAVN+V VVD +G    V+ ISLFS TPGNL++EAE++  GF CGR+   DFV+F  KY
Sbjct  686   ARAVNVVHVVDTSGQDQ-VAFISLFSNTPGNLNMEAEQIKEGFRCGRENKIDFVSFEAKY  744

Query  3375  SCWTEPTAKLGWKESRIPALRVGRDMEGDTRATL-IHIDTAYSTRWSLGINTNEIKDFEL  3551
             SC T+  AK+GW ++ IP LRV  D E D R  + + ++T  S+RW+L I+ +EI+DF +
Sbjct  745   SCVTKKDAKVGWDKNEIPVLRVINDKERDERRVIAVSMETGGSSRWTLRIDMDEIEDFTM  804

Query  3552  K----DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEG  3719
             +    +E  ++++ G + +  +GWH ++F+GGK +PT F L L     +  + + +  + 
Sbjct  805   QVGEEEEEELMIARGEKSSSEEGWHQIQFSGGKKAPTSFVLKLY----TKEEEVSDEKKK  860

Query  3720  ENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
             +  LLKLR D+N +TP++  VL++L  +C+ +GKS+SPFTLA+L ++
Sbjct  861   QRPLLKLRTDLNRRTPQVQRVLQRLPPFCTMFGKSTSPFTLAFLASL  907



>ref|XP_010667589.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Beta vulgaris 
subsp. vulgaris]
Length=918

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/904 (54%), Positives = 646/904 (71%), Gaps = 34/904 (4%)
 Frame = +3

Query  1191  HLKSYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAA  1370
             HL+S       A+RS   ++ L   ++   W V++ Q++ LP P SAE+AG+ GFSE+ A
Sbjct  37    HLRS-------AKRSSSAMLTLCALIMYCCWSVYHYQYENLPLPQSAEQAGKRGFSEIEA  89

Query  1371  MNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVG  1550
             M HV AL++LGPH +GS ALD A+QYV +  E IK  +  +V+V+VE FH   G N L  
Sbjct  90    MKHVNALAELGPHSVGSDALDLAVQYVQRAVEKIKNTSHWEVDVEVEKFHVKGGANRLND  149

Query  1551  GLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSN  1730
             GL+ GKT +Y+DL H+++R++PK       E E +++++LVS+H+DTVF+  GAGD SS 
Sbjct  150   GLFVGKTLIYADLNHIILRITPK------YESEAKQNSVLVSSHIDTVFSTGGAGDCSSC  203

Query  1731  VAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAM  1910
             VAVMLE+ARG+S  A GFK+ SVIFLFNTGEEEGLNGAHSF+TQHPW  TVRVAIDLEAM
Sbjct  204   VAVMLELARGVSHWAHGFKS-SVIFLFNTGEEEGLNGAHSFITQHPWSETVRVAIDLEAM  262

Query  1911  GIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSG  2090
             G+GGK+ IFQAGP PWAI+NFA VAKYPSG V++QDLFSSGVIKS+TDFQ+YK+VAGLSG
Sbjct  263   GVGGKAHIFQAGPHPWAIENFALVAKYPSGNVMAQDLFSSGVIKSATDFQIYKDVAGLSG  322

Query  2091  LDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE  2270
             LDFAF+D+TAVYHTKNDKV LLKPGSLQHLGEN+L FLLQ ASSSDL   N + +T KS 
Sbjct  323   LDFAFSDNTAVYHTKNDKVELLKPGSLQHLGENMLAFLLQTASSSDLVKGNASGATEKS-  381

Query  2271  DEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSI  2450
             D+++ VYFDILG YM+VY + FA+M H +VI+ SLLI   SL MGG +A++S   S LS+
Sbjct  382   DQNSAVYFDILGTYMIVYRQQFANMLHNSVIMQSLLIWFMSLTMGGYTAIVSCALSCLSV  441

Query  2451  VLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHK  2630
             +LMW+ S+S SVLVA++L S+S   VP++ +PWL IGL+  P+LLGAF GQH+ +L L K
Sbjct  442   ILMWVLSISFSVLVAFLLSSMSLASVPYITTPWLVIGLYGFPSLLGAFAGQHLGFLLLQK  501

Query  2631  FLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLA  2810
             +LS T+++ KR+    +Q    V+   LEAERW+FK+G +QWL +L +  Y K+GSSY+ 
Sbjct  502   YLSNTYAQGKRTVGPSIQ----VNLARLEAERWLFKSGTIQWLFILVLTHYFKVGSSYVP  557

Query  2811  LVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVR  2981
             LVWLV+PA +Y LLEA   P +  KPL   T L+ L+VPL +S+G  + ++  LIG  VR
Sbjct  558   LVWLVTPAFSYGLLEATLSPIRLPKPLKTATLLLALSVPLVVSAGSIIRIIGVLIGTAVR  617

Query  2982  FVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMV  3161
             F  NPG   +W+   IV+V++AA+VCLT+ Y+L Y+H SGAK   ++ +C  F  SL  +
Sbjct  618   FDRNPGSAPEWLVNVIVSVVVAAVVCLTLVYLLSYVHLSGAKMSIILVSCAFFFFSLAAI  677

Query  3162  AMQMVPAFVDDTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFV  3326
                ++P++ +DTARAVN+V VVD  G       + S++SLFS+TPGNL+ E E+L  GFV
Sbjct  678   WSGLIPSYTEDTARAVNVVHVVDTRGLYGNAKDLSSYVSLFSSTPGNLNKEIEQLKEGFV  737

Query  3327  CGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTR  3506
             CGR+KA DFVTFSVKY C T    + GW +  IP   V  D + D   T + IDT  STR
Sbjct  738   CGREKALDFVTFSVKYGCLTYNETESGWSDLDIPIFEVKSDKKMDL--TEVSIDTKVSTR  795

Query  3507  WSLGINTNEIKDFELKDESG---VLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWH  3677
             WS+ INT++I DFE +  SG   VLV + G K+ VDGWH ++F+GGKN+PT+F+LT +  
Sbjct  796   WSIAINTDQIADFEFR-VSGYPEVLVPL-GNKSSVDGWHNIQFSGGKNAPTKFDLTFKRV  853

Query  3678  KNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDA  3857
              N+        ++ +  L+KLR DV+  TP+   VL KL +WCS +GKS+SP  LA+L A
Sbjct  854   GNAIHASEHLDNDLQKYLIKLRTDVDRLTPKTEKVLTKLPTWCSLFGKSTSPHKLAFLTA  913

Query  3858  ISVD  3869
             + +D
Sbjct  914   LPID  917



>ref|XP_010420911.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Camelina 
sativa]
Length=912

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/888 (53%), Positives = 639/888 (72%), Gaps = 30/888 (3%)
 Frame = +3

Query  1227  ERSG---YEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQ  1397
             +RSG   + +++L T+    +W V+  Q+  LP+PL+A++AG+ GFSE+ AM HVKAL+Q
Sbjct  41    QRSGKVWFSVLILVTYF---SWAVYSYQYGNLPKPLTAKQAGKRGFSEIEAMKHVKALTQ  97

Query  1398  LGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPV  1577
              GPHP+ S AL  AL+YVL   E +KE A  +V+V+V+ F + SGVN LVGG + GK+ V
Sbjct  98    FGPHPVSSDALVHALEYVLGEVEKVKETAHWEVDVNVDFFESKSGVNRLVGGHFKGKSLV  157

Query  1578  YSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVAR  1757
             YSD+ H+V+R+ PK  +D        ++AILVS+H+DTVF   GAGD SS VAVMLE+AR
Sbjct  158   YSDISHIVLRILPKYESDA------GDNAILVSSHIDTVFTTGGAGDCSSCVAVMLELAR  211

Query  1758  GLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIF  1937
              +S+ A GFKN S+IFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMG GGKS +F
Sbjct  212   SVSQSAHGFKN-SIIFLFNTGEEEGLNGAHSFITQHPWSSTIRLAIDLEAMGAGGKSSVF  270

Query  1938  QAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHT  2117
             QAGP PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+T
Sbjct  271   QAGPSPWAIENFALAAKYPSGQIIGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNT  330

Query  2118  AVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFD  2297
             AVYHTKNDK+ L+KPGSLQHLGEN+L FLL+ ASSSDL + +KTL   +  + D+ VYFD
Sbjct  331   AVYHTKNDKIELIKPGSLQHLGENMLAFLLRVASSSDL-SEDKTLQEEEKANPDSAVYFD  389

Query  2298  ILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvs  2477
             +LG+YM+VY +SFA M + +VI+ S+LI + S++MGG  A++SL+ S LSI+L WI SV+
Sbjct  390   VLGKYMIVYRQSFATMLYVSVIMQSILIWVLSVFMGGYPAVVSLILSCLSIILSWIFSVA  449

Query  2478  lsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSER  2657
              SV VA++LP +SS+PVP+ ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  
Sbjct  450   FSVAVAFILPWISSSPVPYASNPWMVVGLFVSPAVLGSISGQHVAFIFLRK-----KSSN  504

Query  2658  KRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPAL  2837
             + S  L V      +   LEAERW+FKAG +QWL++LA+GTY K+GS+YLALVWLV PA 
Sbjct  505   RNSNKLQVSPRLRDNLARLEAERWLFKAGFIQWLVLLAIGTYYKLGSTYLALVWLVPPAF  564

Query  2838  AYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQA  3008
             AY LLEA   P +  KPL   T  I L VP+ +S+G F+ L  T+IG L+RF S PG   
Sbjct  565   AYGLLEATLSPIRLPKPLKLATLFISLAVPILVSAGSFIQLTGTMIGMLIRFESTPGGTP  624

Query  3009  DWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFV  3188
             +W+  A++AV+IA  + LTM Y+L YIH SGAK+  V   C++  +SL +VA  + PAF 
Sbjct  625   EWLGNALIAVVIATFISLTMVYLLAYIHLSGAKTLLVTALCIITALSLSLVASGVFPAFT  684

Query  3189  DDTARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFS  3365
             +DTARAVN+V VVD +G    V+ +SLFS TPGNL++EAE++  GF CGR+   DFV+F 
Sbjct  685   EDTARAVNVVHVVDTSGQDQ-VAFVSLFSNTPGNLNMEAEQIKEGFKCGRENKIDFVSFE  743

Query  3366  VKYSCWTEPTAKLGWKESRIPALRVGRDMEGDT-RATLIHIDTAYSTRWSLGINTNEIKD  3542
              KYSC T+  A++GW +  IP LRV  D E D  R T + +DT  S+RW+L I+  EI+D
Sbjct  744   AKYSCVTKKDAEVGWDKHNIPVLRVINDKERDEGRVTAVSMDTGGSSRWTLRIDIEEIED  803

Query  3543  FELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             F ++  ++  ++++ G + +   GWH ++FAGGK +PT F L L   K        +  +
Sbjct  804   FTMQVGEDEELMIARGEKSSNEQGWHQIQFAGGKKAPTSFVLKLYKKKEEVSD---DKKK  860

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
              +  LLKLR D N  TP++  VLE+L  +CS +GKS+SPFTLA+L ++
Sbjct  861   KQRPLLKLRTDFNRLTPQVQRVLERLPPFCSLFGKSTSPFTLAFLASL  908



>ref|XP_006287022.1| hypothetical protein CARUB_v10000170mg [Capsella rubella]
 gb|EOA19920.1| hypothetical protein CARUB_v10000170mg [Capsella rubella]
Length=907

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/885 (53%), Positives = 635/885 (72%), Gaps = 25/885 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RSG     +   V+  +W V+  Q   LP+PL++++AG+ GFSE+ AM HVKAL+Q GP
Sbjct  37    KRSGKVWFSVLILVIYFSWAVYSYQHGNLPKPLTSKQAGKRGFSEIEAMKHVKALTQFGP  96

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL   E +KE A  +V+V+V++F +  GVN LVGGL+ GK+ VYSD
Sbjct  97    HPVSSDALVHALEYVLAEVEKVKETAHWEVDVNVDLFESKFGVNRLVGGLFKGKSLVYSD  156

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK       E +  ++AILVS+H+DTVF   GAGD SS VAVMLE+AR +S
Sbjct  157   ISHIVLRILPK------YESDAGDNAILVSSHIDTVFTTGGAGDCSSCVAVMLELARSVS  210

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN S+IFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMG GGKS +FQAG
Sbjct  211   QSAHGFKN-SIIFLFNTGEEEGLNGAHSFITQHPWSSTIRLAIDLEAMGAGGKSSVFQAG  269

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWA++NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+TAVY
Sbjct  270   PSPWAVENFALAAKYPSGQIIGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNTAVY  329

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FLL+ ASSS LP  +K+L   +  D D  VYFDILG
Sbjct  330   HTKNDKIELIKPGSLQHLGENMLAFLLRVASSSTLPK-DKSLQKEEKSDLDAAVYFDILG  388

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YM+VY +SFA M + +VI+ S+LI + S++MGG+ A++SL+ S LSI+L WI +V+ SV
Sbjct  389   KYMIVYRQSFATMLYVSVIMQSILIWVMSVFMGGVPAVVSLILSCLSIILSWIFAVAFSV  448

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              +A++LP +SSTPVP+ ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  + S
Sbjct  449   AIAFILPWISSTPVPYASNPWMVVGLFVSPAVLGSISGQHVAFIFLRK-----KSSNRNS  503

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
               + V      +   LEAERW+FKAG +QWL++LA GTY K+GS+YLALVWLV PA AY 
Sbjct  504   NKMQVSPRLRDNLARLEAERWLFKAGFIQWLVLLAFGTYYKLGSTYLALVWLVPPAFAYG  563

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T  I L VP+ +SSG F+ L  T+IG L+RF S PG   +W+
Sbjct  564   LLEATLSPIRLPKPLKLATLFISLAVPILVSSGSFIQLTGTMIGMLIRFDSTPGGTPEWL  623

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
              +A++A +IA  + LTM Y+L YIH SGAK+  V   C++  +SL +VA  + PAF +DT
Sbjct  624   GSALIAAIIATFISLTMVYLLAYIHLSGAKTSLVTALCIITALSLALVASGVFPAFTEDT  683

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
             ARAVN+V VVD +G    V++ SLFS TPGNL+ EAE++  GF CGR+   DFV+F  +Y
Sbjct  684   ARAVNVVHVVDTSGQDQ-VAYTSLFSNTPGNLNKEAEQIKEGFKCGRENKIDFVSFEAQY  742

Query  3375  SCWTEPTAKLGWKESRIPALRVGRDMEGDT-RATLIHIDTAYSTRWSLGINTNEIKDFEL  3551
             SC T+  A++GW +  IP LRV  D E D  R T++ +DT  S+RW+L I+  +I+DF +
Sbjct  743   SCVTKKDAEIGWDKHNIPVLRVINDKERDEGRVTVVSMDTGGSSRWTLRIDMEKIEDFTM  802

Query  3552  K--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGEN  3725
             +  ++  ++++ G + +  +GWH ++FAGGK + T F L L   K    + + +  + + 
Sbjct  803   QVGEDEELMIARGEKSSNAEGWHQIQFAGGKKASTSFVLKLYKKK----EEVSDEKKKQR  858

Query  3726  LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
              LLKLR D N  TP++  +LE+L  +CS +GKS+SPFTLA+L ++
Sbjct  859   PLLKLRTDFNRLTPQVQRILERLPPYCSLFGKSTSPFTLAFLASL  903



>ref|NP_197566.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 dbj|BAE98701.1| 24 kDa vacuolar protein - like [Arabidopsis thaliana]
 gb|AED92872.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=910

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/887 (53%), Positives = 637/887 (72%), Gaps = 28/887 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RSG   + +   +   +W V+  Q   LP+PL+A++AG+ GFSE+ A+ HVKAL+Q GP
Sbjct  39    KRSGKVWLSVLILITYSSWFVYNYQLGNLPKPLTAKQAGKRGFSEIEAIKHVKALTQFGP  98

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL   E +KE A  +V+V+V+ F +  GVN LVGGL+ GK+ VYSD
Sbjct  99    HPVSSDALVHALEYVLAEVEKVKETAHWEVDVNVDFFESKFGVNRLVGGLFKGKSLVYSD  158

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK  +D        ++AILVS+H+DTVF   GAGD SS VAVMLE+AR  S
Sbjct  159   ISHIVLRILPKYESDA------GDNAILVSSHIDTVFTTGGAGDCSSCVAVMLELARSAS  212

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN S+IFLFNTGEEEGLNGAHSF+TQHPW +TVR+AIDLEAMG GGKS IFQAG
Sbjct  213   QSAHGFKN-SIIFLFNTGEEEGLNGAHSFITQHPWSSTVRLAIDLEAMGTGGKSSIFQAG  271

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA  AKYPSGQ++ QDLF+SG+IKS+TDFQVYKEVAGLSGLDFAF D+TAVY
Sbjct  272   PSPWAIENFALAAKYPSGQIIGQDLFTSGIIKSATDFQVYKEVAGLSGLDFAFADNTAVY  331

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FLL+ ASSSDLP  +KTL   +  + D+ VYFD+LG
Sbjct  332   HTKNDKIELIKPGSLQHLGENMLAFLLRVASSSDLPK-DKTLQGEERSNPDSAVYFDVLG  390

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YM+VY +S A M + +VI+ S+LI + S++MGG  A++SL+ S LSI+L WI SV+ SV
Sbjct  391   KYMIVYRQSLATMLYVSVIMQSILIWVLSVFMGGYPAVVSLILSCLSIILSWIFSVAFSV  450

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LP +SS+PVPF ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  + S
Sbjct  451   AVAFILPWISSSPVPFASNPWMVVGLFVSPAILGSISGQHVAFIFLRK-----KSSNRNS  505

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
               + V      +   LEAERW+FK+G +QWL++LA+GTY K+GS+YLALVWLV PA AY 
Sbjct  506   NKMQVSPRLRDNLARLEAERWLFKSGFIQWLVLLALGTYYKLGSTYLALVWLVPPAFAYG  565

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T LI L VP+ +SSG F+ L  T+IG L+RF SNPG   +W+
Sbjct  566   LLEATLSPIRLPKPLKLATLLISLAVPILVSSGSFIQLTGTMIGMLIRFDSNPGVTPEWL  625

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
              +A++AV IA  + L+M Y+L YIH SGAK   V   C++  +SL +V+  ++PAF +DT
Sbjct  626   GSALIAVAIATFISLSMVYLLAYIHLSGAKKSIVTALCIITALSLALVSSGVLPAFTEDT  685

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
             ARAVN+V VVD +G    V+ ISLFS TPGNL++EAE++  GF CGR+   DFV+F  KY
Sbjct  686   ARAVNVVHVVDTSGQDQ-VAFISLFSNTPGNLNMEAEQIKEGFRCGRENKIDFVSFEAKY  744

Query  3375  SCWTEPTAKLGWKESRIPALRVGRDMEGD-TRATLIHIDTAYSTRWSLGINTNEIKDFEL  3551
             +C T+  A++GW +  IP LRV  D E +  R   + +DT  S+RW+L I+ +EI+DF +
Sbjct  745   NCVTKKDAEVGWDKHDIPVLRVINDKEREGGRVIAVSMDTGGSSRWTLRIDMDEIEDFTM  804

Query  3552  K----DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEG  3719
             +    +E  +++  G + +  +GWH ++FAGGK +PT F L L   +  S  +     + 
Sbjct  805   QVGEEEEEELMIERGEKSSNEEGWHQIQFAGGKKAPTSFVLKLYKEEEVSDDK-----KK  859

Query  3720  ENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
             +  LLKLR D+N +TP++  VLE+L  +C+ +GKS+SPFTLA+L ++
Sbjct  860   QRPLLKLRTDLNRRTPQVQRVLERLPPFCTMFGKSTSPFTLAFLASL  906



>ref|XP_010943482.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Elaeis guineensis]
 ref|XP_010943483.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Elaeis guineensis]
Length=910

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/903 (54%), Positives = 622/903 (69%), Gaps = 28/903 (3%)
 Frame = +3

Query  1200  SYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNH  1379
             S  +E    +RS +  + LF  ++ G+W V + QF+ LP PLSAE+AG+ GFSEV+AM H
Sbjct  22    SSEVEDRRPKRSAFLWLALFVLLLNGSWAVHHIQFENLPLPLSAEKAGKRGFSEVSAMEH  81

Query  1380  VKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLY  1559
             V++L++LGPHP+GS ALD ALQYV   +E +K  A  +V+V V+ FHA  G + L  GL+
Sbjct  82    VQSLTKLGPHPVGSDALDLALQYVFAASEKMKRTAHWEVDVQVDFFHAKIGASRLASGLF  141

Query  1560  FGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAV  1739
              GKT +YSDLKHVV+R+ PK           EE+ ILVS+H+DTVFA EGAGD SS V V
Sbjct  142   KGKTHIYSDLKHVVLRILPKYLPAA------EENLILVSSHIDTVFATEGAGDCSSCVGV  195

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+S+ A GFKN  VIFLFNTGEEEGLNGAHSF+TQHPW   +R  IDLEAMGIG
Sbjct  196   MLELARGISQWAHGFKNG-VIFLFNTGEEEGLNGAHSFITQHPWSRAIRFVIDLEAMGIG  254

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS +FQ G  PWAI+ FAKVAKYPSGQ+++QDLF SG IKS+TD QVY+EVAGL GLDF
Sbjct  255   GKSSLFQGGSAPWAIETFAKVAKYPSGQIIAQDLFLSGAIKSATDLQVYQEVAGLPGLDF  314

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--D  2273
             A++D TAVYHTKNDK+ LLKPGSLQHLGEN+L FLL  A SS L   +K     + E  +
Sbjct  315   AYSDATAVYHTKNDKLKLLKPGSLQHLGENMLAFLLHTAMSSRL---HKVAEVEREEGTN  371

Query  2274  EDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIV  2453
             +   ++FD+LG+YMVVY +  A M H +VI+ SLLI IASL MGG    IS   S LSIV
Sbjct  372   QTQAIFFDVLGKYMVVYTQQLASMLHNSVILQSLLIWIASLLMGGYPGAISFGLSCLSIV  431

Query  2454  LMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKF  2633
             LMWI S+SL++LVA+++P +S++PVP++A PWL +GLF APA+LGA  GQHV + FL K+
Sbjct  432   LMWIFSLSLTILVAFIIPLISTSPVPYIAYPWLVVGLFGAPAMLGALTGQHVGFFFLKKY  491

Query  2634  LSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLAL  2813
             L + + +R  S    VQ++        EAERW+FK+G +QWL++L VG   K+GSS+LAL
Sbjct  492   LHHVYKKRVPSLSHSVQEN----LINWEAERWLFKSGFIQWLILLVVGNLFKVGSSFLAL  547

Query  2814  VWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRF  2984
             VWLVSPA AY L+EA   P +  K L  +T ++GL VP+ +S+G+   LV T+IG LVRF
Sbjct  548   VWLVSPAFAYGLMEATLSPTRLPKQLKIITLILGLAVPVLVSAGMITRLVGTIIGVLVRF  607

Query  2985  VSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVA  3164
               +PG   DW+ + IVA+  AA+VCL + Y+L YIH SGAK   + + C L  ++L  V+
Sbjct  608   ERSPGSAPDWLGSLIVAIFSAAVVCLMLVYLLSYIHLSGAKGLVIFSMCTLLALTLTAVS  667

Query  3165  MQMVPAFVDDTARAVNIVQVVDHT---GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVC  3329
               + P F +D +RAVN+V VVD T   G+    S +SLFS TPG L  E E L    F C
Sbjct  668   SGIFPTFTEDISRAVNVVHVVDTTGRYGSQDPASFVSLFSATPGKLTKEVENLKDEEFAC  727

Query  3330  GRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRW  3509
             GR+K  DFVTF+V Y CW+      GW +  IP L V  D   D R T + IDT  +TRW
Sbjct  728   GRNKTLDFVTFTVNYGCWSSKDGNNGWSKLDIPELHVESDYMSDVRKTRVLIDTKLATRW  787

Query  3510  SLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS-  3686
             SL +N  EI DF  +  S  LV   G K+ VDGWH+++FAGGKNSPT+F+L L W  N+ 
Sbjct  788   SLAVNGEEISDFTFEVGSEELVP-SGNKSMVDGWHIIQFAGGKNSPTKFHLNLFWSTNTS  846

Query  3687  --SGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
               S K   +  +  +LLLKLR DVN  TP++  VL+KL  WCS +GKS+SP+TLA+L A+
Sbjct  847   HPSQKAYKQAEDAASLLLKLRTDVNMVTPKVERVLQKLPHWCSLFGKSTSPYTLAFLSAL  906

Query  3861  SVD  3869
              V 
Sbjct  907   PVQ  909



>gb|KFK29147.1| hypothetical protein AALP_AA7G095000 [Arabis alpina]
Length=901

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/906 (53%), Positives = 644/906 (71%), Gaps = 46/906 (5%)
 Frame = +3

Query  1191  HLKSYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAA  1370
              +K+Y I      RSG   + L   +   +W V+  Q   LP PL+A++AG+ GFSE+ A
Sbjct  26    EVKTYVI------RSGKVWISLLILISYSSWAVYNYQHTNLPRPLTAQQAGKRGFSEIEA  79

Query  1371  MNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVG  1550
             M HV AL+Q GP P+ S AL  ALQYVL+  E +KE A  +V+V+V+VF + SGVN+L+G
Sbjct  80    MKHVSALTQFGPRPVASDALVLALQYVLEAVERVKETAHREVDVNVDVFESKSGVNSLIG  139

Query  1551  GLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSN  1730
             G++ GK+ VYSD+ H+V+R+ PK       E +  ++AILVS+H+DTVF+  GAGD SS 
Sbjct  140   GVFKGKSLVYSDMTHIVLRILPK------YEQDAGDNAILVSSHIDTVFSTGGAGDCSSC  193

Query  1731  VAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAM  1910
             VAVMLE+AR +S+ A GFKN S+IFLFNTGEEEGLNGAHSF+TQHPW ++VR+AIDLEAM
Sbjct  194   VAVMLELARAVSQWAHGFKN-SIIFLFNTGEEEGLNGAHSFITQHPWSSSVRLAIDLEAM  252

Query  1911  GIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSG  2090
             G GGKSGIFQAGP+PWAI+NFA  AKYPS Q+++QDLFSSGVIKS+TDFQVY EVAGLSG
Sbjct  253   GTGGKSGIFQAGPNPWAIENFALSAKYPSAQIIAQDLFSSGVIKSATDFQVYTEVAGLSG  312

Query  2091  LDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE  2270
             LDFAF D+TAVYHTKNDK+ L+KPGSLQHLGEN+LPFLL+ ASSSDLPT ++ L      
Sbjct  313   LDFAFADNTAVYHTKNDKLELIKPGSLQHLGENVLPFLLRVASSSDLPT-DQALQGDDKS  371

Query  2271  DEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSI  2450
               D+ VYFDILG+YM+VY +SF  M + +VI+ S+LI + SL MGG  A++SL+ + LS 
Sbjct  372   KPDSAVYFDILGKYMIVYRQSFGTMLYVSVIMQSILIWVMSLIMGGYPAVVSLILACLSF  431

Query  2451  VLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHK  2630
             +L WI SV+ SV VA+VLP +SS+PVP+ ++PW+A+GLF  PA+LG+  GQHV ++FL K
Sbjct  432   ILSWIFSVAFSVAVAFVLPWISSSPVPYASNPWMAVGLFVPPAILGSLSGQHVAFIFLRK  491

Query  2631  FLSYTFSERKRSFILFVQDDEDVSE------CELEAERWMFKAGLLQWLLVLAVGTYLKI  2792
                      KR+      +D  VS        +LEAERW+FK+G +QWLL+LA+GTY K+
Sbjct  492   ------RSPKRN-----ANDTQVSPRVIDHLAKLEAERWLFKSGFIQWLLLLALGTYYKL  540

Query  2793  GSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTL  2963
             GS+Y+AL+WLV PA AY LLEA   P +S KPL   T LIGL +P  +SSG F+ L  T+
Sbjct  541   GSTYIALLWLVPPAFAYGLLEATLTPIRSPKPLKLATILIGLAIPTLVSSGNFIRLSGTM  600

Query  2964  IGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFV  3143
             IG L+RF  NPG   +W+ +A+VAV+IA  + LTM Y+L YIH S AK+  V   CV  V
Sbjct  601   IGMLIRFDRNPGGTPEWLGSALVAVIIATFISLTMVYLLAYIHLSAAKTFIVTVLCVSTV  660

Query  3144  VSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-G  3320
             +SL +V+  ++PAF +DTARA+N+V VVD +G    VS I LFS TPGNL++EAE++  G
Sbjct  661   LSLSIVSSGVLPAFTEDTARALNVVHVVDTSGQDQ-VSFILLFSNTPGNLNMEAEQIKEG  719

Query  3321  FVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAY  3497
             F CGR+   DFV+F  KYSC TE  A LGW +  +P LRV  D  E + RAT + ++   
Sbjct  720   FRCGRENKIDFVSFEAKYSCVTENDAGLGWDKQDVPVLRVINDNWENEGRATTVSMNAGG  779

Query  3498  STRWSLGINTNEIKDFELK---DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTL  3668
             STRW+LG++  +++DF L+   +   ++++ G + +  +GWH ++FAGGK +PT F L L
Sbjct  780   STRWTLGLDMEQLQDFTLQVSGENEELMIAQGEKTSDGEGWHQIQFAGGKKAPTSFVLKL  839

Query  3669  QWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAY  3848
                     K++    + +  LLKLR D +  TP++  VL+KL  +CS +GKS++PFTLA+
Sbjct  840   Y------KKKLDSDEKKQRPLLKLRTDFDRLTPQVQRVLDKLPPFCSLFGKSTNPFTLAF  893

Query  3849  LDAISV  3866
             L ++S+
Sbjct  894   LASLSL  899



>gb|KHG12605.1| Endoplasmic reticulum metallopeptidase 1 [Gossypium arboreum]
Length=909

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/897 (53%), Positives = 630/897 (70%), Gaps = 27/897 (3%)
 Frame = +3

Query  1200  SYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNH  1379
             +++I+   A RSG+  + LF  +V  +W V+  Q++ LP PL+AE+AG+ GFSEVAAM H
Sbjct  32    NHSIQIRTARRSGFTWLTLFAVIVYSSWAVYQYQYENLPVPLTAEQAGKRGFSEVAAMKH  91

Query  1380  VKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLY  1559
             VKAL++LGPH +GS A++ ALQYVL   E IK+ A  +V+V+V++FH N G   L  G++
Sbjct  92    VKALTELGPHTIGSDAIELALQYVLAELENIKKTAHWEVDVEVDLFHVNVGATRLDSGMF  151

Query  1560  FGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAV  1739
               +T +YSDL H+V+R+ PK         E  E+AILVS+H+DTVF+ EGAGD SS V+V
Sbjct  152   VDRTIIYSDLDHIVLRMLPKYAP------EARENAILVSSHIDTVFSTEGAGDCSSCVSV  205

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+S+ A GFKN +VIFLFNTGEEEGL+GAHSF+TQHPW  T+R+AIDLEAMGIG
Sbjct  206   MLELARGISQWAHGFKN-AVIFLFNTGEEEGLSGAHSFITQHPWSTTIRMAIDLEAMGIG  264

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS IFQAGP P A++ FA VAKYPSG ++ QD+FSSGVIKS+TDFQVY+EVAGLSGLDF
Sbjct  265   GKSAIFQAGPHPLAVETFASVAKYPSGNIIFQDIFSSGVIKSATDFQVYREVAGLSGLDF  324

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
              + DH AVYHTKNDK+ LLK GSLQHLGEN+L FLLQ ++SS L   N T+       +D
Sbjct  325   VYADHGAVYHTKNDKLKLLKSGSLQHLGENMLAFLLQISTSSHLSKANATV-------DD  377

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
                  D  G+YMV+Y + FA+M H +VI+ SLLI   SL MGG +A +SL FS LS +LM
Sbjct  378   IQSGHDSAGQYMVIYRQRFANMLHSSVILQSLLIWTTSLLMGGSTAAVSLAFSCLSNILM  437

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
             WI S+S SVL A++LP +SS+P+P+++ P L +GLFAAPA LGA  GQH+ YL L ++LS
Sbjct  438   WIFSISFSVLAAFILPLISSSPLPYLSIPSLVLGLFAAPAFLGALTGQHLGYLVLKRYLS  497

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               +++RK+     +Q D      +LE ERW+FKAG LQWL++L +GTY KIGSSYLALVW
Sbjct  498   NVYAKRKQ-LSPAIQAD----LIKLETERWLFKAGSLQWLVLLVIGTYYKIGSSYLALVW  552

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LV PA AY LLEA   P +  KPL   T  +GL +P+ +S+G  + L   +IG  VRF+ 
Sbjct  553   LVPPAFAYGLLEATLTPGRLPKPLKLATLWMGLAIPILVSAGQVIKLTTVIIGLSVRFIR  612

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQ  3170
             +PG   +W+P+  +++ IA ++CLT+ Y+L YIH SGAK+  V++TC+LF +SL +V   
Sbjct  613   HPGGTPEWLPSVGLSLFIAVVICLTLVYLLSYIHLSGAKTSIVLSTCILFALSLAVVFSG  672

Query  3171  MVPAFVDDTARAVNIVQVVDHTG--NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDK  3341
             ++P F ++TARAVN+V VVD TG       S+ISLFS TPG    E E++  GF CGR K
Sbjct  673   IIPPFTEETARAVNLVHVVDTTGGFGEKPNSYISLFSFTPGKFTKEVEEIKEGFACGRHK  732

Query  3342  AFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGI  3521
             A D+VTFSVKY C T    + GW ES IP L V +D+ GD R T + IDT  S RW L I
Sbjct  733   AIDYVTFSVKYGCLTYDGTEEGWDESNIPTLDVVKDINGDKRITQVKIDTKRSIRWFLAI  792

Query  3522  NTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRI  3701
             NT EI+DF        LV+  G K  +DGWH ++ +GGKN+PT+F LTL W +NS+ +  
Sbjct  793   NTEEIEDFTFNVGLEELVAADG-KRSIDGWHTIQASGGKNAPTKFELTLFWLQNSTRRSD  851

Query  3702  MEGSEGENLLLKLRADV-NTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                   +  LL++R D+    TP++  VLEKL  W S +GKS+SP TL++L ++ +D
Sbjct  852   KMVQSEQRPLLRIRTDLPGVVTPKVETVLEKLPPWYSLFGKSTSPHTLSFLSSLPID  908



>ref|XP_010253690.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X3 
[Nelumbo nucifera]
Length=898

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/908 (54%), Positives = 622/908 (69%), Gaps = 67/908 (7%)
 Frame = +3

Query  1212  EGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKAL  1391
              G   +RS +  + LF  ++  +W V Y QF+ +P  L+A +AG+ GFSE  AM HVKAL
Sbjct  35    RGESPKRSAFLWLALFAVILNCSWGVHYYQFENMPRSLNANQAGKRGFSEQQAMEHVKAL  94

Query  1392  SQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKT  1571
             ++LGPHP+GS ALD ALQ+VL  +E IK+ A  +V+V V++FHA SG N LV GL+ GKT
Sbjct  95    TELGPHPVGSDALDLALQHVLAASEEIKKMAHWEVDVQVDIFHAKSGANRLVSGLFKGKT  154

Query  1572  PVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEV  1751
              +YSDLKHVV+R+ PK  +      E EE+AILVS+H+DTVF+ EGAGD SS VAVMLE+
Sbjct  155   LLYSDLKHVVLRILPKYGS------EAEENAILVSSHIDTVFSTEGAGDCSSCVAVMLEL  208

Query  1752  ARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSG  1931
             ARG+S+ A GFK N+VIFLFNTGEEEGLNGAHSF+T                        
Sbjct  209   ARGISQWAHGFK-NAVIFLFNTGEEEGLNGAHSFIT------------------------  243

Query  1932  IFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTD  2111
               Q GPDP AI+NFAKVAKYPSGQ+++QDLF SG++KS+TDFQVYKEVAGLSGLDFA+ D
Sbjct  244   --QGGPDPLAIENFAKVAKYPSGQIIAQDLFLSGLVKSATDFQVYKEVAGLSGLDFAYGD  301

Query  2112  HTAVYHTK--------NDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
               AVYHTK        NDK+ LLKPGSLQHLGEN+L FLLQ A SSDL   N T +    
Sbjct  302   AGAVYHTKAFDDSTTQNDKLKLLKPGSLQHLGENMLAFLLQIARSSDL--VNGT-AMQTR  358

Query  2268  EDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALS  2447
             ED D  ++FDILG YMVVY +  A M   +VI+ +LLI   SL MGG  A  SL  S LS
Sbjct  359   EDNDHAIFFDILGTYMVVYRQRLASMLQNSVIMQALLIWTMSLLMGGFPAAASLGLSCLS  418

Query  2448  IVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLH  2627
             ++LMWI S+S S+LVA++LP + S+PVP++A+PWL IGLF APA+LGA  GQHV +  L 
Sbjct  419   VLLMWIFSLSFSILVAFLLPLICSSPVPYIANPWLIIGLFVAPAVLGALTGQHVGFRILQ  478

Query  2628  KFLSYTFSE--RKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSS  2801
             K+L +  S+  +KRS ++           +LE ERW+FKAG +QWL++L VG++ KIGSS
Sbjct  479   KYLQHASSKGGQKRSHVV------QAELIKLETERWLFKAGFVQWLVLLMVGSFYKIGSS  532

Query  2802  YLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGY  2972
             YLALVWLVSPA AY L+EA   P +S KPL   T L+GLTVP+ +S+G+F+ LV T+ G 
Sbjct  533   YLALVWLVSPAFAYGLIEATLSPVRSPKPLKIATLLLGLTVPVLVSAGIFIRLVATMTGM  592

Query  2973  LVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSL  3152
             +VRF  NPG   +W+ + +VAVL+AAI+CLT+ Y+  Y+H SGAK  FV   C LF ++L
Sbjct  593   MVRFDRNPGSTPEWLGSIMVAVLVAAIICLTLVYLFSYVHLSGAKRSFVYANCALFCLAL  652

Query  3153  GMVAMQMVPAFVDDTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-  3317
               V   +VP F +D ARAVN+V VV+ TG    N S VS+ISLFSTTPG L  E E L  
Sbjct  653   TAVVSGIVPPFTEDVARAVNVVHVVETTGRYGENRSPVSYISLFSTTPGKLTKEVEYLKE  712

Query  3318  -GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTA  3494
              GF CGR+K  DFVTF+V Y CW+    + GW ES IP L+V  D  G+ R T I IDT 
Sbjct  713   EGFTCGREKTLDFVTFTVNYGCWSSEDTESGWMESDIPTLKVENDKRGNNRITQISIDTK  772

Query  3495  YSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQW  3674
              STRWSL INT EI+DF  +  S  LV V G KNGV+GWH+++F+GGK SP  FN+TL W
Sbjct  773   DSTRWSLAINTEEIEDFIFEGNSEELVPV-GNKNGVNGWHIIQFSGGKISPRMFNVTLFW  831

Query  3675  HKNSSGKRIMEGSEGEN---LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLA  3845
               NS+  R+   S+ E     LLKLR DV+  TP+   +L KL  WCS +GKS+SP TLA
Sbjct  832   LNNST--RLTNKSDTEKKDPYLLKLRTDVDRLTPKAKRILMKLPPWCSLFGKSTSPHTLA  889

Query  3846  YLDAISVD  3869
             +L  + VD
Sbjct  890   FLSKLPVD  897



>ref|XP_004496278.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X2 [Cicer arietinum]
Length=910

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/897 (54%), Positives = 628/897 (70%), Gaps = 36/897 (4%)
 Frame = +3

Query  1215  GNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALS  1394
             GN+ +RS +  + LF  +      ++  QF+ +P PLSAE+AG+ GFSE+ A NHVKAL+
Sbjct  37    GNI-KRSSFAWLALFFIIAYSCSSIYQYQFQSMPVPLSAEQAGKRGFSEIEAFNHVKALT  95

Query  1395  QLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTP  1574
             ++GPHP+GS AL+ ALQYVL   E IK+ A  +V+V+V++FH  SG N L  GL+ G++ 
Sbjct  96    EVGPHPVGSEALNEALQYVLTACETIKKIAHWEVDVEVDIFHVESGANRLDSGLFAGRSL  155

Query  1575  VYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVA  1754
             VYSDL HVV+R+SPK  +      E  E +ILVS+H+DTVF+ EGAGD SS V VMLE+A
Sbjct  156   VYSDLNHVVVRISPKYMS------EAREKSILVSSHIDTVFSTEGAGDCSSCVGVMLELA  209

Query  1755  RGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGI  1934
             RG+S+ A G K   VIFLFNTGEEEGLNGAHSF+TQHPW  TV++AIDLEAMGIGGKS I
Sbjct  210   RGISQWAHGLKKG-VIFLFNTGEEEGLNGAHSFITQHPWSKTVQMAIDLEAMGIGGKSSI  268

Query  1935  FQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDH  2114
             FQAGP PWAI+N+A VAKYPSGQ+V+QDLFSSGVIKS+TDFQVYK+VAGLSGLDFA+ D+
Sbjct  269   FQAGPHPWAIENYASVAKYPSGQIVAQDLFSSGVIKSATDFQVYKDVAGLSGLDFAYVDN  328

Query  2115  TAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSED--EDTVV  2288
             TAVYHTKNDK+ LL  GSLQHLGEN+L FLL   +SS  P  +   ST   ED   +  +
Sbjct  329   TAVYHTKNDKLELLTKGSLQHLGENMLAFLLHIGASSHFPEGS---STESKEDISNNKAI  385

Query  2289  YFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIG  2468
             YFDILG YMVVY + FA++ H +VI+ SLLI   SL+MGG+ A  SL  S L ++LMW+ 
Sbjct  386   YFDILGTYMVVYRQKFANLLHNSVIMQSLLIWATSLFMGGIPAAASLALSCLGVLLMWLF  445

Query  2469  svslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTF  2648
             ++  S+LVA+++P +SS+PVP+VASPWL +GLF APA+LGA  GQH+ YL   K+L    
Sbjct  446   ALGFSLLVAFLIPMISSSPVPYVASPWLVVGLFGAPAILGALTGQHLGYLLFKKYLLNLH  505

Query  2649  SERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVS  2828
             S+R R     +Q D      +LEAERW++KAG  QWL++L +G Y KIGSSYLALVWLVS
Sbjct  506   SKR-RQIPPIIQAD----LVKLEAERWLYKAGSFQWLILLILGNYFKIGSSYLALVWLVS  560

Query  2829  PALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPG  2999
             PA A+   EA   PA+  KPL   T ++GL  P+  S+G+F+ L  T+IG +VR   NPG
Sbjct  561   PAFAFGFFEATLSPARLPKPLKLATLVLGLATPILFSAGIFIRLAATIIGGMVRLDRNPG  620

Query  3000  EQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVP  3179
                +W+   ++A  IAA++ LT+ Y+L Y+H SG K    + T VLF +SL +V+  +VP
Sbjct  621   GTPEWLGNFVIAAYIAALLSLTLVYLLSYVHLSGVKGTITLATLVLFGLSLAVVSFGVVP  680

Query  3180  AFVDDTARAVNIVQVVDHTGNSSVV----SHISLFSTTPGNLDVEAEKLG-GFVCGRDKA  3344
              F +DTARAVN+V VVD TG    +    S++SLFSTTPGNL+ E E +   F+CG++K 
Sbjct  681   PFSEDTARAVNVVHVVDATGGLDEIHTPESYVSLFSTTPGNLNKEVEHINESFICGKNKT  740

Query  3345  FDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGIN  3524
              DFVTFSVKY C T   A  GW E  IP + VG D + + R T + I+T  S RW L IN
Sbjct  741   VDFVTFSVKYGCRTYNDATSGWSEDDIPTMHVGSDAKENKRITQVSINTKDSVRWVLAIN  800

Query  3525  TNEIKDFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKR  3698
             T+EI+DF+L D   S  L+SV   K+ VDGWH+++F+GGKN+P  F+LTL W   S+   
Sbjct  801   TDEIEDFKLNDARSSEELISV-DRKSSVDGWHIIQFSGGKNAPRLFDLTLYWRSGST---  856

Query  3699  IMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                    +  LLKLR DV+  TP    +L+KL  WCS +GKS+SP TLA+L  ++V+
Sbjct  857   ----PSIDGYLLKLRTDVDILTPITERILQKLPYWCSLFGKSTSPHTLAFLRNLAVN  909



>ref|XP_009146707.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Brassica 
rapa]
Length=911

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/891 (53%), Positives = 630/891 (71%), Gaps = 35/891 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RSG     +   ++  +W V+  Q   LP PL+A++AG+ GFSE+ AM HV AL+Q GP
Sbjct  39    RRSGKTWFSVLILIIYSSWAVYNHQHGNLPRPLTAKQAGKRGFSEIQAMKHVTALTQFGP  98

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL   E +KE A  DV+V+V+ F + SGVN LVGGL+ GK+ VYSD
Sbjct  99    HPVSSDALVHALEYVLGEVEKVKETAHFDVDVNVDFFESKSGVNRLVGGLFKGKSLVYSD  158

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK       E E  E+AILVS+H+DTVF+  GAGD SS VAVMLE+AR +S
Sbjct  159   ISHIVVRIMPK------YESEAGENAILVSSHIDTVFSTGGAGDCSSCVAVMLELARSVS  212

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN SVIFLFNTGEEEGLNGAHSF+TQHPW +TVR+A+DLEAMG GGKS IFQAG
Sbjct  213   QSAHGFKN-SVIFLFNTGEEEGLNGAHSFITQHPWSSTVRLAVDLEAMGAGGKSAIFQAG  271

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVY+EVAGLSGLDFAF D+TAVY
Sbjct  272   PSPWAIENFAMAAKYPSGQIMGQDLFTSGVIKSATDFQVYREVAGLSGLDFAFADNTAVY  331

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FL++  SSSDLP  +KT+ T  S   D  +YFDILG
Sbjct  332   HTKNDKIELIKPGSLQHLGENMLAFLIRVGSSSDLPK-DKTVQTSSS---DAAIYFDILG  387

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMVVY ++FA M + +VI+ S+LI + S  MGG  AL+S++ S LS +L WI SV+ SV
Sbjct  388   KYMVVYRQNFATMMYVSVIMQSMLIWVMSCLMGGYPALVSVMLSCLSFILAWIFSVAFSV  447

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LP +SS+PVP+ + P + IGLF +PA+LG+  GQH+ + FL K  S   S  K  
Sbjct  448   AVAFILPWISSSPVPYASYPLMTIGLFVSPAVLGSISGQHLAFSFLRKKPSNRNSNNKE-  506

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
               L  +  ++++  +LEAERW+FKAG +QW ++L  GTY K+GS+YLALVWLV PA AY 
Sbjct  507   --LSPRLRDNLA--KLEAERWLFKAGFIQWFVLLVFGTYYKLGSTYLALVWLVPPAFAYG  562

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T +I L VP+ +S+G F+ L  TLIG L+RF  NPG   +W+
Sbjct  563   LLEATLTPIRFPKPLKLATLVISLAVPILVSAGGFIRLAGTLIGMLIRFDRNPGGTPEWL  622

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                +VAV+IA  V LTM Y+L YIH SG+K   V   C++  +SL +VA   +PAF +DT
Sbjct  623   GNVVVAVVIATFVSLTMVYLLAYIHLSGSKRSIVTALCIITALSLALVASGFLPAFTEDT  682

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
             ARAVN+V VVD +G     S ISLFS TPGNL+VEAE++  GF CGRD   DFV+F  KY
Sbjct  683   ARAVNVVHVVDTSGEEQ-ASFISLFSNTPGNLNVEAEQIKEGFRCGRDNKVDFVSFETKY  741

Query  3375  SCWTEPTAKLGWKESRIPALRV---GRDMEGDTRATL-IHIDTAYSTRWSLGINTNEIKD  3542
             SC ++  A++GW +S +P LRV    +  EGD R  + + ++T  S+RW LGI+   ++D
Sbjct  742   SCVSKKDAEVGWDKSDVPVLRVVNEEKGGEGDERRIIGVSMETGGSSRWILGIDMEVVED  801

Query  3543  FELK-----DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME  3707
             F L+     ++  +++  G + +G +GWH ++F+GGK +PT+F L L   K    K+ M 
Sbjct  802   FTLQVGEEEEDEELMIGRGEKSSGQEGWHQIQFSGGKKAPTKFVLKLYEKKGDERKKKM-  860

Query  3708  GSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
                 +  +LKLR D +  TP++  VLE+L ++CSQ+GKS+SPFTLA+L ++
Sbjct  861   ----QRPVLKLRTDFDRITPQVKRVLERLPTYCSQFGKSTSPFTLAFLASL  907



>emb|CDY22898.1| BnaA01g18360D [Brassica napus]
Length=991

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/891 (53%), Positives = 626/891 (70%), Gaps = 35/891 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RSG     +   ++  +W V+  Q   LP PL+A++AG+ GFSE+ AM HV AL+Q GP
Sbjct  119   RRSGKTWFSVLILIIYSSWAVYNHQHGNLPRPLTAKQAGKRGFSEIQAMKHVAALTQFGP  178

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL   E +KE A  DV+V+V+ F + SGVN LVGGL+ GK+ VYSD
Sbjct  179   HPVSSDALVHALEYVLGEVEKVKETAHFDVDVNVDFFESKSGVNRLVGGLFKGKSLVYSD  238

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK       E E  E+AILVS+H+DTVF+  GAGD SS VAVMLE+AR +S
Sbjct  239   ISHIVVRIMPK------YESEAGENAILVSSHIDTVFSTGGAGDCSSCVAVMLELARSVS  292

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN SVIFLFNTGEEEGLNGAHSF+TQHPW +TVR+A+DLEAMG GGKS IFQAG
Sbjct  293   QSAHGFKN-SVIFLFNTGEEEGLNGAHSFITQHPWSSTVRLAVDLEAMGAGGKSAIFQAG  351

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+TAVY
Sbjct  352   PSPWAIENFALAAKYPSGQIMGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNTAVY  411

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FL++  SSSDLP  +KTL T  S   D  +YFDILG
Sbjct  412   HTKNDKIELIKPGSLQHLGENMLAFLIRVGSSSDLPK-DKTLQTSSS---DAAIYFDILG  467

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMVVY ++FA M + +VI+ S+LI + S  MGG  AL+S++ S LS +L WI SV+ SV
Sbjct  468   KYMVVYRQNFATMMYVSVIMQSMLIWVMSCLMGGYPALVSVMLSCLSFILAWIFSVAFSV  527

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LP +SS+PVP+ + P + IGLF +PA+LG+  GQH+ + FL K      S R  +
Sbjct  528   AVAFILPWISSSPVPYASYPLMTIGLFVSPAVLGSISGQHLAFSFLRK----KPSNRNSN  583

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
              +       D +  +LEAERW+FKAG +QW ++L  GTY K+GS+YLALVWLV PA +Y 
Sbjct  584   NMELSPRLRD-NLAKLEAERWLFKAGFIQWFVLLVFGTYYKLGSTYLALVWLVPPAFSYG  642

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T  I L VP+ +S+G F+ L  TLIG L+RF  NPG   +W+
Sbjct  643   LLEATLTPIRFPKPLKLATLAISLAVPILVSAGGFIRLAGTLIGMLIRFDRNPGGTPEWL  702

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                +VAV+IA  V LTM Y+L YIH SG+K   V   C++  +SL +VA   +PAF +DT
Sbjct  703   GNVVVAVVIATFVSLTMVYLLAYIHLSGSKRSIVTALCIITALSLALVASGFLPAFTEDT  762

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
             ARAVN+V VVD +G     S ISLFS TPGNL+VEAE++  GF CGRD   DFV+F  KY
Sbjct  763   ARAVNVVHVVDTSGEEQ-ASFISLFSNTPGNLNVEAEQIKEGFRCGRDNKVDFVSFETKY  821

Query  3375  SCWTEPTAKLGWKESRIPALRVGRDMEG----DTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             SC ++  A++GW +S +P LRV  + +G    + R   + ++T  S+RW LGI+   ++D
Sbjct  822   SCVSKKDAEVGWDKSDVPVLRVVNEEKGRGDDERRIIAVSMETGGSSRWILGIDMEVVED  881

Query  3543  FELK--DESG---VLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME  3707
             F L+  +E G   +++  G + +G +GWH ++F+GGK +PT+F L L   K    K+ M 
Sbjct  882   FTLQVGEEEGDEELMIGRGEKSSGQEGWHQIQFSGGKKAPTKFVLKLYEKKGDERKKKM-  940

Query  3708  GSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
                 +  +LKLR D +  TP++  VLE+L ++CSQ+GKS+SPFTLA+L ++
Sbjct  941   ----QRPVLKLRTDFDRITPQVQRVLERLPTYCSQFGKSTSPFTLAFLASL  987



>ref|XP_010943484.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Elaeis guineensis]
Length=878

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/864 (54%), Positives = 599/864 (69%), Gaps = 28/864 (3%)
 Frame = +3

Query  1317  EPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDV  1496
              P SAE+AG+ GFSEV+AM HV++L++LGPHP+GS ALD ALQYV   +E +K  A  +V
Sbjct  29    RPKSAEKAGKRGFSEVSAMEHVQSLTKLGPHPVGSDALDLALQYVFAASEKMKRTAHWEV  88

Query  1497  NVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVS  1676
             +V V+ FHA  G + L  GL+ GKT +YSDLKHVV+R+ PK           EE+ ILVS
Sbjct  89    DVQVDFFHAKIGASRLASGLFKGKTHIYSDLKHVVLRILPKYLPAA------EENLILVS  142

Query  1677  AHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFV  1856
             +H+DTVFA EGAGD SS V VMLE+ARG+S+ A GFKN  VIFLFNTGEEEGLNGAHSF+
Sbjct  143   SHIDTVFATEGAGDCSSCVGVMLELARGISQWAHGFKNG-VIFLFNTGEEEGLNGAHSFI  201

Query  1857  TQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGV  2036
             TQHPW   +R  IDLEAMGIGGKS +FQ G  PWAI+ FAKVAKYPSGQ+++QDLF SG 
Sbjct  202   TQHPWSRAIRFVIDLEAMGIGGKSSLFQGGSAPWAIETFAKVAKYPSGQIIAQDLFLSGA  261

Query  2037  IKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAA  2216
             IKS+TD QVY+EVAGL GLDFA++D TAVYHTKNDK+ LLKPGSLQHLGEN+L FLL  A
Sbjct  262   IKSATDLQVYQEVAGLPGLDFAYSDATAVYHTKNDKLKLLKPGSLQHLGENMLAFLLHTA  321

Query  2217  SSSDLPTPNKTLSTGKSE--DEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisia  2390
              SS L   +K     + E  ++   ++FD+LG+YMVVY +  A M H +VI+ SLLI IA
Sbjct  322   MSSRL---HKVAEVEREEGTNQTQAIFFDVLGKYMVVYTQQLASMLHNSVILQSLLIWIA  378

Query  2391  slYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfa  2570
             SL MGG    IS   S LSIVLMWI S+SL++LVA+++P +S++PVP++A PWL +GLF 
Sbjct  379   SLLMGGYPGAISFGLSCLSIVLMWIFSLSLTILVAFIIPLISTSPVPYIAYPWLVVGLFG  438

Query  2571  apallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLL  2750
             APA+LGA  GQHV + FL K+L + + +R  S    VQ++        EAERW+FK+G +
Sbjct  439   APAMLGALTGQHVGFFFLKKYLHHVYKKRVPSLSHSVQEN----LINWEAERWLFKSGFI  494

Query  2751  QWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPL  2921
             QWL++L VG   K+GSS+LALVWLVSPA AY L+EA   P +  K L  +T ++GL VP+
Sbjct  495   QWLILLVVGNLFKVGSSFLALVWLVSPAFAYGLMEATLSPTRLPKQLKIITLILGLAVPV  554

Query  2922  AISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSG  3101
              +S+G+   LV T+IG LVRF  +PG   DW+ + IVA+  AA+VCL + Y+L YIH SG
Sbjct  555   LVSAGMITRLVGTIIGVLVRFERSPGSAPDWLGSLIVAIFSAAVVCLMLVYLLSYIHLSG  614

Query  3102  AKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT---GNSSVVSHISLF  3272
             AK   + + C L  ++L  V+  + P F +D +RAVN+V VVD T   G+    S +SLF
Sbjct  615   AKGLVIFSMCTLLALTLTAVSSGIFPTFTEDISRAVNVVHVVDTTGRYGSQDPASFVSLF  674

Query  3273  STTPGNLDVEAEKLGG--FVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR  3446
             S TPG L  E E L    F CGR+K  DFVTF+V Y CW+      GW +  IP L V  
Sbjct  675   SATPGKLTKEVENLKDEEFACGRNKTLDFVTFTVNYGCWSSKDGNNGWSKLDIPELHVES  734

Query  3447  DMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRF  3626
             D   D R T + IDT  +TRWSL +N  EI DF  +  S  LV   G K+ VDGWH+++F
Sbjct  735   DYMSDVRKTRVLIDTKLATRWSLAVNGEEISDFTFEVGSEELVP-SGNKSMVDGWHIIQF  793

Query  3627  AGGKNSPTEFNLTLQWHKNS---SGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLL  3797
             AGGKNSPT+F+L L W  N+   S K   +  +  +LLLKLR DVN  TP++  VL+KL 
Sbjct  794   AGGKNSPTKFHLNLFWSTNTSHPSQKAYKQAEDAASLLLKLRTDVNMVTPKVERVLQKLP  853

Query  3798  SWCSQYGKSSSPFTLAYLDAISVD  3869
              WCS +GKS+SP+TLA+L A+ V 
Sbjct  854   HWCSLFGKSTSPYTLAFLSALPVQ  877



>ref|XP_003535531.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X1 [Glycine max]
 ref|XP_006589429.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X2 [Glycine max]
 ref|XP_006589430.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X3 [Glycine max]
 gb|KHN17137.1| Endoplasmic reticulum metallopeptidase 1 [Glycine soja]
Length=912

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/893 (55%), Positives = 627/893 (70%), Gaps = 37/893 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS +  + L   +      +++ QF+ +P PL+AEEAG+ GFSE+ A  HV+AL+Q+GP
Sbjct  42    RRSSFVWLALLLIITYCCSSIYHYQFQSMPVPLTAEEAGKRGFSEIEAFKHVRALTQVGP  101

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS AL  ALQYVL   E IK+ A  +V+V+V++FHA SG N L  GL+ G+T VYSD
Sbjct  102   HPVGSEALHLALQYVLTACENIKKTALWEVDVEVDLFHAKSGANHLRSGLFSGRTLVYSD  161

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L HVV+R+ PK  +      E    +ILVS+H+DTV +  GAGD SS V VMLE+ARG+S
Sbjct  162   LNHVVVRILPKYVS------EARGQSILVSSHIDTVISTAGAGDCSSCVGVMLELARGIS  215

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A G K  ++IFLFNTGEEEGLNGAHSF+TQHPW  TVRVAIDLEAMGIGGKS IFQAG
Sbjct  216   QWAHGLKR-AIIFLFNTGEEEGLNGAHSFITQHPWSKTVRVAIDLEAMGIGGKSTIFQAG  274

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA VAKYPSGQV++QDLFSSG IKS+TDFQVYKEVAGLSGLDFA+ D+TAVY
Sbjct  275   PHPWAIENFALVAKYPSGQVIAQDLFSSGAIKSATDFQVYKEVAGLSGLDFAYLDNTAVY  334

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSED--EDTVVYFDI  2300
             HTKNDK+ LLK GSLQHLGEN+L FLL   +SS +P  N   ST   ED  ++  +YFDI
Sbjct  335   HTKNDKLELLKTGSLQHLGENMLAFLLHIGASSHIPEGN---STESEEDISKNNAIYFDI  391

Query  2301  LGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsl  2480
             LG YMVVY + FA+M H +VI+ SLLI + SL MGG+ A  SL  S LS++LMW+ ++S 
Sbjct  392   LGMYMVVYRQKFANMLHNSVIMQSLLIWVTSLVMGGIPAAASLALSCLSVLLMWVFALSF  451

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSE-R  2657
             S LV+++LP +SS+PVP+V+SP L +GLF APA LGA  GQH  +L L K+LS T S+ R
Sbjct  452   SFLVSFLLPLISSSPVPYVSSPMLVVGLFGAPAFLGALTGQHFGFLLLQKYLSNTLSKGR  511

Query  2658  KRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPAL  2837
             + + I+        +  ++EAERW++KAG  QWL++L +G Y KIGSSYLALVWLVSPA 
Sbjct  512   QLTPII------KAAVVKMEAERWLYKAGSFQWLILLILGNYFKIGSSYLALVWLVSPAF  565

Query  2838  AYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQA  3008
             AY   EA   PA+  KPL   T ++GL  P+  S+G+F+ L  TLIG +VRF  NPG   
Sbjct  566   AYGFFEATLTPARLPKPLKLATIILGLATPILFSAGIFIRLAATLIGGMVRFDRNPGGTP  625

Query  3009  DWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFV  3188
             +W+   ++A  IA+++ LT+ Y+L Y+H SGAK   ++ T VLF +SL +V   +VP F 
Sbjct  626   EWLGNFVIAAFIASLLSLTLVYLLSYVHLSGAKRAIILATLVLFSLSLAVVLTGVVPPFS  685

Query  3189  DDTARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDF  3353
             +DTARAVN+V VVD TG      + +S++SLFS TPGNL+ E +++  GFVCGRDK  DF
Sbjct  686   EDTARAVNVVHVVDATGKLDQGQNPISYVSLFSNTPGNLNKEVKQIDEGFVCGRDKTVDF  745

Query  3354  VTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNE  3533
             VTFSVKY CWT       W E  IP + V  D +G+ R T + I+T  S RW L IN  E
Sbjct  746   VTFSVKYGCWTYNDTTNDWTEMDIPTMNVVSDAKGNGRITQVSINTKGSIRWVLAINIEE  805

Query  3534  IKDFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME  3707
             I+DFE KD   S  L+SV  +K+ VDGWH+++F+GGKN+PT F+LTL W   S+      
Sbjct  806   IEDFEFKDARNSEELISV-DKKSSVDGWHIIQFSGGKNAPTLFDLTLYWRSGST------  858

Query  3708  GSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
                 ++ LLKLR DVN  TP    VLEKL  WCS +GKS+SP+TLA+L  + V
Sbjct  859   -HNSDSPLLKLRTDVNRLTPITERVLEKLPRWCSLFGKSTSPYTLAFLTNLPV  910



>ref|XP_004496277.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X1 [Cicer arietinum]
Length=924

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/911 (53%), Positives = 628/911 (69%), Gaps = 50/911 (5%)
 Frame = +3

Query  1215  GNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALS  1394
             GN+ +RS +  + LF  +      ++  QF+ +P PLSAE+AG+ GFSE+ A NHVKAL+
Sbjct  37    GNI-KRSSFAWLALFFIIAYSCSSIYQYQFQSMPVPLSAEQAGKRGFSEIEAFNHVKALT  95

Query  1395  QLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTP  1574
             ++GPHP+GS AL+ ALQYVL   E IK+ A  +V+V+V++FH  SG N L  GL+ G++ 
Sbjct  96    EVGPHPVGSEALNEALQYVLTACETIKKIAHWEVDVEVDIFHVESGANRLDSGLFAGRSL  155

Query  1575  VYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVA  1754
             VYSDL HVV+R+SPK  +      E  E +ILVS+H+DTVF+ EGAGD SS V VMLE+A
Sbjct  156   VYSDLNHVVVRISPKYMS------EAREKSILVSSHIDTVFSTEGAGDCSSCVGVMLELA  209

Query  1755  RGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGI  1934
             RG+S+ A G K   VIFLFNTGEEEGLNGAHSF+TQHPW  TV++AIDLEAMGIGGKS I
Sbjct  210   RGISQWAHGLKKG-VIFLFNTGEEEGLNGAHSFITQHPWSKTVQMAIDLEAMGIGGKSSI  268

Query  1935  FQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDH  2114
             FQAGP PWAI+N+A VAKYPSGQ+V+QDLFSSGVIKS+TDFQVYK+VAGLSGLDFA+ D+
Sbjct  269   FQAGPHPWAIENYASVAKYPSGQIVAQDLFSSGVIKSATDFQVYKDVAGLSGLDFAYVDN  328

Query  2115  TAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSED--EDTVV  2288
             TAVYHTKNDK+ LL  GSLQHLGEN+L FLL   +SS  P  +   ST   ED   +  +
Sbjct  329   TAVYHTKNDKLELLTKGSLQHLGENMLAFLLHIGASSHFPEGS---STESKEDISNNKAI  385

Query  2289  YFDIL--------------GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALIS  2426
             YFDIL              G YMVVY + FA++ H +VI+ SLLI   SL+MGG+ A  S
Sbjct  386   YFDILVICSCKNLIVLLGYGTYMVVYRQKFANLLHNSVIMQSLLIWATSLFMGGIPAAAS  445

Query  2427  LVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQH  2606
             L  S L ++LMW+ ++  S+LVA+++P +SS+PVP+VASPWL +GLF APA+LGA  GQH
Sbjct  446   LALSCLGVLLMWLFALGFSLLVAFLIPMISSSPVPYVASPWLVVGLFGAPAILGALTGQH  505

Query  2607  VVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYL  2786
             + YL   K+L    S+R R     +Q D      +LEAERW++KAG  QWL++L +G Y 
Sbjct  506   LGYLLFKKYLLNLHSKR-RQIPPIIQAD----LVKLEAERWLYKAGSFQWLILLILGNYF  560

Query  2787  KIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVN  2957
             KIGSSYLALVWLVSPA A+   EA   PA+  KPL   T ++GL  P+  S+G+F+ L  
Sbjct  561   KIGSSYLALVWLVSPAFAFGFFEATLSPARLPKPLKLATLVLGLATPILFSAGIFIRLAA  620

Query  2958  TLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVL  3137
             T+IG +VR   NPG   +W+   ++A  IAA++ LT+ Y+L Y+H SG K    + T VL
Sbjct  621   TIIGGMVRLDRNPGGTPEWLGNFVIAAYIAALLSLTLVYLLSYVHLSGVKGTITLATLVL  680

Query  3138  FVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGNSSVV----SHISLFSTTPGNLDVEA  3305
             F +SL +V+  +VP F +DTARAVN+V VVD TG    +    S++SLFSTTPGNL+ E 
Sbjct  681   FGLSLAVVSFGVVPPFSEDTARAVNVVHVVDATGGLDEIHTPESYVSLFSTTPGNLNKEV  740

Query  3306  EKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIH  3482
             E +   F+CG++K  DFVTFSVKY C T   A  GW E  IP + VG D + + R T + 
Sbjct  741   EHINESFICGKNKTVDFVTFSVKYGCRTYNDATSGWSEDDIPTMHVGSDAKENKRITQVS  800

Query  3483  IDTAYSTRWSLGINTNEIKDFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEF  3656
             I+T  S RW L INT+EI+DF+L D   S  L+SV   K+ VDGWH+++F+GGKN+P  F
Sbjct  801   INTKDSVRWVLAINTDEIEDFKLNDARSSEELISV-DRKSSVDGWHIIQFSGGKNAPRLF  859

Query  3657  NLTLQWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPF  3836
             +LTL W   S+          +  LLKLR DV+  TP    +L+KL  WCS +GKS+SP 
Sbjct  860   DLTLYWRSGST-------PSIDGYLLKLRTDVDILTPITERILQKLPYWCSLFGKSTSPH  912

Query  3837  TLAYLDAISVD  3869
             TLA+L  ++V+
Sbjct  913   TLAFLRNLAVN  923



>ref|XP_010456605.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Camelina 
sativa]
Length=878

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/888 (52%), Positives = 620/888 (70%), Gaps = 64/888 (7%)
 Frame = +3

Query  1227  ERSG---YEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQ  1397
             +RSG   + +++L T+    +W V+  Q+  LP+PL+A++AG+ GFSE+AAM HVKAL+Q
Sbjct  41    QRSGKVWFSVLILVTYF---SWAVYSYQYGNLPKPLTAKQAGKRGFSEIAAMKHVKALTQ  97

Query  1398  LGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPV  1577
              GPHP+ S AL  AL+                                LVGG + GK+ V
Sbjct  98    FGPHPVSSDALVHALE--------------------------------LVGGHFKGKSLV  125

Query  1578  YSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVAR  1757
             YSD+ H+V+R+ PK       E +  ++AILVS+H+DTVF   GAGD SS VAVMLE+AR
Sbjct  126   YSDISHIVLRILPK------YESDAGDNAILVSSHIDTVFTTGGAGDCSSCVAVMLELAR  179

Query  1758  GLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIF  1937
              +S+ A GFKN S+IFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMG GGKS +F
Sbjct  180   SVSQSAHGFKN-SIIFLFNTGEEEGLNGAHSFITQHPWSSTIRLAIDLEAMGAGGKSSVF  238

Query  1938  QAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHT  2117
             QAGP PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+T
Sbjct  239   QAGPSPWAIENFALAAKYPSGQIIGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNT  298

Query  2118  AVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFD  2297
             AVYHTKNDK+ L+KPGSLQHLGEN L FLL+ ASSSDL + +KTL   +  + D+ VYFD
Sbjct  299   AVYHTKNDKIELIKPGSLQHLGENTLAFLLRVASSSDL-SKDKTLQEEEKANPDSAVYFD  357

Query  2298  ILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvs  2477
             +LG+YM+VY +SFA M + +VI+ S+LI + S++MGG  A++SL+ S LSI+L WI SV+
Sbjct  358   VLGKYMIVYRQSFATMLYVSVIMQSILIWVLSVFMGGYPAVVSLILSCLSIILSWIFSVA  417

Query  2478  lsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSER  2657
              SV VA++LP +SS+PVP+ ++PW+ +GLF +PA+LG+  GQHV ++FL K      S  
Sbjct  418   FSVAVAFILPWISSSPVPYASNPWMVVGLFVSPAVLGSISGQHVAFIFLRK-----KSSN  472

Query  2658  KRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPAL  2837
             + S  L V      +   LEAERW+FKAG +QWL++LA+GTY K+GS+YLALVWLV PA 
Sbjct  473   RNSNKLQVSPRLRDNLARLEAERWLFKAGFIQWLVLLAIGTYYKLGSTYLALVWLVPPAF  532

Query  2838  AYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQA  3008
             AY LLEA   P +  KPL   T  I L VP+ +SSG F+ L  T+IG L+RF S PG   
Sbjct  533   AYGLLEATLSPIRLPKPLKLATLFISLVVPILVSSGSFIQLTGTMIGMLIRFESTPGGTP  592

Query  3009  DWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFV  3188
             +W+  A++AV+IA ++ LTM Y+L YIH SGAK+  V   C+   +SL +VA  + PAF 
Sbjct  593   EWLGNALIAVVIATLLSLTMVYLLSYIHLSGAKTLLVTALCISTALSLSLVASGVFPAFT  652

Query  3189  DDTARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFS  3365
             +DTARAVN+V VVD +G    V+ ISLFS TPGNL++EAE++  GF CGR+   DFV+F 
Sbjct  653   EDTARAVNVVHVVDTSGQDQ-VAFISLFSNTPGNLNMEAEQIKEGFKCGRENKIDFVSFE  711

Query  3366  VKYSCWTEPTAKLGWKESRIPALRVGRDMEGDT-RATLIHIDTAYSTRWSLGINTNEIKD  3542
              KYSC T+  A++GW +  IP LRV  D E D  R T I +DT  S+RW+L I+  EI+D
Sbjct  712   AKYSCVTKKDAEVGWDKHNIPVLRVINDKERDEGRVTAISMDTGGSSRWTLRIDMEEIED  771

Query  3543  FELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
             F ++  ++  ++++ G + +   GWH ++FAGGK +PT F L L   +  S ++     +
Sbjct  772   FTMQVSEDEELMIARGEKSSNEQGWHQIQFAGGKKAPTSFVLKLYKKEEVSDEK-----K  826

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
              +  LLKLR D N  TP++  VLE+L  +CS +GKS+SPFTLA+L ++
Sbjct  827   KQRPLLKLRTDFNRLTPQVQRVLERLPPFCSMFGKSTSPFTLAFLASL  874



>emb|CDY44178.1| BnaC01g22280D [Brassica napus]
Length=962

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/891 (53%), Positives = 624/891 (70%), Gaps = 36/891 (4%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RSG     +   ++  +W V+  Q   LP PL+A++AG+ GFSE+ AM HV AL+Q GP
Sbjct  91    RRSGKTWFSVLILIIYSSWAVYNHQHGNLPRPLTAKQAGKRGFSEIQAMKHVTALTQFGP  150

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+ S AL  AL+YVL   E +KE A  DV+V+V+ F + SGVN LVGGL+ GK+ VYSD
Sbjct  151   HPVSSDALLHALEYVLAEVEQVKETAHFDVDVNVDFFESKSGVNRLVGGLFKGKSLVYSD  210

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             + H+V+R+ PK       E E  E+AILVS+H+DTVF+  GAGD SS VAVMLE+AR +S
Sbjct  211   ISHIVVRIMPK------YESEAGENAILVSSHIDTVFSTGGAGDCSSCVAVMLELARSVS  264

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN SVIFLFNTGEEEGLNGAHSF+TQHPW +TVR+A+DLEAMG GGKS IFQAG
Sbjct  265   QSAHGFKN-SVIFLFNTGEEEGLNGAHSFITQHPWSSTVRLAVDLEAMGAGGKSAIFQAG  323

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P PWAI+NFA  AKYPSGQ++ QDLF+SGVIKS+TDFQVYKEVAGLSGLDFAF D+TAVY
Sbjct  324   PSPWAIENFAMAAKYPSGQIMGQDLFTSGVIKSATDFQVYKEVAGLSGLDFAFADNTAVY  383

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ L+KPGSLQHLGEN+L FLL+  SSSDLP  +KTL T  S   D  +YFDILG
Sbjct  384   HTKNDKIELIKPGSLQHLGENMLAFLLRVGSSSDLPK-DKTLETSSS---DAAIYFDILG  439

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMVVY ++FA M + +VI+ S+LI + S  MGG  AL+S++ S LS +L WI SV+ SV
Sbjct  440   KYMVVYRQNFATMMYVSVIMQSMLIWVMSCLMGGYPALVSVILSCLSFILAWIFSVAFSV  499

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
              VA++LP +SS+PVP+ + P + IGLF +PA+LG+  GQH+ + FL K      S R  +
Sbjct  500   AVAFILPWISSSPVPYASYPLMTIGLFVSPAVLGSISGQHLAFSFLRK----KPSNRNSN  555

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
              +       D +  +LEAERW+FKAG +QW ++L  GTY K+GS+YLALVWLV PA AY 
Sbjct  556   NMELSPTLRD-NLAKLEAERWLFKAGFIQWFVLLVFGTYYKLGSTYLALVWLVPPAFAYG  614

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             LLEA   P +  KPL   T +I L VPL +S+G F+ L  TLIG L+RF  NPG   +W+
Sbjct  615   LLEATLTPIRFPKPLKLATLVISLAVPLLVSAGGFIRLAGTLIGMLIRFDRNPGGTPEWL  674

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                +VAV+IA  V LTM Y+L YIH SG+K   V   C++  +SL +VA   +PAF +DT
Sbjct  675   GNVVVAVVIATFVSLTMVYLLAYIHLSGSKRSIVTALCIITALSLALVASGFLPAFTEDT  734

Query  3198  ARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKY  3374
              RAVN+V VVD +G     S ISL S TPGNL+VEAE++  GF CGR+   DFV+F  KY
Sbjct  735   VRAVNVVHVVDASGEEQ-ASFISLSSNTPGNLNVEAEQIKEGFSCGRENKVDFVSFEAKY  793

Query  3375  SCWTEPTAKLGWKESRIPALRVGRDMEG----DTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             SC ++  A++GW +S +P LRV  D +G    + R   + ++T  S+RW LGI+   ++D
Sbjct  794   SCVSKKDAEVGWDKSDVPVLRVVNDEKGRGDDERRIMAVSMETGGSSRWILGIDMEVVED  853

Query  3543  FELK-----DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME  3707
             F L+     ++  +++  G + +G DGWH ++F+GGK +PT+F L L   K    K++  
Sbjct  854   FTLQVGEEEEDEELMIGRGEKSSGEDGWHQIQFSGGKKAPTKFVLKLYQKKGVEKKKM--  911

Query  3708  GSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
                 +  +LKLR D +  TP++  VLE+L ++CSQ+GKS+SPFTLA+L ++
Sbjct  912   ----QRPVLKLRTDFDRITPQVQRVLERLPTYCSQFGKSTSPFTLAFLASL  958



>ref|XP_006846783.1| hypothetical protein AMTR_s00148p00042460 [Amborella trichopoda]
 gb|ERN08364.1| hypothetical protein AMTR_s00148p00042460 [Amborella trichopoda]
Length=929

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/857 (53%), Positives = 607/857 (71%), Gaps = 30/857 (4%)
 Frame = +3

Query  1278  TWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQ  1457
             +W V + QF  LP PL A +AG+ GFSE+ A+ HVKAL++LGPHP+GS ALD ALQYVL 
Sbjct  57    SWFVHHVQFDRLPLPLDANQAGKRGFSELQALLHVKALTKLGPHPVGSDALDLALQYVLV  116

Query  1458  VAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKL  1637
              +E IK+EA  +VNV+V+ FHA  G N LVGGL+ G+T +YSDLKHVVMR+SPK  +D  
Sbjct  117   ASENIKKEAHWEVNVEVDYFHAERGANRLVGGLFKGRTLLYSDLKHVVMRISPKYHSDA-  175

Query  1638  REGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNT  1817
                  EE+AIL+S+H+DTVF+AEGAGD SS VAVMLE+AR  S+ A GFK  +VIFLFNT
Sbjct  176   -----EENAILISSHIDTVFSAEGAGDCSSCVAVMLELARATSQWAHGFKQ-AVIFLFNT  229

Query  1818  GEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPS  1997
             GEEEGLNGAHSF+ QHPW  TV+  +DLEAMG GGKS IFQ+GPDP +I++FA VAKYPS
Sbjct  230   GEEEGLNGAHSFIIQHPWSETVQFVVDLEAMGTGGKSAIFQSGPDPLSIESFAAVAKYPS  289

Query  1998  GQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQH  2177
             GQ+++QD+F SG+IKS TDFQVY+EVAGLSGLDFA+ D  AVYHTKNDK+ LLKPGSLQH
Sbjct  290   GQIIAQDIFHSGIIKSGTDFQVYREVAGLSGLDFAYGDVGAVYHTKNDKLKLLKPGSLQH  349

Query  2178  LGENLLPFLLQAASSSDLPTPNKTLSTGKSEDE--DTVVYFDILGRYMVVYPRSFADMFH  2351
             LGEN+LPF+L+ A+   LP   K  + G  ED   + +V+FDILG YM+VY +S  +M +
Sbjct  350   LGENMLPFILKTATMPPLP---KEKAGGIKEDRGHNQMVFFDILGMYMIVYHQSLVNMLY  406

Query  2352  KAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVP  2531
              +VI+ SLLI  ASL MGG S++I L  S LS+++MW+ S+S SVLVA++LP V S+PVP
Sbjct  407   GSVILQSLLIWTASLVMGGPSSVICLCISMLSVLMMWVLSISFSVLVAFLLPRVCSSPVP  466

Query  2532  FVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECE  2711
             ++A+PWL +GLF  PA++GA +GQH+   FL KFL  T+ +      +  +    V+  +
Sbjct  467   YIANPWLIVGLFGPPAIVGALLGQHLGSFFLQKFLLSTYLK------IGSKKPNYVNSIK  520

Query  2712  LEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPL  2882
              EA+RW+FKAG +QWL++L  GT  K+GSSY ALVWLVSPA +Y LLEA   P QS K L
Sbjct  521   WEAQRWLFKAGFVQWLIILITGTICKVGSSYFALVWLVSPAFSYGLLEATLSPIQSPKQL  580

Query  2883  DPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCL  3062
               +T +IGL  P+ I++G+ + L+ T+IG  VR   NPG   +W+ + ++A L+AAIVCL
Sbjct  581   RTVTLVIGLAAPIIITAGIVIRLMGTIIGTAVRVDRNPGGTPEWLASVVIATLVAAIVCL  640

Query  3063  TMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT--  3236
             T  Y+L Y    GA+   ++    LF ++L  V  +++P F +D +RAVN++ VV+ T  
Sbjct  641   THVYLLSYAQFPGARRSIILAAFALFGITLAFVVAELIPPFTEDVSRAVNVLHVVETTGK  700

Query  3237  --GNSSVVSHISLFSTTPGNLDVEAEKL--GGFVCGRDKAFDFVTFSVKYSCWTEPTAKL  3404
               G  + +S++SL S TPG L  E   L   GFVCG +K  D VTF+V Y C++      
Sbjct  701   QGGKQNPLSYVSLSSVTPGKLKKEVASLENEGFVCGNNKTLDLVTFTVHYGCFSSVDTGE  760

Query  3405  GWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVG  3584
             GW +S +P +++  D++ D R T I IDT  STRWSL IN  E++DF +++ S  LV   
Sbjct  761   GWSKSELPIMQIKSDLQMDGRVTTISIDTKISTRWSLAINMEEVEDFSIEESSKELVP-R  819

Query  3585  GEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS--SGKRIMEGSEGENLLLKLRADVNT  3758
              +K  VDGWH+++++GGKNSPT+F+ TL W KNS  S  R  + ++  +LLLKLR D+N 
Sbjct  820   DKKFNVDGWHIIQYSGGKNSPTKFDFTLYWLKNSTPSKARPRKKTQDSHLLLKLRTDLNR  879

Query  3759  KTPEMVAVLEKLLSWCS  3809
              TP++  VLEKL  WC+
Sbjct  880   VTPKVARVLEKLPIWCT  896



>ref|XP_007143703.1| hypothetical protein PHAVU_007G094700g [Phaseolus vulgaris]
 gb|ESW15697.1| hypothetical protein PHAVU_007G094700g [Phaseolus vulgaris]
Length=910

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/908 (54%), Positives = 632/908 (70%), Gaps = 36/908 (4%)
 Frame = +3

Query  1182  DCPHLKSYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSE  1361
             D   +++    GN   RS +  + L   ++     +++ QF+ +P PL+AEEAG+ GFSE
Sbjct  26    DGAEIRTAVRIGN-PRRSSFVWLTLLLIIIYSCSSIYHYQFQSMPVPLTAEEAGKRGFSE  84

Query  1362  VAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNT  1541
             + A NHVKAL+++GPHP+GS ALD ALQYVL   + IK+ A  +V+V+V++FHA SG N 
Sbjct  85    IEAFNHVKALTEVGPHPVGSEALDIALQYVLTACQNIKKTALWEVDVEVDIFHAKSGANN  144

Query  1542  LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDD  1721
             L  GL  G+T VYSDL HVV+R+ PK  +      E  E +ILVS+H+DTVF+  GAGD 
Sbjct  145   LASGLLSGRTLVYSDLNHVVVRILPKYVS------EAREQSILVSSHIDTVFSTAGAGDC  198

Query  1722  SSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDL  1901
             SS V VMLE+ARG+S+ A G K  +VIFLFNTGEEEGLNGAHSF+TQHPW  TVR+AIDL
Sbjct  199   SSCVGVMLELARGVSQWAHGLKR-AVIFLFNTGEEEGLNGAHSFITQHPWSKTVRMAIDL  257

Query  1902  EAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             EAMGIGGKS IFQAGP PWAI+N+A  AKYPSGQV++QD+F+SG IKS+TDFQVYKEVAG
Sbjct  258   EAMGIGGKSSIFQAGPHPWAIENYALAAKYPSGQVIAQDVFASGAIKSATDFQVYKEVAG  317

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             LSGLDFA+ D+TAVYHTKNDK+ LLK GSLQHLGEN+L FLL   +SS +P  N   ST 
Sbjct  318   LSGLDFAYVDNTAVYHTKNDKLELLKTGSLQHLGENMLAFLLHIGASSHIPEGN---STE  374

Query  2262  KSED--EDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVF  2435
               ED  +++ +YFDILG YMVVY + FA+M H +VI+ SLLI   SL MGG+ A +SL  
Sbjct  375   AEEDIIKNSAIYFDILGMYMVVYRQKFANMLHNSVIMQSLLIWFTSLSMGGIPAAVSLAL  434

Query  2436  SALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVY  2615
             S   ++LMWI ++S S LVA++LP +SS+PVP+V+SP L +GLF APA LGA +GQH+ +
Sbjct  435   SFFGVLLMWIFALSFSFLVAFLLPLISSSPVPYVSSPLLVVGLFGAPAFLGALIGQHLGF  494

Query  2616  LFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIG  2795
             L L K+L    S+R++     +      +  ++EAERW+FKAG  QWL++L +G Y KIG
Sbjct  495   LLLQKYLLNAHSKRRQ-----LSPIIKAAVVKMEAERWLFKAGSFQWLILLILGNYFKIG  549

Query  2796  SSYLALVWLVSPALAYVLLEAPAQS---TKPLDPLTSLIGLTVPLAISSGVFVMLVNTLI  2966
             SSYLALVWLVSPA AY   EA   S    KPL  +T L+GL  P+  S+G+F+ L  TLI
Sbjct  550   SSYLALVWLVSPAFAYGFFEATLTSGRLPKPLKLITLLLGLATPILFSAGIFIRLGATLI  609

Query  2967  GYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVV  3146
             G +VRF  NPG   +W+   ++A  IA+++ L++ Y+L Y+H SGAK   ++ T +LF  
Sbjct  610   GGMVRFDRNPGGTPEWLGGFVIAAFIASLLSLSLVYLLSYVHLSGAKKAIILATLMLFTS  669

Query  3147  SLGMVAMQMVPAFVDDTARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKL  3314
             SL +V   ++P F +DTARAVN+V VVD TG      +  S++SLFSTTPGNL+ E E++
Sbjct  670   SLTIVLSGIIPPFSEDTARAVNVVHVVDATGKPDEGQNPKSYLSLFSTTPGNLNKEVEQI  729

Query  3315  G-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDT  3491
                FVCGRDK  DFVTF VKY CWT      GW E  IP + V  D +G+ R T + IDT
Sbjct  730   NESFVCGRDKTVDFVTFLVKYGCWTYNDTINGWSEMDIPTMHVLSDAKGNGRITEVSIDT  789

Query  3492  AYSTRWSLGINTNEIKDFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLT  3665
               S RW L INT EI+DFELKD  +S  L+SV G+KNGVDGWH+++F+GGK +P  F+LT
Sbjct  790   KGSIRWVLAINTEEIEDFELKDARDSEELISV-GKKNGVDGWHIIQFSGGKKAPKLFDLT  848

Query  3666  LQWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLA  3845
             L W   S+          +  +LKLR DV+  TP    VL+KL  WCS +GKS+SP T A
Sbjct  849   LYWRSGST-------HNSDAPILKLRTDVDRVTPITERVLKKLPRWCSLFGKSTSPHTFA  901

Query  3846  YLDAISVD  3869
             +L  + ++
Sbjct  902   FLRNLHLN  909



>gb|AES62153.2| endoplasmic reticulum metallopeptidase-like protein [Medicago 
truncatula]
Length=912

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/899 (53%), Positives = 618/899 (69%), Gaps = 35/899 (4%)
 Frame = +3

Query  1209  IEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKA  1388
             + G  ++RS    + LF  +      ++  QF+ +P PL+A++AG+ GFSE+ A +HVKA
Sbjct  36    VGGGNSKRSSISWLALFFIIAYSCSAIYKYQFQNMPLPLTADQAGKRGFSEIEAFSHVKA  95

Query  1389  LSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGK  1568
             L+++GPHP+GS AL+ ALQYVL   E IK+ A  +V+V+V++FH  SG N L  GL+ G+
Sbjct  96    LTEVGPHPVGSEALNQALQYVLAACETIKKTAHWEVDVEVDLFHVESGTNHLSSGLFVGR  155

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             + VYSDL HVV+R+ PK T+      E  E++ILVS+H+DTVF+ EGAGD SS V VMLE
Sbjct  156   SLVYSDLDHVVVRIMPKYTS------EASEESILVSSHIDTVFSTEGAGDCSSCVGVMLE  209

Query  1749  VARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKS  1928
             +ARG+S+ A G K   VIFLFNTGEEEGLNGAHSF+TQHPW  TV +AIDLEAMGIGGKS
Sbjct  210   LARGISQWAHGLKKG-VIFLFNTGEEEGLNGAHSFITQHPWSKTVCMAIDLEAMGIGGKS  268

Query  1929  GIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFT  2108
              IFQAGP P AI++FA  AKYPSGQ+V+QDLF+ GVIKS+TDFQVYKEVAGLSGLDFA+ 
Sbjct  269   SIFQAGPHPRAIESFASAAKYPSGQIVAQDLFTLGVIKSATDFQVYKEVAGLSGLDFAYV  328

Query  2109  DHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSED--EDT  2282
             D+TAVYHTKNDK+ LL  GSLQHLGEN+L FLL   +SS  P   +  ST   ED     
Sbjct  329   DNTAVYHTKNDKLELLTKGSLQHLGENMLAFLLHIGASSHFP---EDCSTESKEDITNSK  385

Query  2283  VVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMW  2462
              +YFDILG YMVVY ++ A+M H +VII SLLI + SL MGG+ A  SL  S L ++LMW
Sbjct  386   AIYFDILGTYMVVYRQNLANMLHNSVIIQSLLIWVTSLAMGGIPAATSLALSCLGVILMW  445

Query  2463  IGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSY  2642
             + S+  S+LVA++LP +SS+PVP+V+SPWL +GLF APA+LGA  GQH+ YL   K+L +
Sbjct  446   LFSLGFSLLVAFILPLISSSPVPYVSSPWLVVGLFGAPAILGALTGQHLGYLLFQKYL-F  504

Query  2643  TFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWL  2822
             +   ++  F   +Q +      +LEAERW++KAG  QWL++L +G Y KIGSSYLALVWL
Sbjct  505   SVHSKRGQFPPIIQAE----LVKLEAERWLYKAGSFQWLILLILGNYFKIGSSYLALVWL  560

Query  2823  VSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSN  2993
             VSPA A+   EA   PA+  KPL   T ++GL  P+  S+G F+ L  TLIG +VR   N
Sbjct  561   VSPAFAFGFFEATLSPARLPKPLKLATLVLGLATPILFSAGNFIRLAATLIGGMVRLDRN  620

Query  2994  PGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQM  3173
             PG   +W+   ++A  IAA++ LT+ Y+  Y+H SGAK    + T VLF +SL +V   +
Sbjct  621   PGGTPEWLGNVVIAGYIAALLSLTLVYLFSYVHLSGAKGTITVATLVLFSLSLAVVLSGV  680

Query  3174  VPAFVDDTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRD  3338
             VP F +DTARAVN+V VVD TG      + VS++SLFSTTPGNL+ E E++   FVCG+D
Sbjct  681   VPPFSEDTARAVNVVHVVDATGKLDEKHTPVSYVSLFSTTPGNLNQEVEQINESFVCGKD  740

Query  3339  KAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLG  3518
             K  DFVTFSVKY C T      GW E+ IP + V  D + + R T + I+T  S RW L 
Sbjct  741   KPIDFVTFSVKYGCRTYNNTVSGWSEAEIPTMHVESDAKENGRITQVLINTKDSVRWVLA  800

Query  3519  INTNEIKDFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSG  3692
             INT EI+DF L D   S  L+S   +K+ VDGWH+++F+GGKN+P  F+LTL W   S  
Sbjct  801   INTEEIEDFTLTDARNSEELIS-ADKKSSVDGWHIIQFSGGKNAPRLFDLTLYWKSGSQ-  858

Query  3693  KRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                   S     LLKLR DVN  TP    ++EKL  WCS +GKS+SP TLA+   + V+
Sbjct  859   ------STDNGFLLKLRTDVNRLTPITERIIEKLPRWCSLFGKSTSPHTLAFFRNLPVN  911



>ref|XP_007009835.1| Zn-dependent exopeptidases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY18645.1| Zn-dependent exopeptidases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=818

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/787 (57%), Positives = 573/787 (73%), Gaps = 20/787 (3%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             A RSG+  + LF  +V  +W V Y QF+ LP PL+A +AG+ GFSEV AM HVK L++LG
Sbjct  40    ATRSGFVWLTLFVVIVYSSWTVHYYQFESLPVPLTAVQAGKRGFSEVEAMKHVKGLTELG  99

Query  1404  PHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYS  1583
             PHP+GS ALD ALQYVL  +E IK+ A  +V+V+V+ FH NSGV  L+ GL+ G+T VYS
Sbjct  100   PHPVGSDALDLALQYVLAASETIKKTAHWEVDVEVDFFHVNSGVIRLLTGLFVGRTIVYS  159

Query  1584  DLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGL  1763
             DL H+++R+ PK         E  E+AILVS+H+DTVF+ EGAGD SS VAVMLE+ARG+
Sbjct  160   DLNHIILRILPKYVP------EAGENAILVSSHIDTVFSTEGAGDCSSCVAVMLELARGI  213

Query  1764  SKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQA  1943
             S+ A GFKN +VIFLFNTGEEEGL GAHSF+TQHPW +T+R+AIDLEAMGIGGKS IFQA
Sbjct  214   SQWAHGFKN-AVIFLFNTGEEEGLTGAHSFITQHPWSSTIRMAIDLEAMGIGGKSSIFQA  272

Query  1944  GPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
             GP P A++NFA VAKYPSG +++QDLFSSG IKS+TDFQVYKEVAGLSGLDF +TD+ AV
Sbjct  273   GPHPLAVENFAAVAKYPSGLIIAQDLFSSGAIKSATDFQVYKEVAGLSGLDFVYTDNGAV  332

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
             YHTKNDK+ LLK GSLQHLGEN+L FLLQ ASSS L    KT+  G   + DT V+FDIL
Sbjct  333   YHTKNDKLELLKSGSLQHLGENMLSFLLQIASSSHL-LKAKTMDGGGKPNHDTAVFFDIL  391

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsls  2483
             G+YMVVY    A+M   +VI+ SLLI   SL MGG +A +SL FS LSI+LMWI S+S S
Sbjct  392   GQYMVVYHVRLANMLQYSVIVQSLLIWTTSLLMGGYTAAVSLFFSCLSIILMWIFSISFS  451

Query  2484  vlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR  2663
              +VA++LP +SS+PVP++ASPWL +GLFAAPA LGA  GQH+ YL L +++S  +++RK+
Sbjct  452   AVVAFILPLISSSPVPYIASPWLMVGLFAAPACLGALTGQHLGYLVLQRYISNIYAKRKQ  511

Query  2664  SFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAY  2843
                  +Q D      +LE ERW+FKAG +QWL++L +GTY KIGSSY+ALVWLV PA AY
Sbjct  512   -LSPVIQAD----LIKLETERWLFKAGFVQWLVLLIIGTYYKIGSSYVALVWLVPPAFAY  566

Query  2844  VLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
              LLEA   P +  +PL   T L+GL +P+ +S+G+F+   N +IG +VRF  NPG+  +W
Sbjct  567   GLLEATLTPVRLPRPLKLATLLMGLAIPILVSAGIFIRFANVIIGLIVRFDRNPGDTPEW  626

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             + + ++++ IA ++CLT+ Y+L YIH SGAK+  V++TC+LFV+SL +V   ++P F +D
Sbjct  627   LASVVLSIFIAVVICLTLVYLLSYIHLSGAKTSVVLSTCILFVLSLAVVFSGIIPPFTED  686

Query  3195  TARAVNIVQVVDHTGN--SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFS  3365
              ARAVN+V VVD TG      +S +SL S TPG L  E +++  GFVCGR K  DFVTFS
Sbjct  687   FARAVNVVHVVDTTGRFGEKPISFVSLSSITPGKLTKEIDQVREGFVCGRHKVIDFVTFS  746

Query  3366  VKYSCWTEPTAKLGWKESRIPALRVGRDM-EGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             VKY C T    + GW ES IP L V  D   G  R T + IDT  S RW L INT EI D
Sbjct  747   VKYGCLTFDETEGGWNESDIPMLDVVYDTNNGVRRITQVAIDTKRSIRWFLAINTEEIDD  806

Query  3543  FELKDES  3563
             F  K +S
Sbjct  807   FMFKADS  813



>ref|XP_006485690.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Citrus 
sinensis]
Length=923

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/902 (52%), Positives = 624/902 (69%), Gaps = 28/902 (3%)
 Frame = +3

Query  1206  TIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVK  1385
             +I  + A+RSG    V F  ++C ++ V+Y Q++ +P PL+AE+AG  GFSE+ AM HVK
Sbjct  35    SIHVSSAKRSGLVWTVAFATLICASYGVYYYQYEHMPPPLTAEQAGRRGFSELEAMKHVK  94

Query  1386  ALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFG  1565
             AL+QLGPH +GS ALD ALQYVL  ++ IKE    + +V+V+ FHA SG N +  G++ G
Sbjct  95    ALTQLGPHAVGSDALDRALQYVLAASQKIKESKHWEADVEVDFFHAKSGANRVGTGVFKG  154

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
             KT +YSDL H+V+R+ PK  +      E  E+AILVS+H+DTV A EGAGD SS VAVML
Sbjct  155   KTLIYSDLNHIVLRILPKYAS------EAGENAILVSSHIDTVSAGEGAGDCSSCVAVML  208

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+AR +S+ A  FKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIGG+
Sbjct  209   ELARVMSQWAHEFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIGGR  267

Query  1926  SGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
             S +FQAGP+ WA++NFA VAKYPSGQ++ QDLF+SGV  ++TDFQVY EVAGLSGLDFA+
Sbjct  268   SALFQAGPNLWAVENFAAVAKYPSGQIIGQDLFASGVFGTATDFQVYTEVAGLSGLDFAY  327

Query  2106  TDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTV  2285
             TD +AVYHTKND++ LLKPGSLQHLGEN+L FLLQ ASS+ +P  N     GK+  E T 
Sbjct  328   TDKSAVYHTKNDRLDLLKPGSLQHLGENMLDFLLQTASSTSIPKGNAVEEEGKTVHE-TG  386

Query  2286  VYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWI  2465
             VYFDILG+YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +SL  + LS +LM +
Sbjct  387   VYFDILGKYMVLYHQHFANMLHNSVILQSLLIWTASLVMGGYPAAVSLALTCLSAILMLV  446

Query  2466  GsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYT  2645
              S+S SV++A++LP +SS+PVP+VASPWL +GLFAAPA LGA  GQH+ Y+ L  +L+  
Sbjct  447   LSISFSVVIAFILPQISSSPVPYVASPWLTVGLFAAPAFLGALTGQHLGYIVLKAYLANQ  506

Query  2646  FSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLV  2825
             +S+  +     +      +  +LEAERW+FK+G LQWL++LA+G Y KIGS+Y+ALVWLV
Sbjct  507   YSKGMQ-----LSPVHQAALVKLEAERWLFKSGFLQWLILLALGNYYKIGSTYMALVWLV  561

Query  2826  SPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNP  2996
              PA AY  LEA   P + T+PL   T L+GL VP+ +S+G  + L N L+  LVRF  NP
Sbjct  562   PPAFAYGFLEATLTPVRLTRPLKLATLLLGLAVPVLVSAGNIIRLANVLVATLVRFDRNP  621

Query  2997  GEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMV  3176
             G   +W+   I AV+IA + CLT+ Y+L Y+H SGAK P    + +L  +S+ MV+  ++
Sbjct  622   GGTPEWLGNVIFAVVIAVVSCLTLVYLLSYVHLSGAKGPIAFASFILVGLSIIMVSSGII  681

Query  3177  PAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDK  3341
             P F ++TARAVNIV +VD +    G     S+I+L+S TPG L  E E++  GFVCGRD 
Sbjct  682   PPFSEETARAVNIVHIVDASGKFGGKQEPSSYIALYSATPGKLTKEVEQIKEGFVCGRDN  741

Query  3342  AFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR---DMEG--DTRATLIHIDTAYSTR  3506
               DFVT S+KY C T+  ++ GW +S IP + V     D EG  + R T + ID   + R
Sbjct  742   VIDFVTSSMKYGCLTDDNSEGGWSQSDIPTIHVNSDTVDTEGNENERITQVSIDMKGAKR  801

Query  3507  WSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS  3686
              +L IN  EI+DF  K +S  LV     K+ + GWH++ F+GGKN+ ++F + L W KNS
Sbjct  802   LTLAINAKEIEDFTFKVDSEELVPRDA-KSSIYGWHIIEFSGGKNAASKFEIALYWAKNS  860

Query  3687  S-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAIS  3863
             +       G E +  L+KLR D +  TP+   VL KL  WCS +  S S   L++L+++ 
Sbjct  861   TRAAGNSNGKEKQQPLVKLRTDFDRLTPKTERVLSKLPPWCSLFEGSISSQPLSFLNSLP  920

Query  3864  VD  3869
             V+
Sbjct  921   VN  922



>ref|XP_003591902.1| Endoplasmic reticulum metallopeptidase [Medicago truncatula]
Length=917

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/904 (53%), Positives = 618/904 (68%), Gaps = 40/904 (4%)
 Frame = +3

Query  1209  IEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKA  1388
             + G  ++RS    + LF  +      ++  QF+ +P PL+A++AG+ GFSE+ A +HVKA
Sbjct  36    VGGGNSKRSSISWLALFFIIAYSCSAIYKYQFQNMPLPLTADQAGKRGFSEIEAFSHVKA  95

Query  1389  LSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGK  1568
             L+++GPHP+GS AL+ ALQYVL   E IK+ A  +V+V+V++FH  SG N L  GL+ G+
Sbjct  96    LTEVGPHPVGSEALNQALQYVLAACETIKKTAHWEVDVEVDLFHVESGTNHLSSGLFVGR  155

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             + VYSDL HVV+R+ PK T+      E  E++ILVS+H+DTVF+ EGAGD SS V VMLE
Sbjct  156   SLVYSDLDHVVVRIMPKYTS------EASEESILVSSHIDTVFSTEGAGDCSSCVGVMLE  209

Query  1749  VARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKS  1928
             +ARG+S+ A G K   VIFLFNTGEEEGLNGAHSF+TQHPW  TV +AIDLEAMGIGGKS
Sbjct  210   LARGISQWAHGLKKG-VIFLFNTGEEEGLNGAHSFITQHPWSKTVCMAIDLEAMGIGGKS  268

Query  1929  GIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFT  2108
              IFQAGP P AI++FA  AKYPSGQ+V+QDLF+ GVIKS+TDFQVYKEVAGLSGLDFA+ 
Sbjct  269   SIFQAGPHPRAIESFASAAKYPSGQIVAQDLFTLGVIKSATDFQVYKEVAGLSGLDFAYV  328

Query  2109  DHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSED--EDT  2282
             D+TAVYHTKNDK+ LL  GSLQHLGEN+L FLL   +SS  P   +  ST   ED     
Sbjct  329   DNTAVYHTKNDKLELLTKGSLQHLGENMLAFLLHIGASSHFP---EDCSTESKEDITNSK  385

Query  2283  VVYFDIL-----GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALS  2447
              +YFDIL     G YMVVY ++ A+M H +VII SLLI + SL MGG+ A  SL  S L 
Sbjct  386   AIYFDILVWLYFGTYMVVYRQNLANMLHNSVIIQSLLIWVTSLAMGGIPAATSLALSCLG  445

Query  2448  IVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLH  2627
             ++LMW+ S+  S+LVA++LP +SS+PVP+V+SPWL +GLF APA+LGA  GQH+ YL   
Sbjct  446   VILMWLFSLGFSLLVAFILPLISSSPVPYVSSPWLVVGLFGAPAILGALTGQHLGYLLFQ  505

Query  2628  KFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYL  2807
             K+L ++   ++  F   +Q +      +LEAERW++KAG  QWL++L +G Y KIGSSYL
Sbjct  506   KYL-FSVHSKRGQFPPIIQAE----LVKLEAERWLYKAGSFQWLILLILGNYFKIGSSYL  560

Query  2808  ALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLV  2978
             ALVWLVSPA A+   EA   PA+  KPL   T ++GL  P+  S+G F+ L  TLIG +V
Sbjct  561   ALVWLVSPAFAFGFFEATLSPARLPKPLKLATLVLGLATPILFSAGNFIRLAATLIGGMV  620

Query  2979  RFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGM  3158
             R   NPG   +W+   ++A  IAA++ LT+ Y+  Y+H SGAK    + T VLF +SL +
Sbjct  621   RLDRNPGGTPEWLGNVVIAGYIAALLSLTLVYLFSYVHLSGAKGTITVATLVLFSLSLAV  680

Query  3159  VAMQMVPAFVDDTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GF  3323
             V   +VP F +DTARAVN+V VVD TG      + VS++SLFSTTPGNL+ E E++   F
Sbjct  681   VLSGVVPPFSEDTARAVNVVHVVDATGKLDEKHTPVSYVSLFSTTPGNLNQEVEQINESF  740

Query  3324  VCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYST  3503
             VCG+DK  DFVTFSVKY C T      GW E+ IP + V  D + + R T + I+T  S 
Sbjct  741   VCGKDKPIDFVTFSVKYGCRTYNNTVSGWSEAEIPTMHVESDAKENGRITQVLINTKDSV  800

Query  3504  RWSLGINTNEIKDFELKD--ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWH  3677
             RW L INT EI+DF L D   S  L+S   +K+ VDGWH+++F+GGKN+P  F+LTL W 
Sbjct  801   RWVLAINTEEIEDFTLTDARNSEELIS-ADKKSSVDGWHIIQFSGGKNAPRLFDLTLYWK  859

Query  3678  KNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDA  3857
               S        S     LLKLR DVN  TP    ++EKL  WCS +GKS+SP TLA+   
Sbjct  860   SGSQ-------STDNGFLLKLRTDVNRLTPITERIIEKLPRWCSLFGKSTSPHTLAFFRN  912

Query  3858  ISVD  3869
             + V+
Sbjct  913   LPVN  916



>ref|XP_008659368.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Zea mays]
 gb|AFW86126.1| hypothetical protein ZEAMMB73_851599 [Zea mays]
Length=908

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/891 (52%), Positives = 615/891 (69%), Gaps = 24/891 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              R  Y ++ L    + G+W V+  QF  LP PL AE+AG+ GFSE +A+ HVK L+ LGP
Sbjct  31    RRGAYLLLGLLIVFLHGSWSVYQIQFGSLPLPLDAEQAGKRGFSEASALKHVKYLTGLGP  90

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS  LD A+QYV  VAE IK+ A  +V+V +E+FH + G N L GGL+ GKT +YSD
Sbjct  91    HPVGSDPLDHAIQYVYAVAEKIKKTAHWEVDVQLELFHTDIGANRLSGGLFKGKTLLYSD  150

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHV++R++PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG++
Sbjct  151   LKHVLLRVTPKYLP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVA  204

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  ++FLFNTGEEEGL+GAHSF+TQH W N+V  A+DLEAMGI GKS +FQ G
Sbjct  205   QWAHGFKSG-ILFLFNTGEEEGLDGAHSFITQHHWRNSVIFAVDLEAMGISGKSTLFQ-G  262

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
              D WA+++FA VAKYPS Q+ SQD+FSSG IKS+TDFQ+Y+EV  L GLDFA+TD T+VY
Sbjct  263   TDHWALESFAAVAKYPSAQIASQDVFSSGAIKSATDFQIYEEVGRLPGLDFAYTDTTSVY  322

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ALLKPGSLQH+G+N+L FLL +A+S       +    GK+E +D  VYFDILG
Sbjct  323   HTKNDKMALLKPGSLQHIGDNMLAFLLHSAASPKFLKDAQQRKQGKTE-QDRAVYFDILG  381

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMVVYP   A MFH ++I+ SLLI   SL MGG  AL+S   S LSI+LMWI S+ L V
Sbjct  382   KYMVVYPLRLATMFHNSIILQSLLIWGTSLLMGGHPALVSFAISCLSIILMWIFSICLPV  441

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             +VA+ LP +   P+P+VA+PWL IGLF +PALLGAF+GQH+ ++ L + L    S+ K  
Sbjct  442   VVAFALPYMCPFPIPYVANPWLTIGLFGSPALLGAFIGQHIGFILLKRHLRRVHSKAKTG  501

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 +   E+V+  +LEAERW+FK+G +QWL+ L +GTY K+GSSY+AL+WLVSPA AY 
Sbjct  502   ITPSMI--ENVT--DLEAERWIFKSGFVQWLIALILGTYFKVGSSYIALIWLVSPAFAYG  557

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
              LEA   P +  K L  +T ++GL  P+  S+G+ V + + ++G +VR   NPG   DW+
Sbjct  558   FLEATLSPVRLPKQLKVVTLVVGLVAPVVSSAGLAVRMADVIVGSIVRIDRNPGGLPDWL  617

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                IV+V IA +VC T  Y+L YIH SG K    +   + F +S+ + +  +VPAF +D 
Sbjct  618   GNVIVSVAIAVVVCSTFVYLLSYIHISGDKRILGLLLSLSFGLSIALASSGIVPAFTEDV  677

Query  3198  ARAVNIVQVVD----HTGNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVT  3359
             AR+VN+V VVD    H G+   VS+ISLFS TPG L  E   LGG  F CGR+   D VT
Sbjct  678   ARSVNVVHVVDTTGVHGGHIEPVSYISLFSNTPGKLTNELVDLGGEEFSCGRNMTTDLVT  737

Query  3360  FSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             F+VKY CW+   +  GW  S +P L V  D + G  R T++ +DT  STRW+LGIN + I
Sbjct  738   FTVKYGCWSYKESSTGWSRSEVPVLLVESDSVIGGARQTVVSVDTKSSTRWTLGINKDGI  797

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
              DF ++ +S  +V + G+K+ +DGWH ++FAGGKNSPT+F LTL W  +   +R  + + 
Sbjct  798   DDFTVQVDSEKIV-LPGDKSEIDGWHTIQFAGGKNSPTKFQLTLYWSSSKPSEREAKQAA  856

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                LL+KLR DVN  TP++  V+EKL  WC+ +GKS+SP+TLA+L A+ VD
Sbjct  857   DAPLLVKLRTDVNRVTPQVARVVEKLPRWCTPFGKSTSPYTLAFLTALRVD  907



>ref|XP_009400821.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Musa acuminata 
subsp. malaccensis]
Length=904

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/898 (51%), Positives = 622/898 (69%), Gaps = 24/898 (3%)
 Frame = +3

Query  1206  TIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVK  1385
             T +G    RS +  V LF   +  +W V++ QF+ LP PL AE+AG+ GFSEV+A+ HVK
Sbjct  20    TEQGGKPARSAFLWVALFVLFLNSSWAVYHFQFESLPLPLDAEQAGKRGFSEVSALEHVK  79

Query  1386  ALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFG  1565
              L++LGPHP+GS AL+ A+QYV    E I++ A  +V+V V++FHA +  N L  GL+ G
Sbjct  80    YLTKLGPHPVGSDALELAVQYVFAATEKIQKTAHWEVDVQVDLFHAETAANHLSKGLFKG  139

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
             KT VYSDLKHVV+R+ PK         E E++ ILVS+H+DTVF+++GAGD SS V VML
Sbjct  140   KTLVYSDLKHVVLRILPKYLP------EAEDNVILVSSHIDTVFSSQGAGDCSSCVGVML  193

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+ARG+++ A GFKN  VIFLFNTGEEEGLNGAHSF+TQHPW +T+R  +DLEAMGIGGK
Sbjct  194   ELARGIAQWAHGFKNG-VIFLFNTGEEEGLNGAHSFITQHPWRSTIRFVVDLEAMGIGGK  252

Query  1926  SGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
             S +FQ G  PWA++ +AKV+KYPSG V++QDLF SG I+S+TDFQVY+EV GLSGLDFA+
Sbjct  253   SIVFQGGLVPWALETYAKVSKYPSGLVIAQDLFHSGAIQSATDFQVYEEVGGLSGLDFAY  312

Query  2106  TDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTV  2285
             TD TA+YHTKNDK+ LLKPGSLQHLGEN+L FL+Q+A S++L    +    G  + +   
Sbjct  313   TDATAIYHTKNDKLKLLKPGSLQHLGENMLAFLIQSAMSTNLQNKMEVKKDGIVQSQS--  370

Query  2286  VYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWI  2465
             ++FDILG YMVVY +  A M H +VI+ SLLI   SL MGG    ++   S  SI+LMWI
Sbjct  371   IFFDILGTYMVVYSQRLATMLHNSVILQSLLIWTTSLIMGGYHGAMTFGLSCFSILLMWI  430

Query  2466  GsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYT  2645
              S+SLS++V++++P +S++PVP++A+PWL IGLF APA+LGA  GQH+ +L + ++L  T
Sbjct  431   CSLSLSIMVSFLIPLISTSPVPYIANPWLVIGLFGAPAVLGALTGQHLGFLCISRYLRCT  490

Query  2646  FSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLV  2825
             FS+R  +    V  +   +  +LE ERW+FKAG +QWL++L +G + K+GSS++ALVWLV
Sbjct  491   FSKRVPT----VASNTLENLIKLETERWLFKAGFIQWLILLIIGNFYKVGSSFVALVWLV  546

Query  2826  SPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNP  2996
             SPA AY L+EA   P +S K L  +T ++GL +P+  SSG+ + LV  L+G +VR   NP
Sbjct  547   SPAFAYGLMEATLSPLRSPKQLKIVTLILGLAMPILFSSGMMIRLVGILVGIIVRSERNP  606

Query  2997  GEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMV  3176
             G + DW+   IVAV ++AIVCL + Y+L YIH SGAK P + +  +L  ++L  V+  ++
Sbjct  607   GSRPDWLGNVIVAVFVSAIVCLMLVYLLSYIHLSGAKGPMIFSMLMLLALALAAVSTGIL  666

Query  3177  PAFVDDTARAVNIVQVVDHTGNSS---VVSHISLFSTTPGNLDVEAEKLGG--FVCGRDK  3341
             P F +D +RAV +V VV   GNS      S ISL S TPG L  E + L    F CG +K
Sbjct  667   PTFTEDISRAVTVVHVVKTKGNSENQDASSFISLSSLTPGKLTEEVKNLKDEEFTCGWNK  726

Query  3342  AFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLG  3518
               DFVTF+VKY CW+   +  GW +S IP + V  D +    R T I IDT  S RWSL 
Sbjct  727   TIDFVTFTVKYGCWSSKDSGSGWSKSDIPIVHVEHDSIASGARKTGIFIDTKISKRWSLA  786

Query  3519  INTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKR  3698
             IN  EI+DF  + +S  LV + G+K+ VDGWH ++F+GGKNSPT+F L L W  N++ + 
Sbjct  787   INREEIRDFTFEADSEELVPL-GDKSEVDGWHFIQFSGGKNSPTKFRLNLFWLSNTTHQS  845

Query  3699  IMEGSEGEN-LLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                   G + LLLKLR DV+  TPE+ +VLEK   WCS +GKS+SP+ LA+L  + V 
Sbjct  846   QKSYESGASPLLLKLRTDVSKITPEVESVLEKFPPWCSLFGKSTSPYPLAFLTTLPVQ  903



>dbj|BAJ94531.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03438.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=907

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/891 (52%), Positives = 609/891 (68%), Gaps = 25/891 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS Y ++ LF   + G+W V+  QF  LP PL+AE+AG+ GFSE +A+ HVK L+ LGP
Sbjct  31    KRSAYLLLGLFILFLHGSWSVYRMQFANLPLPLNAEQAGKRGFSEASALKHVKYLTSLGP  90

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS ALD A+QYV   AE I++ A  DV+V +E+FH + G N L GGL+ GKT +YSD
Sbjct  91    HPVGSDALDLAVQYVYAEAEKIQKTAHWDVDVQLELFHTDIGANRLAGGLFKGKTLLYSD  150

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHVV+R+ PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG++
Sbjct  151   LKHVVLRIVPKYLP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLEMARGVA  204

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  V+FLFNTGEEEGL+GAHSF+TQH W N+VR A+DLEAMGI GKS +FQ G
Sbjct  205   QWAHGFKSG-VLFLFNTGEEEGLDGAHSFITQHHWRNSVRFAVDLEAMGISGKSTLFQ-G  262

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
                WA+++FA VAKYPS Q+ +QD+F SG IKS+TDFQ+Y+EVAGL GLDFA+TD T+VY
Sbjct  263   THQWALESFAAVAKYPSAQIATQDVFRSGAIKSATDFQIYEEVAGLPGLDFAYTDTTSVY  322

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+ LL+PGSLQH GEN+L FLL AASS      +   +   S ++   ++FDILG
Sbjct  323   HTKNDKMELLQPGSLQHNGENMLAFLLHAASSPKF-MKDAHQAKQDSTEQKNAIFFDILG  381

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMVVYP+  A MFH ++I  SLLI   SL MGG   L+S   S LSI+L  I S  L V
Sbjct  382   KYMVVYPQRLATMFHNSIIFQSLLIWGTSLLMGGRPGLVSFGISCLSIILTLIFSTVLPV  441

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             +VA+VLP +   P+ FVA+PWL +GLF +PALLGAF+GQH+ ++ L + +   +S  K  
Sbjct  442   VVAFVLPHICPFPISFVANPWLVVGLFGSPALLGAFIGQHIGFILLKRHIQQVYSRTKPG  501

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                 + D        LEAERW++K+G +QWL+VL +GTYLK+G+SY+AL+WLVSPA AY 
Sbjct  502   LTGNMMD----IIVGLEAERWIYKSGFVQWLIVLILGTYLKVGASYIALIWLVSPAFAYG  557

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             L+EA   P +S K L   T ++ L VP+  S+G+F+ +V+ ++G +VR   NPG   DW+
Sbjct  558   LMEATLTPVRSPKQLKVFTLVLALAVPVMSSAGLFIRMVDVMVGSIVRVDRNPGGLPDWL  617

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                +VAV IA +V LT  Y+L Y+H SGAK   +     LF ++L +V+  +VPAF +D 
Sbjct  618   GNVVVAVAIAIVVSLTFVYLLSYVHISGAKKTLLYVLSALFGLALVLVSSGIVPAFTEDI  677

Query  3198  ARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVT  3359
             AR+VN+V VVD T    GN+   S++SLFS  PG L  E   L G  F CGR+   DFVT
Sbjct  678   ARSVNVVHVVDTTRMNDGNTEPSSYVSLFSNMPGKLTQELMDLRGEEFSCGRNMTTDFVT  737

Query  3360  FSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             F+VKY C +   +  GW +S +P L V  D  + D R T++ +DT  STRWSL IN  EI
Sbjct  738   FTVKYGCRSYKASNTGWSKSEVPVLHVESDSADDDGRRTVVSVDTRSSTRWSLAINMQEI  797

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSE  3716
              DF ++  S  LV +GG K  V GWH ++FAGGKN+PT+F L L W  N++     E +E
Sbjct  798   DDFTIEVASDKLVQLGG-KTEVGGWHTIQFAGGKNAPTKFQLALFWSSNATHASPKE-AE  855

Query  3717  GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             G  LL+KLR DVN  TP +  VLEKL  WC+ +GKS+SP+TLA+L A+ V+
Sbjct  856   GPPLLVKLRTDVNRVTPMVETVLEKLPRWCAPFGKSTSPYTLAFLTALPVN  906



>ref|XP_004976249.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Setaria 
italica]
Length=914

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/899 (52%), Positives = 616/899 (69%), Gaps = 27/899 (3%)
 Frame = +3

Query  1212  EGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKAL  1391
             E     R  Y ++ L    + G+W V+  QF  LP PL A++AG+ GFSE +A+ HVK L
Sbjct  29    ESRKHRRGAYLLLGLLIVFLHGSWSVYQIQFGNLPLPLDAKQAGKRGFSEASALEHVKYL  88

Query  1392  SQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKT  1571
             + LGPHP+GS +LD A+QYV  VAE IK+ +  +V+V +E+FH + G N L  GL+ GKT
Sbjct  89    TSLGPHPVGSDSLDLAVQYVYAVAEKIKKTSHWEVDVQLELFHTDIGANRLSKGLFKGKT  148

Query  1572  PVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEV  1751
              +YSDLKHV++R+ PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+
Sbjct  149   LLYSDLKHVLLRVVPKYMP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLEL  202

Query  1752  ARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSG  1931
             ARG+S+ A GFK+  V+FLFNTGEEEGL+GAHSF+TQH W N+VR AIDLEAMGI GKS 
Sbjct  203   ARGVSQWAHGFKSG-VLFLFNTGEEEGLDGAHSFITQHHWRNSVRFAIDLEAMGISGKST  261

Query  1932  IFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTD  2111
             +FQA  D WA+++FA VAKYPS Q+ SQD+F SG IKS+TDFQ+Y+EVAGL GLDFA+TD
Sbjct  262   LFQA-TDHWALESFAAVAKYPSAQIASQDVFRSGAIKSATDFQIYQEVAGLPGLDFAYTD  320

Query  2112  HTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVY  2291
              T+VYHTKNDK+ LLKPGSLQH+G+N+L FLL +A+S +    N      ++ +++ VV+
Sbjct  321   TTSVYHTKNDKMKLLKPGSLQHIGDNMLAFLLHSAASPNF-LKNAQEQKKENTEQNKVVF  379

Query  2292  FDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGs  2471
             FDILG+YMVVYP+  A MFH ++I+ SLLI   SL MGG   L+S   S LSI+LM I S
Sbjct  380   FDILGKYMVVYPQRLATMFHNSIILQSLLIWGTSLLMGGRPGLVSFGISCLSIILMLIFS  439

Query  2472  vslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFS  2651
             + L ++VA++LP +   PVP+VA+PWL IGLF +PALLGAF+GQHV ++ L + L + +S
Sbjct  440   ICLPIVVAFILPHICPFPVPYVANPWLIIGLFGSPALLGAFIGQHVGFILLKRHLRHVYS  499

Query  2652  ERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSP  2831
               K S     ++       +LEAERW+FK+G +QWL+VL +GTY K+GSSY+AL+WLVSP
Sbjct  500   RTKPSLTHNTRE----YVIDLEAERWIFKSGFVQWLIVLTLGTYFKVGSSYIALIWLVSP  555

Query  2832  ALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGE  3002
             A AY  LEA   P +  K L  +T ++GL  P+  S+G+ V + + ++G +VR   NPG 
Sbjct  556   AFAYGFLEATLSPVRLPKQLKVVTLVLGLVAPVVSSAGLAVRMADVIVGSVVRIDRNPGG  615

Query  3003  QADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPA  3182
                W+   IVAV IA +VC    Y+L Y+H SG K    +  C+ F +SL +V+  +VPA
Sbjct  616   LPYWLGNVIVAVAIAVVVCFMFVYLLSYVHISGDKRTLGLLLCLFFGLSLALVSGGIVPA  675

Query  3183  FVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKA  3344
             F +D AR+VN+V VVD T    GN   +S+ISLFS TPG L  E   LG   F CGR+  
Sbjct  676   FTEDVARSVNVVHVVDTTGIDGGNREPLSYISLFSNTPGKLTKELVDLGDEEFFCGRNMT  735

Query  3345  FDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGD-TRATLIHIDTAYSTRWSLGI  3521
              DFVTF++KY CW+   +  GW +S +P L V  D   D  R T+I +DT  STRWSLGI
Sbjct  736   VDFVTFTMKYGCWSYKESSTGWSKSEVPVLHVESDSVTDGARQTVISVDTKSSTRWSLGI  795

Query  3522  NTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKN---SSG  3692
             N  +I DF ++ +S  LV +GG K+ VDGWH ++FAGGK SPT+F LTL W  +   +SG
Sbjct  796   NKQQIDDFTVQVDSEKLVLLGG-KSEVDGWHTIQFAGGKKSPTKFQLTLYWSNSAAQTSG  854

Query  3693  KRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             +   + +     L+KLR DVN  TP++  VLEKL  WC+ +GKS+SP+TLA+L  + VD
Sbjct  855   REANKEAADVPFLVKLRTDVNRVTPQVAKVLEKLPRWCTPFGKSTSPYTLAFLTGLRVD  913



>ref|XP_003580148.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Brachypodium 
distachyon]
 ref|XP_010240142.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Brachypodium 
distachyon]
Length=909

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/897 (52%), Positives = 614/897 (68%), Gaps = 37/897 (4%)
 Frame = +3

Query  1230  RSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPH  1409
             RS Y ++ L    + G+W V+ +QF  LP PL AE+AG+ GFSE +A+ HV+ L+ LGPH
Sbjct  32    RSVYLLLGLLIVFLHGSWSVYRTQFGNLPLPLDAEQAGKRGFSEASALKHVEYLTGLGPH  91

Query  1410  PLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDL  1589
             P+GS +LD A+QYV   AE IK+ A  DV+V +E+FH + G N L GGL+ GKT +Y+DL
Sbjct  92    PVGSDSLDLAVQYVYAEAEKIKKTAHWDVDVQLELFHTDIGANRLSGGLFNGKTLLYADL  151

Query  1590  KHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSK  1769
             KHV++R+ PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG+++
Sbjct  152   KHVILRIVPKYLP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVAQ  205

Query  1770  QATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP  1949
              A GFK+  V+FLFNTGEEEGL+GAHSF+TQH W N+VR A+DLEAMGI GKS +FQ G 
Sbjct  206   WAHGFKSG-VLFLFNTGEEEGLDGAHSFITQHHWRNSVRFAVDLEAMGISGKSTLFQ-GT  263

Query  1950  DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYH  2129
               WA+++FA VAKYPS Q+ +QD+F SG IKS+TDFQ+Y+EVAGL GLDFA+TD T+VYH
Sbjct  264   HQWALESFAAVAKYPSAQIATQDVFRSGAIKSATDFQIYQEVAGLPGLDFAYTDRTSVYH  323

Query  2130  TKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--DEDTVVYFDIL  2303
             TKNDK+ LLKPGSLQH+GEN+L FLL AA+S   P   K     K E  ++   ++FDIL
Sbjct  324   TKNDKMKLLKPGSLQHIGENMLAFLLHAAAS---PKFMKDAHQAKQESTEQKKAIFFDIL  380

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsls  2483
             G+YM+VYP+  A MFH ++I  SLLI   SL MGG   L+S   S LSI+LM I S+ L 
Sbjct  381   GKYMIVYPQRLAIMFHNSIIFQSLLIWGTSLLMGGRHGLVSFGISCLSIILMLIFSICLP  440

Query  2484  vlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR  2663
             V+VA+ LP +S  PV FVA+PWL IGLF +PALLGAF+GQH+ ++ L + +   + + K 
Sbjct  441   VVVAFALPHISPFPVSFVANPWLVIGLFGSPALLGAFIGQHIGFILLKRHIQQVYLKTKP  500

Query  2664  SF----ILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSP  2831
                   I ++ D        LEAERW+FK+G +QWL+VL +GTYLK+G+SY+AL+WLVSP
Sbjct  501   GLTGNTIEYIVD--------LEAERWIFKSGFVQWLIVLILGTYLKVGASYIALIWLVSP  552

Query  2832  ALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGE  3002
             A AY L+EA   PA+  K L  +T ++ L  P+  S+G+ V +V+ + G +VR   NPG 
Sbjct  553   AFAYGLMEATLSPARLPKQLKVVTLVLALAAPVVSSAGLVVRMVDVMAGSIVRADRNPGG  612

Query  3003  QADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPA  3182
               DW+   +VAV IA +V  T  Y+L Y+H SGAK   +   C LF ++L MV+  +VPA
Sbjct  613   LPDWLGNVVVAVGIAIVVSFTFVYLLSYVHISGAKRTLLSLLCTLFGLALVMVSSGIVPA  672

Query  3183  FVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKA  3344
             F +D AR+VN+V VVD T     N+   S+ISLFS TPG L  E   LGG  F CGR+  
Sbjct  673   FTEDIARSVNVVHVVDTTRMNDRNTEPSSYISLFSNTPGKLTKELTDLGGEEFSCGRNMT  732

Query  3345  FDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGI  3521
              DFVTF++KY C +   +  GW +S +P L+V  D    DTR T++ +DT  STRWSL I
Sbjct  733   IDFVTFTMKYGCRSYKGSNTGWSKSEVPLLQVESDSASDDTRRTIVSVDTKSSTRWSLAI  792

Query  3522  NTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRI  3701
             N  EI DF ++ +S  LV + G+K+ +DGWH ++FAGGK+SPT+F LTL W  N++    
Sbjct  793   NKQEIDDFTIQVDSENLVQL-GDKSQLDGWHTVQFAGGKSSPTKFQLTLFWSSNATHASP  851

Query  3702  MEGS-EGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              E   E    L+KLR DVN  TP +  VLEKL  WC+ +GKS+SP+TLA+L A+ V+
Sbjct  852   KEAKVEDYPFLVKLRTDVNRVTPMVEKVLEKLPRWCTPFGKSTSPYTLAFLTALPVN  908



>ref|XP_008785092.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Phoenix 
dactylifera]
Length=884

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/902 (51%), Positives = 598/902 (66%), Gaps = 53/902 (6%)
 Frame = +3

Query  1200  SYTIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNH  1379
             S  +E    +RS +  + LF  ++ G+W V++ QF+ LP PLS E+AG+ GFSE +AM H
Sbjct  23    SREVEDQRPKRSAFLWLALFVLLLNGSWAVYHFQFEKLPLPLSTEKAGKRGFSEASAMEH  82

Query  1380  VKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLY  1559
             VK L++ GPHP+GS ALD ALQYV   +E IKE A  +V+V V+ FHA  G + L  GL+
Sbjct  83    VKYLTKFGPHPVGSDALDLALQYVFAASEKIKETAHWEVDVRVDFFHAKIGASRLASGLF  142

Query  1560  FGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAV  1739
              GKT VYSDLKHVV+R+ PK         E EE+ ILVS+H+DTVFA EGAGD SS V V
Sbjct  143   KGKTHVYSDLKHVVLRILPKYLP------EAEENVILVSSHIDTVFATEGAGDCSSCVGV  196

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+S+ A GFKN  VIF+FNTGEEEGLNGAHSF+ QHPW   +R  IDLEAMGIG
Sbjct  197   MLELARGISQWAHGFKNG-VIFVFNTGEEEGLNGAHSFIAQHPWSRAIRFVIDLEAMGIG  255

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS +FQ G  PWAI+ FAKVAKYPSGQ+++QDLF SG +KS+TD QVY+EVAGLSGLDF
Sbjct  256   GKSSLFQGGSAPWAIETFAKVAKYPSGQIIAQDLFLSGAVKSATDLQVYQEVAGLSGLDF  315

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
             A++D TAVYHTK   +  LK         NL  +L                         
Sbjct  316   AYSDATAVYHTKQG-ICYLK-------SSNLSEYLFYV---------------------Q  346

Query  2280  TVVYFDIL-GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVL  2456
              +++  IL G+YMVVY + FA M H +VI+ SLLI I SL MGG    IS   S LSIVL
Sbjct  347   YLIWRSILQGKYMVVYTQRFASMLHNSVILQSLLIWITSLLMGGYPGAISFGLSCLSIVL  406

Query  2457  MWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFL  2636
             MWI S+SL++LVA+++P +S++PVP++A PWL IGLF APA+LGA  GQHV + FL K+L
Sbjct  407   MWIFSLSLTILVAFIIPLMSTSPVPYIAYPWLVIGLFGAPAILGALTGQHVGFFFLKKYL  466

Query  2637  SYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALV  2816
              + + +R       VQ++      E EAERW+FK+G +QWL++L VG + K+GSS+LAL+
Sbjct  467   RHVYKKRVPRLSHNVQENL----IEWEAERWLFKSGFIQWLILLVVGNFFKVGSSFLALI  522

Query  2817  WLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFV  2987
             WLVSPA AY L+EA   P++  K L  +T ++GL +P+ +S+G+ + LV T+IG   RF 
Sbjct  523   WLVSPAFAYGLMEATLSPSRLPKQLKIITLILGLAMPVLVSAGMIIRLVGTIIGVFARFE  582

Query  2988  SNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAM  3167
              +PG   DW+ + IVA+  AA+VCL + Y+L YIH SGAK   +   C L  ++L  V+ 
Sbjct  583   RSPGSAPDWLGSLIVAIFSAAVVCLMLVYLLSYIHLSGAKGLVIFAMCTLLALTLTAVSS  642

Query  3168  QMVPAFVDDTARAVNIVQVVDHT---GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCG  3332
              + PAF +D +RAVN+V VVD T   GN    S +SLFS TPG L  E E L    F CG
Sbjct  643   GIFPAFTEDISRAVNVVHVVDATGRYGNQDPASFVSLFSATPGKLTKEVENLKDEEFACG  702

Query  3333  RDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWS  3512
             ++K  DFVTF+V Y CW+   +  GW +  IP L V  D   D R T + IDT  +TRWS
Sbjct  703   KNKTLDFVTFTVNYGCWSSKDSNNGWSKLDIPELHVESDSMSDIRKTRVLIDTKLATRWS  762

Query  3513  LGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS--  3686
             L +N  EI DF  + +S  LV   G K+ VDGWH+++F+GGKNSPT+F+L L W  N+  
Sbjct  763   LAVNREEISDFTFEVDSEELVP-SGHKSMVDGWHIIQFSGGKNSPTKFHLNLFWSTNTIH  821

Query  3687  -SGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAIS  3863
              S K   +  +  +LLLKLR DVN  TP++  VL+KL  WCS +GKS+SP+TLA+L A+ 
Sbjct  822   PSQKAYKQAEDTASLLLKLRTDVNMVTPKVERVLQKLPHWCSLFGKSTSPYTLAFLTALP  881

Query  3864  VD  3869
             V 
Sbjct  882   VQ  883



>emb|CAE05634.1| OSJNBb0061C13.16 [Oryza sativa Japonica Group]
 emb|CAE03741.1| OSJNBa0019D11.4 [Oryza sativa Japonica Group]
 emb|CAH67606.1| OSIGBa0145G11.5 [Oryza sativa Indica Group]
 gb|EEC77656.1| hypothetical protein OsI_16670 [Oryza sativa Indica Group]
Length=868

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/878 (51%), Positives = 599/878 (68%), Gaps = 29/878 (3%)
 Frame = +3

Query  1275  GTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVL  1454
             G+W V+  QF  LP PL AE+AG+ GFSE +A+ HVK L+ LGPHP+GS ++D A+QYV 
Sbjct  6     GSWSVYRFQFANLPLPLDAEQAGKRGFSEASALEHVKYLAALGPHPVGSDSIDLAVQYVY  65

Query  1455  QVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADK  1634
              VA+ IK+ A  DV+V +E+FH + G N + GGL+ GKT +YS+LKHV++R+ PK     
Sbjct  66    AVADKIKKTAHWDVDVQLELFHTDIGANRMAGGLFNGKTMLYSNLKHVILRVVPKYLP--  123

Query  1635  LREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFN  1814
                 E E++ ILVS+H+DTV   EGAGD SS V VMLE+ARG+++ A GFK+  V+FLFN
Sbjct  124   ----EAEDNLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVAQWAHGFKSG-VLFLFN  178

Query  1815  TGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYP  1994
             TGEEEGL+GAHSF+TQH W N+VR AIDLEAMGI GKS +FQ G D WA+++FA VAKYP
Sbjct  179   TGEEEGLDGAHSFITQHRWRNSVRFAIDLEAMGISGKSTLFQ-GTDHWALESFASVAKYP  237

Query  1995  SGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQ  2174
             S Q+ SQD+F SG IKS+TDFQ+Y+EV GL GLDFA+TD T+VYHTKNDK+  LKPGSLQ
Sbjct  238   SAQIASQDVFQSGAIKSATDFQIYQEVGGLPGLDFAYTDRTSVYHTKNDKMKHLKPGSLQ  297

Query  2175  HLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--DEDTVVYFDILGRYMVVYPRSFADMF  2348
             H+GEN+L FLL AA+S   P   K     K E  ++   V+FDILG+YMVVYP+    MF
Sbjct  298   HIGENMLAFLLHAAAS---PKFMKDAIQAKQEGAEKTKAVFFDILGKYMVVYPQRLTTMF  354

Query  2349  HKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPV  2528
             H ++I  SLLI   SL MGG   L+S   S L IVLM I SV+LSV+VA  LP + S PV
Sbjct  355   HNSIIFQSLLIWGTSLLMGGRPGLVSFGISCLGIVLMLISSVTLSVVVAIALPHICSFPV  414

Query  2529  PFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSEC  2708
              FVA PWL +GLF +PALLGAF+GQH+ ++ L + L + +S  K      + +       
Sbjct  415   TFVAHPWLVVGLFGSPALLGAFIGQHIGFIILKRHLKHVYSITKSGLAHNMLEQ----IV  470

Query  2709  ELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKP  2879
              LEAERW+FK+G +QWL+VL +GTYLK+GSSY+AL+WLVSPA AY L+EA   PA+S K 
Sbjct  471   NLEAERWIFKSGFVQWLIVLILGTYLKVGSSYIALIWLVSPAFAYGLMEATLSPARSPKQ  530

Query  2880  LDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivC  3059
             L  +T ++ L  P+  S+G+ + +V+ +IG +VR   NPG   DW+   +V+V IA ++C
Sbjct  531   LKVITLVLALAAPVVSSAGLVIRMVDVIIGSIVRIDRNPGGLPDWLGNVVVSVAIAIVIC  590

Query  3060  LTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARA----VNIVQVV  3227
              T  Y+L Y+H SGAK       C+ F ++L +V+  ++PAF +D AR+      +    
Sbjct  591   FTFVYLLSYVHISGAKRTLGFLLCIFFGLALALVSSGILPAFTEDIARSVNVVHVVDTTT  650

Query  3228  DHTGNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVTFSVKYSCWTEPTAK  3401
              ++GN+   S+++LFS TPG L  E   L    F CGR++A DFVTF++KY C +     
Sbjct  651   VNSGNTEPSSYVTLFSNTPGKLTKELVDLRDEEFSCGRNRAIDFVTFTMKYGCLSYEGTN  710

Query  3402  LGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVS  3578
              GW +S +P L +  D +  D R T+I +DT  STRWSL IN  EI DF +  +S  LV 
Sbjct  711   TGWSKSEVPVLSLKSDSVTNDARQTIISVDTKSSTRWSLAINKQEIDDFTVHVDSENLVP  770

Query  3579  VGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME-GSEGENLLLKLRADVN  3755
             + G K+ +DGWH ++FAGGK+SPT+F LTL W  NS      +  SE  + LLKLR DVN
Sbjct  771   L-GNKSEIDGWHTIQFAGGKDSPTKFQLTLFWASNSKDAFPKQVESEDHSFLLKLRTDVN  829

Query  3756  TKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
               TP++  VLEKL  WC+ +GKS+SP+TLA+L A+ V+
Sbjct  830   RVTPKVGRVLEKLPGWCAPFGKSTSPYTLAFLTALPVN  867



>dbj|BAJ95764.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=909

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/892 (51%), Positives = 602/892 (67%), Gaps = 25/892 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS Y ++ LF     G+W V+  QF  LP PL+AE+AG+ GFSE +A+ HVK L+ LGP
Sbjct  31    RRSAYLLLGLFIVFFHGSWSVYRMQFANLPLPLNAEQAGKRGFSEASALEHVKYLTGLGP  90

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS +LD A++YV   AE IK+ A  DV+V +E+FH + G N L GGL+ GKT +Y+D
Sbjct  91    HPVGSDSLDLAVKYVYAEAEKIKKTAHPDVDVQLELFHTDIGANRLTGGLFKGKTILYAD  150

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHV++R  PK         E EE+ ILVS+H+DTVF   GAGD SS V VMLE+ARG+S
Sbjct  151   LKHVILRFVPKYLP------EAEENLILVSSHIDTVFTTGGAGDCSSCVGVMLELARGVS  204

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  V+FLFN+GEEEGL GAHSF+TQH W N+VR AIDLEAMGIGGKS +FQ G
Sbjct  205   QWAHGFKSG-VLFLFNSGEEEGLVGAHSFITQHHWRNSVRFAIDLEAMGIGGKSTLFQ-G  262

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
                WA+++FA VAKYPS Q+  QD+F+SG I S+TDFQ+Y EVAGL GLDFA+TD T+VY
Sbjct  263   THQWALESFAAVAKYPSAQIAIQDIFNSGAINSATDFQIYLEVAGLPGLDFAYTDMTSVY  322

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+  LKPGSLQH GEN+L FL+ AASS      +   +  +S ++   ++FDILG
Sbjct  323   HTKNDKMEHLKPGSLQHNGENMLAFLVHAASSQKF-MEDAHQAKQESIEQKKAIFFDILG  381

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMVVYP+  A MFH ++I  SLLI    L MG  S L+S   S LSI+L  I S+ L V
Sbjct  382   KYMVVYPQRLATMFHNSIIFQSLLILGTLLLMGRCSTLVSFGISCLSIILTLIFSIFLPV  441

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             +VA+ LP +   P+ FVA+PWL IGLF +PALLGAF+GQH+ ++ L K + + +S  K  
Sbjct  442   VVAFALPHICPFPISFVANPWLVIGLFGSPALLGAFIGQHIGFILLKKQIKHVYSRTKPG  501

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
                   D        LEAERW+FK+G LQWL+VL +GTYL++G+SY+AL+WLVSPA AY 
Sbjct  502   LTGNKMD----YIVGLEAERWIFKSGFLQWLIVLILGTYLEVGASYIALIWLVSPAFAYG  557

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             L+EA   P +S+K L  +T ++ L +P+  S+G+ + +V+ +IG +VR   NPG    W+
Sbjct  558   LMEAKLSPLRSSKHLKVVTLVLALALPVVSSAGLVIRMVDVMIGTIVRADRNPGGLTGWL  617

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                 VAV+IA +V   + Y+L Y+H S AK   +   C +F +S+ +V+  +VPAF +D 
Sbjct  618   GNVGVAVVIAIVVSFMLVYLLSYVHISDAKRALLTVLCAVFGLSIVLVSGGIVPAFTEDI  677

Query  3198  ARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVT  3359
             +R VN+V VVD T    G++  +S++SLFS TPG L  E   L G  F CGR+   DF T
Sbjct  678   SRTVNVVHVVDTTRMNDGSTEPLSYVSLFSHTPGKLTQELTDLTGEEFSCGRNMTIDFAT  737

Query  3360  FSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             F++ Y C +   + +GW +  +P L V  D    D R T++ +DT  STRWSL IN  EI
Sbjct  738   FTMMYGCRSYKQSNIGWSQPEVPVLHVESDSATDDARRTVVSVDTKSSTRWSLAINKQEI  797

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEG-S  3713
              DF +  +S  LV +GG K+ VDGWH +RFAGGK+SPT+F LTL W  N++     E  S
Sbjct  798   SDFTVHVDSNNLVELGG-KSKVDGWHTVRFAGGKSSPTKFKLTLFWSSNATHASAEEAKS  856

Query  3714  EGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             E  + L+KLR DVN  TP +  VLEKL  WC+ +GKS+SP+TLA+L A+ +D
Sbjct  857   EDLSPLVKLRTDVNRVTPMVAMVLEKLPGWCTPFGKSTSPYTLAFLTALPID  908



>ref|XP_006652525.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Oryza 
brachyantha]
Length=908

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/878 (51%), Positives = 599/878 (68%), Gaps = 29/878 (3%)
 Frame = +3

Query  1275  GTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVL  1454
             G+W V+  Q+  LP PL+AE+AG+ GFSE +A+ HVK L+ LGPHP+GS +LD A+QYV 
Sbjct  46    GSWSVYRVQYANLPLPLNAEQAGKRGFSEASALEHVKYLAGLGPHPVGSDSLDLAVQYVY  105

Query  1455  QVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADK  1634
              VAE IK+ A  +V+V +E+FH   G N + GGL+ GKT +YSDLKHV++R+ PK     
Sbjct  106   AVAEKIKKTAHWEVDVQLELFHTYIGANRIAGGLFNGKTMLYSDLKHVMLRVVPKYLL--  163

Query  1635  LREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFN  1814
                 E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG+++ A GFK+  V+FLFN
Sbjct  164   ----EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVAQWAHGFKSG-VLFLFN  218

Query  1815  TGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYP  1994
             TGEEEGL+GAHSF+TQH W N VR A+DLEAMGI GKS +FQ G D WA+++FA VAKYP
Sbjct  219   TGEEEGLDGAHSFITQHRWRNAVRFAVDLEAMGISGKSTLFQ-GTDHWALESFASVAKYP  277

Query  1995  SGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQ  2174
             S Q+ SQD+F SG IKS+TDFQ+Y+EV GL GLDFA+TD T+VYHTKNDK+  LKPGSLQ
Sbjct  278   SAQIASQDVFQSGAIKSATDFQIYREVGGLPGLDFAYTDRTSVYHTKNDKMKHLKPGSLQ  337

Query  2175  HLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--DEDTVVYFDILGRYMVVYPRSFADMF  2348
             H+GEN+L FLL AA+S   P   K     K +  +++  V+FDILG+YMVVYP+  A MF
Sbjct  338   HIGENMLAFLLHAAAS---PKFMKDAIQAKQDGAEQNKAVFFDILGKYMVVYPQRLAIMF  394

Query  2349  HKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPV  2528
             H ++I  SLLI   SL MGG   L+S   S LSIVLM I SVSLS +VA  LP + S PV
Sbjct  395   HNSIIFQSLLIWGTSLLMGGRPGLVSFGISCLSIVLMLISSVSLSAVVALALPYICSFPV  454

Query  2529  PFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSEC  2708
              +VA PWL IGLF +PALLGAF+GQH+ ++ L + L + +S  K      V  +      
Sbjct  455   SYVAHPWLVIGLFGSPALLGAFIGQHIGFIILKRHLKHVYSRTKPGLAHNVLGN----IV  510

Query  2709  ELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKP  2879
              LEAERW+FK+G +QWL+VL +GTYLK+GSSY+AL+WLVSPA AY L+EA   PA+S K 
Sbjct  511   SLEAERWIFKSGFVQWLIVLILGTYLKVGSSYIALIWLVSPAFAYGLMEATLSPARSPKQ  570

Query  2880  LDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivC  3059
             L  +T ++ L  P+  S+G+ + +V+ +IG +VR   NPG   DW+   +V+V IA ++ 
Sbjct  571   LKVVTLVLALAAPVVSSAGLAIHMVDIIIGSVVRIDRNPGGLPDWLGNVVVSVAIAVVIS  630

Query  3060  LTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARA----VNIVQVV  3227
              T  Y+L Y H SGAK       CV+F ++L +V+  +VPAF +D AR+      +   V
Sbjct  631   FTFVYLLSYAHISGAKKTLGFLLCVIFGLALVLVSSGIVPAFTEDIARSVNVVHVVDTTV  690

Query  3228  DHTGNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVTFSVKYSCWTEPTAK  3401
              ++GN+   S+++LFS TPG L  E   L    F CGR++  DFVTF++KY C +   + 
Sbjct  691   VNSGNTEPSSYVTLFSNTPGKLTNELVNLRDEEFSCGRNRTVDFVTFTMKYGCLSYEGSN  750

Query  3402  LGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVS  3578
             +GW +S +P L +  D +  D R T+I +DT  STRWS+ IN  EI DF +  +   LV 
Sbjct  751   IGWSKSEVPVLSLESDAVTDDARQTIISVDTKSSTRWSMAINKQEIDDFTVHVDLENLVP  810

Query  3579  VGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME-GSEGENLLLKLRADVN  3755
             + G K  +DGWH ++FAGGK+SPT+F LTL W  N+      +  SE  + L+KLR DVN
Sbjct  811   L-GNKTEIDGWHTIQFAGGKDSPTKFQLTLFWSSNAKDAFPKQVKSEDHSFLVKLRTDVN  869

Query  3756  TKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
               TP++  VLEKL  WC+ +GKS+SP+TLA+L A+ V+
Sbjct  870   RVTPKVARVLEKLPRWCAPFGKSTSPYTLAFLTALPVN  907



>ref|XP_010943485.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X3 
[Elaeis guineensis]
 ref|XP_010943486.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X3 
[Elaeis guineensis]
Length=799

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/813 (54%), Positives = 558/813 (69%), Gaps = 28/813 (3%)
 Frame = +3

Query  1470  IKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             +K  A  +V+V V+ FHA  G + L  GL+ GKT +YSDLKHVV+R+ PK          
Sbjct  1     MKRTAHWEVDVQVDFFHAKIGASRLASGLFKGKTHIYSDLKHVVLRILPKYLPAA-----  55

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
              EE+ ILVS+H+DTVFA EGAGD SS V VMLE+ARG+S+ A GFKN  VIFLFNTGEEE
Sbjct  56    -EENLILVSSHIDTVFATEGAGDCSSCVGVMLELARGISQWAHGFKNG-VIFLFNTGEEE  113

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVV  2009
             GLNGAHSF+TQHPW   +R  IDLEAMGIGGKS +FQ G  PWAI+ FAKVAKYPSGQ++
Sbjct  114   GLNGAHSFITQHPWSRAIRFVIDLEAMGIGGKSSLFQGGSAPWAIETFAKVAKYPSGQII  173

Query  2010  SQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGEN  2189
             +QDLF SG IKS+TD QVY+EVAGL GLDFA++D TAVYHTKNDK+ LLKPGSLQHLGEN
Sbjct  174   AQDLFLSGAIKSATDLQVYQEVAGLPGLDFAYSDATAVYHTKNDKLKLLKPGSLQHLGEN  233

Query  2190  LLPFLLQAASSSDLPTPNKTLSTGKSE--DEDTVVYFDILGRYMVVYPRSFADMFHKAVi  2363
             +L FLL  A SS L   +K     + E  ++   ++FD+LG+YMVVY +  A M H +VI
Sbjct  234   MLAFLLHTAMSSRL---HKVAEVEREEGTNQTQAIFFDVLGKYMVVYTQQLASMLHNSVI  290

Query  2364  ilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVAS  2543
             + SLLI IASL MGG    IS   S LSIVLMWI S+SL++LVA+++P +S++PVP++A 
Sbjct  291   LQSLLIWIASLLMGGYPGAISFGLSCLSIVLMWIFSLSLTILVAFIIPLISTSPVPYIAY  350

Query  2544  PWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAE  2723
             PWL +GLF APA+LGA  GQHV + FL K+L + + +R  S    VQ++        EAE
Sbjct  351   PWLVVGLFGAPAMLGALTGQHVGFFFLKKYLHHVYKKRVPSLSHSVQEN----LINWEAE  406

Query  2724  RWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLT  2894
             RW+FK+G +QWL++L VG   K+GSS+LALVWLVSPA AY L+EA   P +  K L  +T
Sbjct  407   RWLFKSGFIQWLILLVVGNLFKVGSSFLALVWLVSPAFAYGLMEATLSPTRLPKQLKIIT  466

Query  2895  SLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAY  3074
              ++GL VP+ +S+G+   LV T+IG LVRF  +PG   DW+ + IVA+  AA+VCL + Y
Sbjct  467   LILGLAVPVLVSAGMITRLVGTIIGVLVRFERSPGSAPDWLGSLIVAIFSAAVVCLMLVY  526

Query  3075  VLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT---GNS  3245
             +L YIH SGAK   + + C L  ++L  V+  + P F +D +RAVN+V VVD T   G+ 
Sbjct  527   LLSYIHLSGAKGLVIFSMCTLLALTLTAVSSGIFPTFTEDISRAVNVVHVVDTTGRYGSQ  586

Query  3246  SVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKES  3419
                S +SLFS TPG L  E E L    F CGR+K  DFVTF+V Y CW+      GW + 
Sbjct  587   DPASFVSLFSATPGKLTKEVENLKDEEFACGRNKTLDFVTFTVNYGCWSSKDGNNGWSKL  646

Query  3420  RIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNG  3599
              IP L V  D   D R T + IDT  +TRWSL +N  EI DF  +  S  LV   G K+ 
Sbjct  647   DIPELHVESDYMSDVRKTRVLIDTKLATRWSLAVNGEEISDFTFEVGSEELVP-SGNKSM  705

Query  3600  VDGWHVLRFAGGKNSPTEFNLTLQWHKNS---SGKRIMEGSEGENLLLKLRADVNTKTPE  3770
             VDGWH+++FAGGKNSPT+F+L L W  N+   S K   +  +  +LLLKLR DVN  TP+
Sbjct  706   VDGWHIIQFAGGKNSPTKFHLNLFWSTNTSHPSQKAYKQAEDAASLLLKLRTDVNMVTPK  765

Query  3771  MVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             +  VL+KL  WCS +GKS+SP+TLA+L A+ V 
Sbjct  766   VERVLQKLPHWCSLFGKSTSPYTLAFLSALPVQ  798



>gb|EMS48754.1| Endoplasmic reticulum metallopeptidase 1 [Triticum urartu]
Length=908

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/905 (51%), Positives = 596/905 (66%), Gaps = 58/905 (6%)
 Frame = +3

Query  1299  QFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVL----QVAE  1466
             +F  LP PL AE+AG+ GFSE +A+ HVK L+ LGPHP+GS ALD A+Q+        AE
Sbjct  16    EFASLPLPLGAEQAGKRGFSEASALKHVKYLTSLGPHPVGSDALDLAVQHANASFNHEAE  75

Query  1467  GIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREG  1646
              IK+ A  DV+V VE+FH + G N L GGL+ GKT +YSDLKHV++R+ PK         
Sbjct  76    KIKKTAHWDVDVQVELFHTDIGANRLAGGLFKGKTLLYSDLKHVILRIVPKYLP------  129

Query  1647  EDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEE  1826
             E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG+++ A GFK+  V+FLFNTGEE
Sbjct  130   EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVAQWAHGFKSG-VLFLFNTGEE  188

Query  1827  EGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQV  2006
             EGL+GAHSF+TQH W N+VR A+DLEAMGI GKS +FQ G   WA+++FA VAKYPS Q+
Sbjct  189   EGLDGAHSFITQHHWRNSVRFAVDLEAMGISGKSTLFQ-GTHQWALESFAAVAKYPSAQI  247

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTK-----------------  2135
              +QD+F SG IKS+TDFQ+Y+EVAGL GLDFA+TD T+VYHTK                 
Sbjct  248   ATQDVFRSGAIKSATDFQIYEEVAGLPGLDFAYTDTTSVYHTKKLEQGDSFPKKKNEVID  307

Query  2136  ----NDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--DEDTVVYFD  2297
                 NDK+ LLKPGSLQH GEN+L FLL AASS   P   K     K E  ++   ++FD
Sbjct  308   LDVMNDKMELLKPGSLQHNGENMLAFLLHAASS---PKFMKDAHQAKQESTEQKKAIFFD  364

Query  2298  ILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvs  2477
             ILG+YMVVYP+  A MFH ++I  SLLI   SL MGG   L+S   S LSI+L  I S+ 
Sbjct  365   ILGKYMVVYPQRLATMFHNSIIFQSLLIWGTSLLMGGRPGLMSFGISCLSIILTLIFSIF  424

Query  2478  lsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSER  2657
             L V+VA+ LP +   PVPFV +PWL IGLF +PALLGAF+GQH  ++ L + +   +S  
Sbjct  425   LPVVVAFALPHICPFPVPFVGNPWLVIGLFGSPALLGAFIGQHFGFILLKRHIQEVYSRT  484

Query  2658  KRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPAL  2837
             K        D        LEAERW+FK+G +QWL+VL VGTYLK+G+SY+AL+WLVSPA 
Sbjct  485   KPGLTGNTMD----YIVGLEAERWIFKSGFVQWLIVLIVGTYLKVGASYIALIWLVSPAF  540

Query  2838  AYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQA  3008
             AY L+EA   P +S K L   T ++ L VP+  S+G+F+ LV+ ++G +VR   NPG   
Sbjct  541   AYGLMEATLTPVRSPKQLKVFTLVLALAVPVMSSAGLFIRLVDVMVGSIVRADRNPGGLP  600

Query  3009  DWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFV  3188
             DW+   +VAV IA +V  T  Y+L Y+H SGAK   +   C  F ++L +V+  +VPAF 
Sbjct  601   DWLGNVVVAVAIAIVVSFTFVYLLSYVHISGAKKTLLSVLCAFFGLALVLVSSGIVPAFT  660

Query  3189  DDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFD  3350
             +D AR+VN+V VVD T    GN+  +S++SLFS  PG L  E   L G  F CG++   D
Sbjct  661   EDIARSVNVVHVVDTTRTNDGNTEPLSYVSLFSNMPGKLTQELMDLRGEEFSCGKNMTTD  720

Query  3351  FVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINT  3527
             FVTF+VKY C +   +  GW +S +P L V  D    D R T++ +DT  STRWSL IN 
Sbjct  721   FVTFTVKYGCRSYKGSSTGWSKSEVPVLHVESDSATDDARRTVVSVDTKSSTRWSLAINM  780

Query  3528  NEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME  3707
              EI DF ++ ES  LV +GG K+ VDGWH ++FAGGKN+PT+F LTL W   ++     E
Sbjct  781   QEIDDFTVQVESDKLVQLGG-KSEVDGWHTIQFAGGKNAPTKFQLTLFWSSKATQASPKE  839

Query  3708  G-SEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDA----ISVDS  3872
               +E   LL+KLR DVN  TP +  VLEKL  WC+ +GKS+SP+TLA+  A    +S+  
Sbjct  840   ANAEDPPLLVKLRTDVNRVTPMVETVLEKLPRWCAAFGKSTSPYTLAFFTALPLFLSIFR  899

Query  3873  KPSLR  3887
             + +LR
Sbjct  900   RRTLR  904



>gb|AFW86125.1| hypothetical protein ZEAMMB73_851599 [Zea mays]
Length=904

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/909 (49%), Positives = 598/909 (66%), Gaps = 64/909 (7%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              R  Y ++ L    + G+W V+  QF  LP PL AE+AG+ GFSE +A+ H         
Sbjct  31    RRGAYLLLGLLIVFLHGSWSVYQIQFGSLPLPLDAEQAGKRGFSEASALKH---------  81

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
                          YV  VAE IK+ A  +V+V +E+FH + G N L GGL+ GKT +YSD
Sbjct  82    -------------YVYAVAEKIKKTAHWEVDVQLELFHTDIGANRLSGGLFKGKTLLYSD  128

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHV++R++PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG++
Sbjct  129   LKHVLLRVTPKYLP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVA  182

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  ++FLFNTGEEEGL+GAHSF+TQH W N+V  A+DLEAMGI GKS +FQ G
Sbjct  183   QWAHGFKSG-ILFLFNTGEEEGLDGAHSFITQHHWRNSVIFAVDLEAMGISGKSTLFQ-G  240

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
              D WA+++FA VAKYPS Q+ SQD+FSSG IKS+TDFQ+Y+EV  L GLDFA+TD T+VY
Sbjct  241   TDHWALESFAAVAKYPSAQIASQDVFSSGAIKSATDFQIYEEVGRLPGLDFAYTDTTSVY  300

Query  2127  HTK------------------NDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTL  2252
             HTK                  NDK+ALLKPGSLQH+G+N+L FLL +A+S       +  
Sbjct  301   HTKHKSHVTIDLEWNMALISMNDKMALLKPGSLQHIGDNMLAFLLHSAASPKFLKDAQQR  360

Query  2253  STGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLV  2432
               GK+E +D  VYFDILG+YMVVYP   A MFH ++I+ SLLI   SL MGG  AL+S  
Sbjct  361   KQGKTE-QDRAVYFDILGKYMVVYPLRLATMFHNSIILQSLLIWGTSLLMGGHPALVSFA  419

Query  2433  FSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVV  2612
              S LSI+LMWI S+ L V+VA+ LP +   P+P+VA+PWL IGLF +PALLGAF+GQH+ 
Sbjct  420   ISCLSIILMWIFSICLPVVVAFALPYMCPFPIPYVANPWLTIGLFGSPALLGAFIGQHIG  479

Query  2613  YLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKI  2792
             ++ L + L    S+ K      +   E+V++  LEAERW+FK+G +QWL+ L +GTY K+
Sbjct  480   FILLKRHLRRVHSKAKTGITPSMI--ENVTD--LEAERWIFKSGFVQWLIALILGTYFKV  535

Query  2793  GSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTL  2963
             GSSY+AL+WLVSPA AY  LEA   P +  K L  +T ++GL  P+  S+G+ V + + +
Sbjct  536   GSSYIALIWLVSPAFAYGFLEATLSPVRLPKQLKVVTLVVGLVAPVVSSAGLAVRMADVI  595

Query  2964  IGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFV  3143
             +G +VR   NPG   DW+   IV+V IA +VC T  Y+L YIH SG K    +   + F 
Sbjct  596   VGSIVRIDRNPGGLPDWLGNVIVSVAIAVVVCSTFVYLLSYIHISGDKRILGLLLSLSFG  655

Query  3144  VSLGMVAMQMVPAFVDDTARAVNIVQVVD----HTGNSSVVSHISLFSTTPGNLDVEAEK  3311
             +S+ + +  +VPAF +D AR+VN+V VVD    H G+   VS+ISLFS TPG L  E   
Sbjct  656   LSIALASSGIVPAFTEDVARSVNVVHVVDTTGVHGGHIEPVSYISLFSNTPGKLTNELVD  715

Query  3312  LGG--FVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIH  3482
             LGG  F CGR+   D VTF+VKY CW+   +  GW  S +P L V  D + G  R T++ 
Sbjct  716   LGGEEFSCGRNMTTDLVTFTVKYGCWSYKESSTGWSRSEVPVLLVESDSVIGGARQTVVS  775

Query  3483  IDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNL  3662
             +DT  STRW+LGIN + I DF ++ +S  +V + G+K+ +DGWH ++FAGGKNSPT+F L
Sbjct  776   VDTKSSTRWTLGINKDGIDDFTVQVDSEKIV-LPGDKSEIDGWHTIQFAGGKNSPTKFQL  834

Query  3663  TLQWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTL  3842
             TL W  +   +R  + +    LL+KLR DVN  TP++  V+EKL  WC+ +GKS+SP+TL
Sbjct  835   TLYWSSSKPSEREAKQAADAPLLVKLRTDVNRVTPQVARVVEKLPRWCTPFGKSTSPYTL  894

Query  3843  AYLDAISVD  3869
             A+L A+ VD
Sbjct  895   AFLTALRVD  903



>gb|EMT03309.1| Endoplasmic reticulum metallopeptidase 1 [Aegilops tauschii]
Length=884

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/906 (49%), Positives = 576/906 (64%), Gaps = 78/906 (9%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS Y ++ LF   + G+W V+  QF  LP PL AE+A                      
Sbjct  31    KRSAYLLLGLFILFLHGSWSVYRMQFANLPLPLGAEQAE---------------------  69

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
                               AE IK+ A  DV+V VE+FH + G N L GGL+ GKT +YSD
Sbjct  70    ------------------AEKIKKTAHWDVDVQVELFHTDIGANRLAGGLFKGKTLLYSD  111

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHV++R+ PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG++
Sbjct  112   LKHVILRIVPKYLP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLEMARGVA  165

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  V+FLFNTGEEEGL+GAHSF+TQH W N+VR A+DLEAMGI GKS +FQ G
Sbjct  166   QWAHGFKSG-VLFLFNTGEEEGLDGAHSFITQHHWRNSVRFAVDLEAMGISGKSTLFQ-G  223

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
                WA+++FA VAKYPS Q+ +QD+F SG IKS+TDFQ+Y+EVAGL GLDFA+TD T+VY
Sbjct  224   THQWALESFAAVAKYPSAQIATQDVFRSGAIKSATDFQIYEEVAGLPGLDFAYTDTTSVY  283

Query  2127  HTK--------------NDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGK  2264
             HTK              NDK+ LL+PGSLQH GEN+L FLL AASS      +   +   
Sbjct  284   HTKKLERGDSFPKKENENDKMELLQPGSLQHSGENMLAFLLHAASSPKF-MKDAHQAKQD  342

Query  2265  SEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSAL  2444
             S ++   ++FDILG+YMVVYP+  A MFH ++I  SLLI   SL MGG   L+S   S L
Sbjct  343   STEQKKAIFFDILGKYMVVYPQRLATMFHNSIIFQSLLIWGTSLLMGGRPGLVSFGISCL  402

Query  2445  SIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFL  2624
             SI+L  I S+ L V+VA+ LP +   PVPFV +PWL IGLF +PALLGAF+GQH  ++ L
Sbjct  403   SIILTLIFSIFLPVVVAFALPHICPFPVPFVGNPWLVIGLFGSPALLGAFIGQHFGFILL  462

Query  2625  HKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSY  2804
              + +    S  K        D        LEAERW+FK+G +QWL+VL +GTYLK+G+SY
Sbjct  463   KRHIQEVHSRTKPGLTGNTMD----YIVGLEAERWIFKSGFVQWLIVLILGTYLKVGASY  518

Query  2805  LALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYL  2975
             +AL+WLVSPA AY L+EA   P +S K L   T ++ L VP+  S+G+F+ LV+ ++G +
Sbjct  519   IALIWLVSPAFAYGLMEATLTPVRSPKQLKVFTLVLALAVPVMSSAGLFIRLVDVMVGSI  578

Query  2976  VRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLG  3155
             VR   NPG   DW+   +VAV IA +V  T  Y+L Y+H SGAK   +   C  F ++L 
Sbjct  579   VRADRNPGGLPDWLGNVVVAVAIAIVVSFTFVYLLSYVHISGAKKTLLSVLCAFFGLALV  638

Query  3156  MVAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG-  3320
             +V+  +V AF +D AR+VN+V VVD T    GN+  +S++SLFS  PG L  E   L G 
Sbjct  639   LVSSGIVTAFTEDIARSVNVVHVVDTTRMNDGNTEPLSYVSLFSNMPGKLTQELMDLRGE  698

Query  3321  -FVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEG-DTRATLIHIDTA  3494
              F CGR+   DFVTF+VKY C +   +  GW +S +P L V  D    D R T++ +DT 
Sbjct  699   EFSCGRNMTTDFVTFTVKYGCRSYKGSNAGWSKSEVPVLHVESDSAADDARKTVVSVDTK  758

Query  3495  YSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQW  3674
              STRWSL IN  EI DF ++ ES  LV +GG K+ VDGWH ++FAGGKN+PT+F LTL W
Sbjct  759   SSTRWSLAINMQEIDDFTIQVESDKLVQLGG-KSEVDGWHTIQFAGGKNAPTKFQLTLVW  817

Query  3675  HKNSSGKRIMEG-SEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYL  3851
               N++     E  +E   LL+KLR DVN  TP +  VLEKL  WC+ +GKS+SP+TLA+L
Sbjct  818   SSNATQASPKEANAEDPPLLVKLRTDVNRATPMVETVLEKLPRWCAAFGKSTSPYTLAFL  877

Query  3852  DAISVD  3869
              A+ V+
Sbjct  878   TALPVN  883



>ref|XP_007009836.1| Zn-dependent exopeptidases superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY18646.1| Zn-dependent exopeptidases superfamily protein isoform 3 [Theobroma 
cacao]
Length=776

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/786 (53%), Positives = 535/786 (68%), Gaps = 60/786 (8%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             A RSG+  + LF  +V  +W V Y QF+ LP PL+A +AG+ GFSEV AM HVK L++LG
Sbjct  40    ATRSGFVWLTLFVVIVYSSWTVHYYQFESLPVPLTAVQAGKRGFSEVEAMKHVKGLTELG  99

Query  1404  PHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYS  1583
             PHP+GS ALD ALQYVL  +E IK+ A  +V+V+V+ FH NSGV  L+ GL+ G+T VYS
Sbjct  100   PHPVGSDALDLALQYVLAASETIKKTAHWEVDVEVDFFHVNSGVIRLLTGLFVGRTIVYS  159

Query  1584  DLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGL  1763
             DL H+++R+ PK         E  E+AILVS+H+DTVF+ EGAGD SS VAVMLE+ARG+
Sbjct  160   DLNHIILRILPKYVP------EAGENAILVSSHIDTVFSTEGAGDCSSCVAVMLELARGI  213

Query  1764  SKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQA  1943
             S+ A GFKN +VIFLFNTGEEEGL GAHSF+TQHPW +T+R+AIDLEAMGIGGKS IFQA
Sbjct  214   SQWAHGFKN-AVIFLFNTGEEEGLTGAHSFITQHPWSSTIRMAIDLEAMGIGGKSSIFQA  272

Query  1944  GPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
             GP P A++NFA VAKYPSG +++Q                                    
Sbjct  273   GPHPLAVENFAAVAKYPSGLIIAQ------------------------------------  296

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
                 NDK+ LLK GSLQHLGEN+L FLLQ ASSS L    KT+  G   + DT V+FDIL
Sbjct  297   ----NDKLELLKSGSLQHLGENMLSFLLQIASSSHL-LKAKTMDGGGKPNHDTAVFFDIL  351

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvsls  2483
             G+YMVVY    A+M   +VI+ SLLI   SL MGG +A +SL FS LSI+LMWI S+S S
Sbjct  352   GQYMVVYHVRLANMLQYSVIVQSLLIWTTSLLMGGYTAAVSLFFSCLSIILMWIFSISFS  411

Query  2484  vlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR  2663
              +VA++LP +SS+PVP++ASPWL +GLFAAPA LGA  GQH+ YL L +++S  +++RK+
Sbjct  412   AVVAFILPLISSSPVPYIASPWLMVGLFAAPACLGALTGQHLGYLVLQRYISNIYAKRKQ  471

Query  2664  SFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAY  2843
                  +Q D      +LE ERW+FKAG +QWL++L +GTY KIGSSY+ALVWLV PA AY
Sbjct  472   -LSPVIQADL----IKLETERWLFKAGFVQWLVLLIIGTYYKIGSSYVALVWLVPPAFAY  526

Query  2844  VLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
              LLEA   P +  +PL   T L+GL +P+ +S+G+F+   N +IG +VRF  NPG+  +W
Sbjct  527   GLLEATLTPVRLPRPLKLATLLMGLAIPILVSAGIFIRFANVIIGLIVRFDRNPGDTPEW  586

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             + + ++++ IA ++CLT+ Y+L YIH SGAK+  V++TC+LFV+SL +V   ++P F +D
Sbjct  587   LASVVLSIFIAVVICLTLVYLLSYIHLSGAKTSVVLSTCILFVLSLAVVFSGIIPPFTED  646

Query  3195  TARAVNIVQVVDHTGN--SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFS  3365
              ARAVN+V VVD TG      +S +SL S TPG L  E +++  GFVCGR K  DFVTFS
Sbjct  647   FARAVNVVHVVDTTGRFGEKPISFVSLSSITPGKLTKEIDQVREGFVCGRHKVIDFVTFS  706

Query  3366  VKYSCWTEPTAKLGWKESRIPALRVGRDM-EGDTRATLIHIDTAYSTRWSLGINTNEIKD  3542
             VKY C T    + GW ES IP L V  D   G  R T + IDT  S RW L INT EI D
Sbjct  707   VKYGCLTFDETEGGWNESDIPMLDVVYDTNNGVRRITQVAIDTKRSIRWFLAINTEEIDD  766

Query  3543  FELKDE  3560
             F  K+ 
Sbjct  767   FMFKER  772



>ref|XP_004496279.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X3 [Cicer arietinum]
 ref|XP_004496280.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X4 [Cicer arietinum]
Length=739

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/753 (55%), Positives = 530/753 (70%), Gaps = 29/753 (4%)
 Frame = +3

Query  1647  EDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEE  1826
             E  E +ILVS+H+DTVF+ EGAGD SS V VMLE+ARG+S+ A G K   VIFLFNTGEE
Sbjct  3     EAREKSILVSSHIDTVFSTEGAGDCSSCVGVMLELARGISQWAHGLKKG-VIFLFNTGEE  61

Query  1827  EGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQV  2006
             EGLNGAHSF+TQHPW  TV++AIDLEAMGIGGKS IFQAGP PWAI+N+A VAKYPSGQ+
Sbjct  62    EGLNGAHSFITQHPWSKTVQMAIDLEAMGIGGKSSIFQAGPHPWAIENYASVAKYPSGQI  121

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             V+QDLFSSGVIKS+TDFQVYK+VAGLSGLDFA+ D+TAVYHTKNDK+ LL  GSLQHLGE
Sbjct  122   VAQDLFSSGVIKSATDFQVYKDVAGLSGLDFAYVDNTAVYHTKNDKLELLTKGSLQHLGE  181

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSED--EDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             N+L FLL   +SS  P  +   ST   ED   +  +YFDILG YMVVY + FA++ H +V
Sbjct  182   NMLAFLLHIGASSHFPEGS---STESKEDISNNKAIYFDILGTYMVVYRQKFANLLHNSV  238

Query  2361  iilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVA  2540
             I+ SLLI   SL+MGG+ A  SL  S L ++LMW+ ++  S+LVA+++P +SS+PVP+VA
Sbjct  239   IMQSLLIWATSLFMGGIPAAASLALSCLGVLLMWLFALGFSLLVAFLIPMISSSPVPYVA  298

Query  2541  SPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEA  2720
             SPWL +GLF APA+LGA  GQH+ YL   K+L    S+R R     +Q D      +LEA
Sbjct  299   SPWLVVGLFGAPAILGALTGQHLGYLLFKKYLLNLHSKR-RQIPPIIQAD----LVKLEA  353

Query  2721  ERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPL  2891
             ERW++KAG  QWL++L +G Y KIGSSYLALVWLVSPA A+   EA   PA+  KPL   
Sbjct  354   ERWLYKAGSFQWLILLILGNYFKIGSSYLALVWLVSPAFAFGFFEATLSPARLPKPLKLA  413

Query  2892  TSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMA  3071
             T ++GL  P+  S+G+F+ L  T+IG +VR   NPG   +W+   ++A  IAA++ LT+ 
Sbjct  414   TLVLGLATPILFSAGIFIRLAATIIGGMVRLDRNPGGTPEWLGNFVIAAYIAALLSLTLV  473

Query  3072  YVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGNSSV  3251
             Y+L Y+H SG K    + T VLF +SL +V+  +VP F +DTARAVN+V VVD TG    
Sbjct  474   YLLSYVHLSGVKGTITLATLVLFGLSLAVVSFGVVPPFSEDTARAVNVVHVVDATGGLDE  533

Query  3252  V----SHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKE  3416
             +    S++SLFSTTPGNL+ E E +   F+CG++K  DFVTFSVKY C T   A  GW E
Sbjct  534   IHTPESYVSLFSTTPGNLNKEVEHINESFICGKNKTVDFVTFSVKYGCRTYNDATSGWSE  593

Query  3417  SRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKD--ESGVLVSVGGE  3590
               IP + VG D + + R T + I+T  S RW L INT+EI+DF+L D   S  L+SV   
Sbjct  594   DDIPTMHVGSDAKENKRITQVSINTKDSVRWVLAINTDEIEDFKLNDARSSEELISV-DR  652

Query  3591  KNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPE  3770
             K+ VDGWH+++F+GGKN+P  F+LTL W   S+          +  LLKLR DV+  TP 
Sbjct  653   KSSVDGWHIIQFSGGKNAPRLFDLTLYWRSGST-------PSIDGYLLKLRTDVDILTPI  705

Query  3771  MVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
                +L+KL  WCS +GKS+SP TLA+L  ++V+
Sbjct  706   TERILQKLPYWCSLFGKSTSPHTLAFLRNLAVN  738



>gb|EMS65901.1| Endoplasmic reticulum metallopeptidase 1 [Triticum urartu]
Length=870

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/892 (48%), Positives = 572/892 (64%), Gaps = 64/892 (7%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              RS Y ++ L    + G+W V+  QF  LP PL AE+A                      
Sbjct  31    RRSAYLLLGLLIVFLHGSWSVYRMQFANLPLPLDAEQAE---------------------  69

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
                               AE IK+ A  DV+V +E+FH + G N L GGL+ GKT +YSD
Sbjct  70    ------------------AEKIKKAAHPDVDVQLELFHTDIGANRLAGGLFKGKTILYSD  111

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHV++R  PK         E EE+ ILVS+H+DTVF   GAGD SS V VMLE+ARG++
Sbjct  112   LKHVILRFVPKYLP------EAEENLILVSSHIDTVFTTGGAGDCSSCVGVMLELARGVA  165

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK+  V+FLFNTGEEEGL GAHSF+TQH W N+VR A+DLEAMGIGGKS +FQ G
Sbjct  166   QWAHGFKSG-VLFLFNTGEEEGLVGAHSFITQHHWRNSVRFAVDLEAMGIGGKSTLFQ-G  223

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
                WA+++FA VAKYPS Q+  QD+F+SG   S+TDFQ+Y EVAGL GLDFA+TD T+VY
Sbjct  224   THQWALESFAAVAKYPSAQIAIQDIFNSGATNSATDFQIYLEVAGLPGLDFAYTDMTSVY  283

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILG  2306
             HTKNDK+  LKPGSLQH GEN+L FLL AASS      +   +  +S ++   ++FDILG
Sbjct  284   HTKNDKMEHLKPGSLQHNGENMLAFLLHAASSQKF-MEDAHEAKQESVEQKKAIFFDILG  342

Query  2307  RYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsv  2486
             +YMV YP+  A MFH ++I  SLLI   SL MG  S L+SL  S LSI+L  I S+ LSV
Sbjct  343   KYMVAYPQRLATMFHNSIIFHSLLILGTSLLMGRCSVLVSLGISCLSIILTLIFSIFLSV  402

Query  2487  lvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRS  2666
             +VA+V+P +   P+ FVA+PWL IGLF +PALLGAF+GQH+ ++ L K +   +S R + 
Sbjct  403   VVAFVVPHICPFPISFVANPWLVIGLFGSPALLGAFIGQHIGFILLKKHIEQVYS-RTKP  461

Query  2667  FILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYV  2846
              +   + D  V    LEAERW+FK+G LQWL+VL +GTY K+G+SY+AL+WLVSPA AY 
Sbjct  462   GLTGNKMDHIVG---LEAERWIFKSGFLQWLIVLILGTYFKVGASYIALIWLVSPAFAYG  518

Query  2847  LLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWI  3017
             L+EA   P +S K L  +T ++ L VP+  S+G+ + LV+ ++G +VR   NPG    W 
Sbjct  519   LMEATLSPLRSPKHLKVVTLVLALAVPVVSSAGLVIRLVDVMVGTIVRADRNPGGLPGWF  578

Query  3018  PTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDT  3197
                +VAV IA +V     Y+L Y+H SGAK   +   C  F +++ +V+  +VPAF +D 
Sbjct  579   GNVVVAVAIALVVSFMFVYLLSYVHISGAKRALLSVLCASFGLAIVLVSSGIVPAFTEDI  638

Query  3198  ARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVT  3359
             +R VN+V VVD T    G++  +S++SLFS TPG L  E  +L G  F CGR+   DF T
Sbjct  639   SRTVNVVHVVDTTRMNDGSTEPLSYVSLFSHTPGKLTQELMELRGEEFSCGRNMTIDFAT  698

Query  3360  FSVKYSCWTEPTAKLGWKESRIPALRVGRDME-GDTRATLIHIDTAYSTRWSLGINTNEI  3536
             F++ Y C +   + +GW +S +P L V  D    D R T++ IDT  STRWSL IN  EI
Sbjct  699   FTMMYGCRSYKRSNIGWSKSEVPMLHVESDSSTDDARRTIVSIDTKSSTRWSLAINKQEI  758

Query  3537  KDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME-GS  3713
              DF +  +S  LV +GG K+ VDGWH +RFAGGK+SPT+F LTL W  N +     E  +
Sbjct  759   DDFTIHVDSNKLVHLGG-KSEVDGWHTIRFAGGKSSPTKFELTLFWSTNGTHASAKETKA  817

Query  3714  EGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             E  + L+KLR DVN  TP +  VLEKL  W + +GKS+SP+TLA+L A+ ++
Sbjct  818   EDFSPLVKLRTDVNRVTPMVDTVLEKLPRWSTHFGKSTSPYTLAFLTALPIN  869



>gb|KCW65410.1| hypothetical protein EUGRSUZ_G02835 [Eucalyptus grandis]
 gb|KCW65411.1| hypothetical protein EUGRSUZ_G02835 [Eucalyptus grandis]
Length=709

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/717 (56%), Positives = 514/717 (72%), Gaps = 16/717 (2%)
 Frame = +3

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+AR +S+ A GFK+ SVIFLFNTGEEEGLNGAHSF+TQHPW  ++ +A+DLEAMGIG
Sbjct  1     MLELARAVSQWAHGFKS-SVIFLFNTGEEEGLNGAHSFITQHPWSKSIHLAVDLEAMGIG  59

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS IFQAGP+PWAI+NFA  AKYPSG V++QDLF+SG IKS+TDFQVYKEVAGLSGLDF
Sbjct  60    GKSSIFQAGPNPWAIENFASAAKYPSGHVIAQDLFASGAIKSATDFQVYKEVAGLSGLDF  119

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
             A+TD++AVYHTKNDK+ LLK GSLQHLGEN+L FLLQ ASS DL     T   G S    
Sbjct  120   AYTDNSAVYHTKNDKLELLKSGSLQHLGENMLAFLLQIASSPDLSGVQGTKDEGISA-SS  178

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
             + +YFDILG YMV+Y + FA+M H +V + SLLI   SL MGG  A +SLV S LSI+LM
Sbjct  179   SAIYFDILGMYMVLYHQGFANMLHNSVALQSLLIWSTSLLMGGYPAAVSLVLSCLSIILM  238

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
             WI S+S S+L A++LP +S++PVP+VASPWL IGLFAAPALLGA  GQH+ +L L  +LS
Sbjct  239   WIFSLSFSLLSAFILPLLSTSPVPYVASPWLVIGLFAAPALLGALTGQHLGFLILQMYLS  298

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               +S+R++     +      +  +LEAERW++KAG +QWL++L +G Y +IGSSYLALVW
Sbjct  299   NEYSKREQ-----LSPLTQSTLIKLEAERWLYKAGSVQWLILLVIGNYYRIGSSYLALVW  353

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LV PA +Y  LEA   PA+  KPL   T L GL+VP+ +S+GVF+ LV T+IG  VRF  
Sbjct  354   LVPPAFSYGFLEATLTPARFPKPLKLATLLFGLSVPIVVSAGVFIRLVGTIIGMAVRFDR  413

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQ  3170
             NPG+  +W+   IVAV IA ++ LTM Y+L Y+H SGAK   V+    LF +SL  V   
Sbjct  414   NPGDTPEWMVNVIVAVFIALVISLTMVYLLSYVHLSGAKKSIVLAALALFGLSLAAVLSG  473

Query  3171  MVPAFVDDTARAVNIVQVVDHTGNSSVV--SHISLFSTTPGNLDVEAEKL-GGFVCGRDK  3341
             + P F +DTARAVN+V +VD T +      S++S FSTTPG L  E E++ GGF CGRDK
Sbjct  474   VAPPFTEDTARAVNVVHIVDATTSKQEQPDSYVSFFSTTPGKLTKEVEQIGGGFTCGRDK  533

Query  3342  AFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGI  3521
               D VT SVKY CW+    + GW ++ IP L V +D +GD R T + +DT  STRW L +
Sbjct  534   IVDLVTLSVKYGCWSYDDTEGGWSKTDIPTLAVIKDDKGDKRITEVLLDTKSSTRWVLAV  593

Query  3522  NTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRI  3701
             N   I+DF+L+  S  L+ +  +K+ VDGWHV++F+GGK SPT F++TL W  NS+    
Sbjct  594   NAEYIEDFKLEGNSEELIPL-DDKSSVDGWHVIQFSGGKKSPTRFDMTLVW-ANSTQIAH  651

Query  3702  MEGSE-GENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              EGS+  +  LLKLR D++  TP+   VL KL SWCS +GKS+SP TLA+L  + V+
Sbjct  652   GEGSQKNQQPLLKLRTDMDRLTPKAEKVLMKLPSWCSLFGKSTSPQTLAFLRDLPVE  708



>gb|KDO48806.1| hypothetical protein CISIN_1g0024021mg, partial [Citrus sinensis]
 gb|KDO48807.1| hypothetical protein CISIN_1g0024021mg, partial [Citrus sinensis]
 gb|KDO48808.1| hypothetical protein CISIN_1g0024021mg, partial [Citrus sinensis]
 gb|KDO48809.1| hypothetical protein CISIN_1g0024021mg, partial [Citrus sinensis]
Length=732

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/739 (56%), Positives = 526/739 (71%), Gaps = 25/739 (3%)
 Frame = +3

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
             EGAGD SS VAVMLE+AR +S+ A GFKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+
Sbjct  1     EGAGDCSSCVAVMLELARAMSQWAHGFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTI  59

Query  1884  RVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
             RVAIDLEAMGIGGKSG+FQAGP PWA++NFA  AKYPSGQV +QDLF+SG I S+TDFQV
Sbjct  60    RVAIDLEAMGIGGKSGLFQAGPHPWAVENFAAAAKYPSGQVTAQDLFASGAITSATDFQV  119

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             YKEVAGLSGLDFA+TD +AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQAASS+ LP  N
Sbjct  120   YKEVAGLSGLDFAYTDKSAVYHTKNDKLDLLKPGSLQHLGENMLAFLLQAASSTSLPKGN  179

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALI  2423
                  GK+  E T VYFDILG YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +
Sbjct  180   AMEKEGKTVHE-TAVYFDILGTYMVLYRQGFANMLHNSVIVQSLLIWTASLVMGGYPAAV  238

Query  2424  SLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQ  2603
             SL  + LS +LM + SVS +V++A++LP +SS+PVP+VA+PWLA+GLFAAPA LGA  GQ
Sbjct  239   SLALTCLSAILMLVFSVSFAVVIAFILPQISSSPVPYVANPWLAVGLFAAPAFLGALTGQ  298

Query  2604  HVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTY  2783
             H+ Y+ L  +L+  FS+R +     VQ D      +LEAERW+FKAG LQWL++LA+G +
Sbjct  299   HLGYIILKAYLANMFSKRMQ-LSPIVQAD----LIKLEAERWLFKAGFLQWLILLALGNF  353

Query  2784  LKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLV  2954
              KIGS+++AL WLV PA AY  LEA   P +  +PL   T L+GL VP+ +S+G F+ L 
Sbjct  354   YKIGSTFIALFWLVPPAFAYGFLEATLTPVRFPRPLKLATLLLGLAVPVLVSAGNFIRLA  413

Query  2955  NTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCV  3134
             N ++  +VRF  NPG   +W+   I+AV IA ++CLT+ Y+L Y+H SGAK P  I +CV
Sbjct  414   NVIVAIVVRFDRNPGGTPEWLGNVILAVFIAVVLCLTLVYLLSYVHLSGAKRPIAIASCV  473

Query  3135  LFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVE  3302
             LFV+SL +V    VP F +DTARAVN+V VVD +    G     S I+L+STTPG L  E
Sbjct  474   LFVLSLILVLSGTVPPFSEDTARAVNVVHVVDASGKFGGKQEPSSFIALYSTTPGKLTKE  533

Query  3303  AEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR------DMEGD  3461
              E++  GFVCGRD   DFVT S++Y C T    + GW +S +P + V        D +G+
Sbjct  534   VEQIKEGFVCGRDNVVDFVTLSMEYGCLTYDGTEGGWSQSDVPTIHVESEGFGIMDTKGN  593

Query  3462  T--RATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGG  3635
                R T + ID   S RWSL I+  EI+DF  K+ S  LV    EK+G+DGWH+++F+GG
Sbjct  594   DNGRITKVSIDMKGSVRWSLAIDAEEIEDFTFKEGSEELVP-RDEKSGMDGWHIIQFSGG  652

Query  3636  KNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQ  3812
             KN+ ++F+L L W KNS+         E +  LLKLR D +  TP+   VL KL +WCS 
Sbjct  653   KNAVSKFDLDLYWAKNSTESYHNANRKEKQRPLLKLRTDFDRLTPKTERVLSKLPAWCSL  712

Query  3813  YGKSSSPFTLAYLDAISVD  3869
             +GKS+SP TL++L+++ V+
Sbjct  713   FGKSTSPQTLSFLNSLPVN  731



>ref|XP_011031742.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Populus euphratica]
Length=713

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/723 (56%), Positives = 504/723 (70%), Gaps = 24/723 (3%)
 Frame = +3

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+S+ A GFKN  VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEAMG+G
Sbjct  1     MLELARGISQWAHGFKNG-VIFLFNTGEEEGLNGAHSFITQHPWSKTIRLAVDLEAMGVG  59

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKSGIFQAGP PWAI+NFA  AKYPSG +++QDLFS+GVIKS+TDFQVYKE AGLSGLDF
Sbjct  60    GKSGIFQAGPHPWAIENFASAAKYPSGNIIAQDLFSAGVIKSATDFQVYKEDAGLSGLDF  119

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP---NKTLSTGKSE  2270
             AFTD+ AVYHTKNDK+ LLK GSLQHLGEN+L FLL+ ASS  LP     +K L TG   
Sbjct  120   AFTDNGAVYHTKNDKLDLLKSGSLQHLGENMLAFLLRIASSPHLPKSKDMDKELKTG---  176

Query  2271  DEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSI  2450
               DT ++FDILG YM+VY + FA M H +VI+ SLLI  ASL+MGG SA ISL  S LS 
Sbjct  177   -HDTAIFFDILGTYMIVYSQRFASMLHNSVILQSLLIWAASLFMGGSSATISLGLSCLSA  235

Query  2451  VLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHK  2630
             +LM   SVS SV  A+++P +S +PVP+VA+P L +GLFAAPALLGA  GQH+ YL L K
Sbjct  236   ILMLSFSVSFSVFAAFIVPQISPSPVPYVANPLLVLGLFAAPALLGALTGQHLGYLILKK  295

Query  2631  FLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLA  2810
             +L   +S++K+   + + D       +LEAERW++KAG +QWL++L VG Y KIGSSYLA
Sbjct  296   YLLNVYSKKKQLSSVIIAD-----VVKLEAERWLYKAGFVQWLVLLIVGNYYKIGSSYLA  350

Query  2811  LVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVR  2981
             + WLV PA AY LLEA   PA+  KPL   T L+GL VP+ ISSG F+ L  T+IG  VR
Sbjct  351   VFWLVPPAFAYGLLEATLTPARLPKPLKLATLLMGLAVPILISSGTFIRLAGTIIGMAVR  410

Query  2982  FVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMV  3161
             F  NPG   +W+   I+++ IA  +CLT  YVL Y+H SGAK   ++ T +LF +SL +V
Sbjct  411   FDRNPGGTPEWLWNIIISIFIAVCICLTFIYVLSYVHLSGAKRSIILATSILFGLSLILV  470

Query  3162  AMQMVPAFVDDTARAVNIVQVVDHTGN----SSVVSHISLFSTTPGNLDVEAEKLG-GFV  3326
                 +  F +DTARAVN+V VVD +G        +S+ISLFS TPG L+ E E++  GF 
Sbjct  471   LSGRIQPFTEDTARAVNVVHVVDASGRYGEKQDPLSYISLFSNTPGKLEKEVEQIKEGFT  530

Query  3327  CGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTR  3506
             CG+DK  DFVTFSV Y C T    + GW ES IP L V  D +G  R T + IDT  S R
Sbjct  531   CGKDKVVDFVTFSVNYGCLTHDDTESGWSESDIPTLHVDSDTKGGERITRVSIDTKSSMR  590

Query  3507  WSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS  3686
             WSL INT EI+DF LK     L+   G K  VDGWH ++F+GGK SP +F LTL W   S
Sbjct  591   WSLAINTKEIEDFILKGNLEELIPY-GNKTSVDGWHHIQFSGGKESPRKFELTLFWPVKS  649

Query  3687  --SGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
               S   +      +  LLKLR DV+  TP+   VL KL +WCS +GKS+SP TLA+L ++
Sbjct  650   MPSADNVDRTIRDQRPLLKLRTDVDRLTPKAERVLAKLPTWCSLFGKSTSPLTLAFLSSL  709

Query  3861  SVD  3869
              V+
Sbjct  710   PVN  712



>ref|XP_007009837.1| Zn-dependent exopeptidases superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY18647.1| Zn-dependent exopeptidases superfamily protein isoform 4 [Theobroma 
cacao]
Length=659

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/656 (57%), Positives = 478/656 (73%), Gaps = 15/656 (2%)
 Frame = +3

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+S+ A GFKN +VIFLFNTGEEEGL GAHSF+TQHPW +T+R+AIDLEAMGIG
Sbjct  1     MLELARGISQWAHGFKN-AVIFLFNTGEEEGLTGAHSFITQHPWSSTIRMAIDLEAMGIG  59

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS IFQAGP P A++NFA VAKYPSG +++QDLFSSG IKS+TDFQVYKEVAGLSGLDF
Sbjct  60    GKSSIFQAGPHPLAVENFAAVAKYPSGLIIAQDLFSSGAIKSATDFQVYKEVAGLSGLDF  119

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
              +TD+ AVYHTKNDK+ LLK GSLQHLGEN+L FLLQ ASSS L    KT+  G   + D
Sbjct  120   VYTDNGAVYHTKNDKLELLKSGSLQHLGENMLSFLLQIASSSHL-LKAKTMDGGGKPNHD  178

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
             T V+FDILG+YMVVY    A+M   +VI+ SLLI   SL MGG +A +SL FS LSI+LM
Sbjct  179   TAVFFDILGQYMVVYHVRLANMLQYSVIVQSLLIWTTSLLMGGYTAAVSLFFSCLSIILM  238

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
             WI S+S S +VA++LP +SS+PVP++ASPWL +GLFAAPA LGA  GQH+ YL L +++S
Sbjct  239   WIFSISFSAVVAFILPLISSSPVPYIASPWLMVGLFAAPACLGALTGQHLGYLVLQRYIS  298

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               +++RK+     +Q D      +LE ERW+FKAG +QWL++L +GTY KIGSSY+ALVW
Sbjct  299   NIYAKRKQ-LSPVIQAD----LIKLETERWLFKAGFVQWLVLLIIGTYYKIGSSYVALVW  353

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LV PA AY LLEA   P +  +PL   T L+GL +P+ +S+G+F+   N +IG +VRF  
Sbjct  354   LVPPAFAYGLLEATLTPVRLPRPLKLATLLMGLAIPILVSAGIFIRFANVIIGLIVRFDR  413

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQ  3170
             NPG+  +W+ + ++++ IA ++CLT+ Y+L YIH SGAK+  V++TC+LFV+SL +V   
Sbjct  414   NPGDTPEWLASVVLSIFIAVVICLTLVYLLSYIHLSGAKTSVVLSTCILFVLSLAVVFSG  473

Query  3171  MVPAFVDDTARAVNIVQVVDHTGN--SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDK  3341
             ++P F +D ARAVN+V VVD TG      +S +SL S TPG L  E +++  GFVCGR K
Sbjct  474   IIPPFTEDFARAVNVVHVVDTTGRFGEKPISFVSLSSITPGKLTKEIDQVREGFVCGRHK  533

Query  3342  AFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDM-EGDTRATLIHIDTAYSTRWSLG  3518
               DFVTFSVKY C T    + GW ES IP L V  D   G  R T + IDT  S RW L 
Sbjct  534   VIDFVTFSVKYGCLTFDETEGGWNESDIPMLDVVYDTNNGVRRITQVAIDTKRSIRWFLA  593

Query  3519  INTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS  3686
             INT EI DF  K +S  +V   G K+  DGWH+++ +GGKN+PT F+LTL W K +
Sbjct  594   INTEEIDDFMFKADSMEVVPADG-KSSKDGWHIIQVSGGKNAPTRFDLTLFWVKKT  648



>ref|XP_007009838.1| Zn-dependent exopeptidases superfamily protein isoform 5 [Theobroma 
cacao]
 gb|EOY18648.1| Zn-dependent exopeptidases superfamily protein isoform 5 [Theobroma 
cacao]
Length=655

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/656 (57%), Positives = 478/656 (73%), Gaps = 15/656 (2%)
 Frame = +3

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+S+ A GFKN +VIFLFNTGEEEGL GAHSF+TQHPW +T+R+AIDLEAMGIG
Sbjct  1     MLELARGISQWAHGFKN-AVIFLFNTGEEEGLTGAHSFITQHPWSSTIRMAIDLEAMGIG  59

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS IFQAGP P A++NFA VAKYPSG +++QDLFSSG IKS+TDFQVYKEVAGLSGLDF
Sbjct  60    GKSSIFQAGPHPLAVENFAAVAKYPSGLIIAQDLFSSGAIKSATDFQVYKEVAGLSGLDF  119

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
              +TD+ AVYHTKNDK+ LLK GSLQHLGEN+L FLLQ ASSS L    KT+  G   + D
Sbjct  120   VYTDNGAVYHTKNDKLELLKSGSLQHLGENMLSFLLQIASSSHL-LKAKTMDGGGKPNHD  178

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
             T V+FDILG+YMVVY    A+M   +VI+ SLLI   SL MGG +A +SL FS LSI+LM
Sbjct  179   TAVFFDILGQYMVVYHVRLANMLQYSVIVQSLLIWTTSLLMGGYTAAVSLFFSCLSIILM  238

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
             WI S+S S +VA++LP +SS+PVP++ASPWL +GLFAAPA LGA  GQH+ YL L +++S
Sbjct  239   WIFSISFSAVVAFILPLISSSPVPYIASPWLMVGLFAAPACLGALTGQHLGYLVLQRYIS  298

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               +++RK+     +Q D      +LE ERW+FKAG +QWL++L +GTY KIGSSY+ALVW
Sbjct  299   NIYAKRKQ-LSPVIQAD----LIKLETERWLFKAGFVQWLVLLIIGTYYKIGSSYVALVW  353

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LV PA AY LLEA   P +  +PL   T L+GL +P+ +S+G+F+   N +IG +VRF  
Sbjct  354   LVPPAFAYGLLEATLTPVRLPRPLKLATLLMGLAIPILVSAGIFIRFANVIIGLIVRFDR  413

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQ  3170
             NPG+  +W+ + ++++ IA ++CLT+ Y+L YIH SGAK+  V++TC+LFV+SL +V   
Sbjct  414   NPGDTPEWLASVVLSIFIAVVICLTLVYLLSYIHLSGAKTSVVLSTCILFVLSLAVVFSG  473

Query  3171  MVPAFVDDTARAVNIVQVVDHTGN--SSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDK  3341
             ++P F +D ARAVN+V VVD TG      +S +SL S TPG L  E +++  GFVCGR K
Sbjct  474   IIPPFTEDFARAVNVVHVVDTTGRFGEKPISFVSLSSITPGKLTKEIDQVREGFVCGRHK  533

Query  3342  AFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDM-EGDTRATLIHIDTAYSTRWSLG  3518
               DFVTFSVKY C T    + GW ES IP L V  D   G  R T + IDT  S RW L 
Sbjct  534   VIDFVTFSVKYGCLTFDETEGGWNESDIPMLDVVYDTNNGVRRITQVAIDTKRSIRWFLA  593

Query  3519  INTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS  3686
             INT EI DF  K +S  +V   G K+  DGWH+++ +GGKN+PT F+LTL W K +
Sbjct  594   INTEEIDDFMFKADSMEVVPADG-KSSKDGWHIIQVSGGKNAPTRFDLTLFWVKKT  648



>gb|KDO48810.1| hypothetical protein CISIN_1g0024021mg, partial [Citrus sinensis]
Length=698

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/739 (54%), Positives = 503/739 (68%), Gaps = 59/739 (8%)
 Frame = +3

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
             EGAGD SS VAVMLE+AR +S+ A GFKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+
Sbjct  1     EGAGDCSSCVAVMLELARAMSQWAHGFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTI  59

Query  1884  RVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
             RVAIDLEAMGIGGKSG+FQAGP PWA++NFA  AKYPSGQV +QDLF+SG I S+TDFQV
Sbjct  60    RVAIDLEAMGIGGKSGLFQAGPHPWAVENFAAAAKYPSGQVTAQDLFASGAITSATDFQV  119

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             YKEVAGLSGLDFA+TD +AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQAASS+ LP  N
Sbjct  120   YKEVAGLSGLDFAYTDKSAVYHTKNDKLDLLKPGSLQHLGENMLAFLLQAASSTSLPKGN  179

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALI  2423
                  GK+  E T VYFDILG YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +
Sbjct  180   AMEKEGKTVHE-TAVYFDILGTYMVLYRQGFANMLHNSVIVQSLLIWTASLVMGGYPAAV  238

Query  2424  SLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQ  2603
             SL  + LS +LM + SVS +V++A++LP +SS+PVP+VA+PWLA+GLFAAPA LGA  GQ
Sbjct  239   SLALTCLSAILMLVFSVSFAVVIAFILPQISSSPVPYVANPWLAVGLFAAPAFLGALTGQ  298

Query  2604  HVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTY  2783
             H+ Y+ L  +L+  FS+R +     VQ D      +LEAERW+FKAG LQWL++LA+G +
Sbjct  299   HLGYIILKAYLANMFSKRMQ-LSPIVQADL----IKLEAERWLFKAGFLQWLILLALGNF  353

Query  2784  LKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLV  2954
              KIGS+++AL WLV PA AY  LEA   P +  +PL   T L+GL VP+ +S+G F+ L 
Sbjct  354   YKIGSTFIALFWLVPPAFAYGFLEATLTPVRFPRPLKLATLLLGLAVPVLVSAGNFIRLA  413

Query  2955  NTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCV  3134
             N ++  +VRF  NPG                                  AK P  I +CV
Sbjct  414   NVIVAIVVRFDRNPG----------------------------------AKRPIAIASCV  439

Query  3135  LFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVE  3302
             LFV+SL +V    VP F +DTARAVN+V VVD +    G     S I+L+STTPG L  E
Sbjct  440   LFVLSLILVLSGTVPPFSEDTARAVNVVHVVDASGKFGGKQEPSSFIALYSTTPGKLTKE  499

Query  3303  AEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR------DMEGD  3461
              E++  GFVCGRD   DFVT S++Y C T    + GW +S +P + V        D +G+
Sbjct  500   VEQIKEGFVCGRDNVVDFVTLSMEYGCLTYDGTEGGWSQSDVPTIHVESEGFGIMDTKGN  559

Query  3462  T--RATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGG  3635
                R T + ID   S RWSL I+  EI+DF  K+ S  LV    EK+G+DGWH+++F+GG
Sbjct  560   DNGRITKVSIDMKGSVRWSLAIDAEEIEDFTFKEGSEELVP-RDEKSGMDGWHIIQFSGG  618

Query  3636  KNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQ  3812
             KN+ ++F+L L W KNS+         E +  LLKLR D +  TP+   VL KL +WCS 
Sbjct  619   KNAVSKFDLDLYWAKNSTESYHNANRKEKQRPLLKLRTDFDRLTPKTERVLSKLPAWCSL  678

Query  3813  YGKSSSPFTLAYLDAISVD  3869
             +GKS+SP TL++L+++ V+
Sbjct  679   FGKSTSPQTLSFLNSLPVN  697



>ref|XP_001768589.1| predicted protein [Physcomitrella patens]
 gb|EDQ66527.1| predicted protein [Physcomitrella patens]
Length=885

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/897 (43%), Positives = 561/897 (63%), Gaps = 51/897 (6%)
 Frame = +3

Query  1275  GTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVL  1454
              TWL+F  Q ++LP PLS + AG  GFSE  A  HV ALS LGPHP+ S AL  A+QYV+
Sbjct  8     ATWLIFRYQTEILPSPLSEKAAGVRGFSEERAYRHVAALSSLGPHPIRSDALGHAIQYVI  67

Query  1455  QVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADK  1634
                  +++ A  +V V+V+ FHA  G   L GGL+ GK+ VYS LKHVV+RL PK     
Sbjct  68    DQVTEVRDTANSEVEVEVDYFHARPGATQLTGGLFKGKSLVYSGLKHVVVRLHPK-----  122

Query  1635  LREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFN  1814
               E    E+AIL+S+H+DTV  A GAGD SS V V+LE+ R LS    GFK+ S+IFLFN
Sbjct  123   -YEDSALENAILISSHIDTVITAPGAGDCSSCVGVLLELVRALSHWGQGFKH-SIIFLFN  180

Query  1815  TGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYP  1994
             TGEEEGL GAHSF+TQHPW  T+R A+DLEA GIGGK  +FQ GPD W I+ +AKVAK+P
Sbjct  181   TGEEEGLIGAHSFMTQHPWRGTIRAAVDLEASGIGGKHWLFQGGPDAWLIETYAKVAKWP  240

Query  1995  SGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQ  2174
             +  +++QD+F SG++KS+TDFQ+++E+AGL+GLDFA+ +++AVYHTKND + LL+PGSLQ
Sbjct  241   ATMMLAQDIFHSGLVKSATDFQIFREIAGLTGLDFAYMENSAVYHTKNDNLGLLRPGSLQ  300

Query  2175  HLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHK  2354
             H G+N+LPFL + A+SS+L + N T  TG S  +  VVY+DILG YMV Y + FA + H 
Sbjct  301   HSGDNMLPFLREVATSSELASRNMTYPTGFSNMD--VVYWDILGWYMVTYSQGFAKLLHH  358

Query  2355  AViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPF  2534
             ++I   +++ ++++ + G+S+L++   + L+I   W  ++  +++VA ++PS++S+ VPF
Sbjct  359   SIIFQLIILQVSAISLSGISSLVAACLALLTIYFTWCFAIGFALVVAILIPSIASSAVPF  418

Query  2535  VASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECE-  2711
             +ASPWL I L+  PA +GA +G H  ++ L  +L +   E  ++        + V+  E 
Sbjct  419   LASPWLVIPLYCVPATIGALIGHHFGHMLLVWYLCHVDEEENKA----QSKSDQVASVEG  474

Query  2712  ----------LEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLE--  2855
                        EAERW+FKA ++QWLL+L V T+ K GSSYLAL W++ P +AY LLE  
Sbjct  475   LVEKVPQTVFWEAERWLFKAAIMQWLLLLGVATWAKAGSSYLALAWVIGPTMAYGLLEVR  534

Query  2856  -APAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaiv  3032
              +  Q  + L  LT  IG+ +P  +++  F      L   LV F  NPG    W+ + ++
Sbjct  535   LSSRQVLRQLRHLTFWIGVLIPTVLTAFPFFHFPLALTNMLVNFDRNPGGLPVWLGSVMI  594

Query  3033  avliaaivCLTMAYVLPYIHNSGAKSPFVITTC-VLFVVSLGMVAMQMVPAFVDDTARAV  3209
             A L  AI    + Y+LPY+H SG   P+V+     + +++L  V + + PAF  +  R +
Sbjct  595   ACLCTAITVSILVYLLPYVHRSGGL-PYVLGALGAVLLIALTAVTLSIFPAFTAEVGRGI  653

Query  3210  NIVQVVDHTGN---SSVVSHISLFSTTPGNLDVEAEKLG--GFVCGRDKAFDFVTFSVKY  3374
             N+V V+D       S+  S ISL S T G LD EA+  G    +C ++   DFVT+ VKY
Sbjct  654   NVVHVIDTDAKDVESAAKSFISLASVTMGRLDEEAKHTGDLNLLCNQNSTLDFVTYKVKY  713

Query  3375  SCWTE-PTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFEL  3551
              C    P  +  W E+R P+L V  D +   R T++ ++   ++RW L IN+N+I +F+L
Sbjct  714   GCIKPVPLDESLW-EAR-PSLVVVNDEKDPPRVTVVRLNAGEASRWFLAINSNKISEFQL  771

Query  3552  K---DESGV---LVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGS  3713
             +   D S     LV V  +  GVDGWH +++    + P  F LTL W +N + + +++  
Sbjct  772   EALTDSSSAQDPLVPV-TKALGVDGWHHIQYNTDASGPRNFLLTLHWSENDTDENVLK--  828

Query  3714  EGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVDSKPSL  3884
                  LLKLR DV+  TPE+  +LE L  WC  +GKS+SP++LAYL ++ VD    L
Sbjct  829   -----LLKLRTDVDLTTPEVAKMLENLPKWCLSFGKSTSPYSLAYLASLPVDLNKEL  880



>gb|KDO48811.1| hypothetical protein CISIN_1g0024021mg, partial [Citrus sinensis]
Length=706

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/739 (53%), Positives = 502/739 (68%), Gaps = 51/739 (7%)
 Frame = +3

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
             EGAGD SS VAVMLE+AR +S+ A GFKN +VIFLFNTGEEEGLNGAHSFVTQ       
Sbjct  1     EGAGDCSSCVAVMLELARAMSQWAHGFKN-AVIFLFNTGEEEGLNGAHSFVTQ-------  52

Query  1884  RVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
                                AGP PWA++NFA  AKYPSGQV +QDLF+SG I S+TDFQV
Sbjct  53    -------------------AGPHPWAVENFAAAAKYPSGQVTAQDLFASGAITSATDFQV  93

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             YKEVAGLSGLDFA+TD +AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQAASS+ LP  N
Sbjct  94    YKEVAGLSGLDFAYTDKSAVYHTKNDKLDLLKPGSLQHLGENMLAFLLQAASSTSLPKGN  153

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALI  2423
                  GK+  E T VYFDILG YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +
Sbjct  154   AMEKEGKTVHE-TAVYFDILGTYMVLYRQGFANMLHNSVIVQSLLIWTASLVMGGYPAAV  212

Query  2424  SLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQ  2603
             SL  + LS +LM + SVS +V++A++LP +SS+PVP+VA+PWLA+GLFAAPA LGA  GQ
Sbjct  213   SLALTCLSAILMLVFSVSFAVVIAFILPQISSSPVPYVANPWLAVGLFAAPAFLGALTGQ  272

Query  2604  HVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTY  2783
             H+ Y+ L  +L+  FS+R +     VQ D      +LEAERW+FKAG LQWL++LA+G +
Sbjct  273   HLGYIILKAYLANMFSKRMQ-LSPIVQAD----LIKLEAERWLFKAGFLQWLILLALGNF  327

Query  2784  LKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLV  2954
              KIGS+++AL WLV PA AY  LEA   P +  +PL   T L+GL VP+ +S+G F+ L 
Sbjct  328   YKIGSTFIALFWLVPPAFAYGFLEATLTPVRFPRPLKLATLLLGLAVPVLVSAGNFIRLA  387

Query  2955  NTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCV  3134
             N ++  +VRF  NPG   +W+   I+AV IA ++CLT+ Y+L Y+H SGAK P  I +CV
Sbjct  388   NVIVAIVVRFDRNPGGTPEWLGNVILAVFIAVVLCLTLVYLLSYVHLSGAKRPIAIASCV  447

Query  3135  LFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVE  3302
             LFV+SL +V    VP F +DTARAVN+V VVD +    G     S I+L+STTPG L  E
Sbjct  448   LFVLSLILVLSGTVPPFSEDTARAVNVVHVVDASGKFGGKQEPSSFIALYSTTPGKLTKE  507

Query  3303  AEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR------DMEGD  3461
              E++  GFVCGRD   DFVT S++Y C T    + GW +S +P + V        D +G+
Sbjct  508   VEQIKEGFVCGRDNVVDFVTLSMEYGCLTYDGTEGGWSQSDVPTIHVESEGFGIMDTKGN  567

Query  3462  T--RATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGG  3635
                R T + ID   S RWSL I+  EI+DF  K+ S  LV    EK+G+DGWH+++F+GG
Sbjct  568   DNGRITKVSIDMKGSVRWSLAIDAEEIEDFTFKEGSEELVP-RDEKSGMDGWHIIQFSGG  626

Query  3636  KNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQ  3812
             KN+ ++F+L L W KNS+         E +  LLKLR D +  TP+   VL KL +WCS 
Sbjct  627   KNAVSKFDLDLYWAKNSTESYHNANRKEKQRPLLKLRTDFDRLTPKTERVLSKLPAWCSL  686

Query  3813  YGKSSSPFTLAYLDAISVD  3869
             +GKS+SP TL++L+++ V+
Sbjct  687   FGKSTSPQTLSFLNSLPVN  705



>ref|XP_002962285.1| hypothetical protein SELMODRAFT_77473 [Selaginella moellendorffii]
 gb|EFJ37545.1| hypothetical protein SELMODRAFT_77473 [Selaginella moellendorffii]
Length=848

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/875 (45%), Positives = 552/875 (63%), Gaps = 49/875 (6%)
 Frame = +3

Query  1287  VFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAE  1466
             V Y Q   LP PL AEEAG+ GFSE  AM H+K L+  GP P+GS  LD AL+Y+++V E
Sbjct  8     VHYVQSIRLPRPLLAEEAGKLGFSEERAMGHLKVLTSFGPKPVGSENLDHALEYIVRVLE  67

Query  1467  GIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREG  1646
              IK +A   V +++E F A  G N L GGL+ GKT  Y+DL HV++RLS K + D     
Sbjct  68    SIKSKANSRVFMEIERFRAKPGRNRLQGGLFKGKTLAYADLSHVLVRLSSKHSDDA----  123

Query  1647  EDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEE  1826
               E++AILVS+HVDTVF + G GD  S V+ MLE+ R LS  A GFK+ SV+FLFN GEE
Sbjct  124   --EDNAILVSSHVDTVFTSSGGGDCGSCVSSMLELVRALSNIAQGFKH-SVVFLFNAGEE  180

Query  1827  EGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQV  2006
             EGL+GAHSF+TQH W +++R  IDLEAMG GGKS +FQAGPD W +  FA+ A+ PS  +
Sbjct  181   EGLDGAHSFITQHHWNSSIRAFIDLEAMGAGGKSKLFQAGPDKWLVDVFAQTARRPSANI  240

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             V+QD+F +G+IKS+TDFQVY+E+AGLSGLDFA+ ++ AVYHT+ND   L++ GSLQHLG+
Sbjct  241   VAQDVFQAGLIKSATDFQVYREIAGLSGLDFAYVENGAVYHTQNDAFKLVRAGSLQHLGD  300

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAVii  2366
             N+LPFL++ ASS +L      L T +S   + +VYFD+LG+YMV + R FA + + +V+I
Sbjct  301   NILPFLVEVASSPEL----AHLGTSQSSKLE-MVYFDVLGQYMVTFTRDFAKLLYSSVLI  355

Query  2367  lsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASP  2546
              SLL+ + S+      +L +L+ +A  ++L WI S+S +V VA +LP + +  VP++A P
Sbjct  356   QSLLLFVGSMIRADQFSLPALLLAAFGVILFWIFSLSSAVAVAALLPRLCTYSVPYLAHP  415

Query  2547  WlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAER  2726
              LA+GLF APA+ G  +G  + Y  L  +L              V+   + +    E E+
Sbjct  416   ILAVGLFGAPAVFGGVIGHTLGYKLLRSYL--------------VRSIPNSASVTAETEK  461

Query  2727  WMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEAPA---QSTKPLDPLTS  2897
             +MFKA  L WLLV  +G +   GSSY+A+ WLV P++AY L E+     Q+ + L   T 
Sbjct  462   FMFKAVFLMWLLVFGLGVWANAGSSYIAMAWLVIPSIAYGLKESSLSKHQAPRQLSSWTL  521

Query  2898  LIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYV  3077
             L+GL VP+ ++S +F+ L N LI  LVRF  +PG    W+  A++AV+I+AI+CL+++Y+
Sbjct  522   LLGLPVPIVLTSDIFLSLPNVLISNLVRFDRHPGGGPPWVGNAVIAVMISAILCLSLSYL  581

Query  3078  LPYIH-----NSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGN  3242
             +PYIH      SGA     ++T  +F+VSL +V+ ++VPAF  D AR   +V V++   +
Sbjct  582   MPYIHRDPFVRSGAGVWISLSTIFIFLVSLSVVSYELVPAFTKDVARGTYVVHVIEANMD  641

Query  3243  S-SVVSHISLFSTTPGNLDVEAEKLG--GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWK  3413
               S  S+IS+  TTPG L  E + L   GF CG  +  DFVTF V+  C           
Sbjct  642   KLSSESYISVSFTTPGGLGKEVQSLAESGFTCGGTERPDFVTFGVRKGCEKPSDLDEDLW  701

Query  3414  ESRIPALRVGRDME-GDTRATLIHIDTAYSTRWSLGINTNEIKDFE---LKDESGVLVSV  3581
             + R P L +  D   GD R T + + T  S RWSL I+T+ I+      + DE+ +LV  
Sbjct  702   QGR-PNLTILSDHTVGDQRTTSVLLKTMSSNRWSLSIDTDRIQALHVDIITDETEMLVP-  759

Query  3582  GGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGENLLLKLRADVNTK  3761
               +  G+DG HVL+FA GKN P  FN+ L W K  S     E S  E  LLKLR D+N  
Sbjct  760   KDDIAGIDGVHVLQFASGKNGPHVFNIELVWQKGISA----EKSSKE--LLKLRTDLNVL  813

Query  3762  TPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
             TP+    L+ L  +C+ +GKS+SP+TLAYL  +S+
Sbjct  814   TPDAAKTLKLLPDFCTLFGKSTSPYTLAYLSRLSL  848



>ref|XP_002965202.1| hypothetical protein SELMODRAFT_83186 [Selaginella moellendorffii]
 gb|EFJ34040.1| hypothetical protein SELMODRAFT_83186 [Selaginella moellendorffii]
Length=848

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/875 (45%), Positives = 555/875 (63%), Gaps = 49/875 (6%)
 Frame = +3

Query  1287  VFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAE  1466
             V Y Q   LP PL AEEAG+ GFSE  AM H+K L+  GP P+GS  LD AL+Y+++V E
Sbjct  8     VHYVQSIQLPRPLPAEEAGKLGFSEERAMGHLKVLTSFGPKPVGSENLDHALEYIVRVLE  67

Query  1467  GIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREG  1646
              IK +A   V +++E F A  G N L GGL+ GKT  Y+DL HV++RLS K + D     
Sbjct  68    FIKSKANSRVFMEIERFRAKPGRNRLQGGLFKGKTLAYADLSHVLVRLSSKHSDDA----  123

Query  1647  EDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEE  1826
               E++AILVS+HVDTVF + G GD  S V+ MLE+ R LS  A GFK+ SV+FLFN GEE
Sbjct  124   --EDNAILVSSHVDTVFTSSGGGDCGSCVSSMLELVRALSNIAQGFKH-SVVFLFNAGEE  180

Query  1827  EGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQV  2006
             EGL+GAHSF+TQH W +++R  IDLEAMG GGKS +FQAGPD W +  FA+ A+ PS  +
Sbjct  181   EGLDGAHSFITQHHWNSSIRAFIDLEAMGAGGKSKLFQAGPDKWLVDVFAQTARRPSANI  240

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             V+QD+F +G+IKS+TDFQVY+E+AGLSGLDFA+ ++ AVYHT+ND + L++ GSLQHLG+
Sbjct  241   VAQDVFQAGLIKSATDFQVYREIAGLSGLDFAYVENGAVYHTQNDALKLVRAGSLQHLGD  300

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAVii  2366
             N+LPFL++ ASS +L      L T +S   + +VYFD+LG+YMV + R FA + + +V+I
Sbjct  301   NILPFLVEVASSPEL----AHLGTSQSSKLE-MVYFDVLGQYMVTFTRDFAKLLYSSVLI  355

Query  2367  lsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASP  2546
              SLL+ + S+      +L +L+ +A  ++L WI S+S +V VA +LP + +  VP++A P
Sbjct  356   QSLLLFVGSMIRADQFSLPALLLAAFGVILSWIFSLSSAVAVAALLPRLCTYSVPYLAHP  415

Query  2547  WlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAER  2726
              LA+GLF APA+ G  +G  + Y  L  +L              V+   + +    E E+
Sbjct  416   ILAVGLFGAPAVFGGVIGHTLGYKLLRSYL--------------VRSMPNSASVTAETEK  461

Query  2727  WMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLE---APAQSTKPLDPLTS  2897
             +MFKA  L WLLV  +G +   GSSY+A+ WLV P++AY L E   +  Q+ + L   T 
Sbjct  462   FMFKAVFLMWLLVFGLGVWANAGSSYIAMAWLVIPSIAYGLKESSLSKNQAPRQLSSWTL  521

Query  2898  LIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYV  3077
             L+GL VP+ ++S +F+ L N LI  LVRF  +PG  + W+  A++AVLI+AI+CL+++Y+
Sbjct  522   LLGLPVPIVLTSDIFLSLPNVLISNLVRFDRHPGGGSPWVGNAVIAVLISAILCLSLSYL  581

Query  3078  LPYIH-----NSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGN  3242
             +PYIH      SGA     ++T  +F+VSL +V+ ++VPAF  D A+   +V V++   +
Sbjct  582   MPYIHRDPFVRSGAGVWISLSTIFIFLVSLSVVSYELVPAFTKDVAKGTYVVHVIEANMD  641

Query  3243  S-SVVSHISLFSTTPGNLDVEAEKLG--GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWK  3413
               S  S+IS+  TTPG L  E + L   GF CG  +  DFVTF V+  C           
Sbjct  642   KLSSESYISVSFTTPGGLGKEVQSLAESGFTCGGTERPDFVTFGVRKGCEKPSDLDEDLW  701

Query  3414  ESRIPALRVGRDME-GDTRATLIHIDTAYSTRWSLGINTNEIKDFE---LKDESGVLVSV  3581
             + R P L +  D   GD R T + + T  S RWSL I+T+ I+  +   + +E+ +LV  
Sbjct  702   QGR-PNLTILSDHTVGDQRTTSVLLKTMSSNRWSLSIDTDRIQALQVDIITEETEMLVP-  759

Query  3582  GGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGENLLLKLRADVNTK  3761
               +  G+DG HVL+FA GKN P  FN+ L W K  S     E S  E  LLKLR D+N  
Sbjct  760   KDDIAGIDGVHVLQFASGKNGPHVFNIELVWQKGISA----ETSSKE--LLKLRTDLNVL  813

Query  3762  TPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
             TP+    L+ L  +C+ +GKS+SP+TLAYL  +S+
Sbjct  814   TPDAAKTLKLLPDFCTLFGKSTSPYTLAYLSRLSL  848



>gb|KDO48812.1| hypothetical protein CISIN_1g0024021mg [Citrus sinensis]
Length=682

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/687 (54%), Positives = 480/687 (70%), Gaps = 24/687 (3%)
 Frame = +3

Query  1860  QHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVI  2039
             QHPW  T+RVAIDLEAMGIGGKSG+FQAGP PWA++NFA  AKYPSGQV +QDLF+SG I
Sbjct  2     QHPWSTTIRVAIDLEAMGIGGKSGLFQAGPHPWAVENFAAAAKYPSGQVTAQDLFASGAI  61

Query  2040  KSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAAS  2219
              S+TDFQVYKEVAGLSGLDFA+TD +AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQAAS
Sbjct  62    TSATDFQVYKEVAGLSGLDFAYTDKSAVYHTKNDKLDLLKPGSLQHLGENMLAFLLQAAS  121

Query  2220  SSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslY  2399
             S+ LP  N     GK+  E T VYFDILG YMV+Y + FA+M H +VI+ SLLI  ASL 
Sbjct  122   STSLPKGNAMEKEGKTVHE-TAVYFDILGTYMVLYRQGFANMLHNSVIVQSLLIWTASLV  180

Query  2400  MGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapa  2579
             MGG  A +SL  + LS +LM + SVS +V++A++LP +SS+PVP+VA+PWLA+GLFAAPA
Sbjct  181   MGGYPAAVSLALTCLSAILMLVFSVSFAVVIAFILPQISSSPVPYVANPWLAVGLFAAPA  240

Query  2580  llgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWL  2759
              LGA  GQH+ Y+ L  +L+  FS+R +     VQ D      +LEAERW+FKAG LQWL
Sbjct  241   FLGALTGQHLGYIILKAYLANMFSKRMQ-LSPIVQAD----LIKLEAERWLFKAGFLQWL  295

Query  2760  LVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAIS  2930
             ++LA+G + KIGS+++AL WLV PA AY  LEA   P +  +PL   T L+GL VP+ +S
Sbjct  296   ILLALGNFYKIGSTFIALFWLVPPAFAYGFLEATLTPVRFPRPLKLATLLLGLAVPVLVS  355

Query  2931  SGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKS  3110
             +G F+ L N ++  +VRF  NPG   +W+   I+AV IA ++CLT+ Y+L Y+H SGAK 
Sbjct  356   AGNFIRLANVIVAIVVRFDRNPGGTPEWLGNVILAVFIAVVLCLTLVYLLSYVHLSGAKR  415

Query  3111  PFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFST  3278
             P  I +CVLFV+SL +V    VP F +DTARAVN+V VVD +    G     S I+L+ST
Sbjct  416   PIAIASCVLFVLSLILVLSGTVPPFSEDTARAVNVVHVVDASGKFGGKQEPSSFIALYST  475

Query  3279  TPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR---  3446
             TPG L  E E++  GFVCGRD   DFVT S++Y C T    + GW +S +P + V     
Sbjct  476   TPGKLTKEVEQIKEGFVCGRDNVVDFVTLSMEYGCLTYDGTEGGWSQSDVPTIHVESEGF  535

Query  3447  ---DMEGDT--RATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGW  3611
                D +G+   R T + ID   S RWSL I+  EI+DF  K+ S  LV    EK+G+DGW
Sbjct  536   GIMDTKGNDNGRITKVSIDMKGSVRWSLAIDAEEIEDFTFKEGSEELVP-RDEKSGMDGW  594

Query  3612  HVLRFAGGKNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLE  3788
             H+++F+GGKN+ ++F+L L W KNS+         E +  LLKLR D +  TP+   VL 
Sbjct  595   HIIQFSGGKNAVSKFDLDLYWAKNSTESYHNANRKEKQRPLLKLRTDFDRLTPKTERVLS  654

Query  3789  KLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             KL +WCS +GKS+SP TL++L+++ V+
Sbjct  655   KLPAWCSLFGKSTSPQTLSFLNSLPVN  681



>ref|XP_004166768.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like, partial 
[Cucumis sativus]
Length=637

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/647 (56%), Positives = 453/647 (70%), Gaps = 20/647 (3%)
 Frame = +3

Query  1953  PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHT  2132
             PWA++ FA VAKYPS Q+VS+DLF+SG IKS TDFQ+Y+E+AGLSGLDFA+ D+TAVYHT
Sbjct  2     PWAVETFASVAKYPSAQIVSEDLFTSGAIKSGTDFQIYRELAGLSGLDFAYADNTAVYHT  61

Query  2133  KNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRY  2312
             KNDK  LLKPGSLQHLGEN+L FLL AA S   P  ++ +   +  D+D  VYFDILG Y
Sbjct  62    KNDKFELLKPGSLQHLGENMLAFLLHAAPS---PKLSENVIKSQHSDQDKAVYFDILGTY  118

Query  2313  MVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlv  2492
             M+VY + FA + H +VII SL+I I SL MGG  A +SL  S LS+VLMWI S+S S  V
Sbjct  119   MIVYRQRFATLLHNSVIIQSLMIWITSLVMGGFPAAVSLALSCLSLVLMWIFSLSFSASV  178

Query  2493  ayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFI  2672
             A++LP +SS+PVP+VASPWLA+GLF APA LGA  GQ+V +L LH +LS  +S+R++  +
Sbjct  179   AFILPVISSSPVPYVASPWLAVGLFVAPAFLGALAGQYVGFLILHTYLSNVYSKREQ--L  236

Query  2673  LFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLL  2852
             L     E +    LEAERW+FKAG  QWL+ L +G Y KIGSSYLALVWLVSPA AY LL
Sbjct  237   LPATRAELI---RLEAERWLFKAGSFQWLIFLIIGNYYKIGSSYLALVWLVSPAFAYGLL  293

Query  2853  EA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPT  3023
             EA   PA+  KPL   T LIGLTVPL +S+G  + L ++LIG  VRF  NPG   DW+ +
Sbjct  294   EATLTPARFPKPLKLATLLIGLTVPLLVSAGTIIRLASSLIGSAVRFDRNPGSTPDWLGS  353

Query  3024  aivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTAR  3203
              IVAV +A I+CLT  Y+L Y+H S AK   +  TC+LF  SL  VA  +VP F D TAR
Sbjct  354   VIVAVFVAIILCLTSVYLLSYLHLSDAKRSIIFATCILFGFSLAAVASGIVPPFTDLTAR  413

Query  3204  AVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSV  3368
              VN+V V+D T    G    VS++SLFSTTPG L  E E +  GF CGRDK  D+VTFSV
Sbjct  414   TVNVVHVIDTTTEYGGERDPVSYVSLFSTTPGKLTREIEHINEGFTCGRDKPIDYVTFSV  473

Query  3369  KYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFE  3548
              Y CWT    + GW +S IP L V  D+  + R T I IDT  STRWSLGINT+EI+DF+
Sbjct  474   NYGCWTHEDGEDGWDKSDIPLLLVDSDVSNNGRITNILIDTKGSTRWSLGINTDEIEDFK  533

Query  3549  LKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGENL  3728
              K E  ++ +  G K+ VDGWH ++F+GGK++PT F LTL W KNS+  R ++G+     
Sbjct  534   FKGEDELVPT--GNKSSVDGWHTIQFSGGKDAPTSFALTLLWKKNST--RWVKGNTVPPP  589

Query  3729  LLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             LLKLR D N  TP+   V+ KL SWCS +GKS+SP+TLA+L A+ V+
Sbjct  590   LLKLRTDFNRLTPKAERVISKLPSWCSLFGKSTSPYTLAFLTALPVN  636



>gb|KDO48813.1| hypothetical protein CISIN_1g0024021mg [Citrus sinensis]
Length=665

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/671 (53%), Positives = 466/671 (69%), Gaps = 24/671 (4%)
 Frame = +3

Query  1908  MGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLS  2087
             MGIGGKSG+FQAGP PWA++NFA  AKYPSGQV +QDLF+SG I S+TDFQVYKEVAGLS
Sbjct  1     MGIGGKSGLFQAGPHPWAVENFAAAAKYPSGQVTAQDLFASGAITSATDFQVYKEVAGLS  60

Query  2088  GLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
             GLDFA+TD +AVYHTKNDK+ LLKPGSLQHLGEN+L FLLQAASS+ LP  N     GK+
Sbjct  61    GLDFAYTDKSAVYHTKNDKLDLLKPGSLQHLGENMLAFLLQAASSTSLPKGNAMEKEGKT  120

Query  2268  EDEDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALS  2447
               E T VYFDILG YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +SL  + LS
Sbjct  121   VHE-TAVYFDILGTYMVLYRQGFANMLHNSVIVQSLLIWTASLVMGGYPAAVSLALTCLS  179

Query  2448  IVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLH  2627
              +LM + SVS +V++A++LP +SS+PVP+VA+PWLA+GLFAAPA LGA  GQH+ Y+ L 
Sbjct  180   AILMLVFSVSFAVVIAFILPQISSSPVPYVANPWLAVGLFAAPAFLGALTGQHLGYIILK  239

Query  2628  KFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYL  2807
              +L+  FS+R +     VQ D      +LEAERW+FKAG LQWL++LA+G + KIGS+++
Sbjct  240   AYLANMFSKRMQ-LSPIVQAD----LIKLEAERWLFKAGFLQWLILLALGNFYKIGSTFI  294

Query  2808  ALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLV  2978
             AL WLV PA AY  LEA   P +  +PL   T L+GL VP+ +S+G F+ L N ++  +V
Sbjct  295   ALFWLVPPAFAYGFLEATLTPVRFPRPLKLATLLLGLAVPVLVSAGNFIRLANVIVAIVV  354

Query  2979  RFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGM  3158
             RF  NPG   +W+   I+AV IA ++CLT+ Y+L Y+H SGAK P  I +CVLFV+SL +
Sbjct  355   RFDRNPGGTPEWLGNVILAVFIAVVLCLTLVYLLSYVHLSGAKRPIAIASCVLFVLSLIL  414

Query  3159  VAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GF  3323
             V    VP F +DTARAVN+V VVD +    G     S I+L+STTPG L  E E++  GF
Sbjct  415   VLSGTVPPFSEDTARAVNVVHVVDASGKFGGKQEPSSFIALYSTTPGKLTKEVEQIKEGF  474

Query  3324  VCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR------DMEGDT--RATLI  3479
             VCGRD   DFVT S++Y C T    + GW +S +P + V        D +G+   R T +
Sbjct  475   VCGRDNVVDFVTLSMEYGCLTYDGTEGGWSQSDVPTIHVESEGFGIMDTKGNDNGRITKV  534

Query  3480  HIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFN  3659
              ID   S RWSL I+  EI+DF  K+ S  LV    EK+G+DGWH+++F+GGKN+ ++F+
Sbjct  535   SIDMKGSVRWSLAIDAEEIEDFTFKEGSEELVP-RDEKSGMDGWHIIQFSGGKNAVSKFD  593

Query  3660  LTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPF  3836
             L L W KNS+         E +  LLKLR D +  TP+   VL KL +WCS +GKS+SP 
Sbjct  594   LDLYWAKNSTESYHNANRKEKQRPLLKLRTDFDRLTPKTERVLSKLPAWCSLFGKSTSPQ  653

Query  3837  TLAYLDAISVD  3869
             TL++L+++ V+
Sbjct  654   TLSFLNSLPVN  664



>gb|EEE61353.1| hypothetical protein OsJ_15486 [Oryza sativa Japonica Group]
Length=743

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/701 (51%), Positives = 467/701 (67%), Gaps = 32/701 (5%)
 Frame = +3

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+ARG+++ A GFK+  V+FLFNTGEEEGL+GAHSF+TQH W N+VR AIDLEAMGI 
Sbjct  1     MLELARGVAQWAHGFKSG-VLFLFNTGEEEGLDGAHSFITQHRWRNSVRFAIDLEAMGIS  59

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             GKS +FQ G D WA+++FA VAKYPS Q+ SQD+F SG IKS+TDFQ+Y+EV GL GLDF
Sbjct  60    GKSTLFQ-GTDHWALESFASVAKYPSAQIASQDVFQSGAIKSATDFQIYQEVGGLPGLDF  118

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSE--D  2273
             A+TD T+VYHTKNDK+  LKPGSLQH+GEN+L FLL AA+S   P   K     K E  +
Sbjct  119   AYTDRTSVYHTKNDKMKHLKPGSLQHIGENMLAFLLHAAAS---PKFMKDAIQAKQEGAE  175

Query  2274  EDTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIV  2453
             +   V+FDILG+YMVVYP+    MFH ++I  SLLI   SL MGG   L+S   S L IV
Sbjct  176   KTKAVFFDILGKYMVVYPQRLTTMFHNSIIFQSLLIWGTSLLMGGRPGLVSFGISCLGIV  235

Query  2454  LMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKF  2633
             LM I SV+LSV+VA  LP + S PV FVA PWL +GLF +PALLGAF+GQH+ ++ L + 
Sbjct  236   LMLISSVTLSVVVAIALPHICSFPVTFVAHPWLVVGLFGSPALLGAFIGQHIGFIILKRH  295

Query  2634  LSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLAL  2813
             L + +S  K      + +        LEAERW+FK+G +QWL+VL +GTYLK+GSSY+AL
Sbjct  296   LKHVYSITKSGLAHNMLEQ----IVNLEAERWIFKSGFVQWLIVLILGTYLKVGSSYIAL  351

Query  2814  VWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRF  2984
             +WLVSPA AY L+EA   PA+S K L  +T ++ L  P+  S+G+ + +V+ +IG +VR 
Sbjct  352   IWLVSPAFAYGLMEATLSPARSPKQLKVITLVLALAAPVVSSAGLVIRMVDVIIGSIVRI  411

Query  2985  VSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVA  3164
               NPG   DW+   +V+V IA ++C T  Y+L Y+H SGAK       C+ F ++L +V+
Sbjct  412   DRNPGGLPDWLGNVVVSVAIAIVICFTFVYLLSYVHISGAKRTLGFLLCIFFGLALALVS  471

Query  3165  MQMVPAFVDDTARAVNIVQVVDHTGNSSVVSHISLFS-TTPGNLDVEAEKLGG--FVCGR  3335
               ++PAF +D AR+VN     +H        H+ L S  TPG L  E   L    F CGR
Sbjct  472   SGILPAFTEDIARSVN-----NH-------HHMLLCSPITPGKLTKELVDLRDEEFSCGR  519

Query  3336  DKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWS  3512
             ++A DFVTF++KY C +      GW +S +P L +  D +  D R T+I +DT  STRWS
Sbjct  520   NRAIDFVTFTMKYGCLSYEGTNTGWSKSEVPVLSLKSDSVTNDARQTIISVDTKSSTRWS  579

Query  3513  LGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSG  3692
             L IN  EI DF +  +S  LV + G K+ +DGWH ++FAGGK+SPT+F LTL W  NS  
Sbjct  580   LAINKQEIDDFTVHVDSENLVPL-GNKSEIDGWHTIQFAGGKDSPTKFQLTLFWASNSKD  638

Query  3693  KRIME-GSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQ  3812
                 +  SE  + LLKLR DVN  TP++  VLEKL   C +
Sbjct  639   AFPKQVESEDHSFLLKLRTDVNRVTPKVGRVLEKLPGCCGR  679



>ref|XP_003591903.1| Endoplasmic reticulum metallopeptidase [Medicago truncatula]
Length=665

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/641 (55%), Positives = 455/641 (71%), Gaps = 25/641 (4%)
 Frame = +3

Query  1209  IEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKA  1388
             + G  ++RS    + LF  +      ++  QF+ +P PL+A++AG+ GFSE+ A +HVKA
Sbjct  36    VGGGNSKRSSISWLALFFIIAYSCSAIYKYQFQNMPLPLTADQAGKRGFSEIEAFSHVKA  95

Query  1389  LSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGK  1568
             L+++GPHP+GS AL+ ALQYVL   E IK+ A  +V+V+V++FH  SG N L  GL+ G+
Sbjct  96    LTEVGPHPVGSEALNQALQYVLAACETIKKTAHWEVDVEVDLFHVESGTNHLSSGLFVGR  155

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             + VYSDL HVV+R+ PK T+      E  E++ILVS+H+DTVF+ EGAGD SS V VMLE
Sbjct  156   SLVYSDLDHVVVRIMPKYTS------EASEESILVSSHIDTVFSTEGAGDCSSCVGVMLE  209

Query  1749  VARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKS  1928
             +ARG+S+ A G K   VIFLFNTGEEEGLNGAHSF+TQHPW  TV +AIDLEAMGIGGKS
Sbjct  210   LARGISQWAHGLKKG-VIFLFNTGEEEGLNGAHSFITQHPWSKTVCMAIDLEAMGIGGKS  268

Query  1929  GIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFT  2108
              IFQAGP P AI++FA  AKYPSGQ+V+QDLF+ GVIKS+TDFQVYKEVAGLSGLDFA+ 
Sbjct  269   SIFQAGPHPRAIESFASAAKYPSGQIVAQDLFTLGVIKSATDFQVYKEVAGLSGLDFAYV  328

Query  2109  DHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSED--EDT  2282
             D+TAVYHTKNDK+ LL  GSLQHLGEN+L FLL   +SS  P   +  ST   ED     
Sbjct  329   DNTAVYHTKNDKLELLTKGSLQHLGENMLAFLLHIGASSHFP---EDCSTESKEDITNSK  385

Query  2283  VVYFDIL-----GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALS  2447
              +YFDIL     G YMVVY ++ A+M H +VII SLLI + SL MGG+ A  SL  S L 
Sbjct  386   AIYFDILVWLYFGTYMVVYRQNLANMLHNSVIIQSLLIWVTSLAMGGIPAATSLALSCLG  445

Query  2448  IVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLH  2627
             ++LMW+ S+  S+LVA++LP +SS+PVP+V+SPWL +GLF APA+LGA  GQH+ YL   
Sbjct  446   VILMWLFSLGFSLLVAFILPLISSSPVPYVSSPWLVVGLFGAPAILGALTGQHLGYLLFQ  505

Query  2628  KFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYL  2807
             K+L    S+R + F   +Q +      +LEAERW++KAG  QWL++L +G Y KIGSSYL
Sbjct  506   KYLFSVHSKRGQ-FPPIIQAE----LVKLEAERWLYKAGSFQWLILLILGNYFKIGSSYL  560

Query  2808  ALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLV  2978
             ALVWLVSPA A+   EA   PA+  KPL   T ++GL  P+  S+G F+ L  TLIG +V
Sbjct  561   ALVWLVSPAFAFGFFEATLSPARLPKPLKLATLVLGLATPILFSAGNFIRLAATLIGGMV  620

Query  2979  RFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSG  3101
             R   NPG   +W+   ++A  IAA++ LT+ Y+  Y+H SG
Sbjct  621   RLDRNPGGTPEWLGNVVIAGYIAALLSLTLVYLFSYVHLSG  661



>emb|CAN65299.1| hypothetical protein VITISV_008131 [Vitis vinifera]
Length=804

 Score =   567 bits (1462),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 352/732 (48%), Positives = 463/732 (63%), Gaps = 120/732 (16%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS    + LF  ++  +W V Y QF  +P PL A+ AG+ GF EV A+ HV+AL+Q+GP
Sbjct  23    KRSALVWLALFVVIIYFSWAVHYYQFDNMPAPLGADHAGKRGFXEVEAIRHVRALTQVGP  82

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS ALD ALQYVL  AE IK+ A  +V+V V+ FHA SG N +V GL+ GKT +YSD
Sbjct  83    HSIGSDALDDALQYVLAEAEKIKKMAHWEVDVQVDFFHAKSGANRMVSGLFVGKTLIYSD  142

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+++R+ PK  +      E E++AILVS+H+DTVF+ EGAGD SS VAVMLE+ARG+S
Sbjct  143   LYHIILRILPKYAS------EAEDNAILVSSHIDTVFSTEGAGDCSSCVAVMLELARGVS  196

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ--  1940
             + A GFKN +VIFLFNTGEEEGLNGAHSF+TQHPW +T+R+AIDLEAMGIGGKS IFQ  
Sbjct  197   QWAHGFKN-AVIFLFNTGEEEGLNGAHSFITQHPWSSTIRMAIDLEAMGIGGKSSIFQVS  255

Query  1941  -------------------------------------------------AGPDPWAIQNF  1973
                                                              AGP P AI+NF
Sbjct  256   PCVFXLTHXFFDKLNVTSIMCETPSFVKXGFAELRSQSVELLNLMIHLMAGPHPLAIENF  315

Query  1974  AKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVAL  2153
             AK AKYP+GQ+VSQD+FSSGVIKS+TDFQVY+EVAGLSGLDFA+TD++AVYHTKNDK+ L
Sbjct  316   AKAAKYPNGQIVSQDIFSSGVIKSATDFQVYQEVAGLSGLDFAYTDNSAVYHTKNDKLEL  375

Query  2154  LKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRS  2333
             LKPGSLQHLG+N+L FLLQ A S +LP   K +   +    +T ++FDILG YMVVY + 
Sbjct  376   LKPGSLQHLGDNMLAFLLQTAPS-NLPK-GKAMEAEEKTGHETAIFFDILGTYMVVYRQR  433

Query  2334  FADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsv  2513
             FA++ H +VI+ S+LI + SL MGG  A +SL  S LS++LMWI S+S S+ V ++LP +
Sbjct  434   FANLLHNSVIMQSILIWVTSLLMGGYPAAVSLALSCLSVILMWIFSLSFSIPVGFLLPLI  493

Query  2514  ssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDE  2693
             SS+PVPFVA+PWL +GLFAAPA LGA  GQH+ YL LH +LS+  S+R ++    +Q + 
Sbjct  494   SSSPVPFVANPWLVVGLFAAPAFLGALTGQHLGYLILHSYLSHASSKRMQNLPPVIQANV  553

Query  2694  DVSECELEAERWMFKAGLLQWLLVL---------------------------AVGTYLKI  2792
                  + EAERW+FKAG +QW ++L                           A+ T+L  
Sbjct  554   ----IKFEAERWLFKAGFVQWFVLLMVGNYYKIGSSYVALVWLVSPAFACKFAIITFLAW  609

Query  2793  GSSYLALVWL--------------------VSPALAYV------LLEA---PAQSTKPLD  2885
                     WL                    V   + Y        LEA   P +  +PL 
Sbjct  610   AKVRWGARWLEEGLSNERVGVGIEIEIGVRVGTGIDYTSIVTDGFLEATLSPVRLPRPLK  669

Query  2886  PLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLT  3065
              +T L+G+++P+ +S+G+F+ +  TLIG  VRF  NPG   +W+   I+A+ IAA++CLT
Sbjct  670   IVTLLMGISLPILLSAGMFIRMAGTLIGTAVRFDRNPGSTPEWLGNVIIAIYIAAVICLT  729

Query  3066  MAYVLPYIHNSG  3101
             +AY+L Y H SG
Sbjct  730   LAYLLSYFHLSG  741



>ref|XP_001757727.1| predicted protein [Physcomitrella patens]
 gb|EDQ77367.1| predicted protein [Physcomitrella patens]
Length=856

 Score =   563 bits (1452),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 355/894 (40%), Positives = 537/894 (60%), Gaps = 68/894 (8%)
 Frame = +3

Query  1242  EIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGS  1421
             E + +   ++ G WL+F  Q ++LP P+S  +AG  GF+E  A  HV++LS  GPHPL S
Sbjct  10    EWLAMVVILLFGMWLIFRYQMELLPPPVSGNDAGLRGFAEERAYKHVESLSSFGPHPLRS  69

Query  1422  TALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVV  1601
              AL  A+QYVL     +++    +V V+V+ FHA+ GV  L G +  G++ VY  LKHV+
Sbjct  70    KALGHAIQYVLDQVTEVQQTENSEVKVEVDYFHASPGVTQLTG-ICDGESTVYYGLKHVI  128

Query  1602  MRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATG  1781
              RL PK       E    E+AILVS+H+DTV  ++GAGD SS   V              
Sbjct  129   ARLHPK------YEDSALENAILVSSHIDTVITSQGAGDCSSCAQV--------------  168

Query  1782  FKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWA  1961
             FK+ SVIFLFNTGEEEGL GAHSF+TQHPW  T+R A+DLEAMG+GGK  +FQ GPD + 
Sbjct  169   FKH-SVIFLFNTGEEEGLLGAHSFMTQHPWRETIRAAVDLEAMGVGGKHWLFQGGPDAFL  227

Query  1962  IQ-NFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKN  2138
             ++ ++AKVAK+P+  +++QD+F SG++K++TDFQ+++EV GL+GLDFA+ +++AVY TKN
Sbjct  228   VETSYAKVAKWPATIMLAQDIFYSGLVKTTTDFQIFREVGGLTGLDFAYMENSAVYLTKN  287

Query  2139  DKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMV  2318
             DK+ LL+PGSLQH G+N+LPFL + A+S +L + N T  TG S     VVY+DILG YMV
Sbjct  288   DKLKLLRPGSLQHSGDNMLPFLREIATSPELASRNLTYPTGFSNMN--VVYWDILGWYMV  345

Query  2319  VYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvay  2498
              Y + FA + H ++I   +++ +  +Y+ G+  L++   + L+I   W  ++  ++LVA 
Sbjct  346   TYSQDFAKLLHHSIIFQLIVLQVGDIYLSGIPCLVASCLAFLTICFTWCFALGFTLLVAI  405

Query  2499  vlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKR---SF  2669
             ++P++ S+ VPF+A PWLAI L+  PA +GA VG    ++ L  +L +   E+ +   S 
Sbjct  406   LVPTLGSSAVPFLACPWLAIPLYCLPAAIGALVGHRFGHMLLVWYLRHVDEEQHKKTQST  465

Query  2670  ILFVQDDEDVS-----ECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPA  2834
             +  V  +++++         EA+RW+FKAG++Q +LVL + T+ K GSSYLAL W+V   
Sbjct  466   LEQVVPEKNLAINAPYTVLCEAQRWLFKAGIMQRVLVLVLATWAKAGSSYLALAWVV---  522

Query  2835  LAYVLLEAPAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADW  3014
                        + + L  LT  +G+  P A+++     L    I  +V F  +PG+   W
Sbjct  523   -----------ALRKLRYLTFRLGVVAPAALTALSAFQLPLVFINMVVNFDRDPGDLPVW  571

Query  3015  IPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDD  3194
             + + ++A + AAI  L +  +LPY+H SG  +  +     + +++L  VA+ + PAF  D
Sbjct  572   VGSVMIACICAAITTLMLVCLLPYVHRSGRLAYVLGVLGAILLLALASVAISIFPAFTPD  631

Query  3195  TARAVNIVQVVD----HTGNSSVVSHISLFSTTPGNLDVEAEKLG--GFVCGRDKAFDFV  3356
               R +N+V V+D    ++G +S  S +SL S T G+LD EA+ +G    VC R+   DFV
Sbjct  632   VGRGINVVHVIDADGQNSGRNSTNSFLSLASVTMGSLDPEAKHMGDADLVCNRNNTIDFV  691

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             T  VKY C           E R P+L V +D +G  R T + +    + RW L +N+N++
Sbjct  692   THKVKYGCQKPILLDESLWEDR-PSLVVIKDEDGPPRVTTVRLSAGKACRWFLTVNSNKV  750

Query  3537  KDFEL------KDESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKR  3698
               F+L      K    VLV    + +GV GWH++++ G    P+ F L L W +N++   
Sbjct  751   AKFQLEVTIDSKSPQQVLVPT-TKTSGVVGWHLIQYNGDPAGPSNFLLILHWFQNATD--  807

Query  3699  IMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
               + S+    LLKLR DV+  TPE   +L++L  WC  +G  SSP+ LAYL ++
Sbjct  808   -FDASK----LLKLRTDVDLTTPEAAKMLDELPKWCFGFGMPSSPYLLAYLASM  856



>gb|KDO44700.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
Length=545

 Score =   538 bits (1386),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 318/555 (57%), Positives = 411/555 (74%), Gaps = 16/555 (3%)
 Frame = +3

Query  1446  YVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKST  1625
             YVL  ++ IKE    + +V+V+ FHA SG N +  G++ GKT +YSDL H+V+R+ PK  
Sbjct  1     YVLAASQKIKESKHWEADVEVDFFHAKSGANRVGTGVFKGKTLIYSDLNHIVLRILPKYA  60

Query  1626  ADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIF  1805
             +      E  E+AILVS+H+DTV A EGAGD SS VAVMLE+AR +S+ A  FKN +VIF
Sbjct  61    S------EAGENAILVSSHIDTVSAGEGAGDCSSCVAVMLELARVMSQWAHEFKN-AVIF  113

Query  1806  LFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVA  1985
             LFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIGG+S +FQAGP+ WA++NFA VA
Sbjct  114   LFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIGGRSALFQAGPNLWAVENFAAVA  173

Query  1986  KYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPG  2165
             KYPSGQ++ QDLF+SGV +++TDFQVY EVAGLSGLDFA+TD +AVYHTKND++ LLKPG
Sbjct  174   KYPSGQIIGQDLFASGVFETATDFQVYTEVAGLSGLDFAYTDKSAVYHTKNDRLDLLKPG  233

Query  2166  SLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADM  2345
             SLQHLGEN+L FLLQ ASS+ +P  N     GK+  E T VYFDILG+YMV+Y + FA+M
Sbjct  234   SLQHLGENMLDFLLQTASSTSIPKGNAVEEEGKTVHE-TGVYFDILGKYMVLYHQHFANM  292

Query  2346  FHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTP  2525
              H +VI+ SLLI  ASL MGG  A +SL  + LS +LM + S+S SV++A++LP +SS+P
Sbjct  293   LHNSVILQSLLIWTASLVMGGYPAAVSLALTCLSAILMLVLSISFSVVIAFILPQISSSP  352

Query  2526  VPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSE  2705
             VP+VASPWL +GLFAAPA LGA  GQH+ Y+ L  +L+  +S+  +     +      + 
Sbjct  353   VPYVASPWLTVGLFAAPAFLGALTGQHLGYIVLKAYLANQYSKGMQ-----LSPVHQAAL  407

Query  2706  CELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTK  2876
              +LEAERW+FK+G LQWL++LA+G Y KIGS+Y+ALVWLV PA AY  LEA   P + T+
Sbjct  408   VKLEAERWLFKSGFLQWLILLALGNYYKIGSTYMALVWLVPPAFAYGFLEATLTPVRLTR  467

Query  2877  PLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaiv  3056
             PL   T L+GL VP+ +S+G  + L N L+  LVRF  NPG   +W+   I AV+IA + 
Sbjct  468   PLKLATLLLGLAVPVLVSAGNIIRLANVLVATLVRFDRNPGGTPEWLGNVIFAVVIAVVS  527

Query  3057  CLTMAYVLPYIHNSG  3101
             CLT+ Y+L Y+H SG
Sbjct  528   CLTLVYLLSYVHLSG  542



>gb|KDO44702.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
 gb|KDO44703.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
 gb|KDO44704.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
 gb|KDO44705.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
Length=541

 Score =   536 bits (1381),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 317/554 (57%), Positives = 410/554 (74%), Gaps = 16/554 (3%)
 Frame = +3

Query  1446  YVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKST  1625
             YVL  ++ IKE    + +V+V+ FHA SG N +  G++ GKT +YSDL H+V+R+ PK  
Sbjct  1     YVLAASQKIKESKHWEADVEVDFFHAKSGANRVGTGVFKGKTLIYSDLNHIVLRILPKYA  60

Query  1626  ADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIF  1805
             +      E  E+AILVS+H+DTV A EGAGD SS VAVMLE+AR +S+ A  FKN +VIF
Sbjct  61    S------EAGENAILVSSHIDTVSAGEGAGDCSSCVAVMLELARVMSQWAHEFKN-AVIF  113

Query  1806  LFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVA  1985
             LFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIGG+S +FQAGP+ WA++NFA VA
Sbjct  114   LFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIGGRSALFQAGPNLWAVENFAAVA  173

Query  1986  KYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPG  2165
             KYPSGQ++ QDLF+SGV +++TDFQVY EVAGLSGLDFA+TD +AVYHTKND++ LLKPG
Sbjct  174   KYPSGQIIGQDLFASGVFETATDFQVYTEVAGLSGLDFAYTDKSAVYHTKNDRLDLLKPG  233

Query  2166  SLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADM  2345
             SLQHLGEN+L FLLQ ASS+ +P  N     GK+  E T VYFDILG+YMV+Y + FA+M
Sbjct  234   SLQHLGENMLDFLLQTASSTSIPKGNAVEEEGKTVHE-TGVYFDILGKYMVLYHQHFANM  292

Query  2346  FHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTP  2525
              H +VI+ SLLI  ASL MGG  A +SL  + LS +LM + S+S SV++A++LP +SS+P
Sbjct  293   LHNSVILQSLLIWTASLVMGGYPAAVSLALTCLSAILMLVLSISFSVVIAFILPQISSSP  352

Query  2526  VPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSE  2705
             VP+VASPWL +GLFAAPA LGA  GQH+ Y+ L  +L+  +S+  +     +      + 
Sbjct  353   VPYVASPWLTVGLFAAPAFLGALTGQHLGYIVLKAYLANQYSKGMQ-----LSPVHQAAL  407

Query  2706  CELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTK  2876
              +LEAERW+FK+G LQWL++LA+G Y KIGS+Y+ALVWLV PA AY  LEA   P + T+
Sbjct  408   VKLEAERWLFKSGFLQWLILLALGNYYKIGSTYMALVWLVPPAFAYGFLEATLTPVRLTR  467

Query  2877  PLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaiv  3056
             PL   T L+GL VP+ +S+G  + L N L+  LVRF  NPG   +W+   I AV+IA + 
Sbjct  468   PLKLATLLLGLAVPVLVSAGNIIRLANVLVATLVRFDRNPGGTPEWLGNVIFAVVIAVVS  527

Query  3057  CLTMAYVLPYIHNS  3098
             CLT+ Y+L Y+H S
Sbjct  528   CLTLVYLLSYVHLS  541



>gb|EYU39837.1| hypothetical protein MIMGU_mgv1a0009862mg, partial [Erythranthe 
guttata]
Length=393

 Score =   467 bits (1201),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 228/359 (64%), Positives = 287/359 (80%), Gaps = 12/359 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS Y I+ LF  V+ G W V++ QF  LP P+S ++ G+ GFSE  AM HV+AL+QLGP
Sbjct  47    KRSSYAILALFVLVIYGAWGVYHYQFDTLPSPMSLQQVGKRGFSEHEAMKHVQALTQLGP  106

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS +L+ A++YV  V+E IK  A  +V+V+V++FH  SG N LVGGL+ GK+ VYSD
Sbjct  107   HSVGSESLERAIKYVANVSETIKASAHWEVDVEVDLFHVKSGFNGLVGGLFKGKSLVYSD  166

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L HVV+R+SPK  +      E  E+AILVS+H+DTVFA EGAGD SS VAVMLE+ARG+S
Sbjct  167   LNHVVLRISPKYAS------EAGENAILVSSHIDTVFAGEGAGDCSSCVAVMLELARGVS  220

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFKN SVIFLFNTGEEEGLNGAHSF++QHPW +TVRVA+DLEA+GIGGKSGIFQAG
Sbjct  221   QWAHGFKN-SVIFLFNTGEEEGLNGAHSFISQHPWSDTVRVAVDLEAIGIGGKSGIFQAG  279

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVY  2126
             P+PWAI+N+A V+KYPS Q+ +QD+F+SG IKS+TDFQVY+E+AGLSGLDFA+ D+TAVY
Sbjct  280   PNPWAIENYASVSKYPSAQIAAQDVFTSGAIKSATDFQVYQELAGLSGLDFAYADNTAVY  339

Query  2127  HTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
             HTKNDK++LLKPGSLQHLGEN+L FLL A +SS +P  + T S+     ED  +YFDIL
Sbjct  340   HTKNDKLSLLKPGSLQHLGENMLAFLLHAGASSTIPKESDTYSS-----EDKAIYFDIL  393



>gb|EYU39838.1| hypothetical protein MIMGU_mgv1a0009861mg, partial [Erythranthe 
guttata]
Length=529

 Score =   459 bits (1180),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 268/532 (50%), Positives = 355/532 (67%), Gaps = 14/532 (3%)
 Frame = +3

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWI-Gsvsl  2480
             G YM+ + +  A+M + +VI+ SLLI   S+ MGG  A ISL  S LSIVLMWI   V  
Sbjct  1     GMYMITFRQRLANMLYNSVIMQSLLIWTTSVLMGGYPAAISLALSILSIVLMWIFSVVFS  60

Query  2481  svlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERK  2660
                   +    SS+P+PFVASPWL + L+  PAL+GA  GQH+ Y  L  +L+ +F ERK
Sbjct  61    VSAAFVLPLVSSSSPMPFVASPWLVVFLYGGPALIGALTGQHIGYRALESYLARSFVERK  120

Query  2661  RSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALA  2840
             RS     Q     S  +L+AERW++KAGLLQWL++L VG Y ++GSSYLA  WL+SPA A
Sbjct  121   RSLPASWQS----SVAKLDAERWIYKAGLLQWLVLLMVGNYFRVGSSYLAFAWLISPAFA  176

Query  2841  YVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQAD  3011
             Y LLEA   P++  + L  +T L+G  VP  +SSG+ + LV TL G  VR V NPG   D
Sbjct  177   YGLLEATLSPSRLPRQLKTVTLLVGSFVPFVLSSGMVIRLVATLTGTTVRLVRNPGTTPD  236

Query  3012  WIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVD  3191
             W+   ++AV IAA+VCLT  Y+L YIH SGAK P +IT  +LF++SL  V   +VP F +
Sbjct  237   WMGNIVIAVFIAAVVCLTFVYLLSYIHISGAKMPIIITASILFLISLAAVWGGVVPPFTE  296

Query  3192  DTARAVNIVQVVDHTG----NSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFV  3356
             DTARAVN+V VVD T     N    S+ISLFSTTPGNL  EA ++G GFVCG+++  DFV
Sbjct  297   DTARAVNVVHVVDATKTGGENIEPASYISLFSTTPGNLIKEANEIGEGFVCGKNRHLDFV  356

Query  3357  TFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEI  3536
             TF   YSCWT   A+ GW +S IP ++V +D++GD R T I IDT  STRWSLGINT EI
Sbjct  357   TFYANYSCWTNKNAEKGWFKSNIPTIQVDKDLKGDNRETQISIDTKDSTRWSLGINTVEI  416

Query  3537  KDFELKD-ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIMEGS  3713
             +DF+LKD E+   +   GEK+ VDGWH+++F+GG+NSPT+F ++L W  + +  +I +G 
Sbjct  417   EDFQLKDAETNEELIPLGEKSSVDGWHIIQFSGGRNSPTKFKISLFWLNSGTHMKIEDGV  476

Query  3714  EGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             + E  +LKLR DV+  TP +  VL KL  WCS +GKS+SP TLA+L ++ + 
Sbjct  477   KNEGFVLKLRTDVDKLTPPVETVLRKLPEWCSLFGKSTSPHTLAFLSSLPIS  528



>gb|KDO44706.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
Length=449

 Score =   447 bits (1151),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 268/456 (59%), Positives = 344/456 (75%), Gaps = 10/456 (2%)
 Frame = +3

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLE+AR +S+ A  FKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIG
Sbjct  1     MLELARVMSQWAHEFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIG  59

Query  1920  GKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDF  2099
             G+S +FQAGP+ WA++NFA VAKYPSGQ++ QDLF+SGV +++TDFQVY EVAGLSGLDF
Sbjct  60    GRSALFQAGPNLWAVENFAAVAKYPSGQIIGQDLFASGVFETATDFQVYTEVAGLSGLDF  119

Query  2100  AFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDED  2279
             A+TD +AVYHTKND++ LLKPGSLQHLGEN+L FLLQ ASS+ +P  N     GK+  E 
Sbjct  120   AYTDKSAVYHTKNDRLDLLKPGSLQHLGENMLDFLLQTASSTSIPKGNAVEEEGKTVHE-  178

Query  2280  TVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
             T VYFDILG+YMV+Y + FA+M H +VI+ SLLI  ASL MGG  A +SL  + LS +LM
Sbjct  179   TGVYFDILGKYMVLYHQHFANMLHNSVILQSLLIWTASLVMGGYPAAVSLALTCLSAILM  238

Query  2460  WIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLS  2639
              + S+S SV++A++LP +SS+PVP+VASPWL +GLFAAPA LGA  GQH+ Y+ L  +L+
Sbjct  239   LVLSISFSVVIAFILPQISSSPVPYVASPWLTVGLFAAPAFLGALTGQHLGYIVLKAYLA  298

Query  2640  YTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVW  2819
               +S+  +     +      +  +LEAERW+FK+G LQWL++LA+G Y KIGS+Y+ALVW
Sbjct  299   NQYSKGMQ-----LSPVHQAALVKLEAERWLFKSGFLQWLILLALGNYYKIGSTYMALVW  353

Query  2820  LVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVS  2990
             LV PA AY  LEA   P + T+PL   T L+GL VP+ +S+G  + L N L+  LVRF  
Sbjct  354   LVPPAFAYGFLEATLTPVRLTRPLKLATLLLGLAVPVLVSAGNIIRLANVLVATLVRFDR  413

Query  2991  NPGEQADWIPTaivavliaaivCLTMAYVLPYIHNS  3098
             NPG   +W+   I AV+IA + CLT+ Y+L Y+H S
Sbjct  414   NPGGTPEWLGNVIFAVVIAVVSCLTLVYLLSYVHLS  449



>gb|EPS60097.1| hypothetical protein M569_14706, partial [Genlisea aurea]
Length=323

 Score =   434 bits (1116),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/330 (64%), Positives = 264/330 (80%), Gaps = 7/330 (2%)
 Frame = +3

Query  1230  RSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPH  1409
             RS Y I+ LF   + G W V + QF+ LP PLS ++AG+ GFSE  A+ HV+AL+Q+GPH
Sbjct  1     RSSYSILTLFVLAIYGAWSVHHHQFEALPPPLSLQQAGKRGFSEQEALKHVEALTQIGPH  60

Query  1410  PLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDL  1589
             P+ S  L  ALQYV  V++ IK+ A  +V+V+V++FH  SGVN LVGG + G++ VYSDL
Sbjct  61    PVASDELQIALQYVKNVSDYIKQTAHWEVSVEVDLFHVKSGVNRLVGGHFKGRSLVYSDL  120

Query  1590  KHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSK  1769
              H+V+R+ PK ++         ++AI++S+H+DTVF+ EGAGD SS VAVMLE+ARG+S+
Sbjct  121   SHIVLRVQPKYSSGA------GDNAIMISSHIDTVFSTEGAGDCSSCVAVMLELARGVSQ  174

Query  1770  QATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP  1949
              A GFKN +VIFLFNTGEEEGL GAHSF+TQHPW +TVRVA+DLEAMGIGGKS IFQ GP
Sbjct  175   LAHGFKN-AVIFLFNTGEEEGLTGAHSFITQHPWRDTVRVAVDLEAMGIGGKSSIFQTGP  233

Query  1950  DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYH  2129
             DPWAI+ FA VAK+PS Q++S+DLFSSG IKS+TDFQVY+EVAGLSGLDFAFTD++AVYH
Sbjct  234   DPWAIEIFASVAKHPSAQIISEDLFSSGAIKSATDFQVYREVAGLSGLDFAFTDNSAVYH  293

Query  2130  TKNDKVALLKPGSLQHLGENLLPFLLQAAS  2219
             TKNDK+ LLKPGSLQHLGEN+L FL  A +
Sbjct  294   TKNDKLQLLKPGSLQHLGENMLSFLFHAGA  323



>ref|XP_011084329.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Sesamum indicum]
Length=869

 Score =   443 bits (1139),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 286/540 (53%), Positives = 373/540 (69%), Gaps = 15/540 (3%)
 Frame = +3

Query  2277  DTVVYFDILGRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVL  2456
             D    +   G YM+ + +  A+M + +VI+ SLL+   SL MGG SA +SL+ S LS+VL
Sbjct  334   DNTAVYHTKGTYMITFRQRLANMLYNSVILQSLLLWSTSLLMGGYSAALSLLLSCLSLVL  393

Query  2457  MWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFL  2636
             MWI S+S S +VA++LP +SS+PVPF++SPWL +GLF APALLGAF+GQ V ++ L  +L
Sbjct  394   MWIFSISFSSVVAFILPLISSSPVPFISSPWLVVGLFGAPALLGAFLGQLVGFIVLESYL  453

Query  2637  SYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALV  2816
               T  ER+++    +Q     S  +L+AERW++KAGLLQWL++L VG Y +IGS+YLAL 
Sbjct  454   FRTLPERRKNLPANLQS----SVAKLDAERWLYKAGLLQWLVLLMVGNYYRIGSTYLALA  509

Query  2817  WLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFV  2987
             WLV PA AY LLEA   PA+  KPL  LT LIGL VP  +SSG+ + L  T+IG  VRFV
Sbjct  510   WLVCPAFAYGLLEATLSPARLPKPLKTLTLLIGLFVPFLLSSGMVIRLSATIIGTAVRFV  569

Query  2988  SNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAM  3167
               PG   +W+   IVAV IAAIVCLT+ Y+L YIH SGAK   +I T ++FVVS+G V  
Sbjct  570   RYPGTTPEWMGNVIVAVFIAAIVCLTLVYLLSYIHISGAKMSIIIATSIVFVVSVGAVWA  629

Query  3168  QMVPAFVDDTARAVNIVQVVDHTGNS----SVVSHISLFSTTPGNLDVEAEKLG-GFVCG  3332
              + P F +DTARAVN+V VVD T  +      VS+ISLFSTTPGNL  EA+ +G GFVCG
Sbjct  630   GVFPPFTEDTARAVNVVHVVDETRTNGEKLEPVSYISLFSTTPGNLIKEADHIGEGFVCG  689

Query  3333  RDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWS  3512
              D+  DFVTFSV YSC T+  A  GW ES IPA+ V +D++G++R T I IDT  STRWS
Sbjct  690   TDRHLDFVTFSVNYSCSTDKGAATGWLESDIPAIHVDKDVKGESRETQISIDTRASTRWS  749

Query  3513  LGINTNEIKDFELK--DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNS  3686
             L INT EI DF LK  D S  L+ + GEK+ VDGWH ++F+GG+ +PT+FNL+L W KN 
Sbjct  750   LAINTREIDDFRLKDTDSSEELIPL-GEKSSVDGWHTIQFSGGRKAPTKFNLSLFWLKNR  808

Query  3687  SGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
             +          + LLL+LR DV+  TP M  +L+KL  WCSQ+GKS+SP TLA+L ++S+
Sbjct  809   TQTTTGGVKNNDRLLLRLRTDVDRSTPPMKTILQKLPPWCSQFGKSTSPHTLAFLTSLSI  868


 Score =   406 bits (1043),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 248/305 (81%), Gaps = 7/305 (2%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             +A+RS Y I  LF   + G W V++ QF+ LP PL+ ++ G+ GFSE  AM HV+AL++L
Sbjct  45    VAKRSSYVIFTLFVLAIYGAWGVYHYQFESLPVPLTLDQVGKRGFSEHEAMKHVEALTRL  104

Query  1401  GPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
             GPHP+GS  L++AL+YV +  E IK++A  +V+++V++FHA  G N LVGGL+ GKT VY
Sbjct  105   GPHPVGSDTLESALKYVTEAIETIKKKAHWEVDMEVDLFHAKHGANNLVGGLFKGKTLVY  164

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
             SDL HVV+R+ PK  +      E  E+AILVS+H+DTVFAAEGAGD SS VAVMLE+ARG
Sbjct  165   SDLNHVVLRIMPKYAS------EAGENAILVSSHIDTVFAAEGAGDCSSCVAVMLELARG  218

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             +S+ A GFK+ +VIFLFNTGEEEGLNGAHSF+TQHPW +TVR+AIDLEAMGIGGKSGIFQ
Sbjct  219   VSQWAHGFKH-AVIFLFNTGEEEGLNGAHSFITQHPWSDTVRIAIDLEAMGIGGKSGIFQ  277

Query  1941  AGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTA  2120
             AGP PWAI+NFA VAKYPS Q+V+QD+F SG IKS+TDFQVYKE+AGLSGLDFA+ D+TA
Sbjct  278   AGPHPWAIENFALVAKYPSAQIVAQDIFLSGAIKSATDFQVYKELAGLSGLDFAYADNTA  337

Query  2121  VYHTK  2135
             VYHTK
Sbjct  338   VYHTK  342



>ref|XP_010104270.1| Endoplasmic reticulum metallopeptidase 1 [Morus notabilis]
 gb|EXC48064.1| Endoplasmic reticulum metallopeptidase 1 [Morus notabilis]
Length=597

 Score =   420 bits (1079),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 236/456 (52%), Positives = 307/456 (67%), Gaps = 13/456 (3%)
 Frame = +3

Query  2523  PVPFVASPWlaiglfaapallgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVS  2702
             P P+VASPWL  GLFAAP+L+GA  GQ++ YL L  +LS  +S+RK+     +       
Sbjct  147   PTPYVASPWLVFGLFAAPSLVGALTGQYIGYLILRAYLSKVYSKRKQ-----LSPIIQAY  201

Query  2703  ECELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQST  2873
               +LEAERW++KAG +QWL +L +G Y K+GSSYLALVWLV P  AY LLEA   PA+  
Sbjct  202   SVKLEAERWLYKAGSVQWLFLLILGNYYKVGSSYLALVWLVPPTFAYGLLEATLSPARLP  261

Query  2874  KPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaai  3053
             KPL   T LIGL  P+ ISSG F+ LV T+I   VRF  NPG   +W+   IVA+ +A +
Sbjct  262   KPLKLATLLIGLAPPILISSGTFIRLVGTMIATWVRFDRNPGSTPEWLGNVIVAIFVAVV  321

Query  3054  vCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDH  3233
             VCLT+ Y+L Y+H SG K   +++ C++F +S+ +VA  +VP F +D ARAVN+VQVVD 
Sbjct  322   VCLTLVYLLSYVHLSGVKRLIILSACLVFGLSIAVVASGIVPPFTNDIARAVNVVQVVDS  381

Query  3234  TGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGW  3410
             TG     S +S+FSTTPG L  E E++  GF+CGRDK  DFVTFSVKY CW     + GW
Sbjct  382   TGKEDPSSFVSIFSTTPGKLTKEVEQVNEGFICGRDKVVDFVTFSVKYGCWAYNENEDGW  441

Query  3411  KESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKD--ESGVLVSVG  3584
              +S +P L V  D     R T + IDT  STRWSL IN  EI+DF LKD   S  LV V 
Sbjct  442   SKSDVPLLNVDSDTNQHKRITQVSIDTKSSTRWSLAINFEEIEDFALKDAGNSEELVPV-  500

Query  3585  GEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTK  3761
             G K+GV+GWH+++F+GGKN+PT+F+LTL W KNSS     + G+  + LLLKLR D+N  
Sbjct  501   GNKSGVEGWHIIQFSGGKNAPTKFDLTLFWSKNSSRSTDTIHGNGQDRLLLKLRTDLNIV  560

Query  3762  TPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             TP++  VL KL +WCSQ+GKS+SP TLA+L  + V+
Sbjct  561   TPKVERVLSKLPAWCSQFGKSTSPHTLAFLSNLPVN  596


 Score =   207 bits (526),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 114/132 (86%), Gaps = 5/132 (4%)
 Frame = +3

Query  1887  VAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVY  2066
             +AIDLEAMGIGGKS IFQAGP+PWAI+NFA VAKYPSGQ+++QDLFSSG +KS+TDFQVY
Sbjct  1     MAIDLEAMGIGGKSSIFQAGPNPWAIENFAMVAKYPSGQIIAQDLFSSGAVKSATDFQVY  60

Query  2067  KEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNK  2246
             KEVAGLSGLDFA+TD+TAVYHTKNDK  LLKPGSLQHLGEN+L FLLQ A SS LP    
Sbjct  61    KEVAGLSGLDFAYTDNTAVYHTKNDKFELLKPGSLQHLGENMLAFLLQTARSSHLPK---  117

Query  2247  TLSTGKSEDEDT  2282
               S+   E+E+T
Sbjct  118   --SSAVEEEENT  127



>gb|KDO44701.1| hypothetical protein CISIN_1g0024293mg, partial [Citrus sinensis]
Length=480

 Score =   402 bits (1034),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 262/338 (78%), Gaps = 8/338 (2%)
 Frame = +3

Query  1446  YVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKST  1625
             YVL  ++ IKE    + +V+V+ FHA SG N +  G++ GKT +YSDL H+V+R+ PK  
Sbjct  1     YVLAASQKIKESKHWEADVEVDFFHAKSGANRVGTGVFKGKTLIYSDLNHIVLRILPKYA  60

Query  1626  ADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIF  1805
             +      E  E+AILVS+H+DTV A EGAGD SS VAVMLE+AR +S+ A  FKN +VIF
Sbjct  61    S------EAGENAILVSSHIDTVSAGEGAGDCSSCVAVMLELARVMSQWAHEFKN-AVIF  113

Query  1806  LFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDPWAIQNFAKVA  1985
             LFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIGG+S +FQAGP+ WA++NFA VA
Sbjct  114   LFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIGGRSALFQAGPNLWAVENFAAVA  173

Query  1986  KYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPG  2165
             KYPSGQ++ QDLF+SGV +++TDFQVY EVAGLSGLDFA+TD +AVYHTKND++ LLKPG
Sbjct  174   KYPSGQIIGQDLFASGVFETATDFQVYTEVAGLSGLDFAYTDKSAVYHTKNDRLDLLKPG  233

Query  2166  SLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADM  2345
             SLQHLGEN+L FLLQ ASS+ +P  N     GK+  E T VYFDILG+YMV+Y + FA+M
Sbjct  234   SLQHLGENMLDFLLQTASSTSIPKGNAVEEEGKTVHE-TGVYFDILGKYMVLYHQHFANM  292

Query  2346  FHKAViilsllisiaslYMGGLSALISLVFSALSIVLM  2459
              H +VI+ SLLI  ASL MGG  A +SL  + LS +LM
Sbjct  293   LHNSVILQSLLIWTASLVMGGYPAAVSLALTCLSAILM  330


 Score =   124 bits (312),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +3

Query  2709  ELEAERWMFKAGLLQWLLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKP  2879
             +LEAERW+FK+G LQWL++LA+G Y KIGS+Y+ALVWLV PA AY  LEA   P + T+P
Sbjct  348   KLEAERWLFKSGFLQWLILLALGNYYKIGSTYMALVWLVPPAFAYGFLEATLTPVRLTRP  407

Query  2880  LDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivC  3059
             L   T L+GL VP+ +S+G  + L N L+  LVRF  NPG   +W+   I AV+IA + C
Sbjct  408   LKLATLLLGLAVPVLVSAGNIIRLANVLVATLVRFDRNPGGTPEWLGNVIFAVVIAVVSC  467

Query  3060  LTMAYVLPYIHNS  3098
             LT+ Y+L Y+H S
Sbjct  468   LTLVYLLSYVHLS  480



>ref|XP_006436428.1| hypothetical protein CICLE_v10030885mg [Citrus clementina]
 gb|ESR49668.1| hypothetical protein CICLE_v10030885mg [Citrus clementina]
Length=578

 Score =   384 bits (986),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 241/310 (78%), Gaps = 7/310 (2%)
 Frame = +3

Query  1206  TIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVK  1385
             +I  + A+RSG    V F  ++C ++ V+Y Q++ +P PL+AE+AG  GFSE+ AM HVK
Sbjct  35    SIHVSSAKRSGLVWTVAFATLICASYGVYYYQYEHMPPPLTAEQAGRRGFSELEAMKHVK  94

Query  1386  ALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFG  1565
             AL+QLGPH +GS ALD ALQYVL  ++ IKE    + +V+V+ FHA SG N +  G++ G
Sbjct  95    ALTQLGPHAVGSDALDRALQYVLAASQKIKESKHWEADVEVDFFHAKSGANRVGTGVFKG  154

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
             KT +YSDL H+V+R+ PK  +      E  E+AILVS+H+DTV A EGAGD SS VAVML
Sbjct  155   KTLIYSDLNHIVLRILPKYAS------EAGENAILVSSHIDTVSAGEGAGDCSSCVAVML  208

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+AR +S+ A  FKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIGG+
Sbjct  209   ELARVMSQWAHEFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIGGR  267

Query  1926  SGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
             S +FQAGP+ WA++NFA VAKYPSGQ++ QDLF+SGV  ++TDFQVY EVAGLSGLDFA+
Sbjct  268   SALFQAGPNLWAVENFAAVAKYPSGQIIGQDLFASGVFGTATDFQVYTEVAGLSGLDFAY  327

Query  2106  TDHTAVYHTK  2135
             TD +AVYHTK
Sbjct  328   TDKSAVYHTK  337


 Score =   158 bits (400),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 135/238 (57%), Gaps = 11/238 (5%)
 Frame = +3

Query  2871  TKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaa  3050
             TK ++   S      P  +      M  N ++  LVRF  NPG   +W+   I AV+IA 
Sbjct  336   TKAIEACDSAFIYYAPFYLHPSWLNMHYN-MVQSLVRFDRNPGGTPEWLGNVIFAVVIAV  394

Query  3051  ivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVD  3230
             + CLT+ Y+L Y+H SGAK P    + +L  +S+ MV+  ++P F ++TARAVNIV +VD
Sbjct  395   VSCLTLVYLLSYVHLSGAKGPIAFASFILVGLSIIMVSSGIIPPFSEETARAVNIVHIVD  454

Query  3231  HT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPT  3395
              +    G     S+I+L+S TPG L  E E++  GFVCGRD   DFVT S+KY C T+  
Sbjct  455   ASGKFGGKQEPSSYIALYSATPGKLTKEVEQIKEGFVCGRDNVIDFVTSSMKYGCLTDDN  514

Query  3396  AKLGWKESRIPALRVGR---DMEG--DTRATLIHIDTAYSTRWSLGINTNEIKDFELK  3554
             ++ GW +S IP + V     D EG  + R T + ID   + R +L IN  EI+DF  K
Sbjct  515   SEGGWSQSDIPTIHVNSDTVDTEGNENERITQVSIDMKGAKRLTLAINAKEIEDFTFK  572



>ref|XP_006436429.1| hypothetical protein CICLE_v10030885mg [Citrus clementina]
 gb|ESR49669.1| hypothetical protein CICLE_v10030885mg [Citrus clementina]
Length=678

 Score =   384 bits (986),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 241/310 (78%), Gaps = 7/310 (2%)
 Frame = +3

Query  1206  TIEGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVK  1385
             +I  + A+RSG    V F  ++C ++ V+Y Q++ +P PL+AE+AG  GFSE+ AM HVK
Sbjct  35    SIHVSSAKRSGLVWTVAFATLICASYGVYYYQYEHMPPPLTAEQAGRRGFSELEAMKHVK  94

Query  1386  ALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFG  1565
             AL+QLGPH +GS ALD ALQYVL  ++ IKE    + +V+V+ FHA SG N +  G++ G
Sbjct  95    ALTQLGPHAVGSDALDRALQYVLAASQKIKESKHWEADVEVDFFHAKSGANRVGTGVFKG  154

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
             KT +YSDL H+V+R+ PK  +      E  E+AILVS+H+DTV A EGAGD SS VAVML
Sbjct  155   KTLIYSDLNHIVLRILPKYAS------EAGENAILVSSHIDTVSAGEGAGDCSSCVAVML  208

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+AR +S+ A  FKN +VIFLFNTGEEEGLNGAHSFVTQHPW  T+RVA+DLEAMGIGG+
Sbjct  209   ELARVMSQWAHEFKN-AVIFLFNTGEEEGLNGAHSFVTQHPWSTTIRVAVDLEAMGIGGR  267

Query  1926  SGIFQAGPDPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
             S +FQAGP+ WA++NFA VAKYPSGQ++ QDLF+SGV  ++TDFQVY EVAGLSGLDFA+
Sbjct  268   SALFQAGPNLWAVENFAAVAKYPSGQIIGQDLFASGVFGTATDFQVYTEVAGLSGLDFAY  327

Query  2106  TDHTAVYHTK  2135
             TD +AVYHTK
Sbjct  328   TDKSAVYHTK  337


 Score =   223 bits (567),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 196/344 (57%), Gaps = 13/344 (4%)
 Frame = +3

Query  2871  TKPLDPLTSLIGLTVPLAISSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaa  3050
             TK ++   S      P  +      M  N ++  LVRF  NPG   +W+   I AV+IA 
Sbjct  336   TKAIEACDSAFIYYAPFYLHPSWLNMHYN-MVQSLVRFDRNPGGTPEWLGNVIFAVVIAV  394

Query  3051  ivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVD  3230
             + CLT+ Y+L Y+H SGAK P    + +L  +S+ MV+  ++P F ++TARAVNIV +VD
Sbjct  395   VSCLTLVYLLSYVHLSGAKGPIAFASFILVGLSIIMVSSGIIPPFSEETARAVNIVHIVD  454

Query  3231  HT----GNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPT  3395
              +    G     S+I+L+S TPG L  E E++  GFVCGRD   DFVT S+KY C T+  
Sbjct  455   ASGKFGGKQEPSSYIALYSATPGKLTKEVEQIKEGFVCGRDNVIDFVTSSMKYGCLTDDN  514

Query  3396  AKLGWKESRIPALRVGR---DMEG--DTRATLIHIDTAYSTRWSLGINTNEIKDFELKDE  3560
             ++ GW +S IP + V     D EG  + R T + ID   + R +L IN  EI+DF  K +
Sbjct  515   SEGGWSQSDIPTIHVNSDTVDTEGNENERITQVSIDMKGAKRLTLAINAKEIEDFTFKVD  574

Query  3561  SGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLK  3737
             S  LV     K+ + GWH++ F+GGKN+ ++F + L W KNS+       G E +  L+K
Sbjct  575   SEELVPRDA-KSSIYGWHIIEFSGGKNAASKFEIALYWAKNSTRAAGNSNGKEKQQPLVK  633

Query  3738  LRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             LR D +  TP+   VL KL  WCS +  S S   L++L+++ V+
Sbjct  634   LRTDFDRLTPKTERVLSKLPPWCSLFEGSISSQPLSFLNSLPVN  677



>gb|EPS57910.1| hypothetical protein M569_16907, partial [Genlisea aurea]
Length=497

 Score =   345 bits (885),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 306/484 (63%), Gaps = 15/484 (3%)
 Frame = +3

Query  2397  YMGGLSALISLVFSALSIVLMWIGsvslsvlvayvlpsvssTPVPFVASPWlaiglfaap  2576
             Y  G   ++++  S LS++L W+ S+S +  VA VLP +S + VPFV+ P L +GLF AP
Sbjct  18    YKAGFPGIVAVALSFLSVLLTWLCSISFTSAVAIVLPWLSISAVPFVSHPVLIVGLFGAP  77

Query  2577  allgafVGQHVVYLFLHKFLSYTFSERKRSFILFVQDDEDVSECELEAERWMFKAGLLQW  2756
             A LGA +GQHV  L L  +L  +FS RKR     ++     +  +L+AERW+FKAG LQW
Sbjct  78    AFLGALIGQHVGLLALESYLCRSFSGRKRQLPSALRG----AVAKLDAERWIFKAGFLQW  133

Query  2757  LLVLAVGTYLKIGSSYLALVWLVSPALAYVLLEA---PAQSTKPLDPLTSLIGLTVPLAI  2927
             L++L +GT  ++G++Y+AL WLVSPA AY LLEA   P +  KPL  +T ++ L+ P  +
Sbjct  134   LILLVIGTVYRVGATYIALTWLVSPAFAYGLLEATLSPERLPKPLKIVTLIVSLSAPFLL  193

Query  2928  SSGVFVMLVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAK  3107
             S+GVF+ L   L+G LVR V +PG   DW+    V V I+ +VCLT+ ++L Y+H S AK
Sbjct  194   SAGVFIRLTGALVGSLVRSVWSPGTTPDWMANLAVGVFISILVCLTLWHLLCYVHISDAK  253

Query  3108  SPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGNSSVVSHISLFSTTPG  3287
             +  V++   LF  SL  V   +VP F +DT+RAVN+V VVD TG     S++++FS TPG
Sbjct  254   TVVVLSAVALFATSLAAVISGVVPPFSEDTSRAVNVVHVVDATGAGRPASYVAVFSGTPG  313

Query  3288  NLDVEAEKLG-GFVCGRDKA-FDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEG  3458
             NLD E+  +G G VCGRD    DFVTFS++Y C T   A+ GW  S IP +RV  D    
Sbjct  314   NLDAESRHIGEGLVCGRDDGEVDFVTFSMRYGCRTGKNAEAGWARSEIPTIRVEEDHRRR  373

Query  3459  DTRATLIHIDTAYSTRWSLGINTNEIKDFELKD-ESG-VLVSVGGEKNGVDGWHVLRFAG  3632
             +   T + +DT  STRW LGIN   ++DF L+D ESG  L+  GG+K+ VDGWH+++F+G
Sbjct  374   EAGVTRVSVDTRVSTRWFLGINFALVEDFRLEDGESGEELIPTGGDKSSVDGWHIIQFSG  433

Query  3633  GKNSPTEFNLTLQWHKNSSGKRIMEGSEGEN---LLLKLRADVNTKTPEMVAVLEKLLSW  3803
             GK SPT F LTL W   + G+R  E  +  +   LLL+LR DV   +P    ++ KL  W
Sbjct  434   GKRSPTTFKLTLIWSSEAGGRRNGEEDKKNDELLLLLRLRTDVPRLSPPAKDIISKLPVW  493

Query  3804  CSQY  3815
             CS +
Sbjct  494   CSLF  497



>ref|XP_008377574.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Malus domestica]
Length=302

 Score =   306 bits (784),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/263 (59%), Positives = 204/263 (78%), Gaps = 9/263 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             +RS +  + LF  +   ++ V+  QF+ LPEPL+A++AG+ GFSE +A+ HV+AL+QLGP
Sbjct  35    QRSPFVWLTLFLAIGYCSYGVYQYQFESLPEPLTADQAGKRGFSEFSALKHVEALTQLGP  94

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             H +GS AL+ ALQYVL  AE IK+ A  +V V+V+ FH  SG N +VGGL+ G+T VY+D
Sbjct  95    HSVGSDALNLALQYVLAEAEKIKKTAHWEVXVEVDSFHVESGANRMVGGLFKGRTLVYAD  154

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             L H+V+R+ PK   + +      ++AILVS+H+DTVF+  GAGD SS VAVMLE+ARG+S
Sbjct  155   LNHIVVRVLPKYAPESV------DNAILVSSHIDTVFSTGGAGDCSSCVAVMLELARGVS  208

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             + A GFK ++VIFLFNTGEEEGLNGAHSF+TQHPW  T+R+A+DLEAMGIGGKSGIFQA 
Sbjct  209   QWAHGFK-HAVIFLFNTGEEEGLNGAHSFITQHPWSTTIRLAVDLEAMGIGGKSGIFQA-  266

Query  1947  PDPWAIQNFAKVAKYPSGQVVSQ  2015
              D W+I+NFA VAKYPSGQ++ Q
Sbjct  267   -DAWSIENFASVAKYPSGQIIGQ  288



>ref|NP_001154727.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 gb|AAM64391.1| unknown [Arabidopsis thaliana]
 gb|AED92873.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=301

 Score =   239 bits (609),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 196/297 (66%), Gaps = 12/297 (4%)
 Frame = +3

Query  2988  SNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITTCVLFVVSLGMVAM  3167
             +NPG   +W+ +A++AV IA  + L+M Y+L YIH SGAK   V   C++  +SL +V+ 
Sbjct  7     NNPGVTPEWLGSALIAVAIATFISLSMVYLLAYIHLSGAKKSIVTALCIITALSLALVSS  66

Query  3168  QMVPAFVDDTARAVNIVQVVDHTGNSSVVSHISLFSTTPGNLDVEAEKLG-GFVCGRDKA  3344
              ++PAF +DTARAVN+V VVD +G    V+ ISLFS TPGNL++EAE++  GF CGR+  
Sbjct  67    GVLPAFTEDTARAVNVVHVVDTSGQDQ-VAFISLFSNTPGNLNMEAEQIKEGFRCGRENK  125

Query  3345  FDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRDMEGD-TRATLIHIDTAYSTRWSLGI  3521
              DFV+F  KY+C T+  A++GW +  IP LRV  D E +  R   + +DT  S+RW+L I
Sbjct  126   IDFVSFEAKYNCVTKKDAEVGWDKHDIPVLRVINDKEREGGRVIAVSMDTGGSSRWTLRI  185

Query  3522  NTNEIKDFELK----DESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSS  3689
             + +EI+DF ++    +E  +++  G + +  +GWH ++FAGGK +PT F L L   +  S
Sbjct  186   DMDEIEDFTMQVGEEEEEELMIERGEKSSNEEGWHQIQFAGGKKAPTSFVLKLYKEEEVS  245

Query  3690  GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAI  3860
                  +  + +  LLKLR D+N +TP++  VLE+L  +C+ +GKS+SPFTLA+L ++
Sbjct  246   -----DDKKKQRPLLKLRTDLNRRTPQVQRVLERLPPFCTMFGKSTSPFTLAFLASL  297



>ref|XP_002437719.1| hypothetical protein SORBIDRAFT_10g001320 [Sorghum bicolor]
 gb|EER89086.1| hypothetical protein SORBIDRAFT_10g001320 [Sorghum bicolor]
Length=303

 Score =   237 bits (604),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 185/298 (62%), Gaps = 9/298 (3%)
 Frame = +3

Query  2949  LVNTLIGYLVRFVSNPGEQADWIPTaivavliaaivCLTMAYVLPYIHNSGAKSPFVITT  3128
             + + ++G +VR   NPG   DW+   IV+V IA +VC T  Y+L Y+H SG K    +  
Sbjct  1     MADVIVGSIVRIDRNPGGLPDWLGNVIVSVAIAVVVCSTFVYLLSYVHISGDKIILGLLL  60

Query  3129  CVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHT----GNSSVVSHISLFSTTPGNLD  3296
              + F +SL + +  +VPAF  D AR+VN+V VVD T    GN   VS+ISLFS TPG L 
Sbjct  61    FISFGLSLALASSGIVPAFTADVARSVNVVHVVDTTGIDDGNREPVSYISLFSNTPGKLT  120

Query  3297  VEAEKLGG--FVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD-MEGDTR  3467
              E   LG   F CGR+   DFVTF++KY C +   +  GW +S +P L V  D + G  R
Sbjct  121   NELADLGDEEFYCGRNMTTDFVTFTMKYGCSSYKESNTGWSKSEVPVLLVESDSVTGGAR  180

Query  3468  ATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGWHVLRFAGGKNSP  3647
              T++ +DT  STRW+LGIN +EI DF ++ +S  +V + G+K+ +DGWH ++FAGGKNSP
Sbjct  181   QTVVSVDTKSSTRWALGINKDEIDDFTVQVDSEKIVPL-GDKSEIDGWHTIQFAGGKNSP  239

Query  3648  TEFNLTLQWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLSWCSQYGK  3821
             T+F LTL W   +S +     +E    L+KLR DVN  TP++  VLEKL  WC+ +GK
Sbjct  240   TKFQLTLYWSTKASQREAKAAAEVP-FLMKLRTDVNRVTPQVARVLEKLPRWCTPFGK  296



>emb|CAN83785.1| hypothetical protein VITISV_008228 [Vitis vinifera]
Length=260

 Score =   225 bits (573),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 147/225 (65%), Gaps = 8/225 (4%)
 Frame = +3

Query  3213  IVQVVDHTGNSSVV----SHISLFSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYS  3377
             +V VVD T     +    S+IS+FSTTPGNL  E E++  GFVCGRDK  DFVTFSVKY 
Sbjct  35    VVHVVDTTEKYGEMQDPRSYISIFSTTPGNLIKEVEQINEGFVCGRDKVLDFVTFSVKYG  94

Query  3378  CWTEPTAKLGWKESRIPALRVGRDMEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKD  3557
             C T      GW +S IP L V  D EGD R T I IDT  STRWSL INT EI+DF  K+
Sbjct  95    CLTNDDIGGGWSKSDIPVLHVDSDTEGDGRTTQISIDTKVSTRWSLAINTQEIEDFLFKE  154

Query  3558  ESGVLVSVGGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSS-GKRIMEGSEGENL-L  3731
              S  LV +GG K   +GWH+ +F+GGKNSPT F+LTL W KNS+      +G   E   L
Sbjct  155   NSDELVPLGG-KGSNNGWHIFQFSGGKNSPTRFDLTLFWRKNSTKSAHNADGQRAEQRPL  213

Query  3732  LKLRADVNTKTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISV  3866
             LKLR DVN  TP+   VL KL SWCSQ+GKS+SP+ LA+L ++ V
Sbjct  214   LKLRTDVNRLTPKAARVLTKLPSWCSQFGKSTSPYNLAFLTSLPV  258



>ref|XP_002437720.1| hypothetical protein SORBIDRAFT_10g001330 [Sorghum bicolor]
 gb|EER89087.1| hypothetical protein SORBIDRAFT_10g001330 [Sorghum bicolor]
Length=280

 Score =   224 bits (570),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 154/212 (73%), Gaps = 7/212 (3%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
              R  Y ++ L    + G+W V+  QF  LP PL AE+AG+ GFSE +A+ HVK L+ LGP
Sbjct  31    RRGAYLLLGLLIIFLHGSWSVYQIQFGSLPLPLDAEKAGKRGFSEASALKHVKYLTGLGP  90

Query  1407  HPLGSTALDTALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSD  1586
             HP+GS +LD A+QYV  VAE IK+ A  +V+V +E+FH + G N L GGL+ GKT +YSD
Sbjct  91    HPVGSDSLDRAIQYVYAVAEKIKKTAHWEVDVQLELFHTDIGANRLSGGLFKGKTLLYSD  150

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             LKHV++R++PK         E EE+ ILVS+H+DTV   EGAGD SS V VMLE+ARG++
Sbjct  151   LKHVLLRVTPKYLP------EAEENLILVSSHIDTVSTTEGAGDCSSCVGVMLELARGVA  204

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQ  1862
             ++A GFK+  ++FLFNTGEEEGL+GAHSF+TQ
Sbjct  205   QRAHGFKSG-ILFLFNTGEEEGLDGAHSFITQ  235



>ref|XP_010456606.1| PREDICTED: uncharacterized protein LOC104738067, partial [Camelina 
sativa]
Length=260

 Score =   223 bits (567),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 170/260 (65%), Gaps = 10/260 (4%)
 Frame = +3

Query  3093  NSGAKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGNSSVVSHISLF  3272
             +SGAK+  V   C+   +SL +VA  + PAF +DTARAVN+V VVD +G   V + ISLF
Sbjct  3     SSGAKTLLVTALCISTALSLSLVASGVFPAFTEDTARAVNVVHVVDTSGQDQV-AFISLF  61

Query  3273  STTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGRD  3449
             S TPGNL++EAE++  GF CGR+   DFV+F  KYSC T+  A++GW +  IP LRV  D
Sbjct  62    SNTPGNLNMEAEQIKEGFKCGRENKIDFVSFEAKYSCVTKKDAEVGWDKHNIPVLRVIND  121

Query  3450  MEGDT-RATLIHIDTAYSTRWSLGINTNEIKDFELK--DESGVLVSVGGEKNGVDGWHVL  3620
              E D  R T I +DT  S+RW+L I+  EI+DF ++  ++  ++++ G + +   GWH +
Sbjct  122   KERDEGRVTAISMDTGGSSRWTLRIDMEEIEDFTMQVSEDEELMIARGEKSSNEQGWHQI  181

Query  3621  RFAGGKNSPTEFNLTLQWHKNSSGKRIMEGSEGENLLLKLRADVNTKTPEMVAVLEKLLS  3800
             +FAGGK +PT F L L   +  S ++     + +  LLKLR D N  TP++  VLE+L  
Sbjct  182   QFAGGKKAPTSFVLKLYKKEEVSDEK-----KKQRPLLKLRTDFNRLTPQVQRVLERLPP  236

Query  3801  WCSQYGKSSSPFTLAYLDAI  3860
             +CS +GKS+SPFTLA+L ++
Sbjct  237   FCSMFGKSTSPFTLAFLASL  256



>ref|XP_002606922.1| hypothetical protein BRAFLDRAFT_91691 [Branchiostoma floridae]
 gb|EEN62932.1| hypothetical protein BRAFLDRAFT_91691 [Branchiostoma floridae]
Length=806

 Score =   219 bits (557),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 204/378 (54%), Gaps = 26/378 (7%)
 Frame = +3

Query  1212  EGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKAL  1391
             +  + E+    I V FT V+    L+ +   K LP   +      T FSE  A  H+ A+
Sbjct  40    KATLGEQVYVVIAVFFTAVL----LIVFLAAKQLPPARTDAGTPPTQFSEERARRHLDAI  95

Query  1392  SQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGK  1568
             +  GP   G+   +   ++Y+L   + I++ A     ++V+V    +G  TL        
Sbjct  96    TGFGPRVAGTYQNEVLTVRYLLGEIDKIQQAAKPSHRIEVDV-QRPTGYFTL--DFLSSF  152

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             T  Y ++ ++V+RLSPK         +    +++++AH D+     GA DD+++ A MLE
Sbjct  153   THYYDNITNIVVRLSPK---------KQTRHSLMINAHFDSTMGGPGASDDAASCASMLE  203

Query  1749  VARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKS  1928
             V R LS+  T  KN S+IF+ N  EE  L  +H F+TQHPW   +R  ++LE+ G GG+ 
Sbjct  204   VLRVLSQTDTPLKN-SIIFVLNGAEENILQASHGFITQHPWAGDIRAFVNLESAGAGGRE  262

Query  1929  GIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
              +FQ GPD PW ++ +A+ AKYP   V +Q+LF S VI S TDF++Y++   L G+D A+
Sbjct  263   VVFQTGPDHPWLVRAYAEAAKYPFASVTAQELFQSNVIPSDTDFRIYRDYGNLPGIDIAY  322

Query  2106  TDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTV  2285
              D+  VYH K D    + PGS+Q  GENLL  +    +S  L  P +    GK+      
Sbjct  323   MDNGYVYHLKYDSPDQIPPGSMQRAGENLLSIVQHLVNSPYLAYPGE-YRHGKT------  375

Query  2286  VYFDILGRYMVVYPRSFA  2339
             V+FD++G +MVVYP   A
Sbjct  376   VFFDVIGLFMVVYPHHVA  393



>ref|XP_001640905.1| predicted protein [Nematostella vectensis]
 gb|EDO48842.1| predicted protein [Nematostella vectensis]
Length=902

 Score =   218 bits (556),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 190/341 (56%), Gaps = 19/341 (6%)
 Frame = +3

Query  1311  LPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAF  1487
             +P P  + E+    FSE  A  H+  ++  GP P GS A +  A+ Y+L+    IK  A 
Sbjct  63    VPPPKLSSESHLGEFSEQRARVHLDKIASYGPRPTGSIANEVHAVNYILKQVSDIKSSAK  122

Query  1488  GDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAI  1667
               V +D++V    SG  T   G   G T  Y ++ ++V+RLSP+       E    +  +
Sbjct  123   KSVRIDIDV-QRPSG--TFFLGFLDGFTSHYYNVTNIVVRLSPE-------ENFPPKHTV  172

Query  1668  LVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAH  1847
             LV+AH D+V  + GA DD+ + A MLEV R +S+         VIFLFN  EE  L  +H
Sbjct  173   LVNAHFDSVPYSPGASDDAVSCATMLEVLRVMSQCPEVNFTYGVIFLFNGAEENILQASH  232

Query  1848  SFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLF  2024
              F++QHPW  +VR  ++LEA G GGK  +FQ GP+ PW I+ + +VA YPS QV+ Q++F
Sbjct  233   GFISQHPWAQSVRAFVNLEAAGAGGKEVVFQTGPEHPWLIKTYTEVAPYPSAQVLGQEIF  292

Query  2025  SSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFL  2204
              SG+I S TDF+++++   + G+D A+  +  VYHT+ D  A +  GS+Q  GEN+   +
Sbjct  293   QSGLIPSDTDFRIFRDYGHIPGIDIAYITNGFVYHTQYDTPAAITKGSIQRAGENVFSVV  352

Query  2205  LQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              + A+S  L  P +            +V+FD LG  M+ YP
Sbjct  353   KEIANSPLLEDPGEY-------RHGAMVFFDFLGLLMIHYP  386



>ref|XP_005105979.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Aplysia 
californica]
Length=909

 Score =   216 bits (551),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 194/344 (56%), Gaps = 19/344 (6%)
 Frame = +3

Query  1314  PEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIKEEAFGD  1493
             P P   + +    F E  A  H+  L+ LGP   GS A   A +Y+LQ+   I+      
Sbjct  88    PIPKCWKNSESFEFREENARAHLDELTGLGPRVSGSDANMKAEEYILQMIASIQRSKKSH  147

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGK-TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
               + V+V   + G+      +  G+ T VY DL++V++++SP S A+         +++L
Sbjct  148   FKMTVDVQVTSGGLTLDFNNVGIGEFTSVYQDLRNVIVKVSPVSEAN---------NSVL  198

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
             V+ H D+V  + GAGDD+++ AVMLE+ R L++      +N ++FLFN+ EE  L  +H 
Sbjct  199   VNCHYDSVIDSPGAGDDAASCAVMLEMMRALTQGELVLLHN-IVFLFNSAEENILQTSHG  257

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW  +++  ++L++ G GG   +FQ GP+ PW I+ + + A YP   V+ Q++F 
Sbjct  258   FITQHPWAPSIKAFVNLDSAGAGGWEIVFQTGPEHPWLIKAYIESAPYPHASVIGQEIFQ  317

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             +G+I S TDF+++++   + G+D A   +  VYHT+ND    + PG +Q  GEN+L  L 
Sbjct  318   TGLIPSDTDFRIFRDYGNIPGIDIAHIKNGYVYHTRNDLPRFIPPGCMQRGGENVLSLLK  377

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFA  2339
               ++S  L  P        ++   ++V+FD LG +MV YP+  A
Sbjct  378   TLSTSMKLVDPG-------ADKHGSMVFFDFLGFFMVAYPKRIA  414



>ref|XP_007904725.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Callorhinchus milii]
Length=857

 Score =   215 bits (547),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 195/338 (58%), Gaps = 26/338 (8%)
 Frame = +3

Query  1326  SAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEE--AFGDV  1496
             +++    + FS   A  H++ +++LGP P GS A +   + Y+L+  + +KE   A   +
Sbjct  52    NSDNDNSSHFSAGRAREHLQHITELGPRPSGSPANEILTVNYLLEQVQKMKEGGGAAHQI  111

Query  1497  NVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVS  1676
              VDV+    +  ++ L G   FG    Y ++ +VV++L PK  A         + A+L +
Sbjct  112   TVDVQRPTGSFSIDFLGG---FGS--YYDNISNVVVKLEPKHGA---------KHAVLAN  157

Query  1677  AHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFV  1856
              H D+V  + GA DD+ + AVMLEV   LS  +T   +++VIFLFN  EE  L  +H F+
Sbjct  158   CHFDSVANSPGASDDAVSCAVMLEVLNSLSHLSTPL-HHAVIFLFNGAEENVLQASHGFI  216

Query  1857  TQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSG  2033
             TQHPW   +R  I+LEA G+GGK  +FQ GP +PW +Q + + AK+P   VV Q++F SG
Sbjct  217   TQHPWAKLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVRAAKHPFASVVGQEIFQSG  276

Query  2034  VIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQA  2213
             VI + TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   
Sbjct  277   VIPADTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRISLDSIQRAGDNILAVLQYL  336

Query  2214  ASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             A+S +       L+  K+    T+V+FD+LG ++V YP
Sbjct  337   ATSVE-------LADSKAYRHGTMVFFDVLGLFVVAYP  367



>ref|NP_725876.1| CG11961, isoform A [Drosophila melanogaster]
 ref|NP_001246418.1| CG11961, isoform C [Drosophila melanogaster]
 gb|AAF57575.1| CG11961, isoform A [Drosophila melanogaster]
 gb|AAQ23620.1| LD02432p [Drosophila melanogaster]
 gb|AFH08171.1| CG11961, isoform C [Drosophila melanogaster]
Length=891

 Score =   210 bits (535),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 208/388 (54%), Gaps = 36/388 (9%)
 Frame = +3

Query  1197  KSYTIEGNMAERS---GYEIVVLFTFVVCGTWLVFYSQFKV-----LPEPLSA--EEAGE  1346
             + Y  + N  ER+   G +I   +     G WL+ Y    +     LP PL+   EE   
Sbjct  32    QQYEAQPNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHP  91

Query  1347  TGFSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEEAFGDVNVDVEVFHA  1523
               F    A  +++ L  LGP  +GS   +  AL+ + Q  + I+     D+ VDV+V   
Sbjct  92    DQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDIEVDVQVASG  151

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +         +++    +Y  ++++V+++SPK+T        +    +LV++H D+V A 
Sbjct  152   SY--------VHWSMVNMYQSIQNIVVKISPKNT--------NSTTYLLVNSHYDSVPAG  195

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GAGDD S VA M+EV R L+K     KN  V+FLFN  EE  L  +H+F+TQH W    
Sbjct  196   PGAGDDGSMVATMMEVLRVLAKSDKPLKN-PVVFLFNGAEENPLQASHAFITQHKWAKYC  254

Query  1884  RVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             +  I+L++ G GG+  +FQ+GP+ PW ++N+ +  K+P    + ++LF    I S TDF+
Sbjct  255   KALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFR  314

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             ++++   + GLD A+T +  VYHT++DK  +   GS QH G+NLL  + Q A+S ++   
Sbjct  315   IFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENS  374

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
              K  + G +      +YFD++G ++V Y
Sbjct  375   AK-YAKGHT------IYFDVMGWFLVFY  395



>ref|XP_009859475.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Ciona 
intestinalis]
Length=869

 Score =   210 bits (534),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 186/345 (54%), Gaps = 21/345 (6%)
 Frame = +3

Query  1302  FKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKE  1478
             +  LP+   A EA +  F E  A  H+  L  LG  P GS A +  A+ Y+L   E IK+
Sbjct  46    YHSLPKSKLASEAHQLDFIEENARIHLHELVSLGHRPAGSIANEIDAVNYILATVENIKQ  105

Query  1479  EAFGDVNVDVEVFHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDE  1655
              A  +VN++  + H     +   +GG        YS++ + V++LSP     K       
Sbjct  106   NAQPNVNIETSLQHPTGSFSIDFLGGF----ASYYSNITNTVVKLSPVKHQAK-------  154

Query  1656  EDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGL  1835
              DA+L++ H D+V    GA DD+   +V+LEV R +S+     ++ S+IFLFN  EE  L
Sbjct  155   -DALLLNCHTDSVSGGPGASDDAVACSVLLEVMRAMSRSKEELQH-SIIFLFNGAEENVL  212

Query  1836  NGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVS  2012
               +H F+TQHPW   V+  I+LEA G GGK  +FQ GP +PW    +A+ A +P G V++
Sbjct  213   QASHGFITQHPWAKEVQAFINLEAAGAGGKEIVFQTGPSNPWLALAWAQNAPHPFGSVLA  272

Query  2013  QDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENL  2192
             Q++F SG+I S TDF+++++   + G+D A+  +  VYHT  D   ++ PG +Q  GEN+
Sbjct  273   QEVFQSGIIPSDTDFRIFRDYGKIPGIDLAYMKNGYVYHTIYDNEDMILPGCIQRAGENI  332

Query  2193  LPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             L  +    +S     P+  LS   S     + + DIL  YM+  P
Sbjct  333   LAVVRHLVNS-----PSSMLSDPSSYRHGALAFMDILSVYMITLP  372



>ref|XP_004074949.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Oryzias 
latipes]
Length=888

 Score =   209 bits (531),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 181/329 (55%), Gaps = 25/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+   A  H++ ++ +GP P+GS   +   + Y+L+  E I+ + A G   + V+V H  
Sbjct  85    FNAARARQHLEQITSVGPRPVGSQENEVLTVAYLLEQIESIRAKTAAGPHQLTVDVQHPT  144

Query  1527  SGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
                +   +GG     T  Y  + ++ +RL PK  +  L         +L + H DTV  +
Sbjct  145   GSFSIDFLGGF----TSFYDHVTNIAVRLEPKGGSQHL---------MLANCHFDTVANS  191

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + AVMLEV   L+ Q+T F++  VIFLFN  EE  L  +H F+TQHPW   V
Sbjct  192   PGASDDAVSCAVMLEVLHSLANQSTAFQHG-VIFLFNGAEENILQASHGFITQHPWAKNV  250

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SG+I S TDF+
Sbjct  251   RAFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGIIPSDTDFR  310

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +  GS+Q  G+N+L  L     S      
Sbjct  311   IYRDFGNIPGIDLAFIENGFIYHTKYDTADRILSGSIQRAGDNILAVLKYLLMS------  364

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              + L+         +V+FD+LG  +V YP
Sbjct  365   -EKLADSSEYRHGNMVFFDVLGVVVVAYP  392



>ref|NP_611413.2| CG11961, isoform B [Drosophila melanogaster]
 gb|AAN71167.1| GH11271p [Drosophila melanogaster]
 gb|AAF57574.2| CG11961, isoform B [Drosophila melanogaster]
 gb|ACL88320.1| CG11961-PB, partial [synthetic construct]
Length=867

 Score =   208 bits (530),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 207/388 (53%), Gaps = 36/388 (9%)
 Frame = +3

Query  1197  KSYTIEGNMAERS---GYEIVVLFTFVVCGTWLVFYSQFKV-----LPEPLSA--EEAGE  1346
             K    + N  ER+   G +I   +     G WL+ Y    +     LP PL+   EE   
Sbjct  8     KRSKAQPNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHP  67

Query  1347  TGFSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEEAFGDVNVDVEVFHA  1523
               F    A  +++ L  LGP  +GS   +  AL+ + Q  + I+     D+ VDV+V   
Sbjct  68    DQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDIEVDVQVASG  127

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +         +++    +Y  ++++V+++SPK+T        +    +LV++H D+V A 
Sbjct  128   SY--------VHWSMVNMYQSIQNIVVKISPKNT--------NSTTYLLVNSHYDSVPAG  171

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GAGDD S VA M+EV R L+K     KN  V+FLFN  EE  L  +H+F+TQH W    
Sbjct  172   PGAGDDGSMVATMMEVLRVLAKSDKPLKN-PVVFLFNGAEENPLQASHAFITQHKWAKYC  230

Query  1884  RVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             +  I+L++ G GG+  +FQ+GP+ PW ++N+ +  K+P    + ++LF    I S TDF+
Sbjct  231   KALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFR  290

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             ++++   + GLD A+T +  VYHT++DK  +   GS QH G+NLL  + Q A+S ++   
Sbjct  291   IFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENS  350

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
              K  + G +      +YFD++G ++V Y
Sbjct  351   AK-YAKGHT------IYFDVMGWFLVFY  371



>ref|NP_001053331.1| Os04g0519900 [Oryza sativa Japonica Group]
 dbj|BAF15245.1| Os04g0519900, partial [Oryza sativa Japonica Group]
Length=217

 Score =   194 bits (492),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 140/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  3231  HTGNSSVVSHISLFSTTPGNLDVEAEKLGG--FVCGRDKAFDFVTFSVKYSCWTEPTAKL  3404
             ++GN+   S+++LFS TPG L  E   L    F CGR++A DFVTF++KY C +      
Sbjct  1     NSGNTEPSSYVTLFSNTPGKLTKELVDLRDEEFSCGRNRAIDFVTFTMKYGCLSYEGTNT  60

Query  3405  GWKESRIPALRVGRD-MEGDTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSV  3581
             GW +S +P L +  D +  D R T+I +DT  STRWSL IN  EI DF +  +S  LV +
Sbjct  61    GWSKSEVPVLSLKSDSVTNDARQTIISVDTKSSTRWSLAINKQEIDDFTVHVDSENLVPL  120

Query  3582  GGEKNGVDGWHVLRFAGGKNSPTEFNLTLQWHKNSSGKRIME-GSEGENLLLKLRADVNT  3758
             G  K+ +DGWH ++FAGGK+SPT+F LTL W  NS      +  SE  + LLKLR DVN 
Sbjct  121   GN-KSEIDGWHTIQFAGGKDSPTKFQLTLFWASNSKDAFPKQVESEDHSFLLKLRTDVNR  179

Query  3759  KTPEMVAVLEKLLSWCSQYGKSSSPFTLAYLDAISVD  3869
              TP++  VLEKL  WC+ +GKS+SP+TLA+L A+ V+
Sbjct  180   VTPKVGRVLEKLPGWCAPFGKSTSPYTLAFLTALPVN  216



>ref|XP_002034573.1| GM21951 [Drosophila sechellia]
 gb|EDW48586.1| GM21951 [Drosophila sechellia]
Length=885

 Score =   207 bits (528),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 197/359 (55%), Gaps = 33/359 (9%)
 Frame = +3

Query  1275  GTWLVFYSQFKV-----LPEPLSA--EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALD  1433
             G WL+ Y    +     LP PL+   EE     F    A  +++ L  LGP  +GS   +
Sbjct  61    GFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNE  120

Query  1434  -TALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRL  1610
               AL+ + Q  + I+     D+ VDV+V   +         +++    +Y  ++++V+++
Sbjct  121   MAALKMLSQKMQRIRSGTANDIEVDVQVASGSY--------VHWSMVNMYQSIQNIVVKI  172

Query  1611  SPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKN  1790
             SPK+T        +    +LV++H D+V A  GAGDD S VA M+EV R L+K     KN
Sbjct  173   SPKNT--------NSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKN  224

Query  1791  NSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQ  1967
               V+FLFN  EE  L  +H+F+TQH W    +  I+L++ G GG+  +FQ+GP+ PW ++
Sbjct  225   -PVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMK  283

Query  1968  NFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKV  2147
             N+ +  K+P    + ++LF    I S TDF+++++   + GLD A+T +  VYHT++DK 
Sbjct  284   NYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKA  343

Query  2148  ALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
              +   GS QH G+NLL  + Q A+S ++    K  + G +      +YFD++G ++V Y
Sbjct  344   EIFPRGSFQHTGDNLLALVRQIANSPEIENSAK-YAKGHT------IYFDVMGWFLVFY  395



>ref|XP_002082218.1| GD11447 [Drosophila simulans]
 gb|EDX07803.1| GD11447 [Drosophila simulans]
Length=867

 Score =   207 bits (527),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 197/359 (55%), Gaps = 33/359 (9%)
 Frame = +3

Query  1275  GTWLVFYSQFKV-----LPEPLSA--EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALD  1433
             G WL+ Y    +     LP PL+   EE     F    A  +++ L  LGP  +GS   +
Sbjct  37    GFWLLLYVTISIPACHRLPRPLTIQDEEKHPDQFIAERAEKNLRELVSLGPRVVGSRQNE  96

Query  1434  -TALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRL  1610
               AL+ + Q  + I+     D+ VDV+V   +         +++    +Y  ++++V+++
Sbjct  97    MAALKMLSQKMQKIRSGNANDIEVDVQVASGSY--------VHWSMVNMYQSIQNIVVKI  148

Query  1611  SPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKN  1790
             SPK+T        +    +LV++H D+V A  GAGDD S VA M+EV R L+K     KN
Sbjct  149   SPKNT--------NSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKN  200

Query  1791  NSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQ  1967
               V+FLFN  EE  L  +H+F+TQH W    +  I+L++ G GG+  +FQ+GP+ PW ++
Sbjct  201   -PVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMK  259

Query  1968  NFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKV  2147
             N+ +  K+P    + ++LF    I S TDF+++++   + GLD A+T +  VYHT++DK 
Sbjct  260   NYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKA  319

Query  2148  ALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
              +   GS QH G+NLL  + Q A+S ++    K  + G +      +YFD++G ++V Y
Sbjct  320   EIFPRGSFQHTGDNLLALVRQIANSPEIENSAK-YAKGHT------IYFDVMGWFLVFY  371



>gb|EKC31796.1| Endoplasmic reticulum metallopeptidase 1 [Crassostrea gigas]
Length=833

 Score =   205 bits (522),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/347 (32%), Positives = 195/347 (56%), Gaps = 20/347 (6%)
 Frame = +3

Query  1293  YSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEG  1469
             Y+ F   P  +   E+ E  F E  A  H++ ++  GP   GS A +  A +Y+++  + 
Sbjct  2     YTLFHSFPSAVKEAESSENKFCEERARYHLENITSFGPRVAGSNANEVHAKEYLMKEIQK  61

Query  1470  IKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             I+++      +++++    SG   LV  +      VY +++++V+         K+ + E
Sbjct  62    IEKQHHPSKRMEIDL-QITSGSFHLVNFIQTNFYSVYRNMQNIVV---------KITDEE  111

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
             + +D+ L++ H D+V ++ GAGD++ + +VMLE+ R +S+ +   K+N VIFLFN  EE 
Sbjct  112   ESDDSFLINCHHDSVSSSPGAGDNAVSCSVMLEIIRIISRSSVKLKHN-VIFLFNGAEEN  170

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQV  2006
              L  +H F+TQH W+ +++  I+L++ G GG   +FQ GP+ PW +  +A+   +P G V
Sbjct  171   MLQASHGFITQHKWVKSIKTVINLDSAGAGGWEVVFQTGPEHPWLVAAYAESVPHPFGSV  230

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             + Q+ F  G+I S TDF+++++   + GLD A   +  VYHTK D+   +  G LQ  G+
Sbjct  231   IGQEFFELGLIPSDTDFRIFRDFGQIPGLDIAHIANGYVYHTKYDQPRYIPSGCLQRAGD  290

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             NLL  +L+ A++  L  P         +   ++V+ D+LG +MV YP
Sbjct  291   NLLALILKLATNPKLADPGL-------DRHGSMVFIDVLGFFMVHYP  330



>ref|XP_003965609.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Takifugu 
rubripes]
Length=883

 Score =   206 bits (523),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 182/330 (55%), Gaps = 27/330 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG---DVNVDVEVFH  1520
             F+ + A  H++ ++ +GP P+GS   +   + Y+L+  E I+ E       + VDV+   
Sbjct  85    FNALRARRHLEQITSVGPRPVGSQENEVLTVGYLLEQIEQIRAETAAGPHQLTVDVQRPT  144

Query  1521  ANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFA  1700
                 ++ L GG     T  Y  + +VV+RL PK  A  L         +L + H DTV  
Sbjct  145   GTFSIDFL-GGF----TSFYDRVTNVVVRLEPKGGAQHL---------MLANCHFDTVAN  190

Query  1701  AEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINT  1880
             + GA DD+ + AVMLEV   L+ Q+T   ++ V+FLFN  EE  L  +H F+TQHPW   
Sbjct  191   SPGASDDAVSCAVMLEVLHSLANQSTPL-HHGVVFLFNGAEENILQASHGFITQHPWAKQ  249

Query  1881  VRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDF  2057
             VR  I+LEA G+GGK  +FQ GP +PW +Q + + AK+P   VV Q++F SG+I S TDF
Sbjct  250   VRAFINLEAAGVGGKEVVFQTGPENPWLVQAYVQAAKHPFASVVGQEVFQSGIIPSDTDF  309

Query  2058  QVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPT  2237
             ++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L     S     
Sbjct  310   RIYRDFGNIPGIDLAFIENGFIYHTKYDTADRILTDSIQRAGDNILAVLRYLLMS-----  364

Query  2238  PNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
               + L+         +V+FD+LG ++V YP
Sbjct  365   --EKLADSSEYRHGNMVFFDLLGVFVVAYP  392



>ref|XP_001958900.1| GF12330 [Drosophila ananassae]
 gb|EDV35722.1| GF12330 [Drosophila ananassae]
Length=891

 Score =   206 bits (523),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 123/388 (32%), Positives = 209/388 (54%), Gaps = 36/388 (9%)
 Frame = +3

Query  1197  KSYTIEGNMAERSGYE---IVVLFTFVVCGTWLVFYSQFKV-----LPEPLSAEEAGE--  1346
             + Y  + N  ER+  +   I   +     G WL+ Y    +     LP PL+ ++  +  
Sbjct  32    QQYEAQPNGCERAFIQHNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEAKHP  91

Query  1347  TGFSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEEAFGDVNVDVEVFHA  1523
               F    A N+++ L  LGP  +GS   +  AL+ + +    IK     ++ VDV+V   
Sbjct  92    DQFIAERAENNLRDLVSLGPRVVGSRTNEMAALKLLSEKTHKIKSGTANEIEVDVQV---  148

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
              SG       +++    +Y  ++++V+++SP+        G +    +LV++H D+V A 
Sbjct  149   ASG-----SYVHWSMVNMYQSIQNIVVKVSPR--------GTNSTTWLLVNSHYDSVPAG  195

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GAGDD+S VA M+EV R L       KN  V+FLFN  EE  L  +H+F+TQH W    
Sbjct  196   PGAGDDASMVATMMEVLRVLVNSEKPLKN-PVVFLFNGAEENPLQASHAFITQHKWAKYC  254

Query  1884  RVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             +  I+L++ G GG+  +FQ+GP+ PW ++N+ +  K+P    + +++F + +I S TDF+
Sbjct  255   KALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEEMFQNNMIPSDTDFR  314

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             ++++   + GLD A+T +  VYHT++DK  +   GSLQH G+NLL  + + A+S +L   
Sbjct  315   IFRDHGAVPGLDMAYTYNGYVYHTRHDKAEIFPRGSLQHTGDNLLALVREIANSPELEDS  374

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
             +K         E   +YFD++G ++V Y
Sbjct  375   SKYA-------EGHTIYFDVMGWFLVFY  395



>ref|XP_001974797.1| GG21963 [Drosophila erecta]
 gb|EDV55197.1| GG21963 [Drosophila erecta]
Length=867

 Score =   204 bits (519),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/359 (33%), Positives = 196/359 (55%), Gaps = 33/359 (9%)
 Frame = +3

Query  1275  GTWLVFYSQFKV-----LPEPLSA--EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALD  1433
             G WL+ Y    +     LP PL+   E+     F    A  +++ L  LGP  +GS   +
Sbjct  37    GFWLLLYVTISIPACHRLPRPLTIQDEDKHPDQFIAERAEKNLRELVTLGPRVVGSRQNE  96

Query  1434  -TALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRL  1610
               AL+ + Q  + I+     D+ VDV+V   +         +++    +Y  ++++V+++
Sbjct  97    MAALKMLSQKMQKIRSGTVNDIEVDVQVASGSY--------VHWSMVNMYQSIQNIVVKI  148

Query  1611  SPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKN  1790
             SPK++        +    +LV++H D+V A  GAGDD S VA M+EV R L+K     KN
Sbjct  149   SPKNS--------NSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKN  200

Query  1791  NSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQ  1967
               V+FLFN  EE  L  +H+F+TQH W    +  I+L++ G GG+  +FQ+GP+ PW ++
Sbjct  201   -PVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMK  259

Query  1968  NFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKV  2147
             N+ +  K+P    + ++LF    I S TDF+++++   + GLD A+T +  VYHT++D  
Sbjct  260   NYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDTA  319

Query  2148  ALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
              +   GS QH G+NLL  + Q A+S ++    K  + G +      +YFD+LG ++V Y
Sbjct  320   EIFPRGSFQHTGDNLLALVRQIANSPEIENSAK-YAKGHT------IYFDVLGWFLVFY  371



>ref|XP_004538113.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Maylandia 
zebra]
 ref|XP_005735234.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Pundamilia 
nyererei]
Length=888

 Score =   204 bits (519),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 177/328 (54%), Gaps = 23/328 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H++ ++  GP P+GS   +   + Y+L+  E I+ E A G   + +++    
Sbjct  86    FNAVRARQHLEQITSAGPRPVGSQENEVLTVGYLLKQIEDIQVETAAGPHQLSIDI---Q  142

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                 T       G T  Y  + ++ +RL PK  A  L         +L + H DTV  + 
Sbjct  143   RPTGTFSIDFLGGFTSFYDHITNIAVRLEPKGGAQHL---------MLANCHFDTVANSP  193

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV   L+ Q+T   N+ VIFLFN  EE  L  +H F+TQHPW   VR
Sbjct  194   GASDDAVSCAVMLEVLHSLANQSTPL-NHGVIFLFNGAEENVLQASHGFITQHPWAKQVR  252

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF++
Sbjct  253   AFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFRI  312

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             +++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A S       
Sbjct  313   FRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKYLAMS-------  365

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             + L+         +V+FD+LG  +V YP
Sbjct  366   EKLADSSEYRHGNMVFFDLLGVIVVAYP  393



>ref|XP_009097246.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Serinus 
canaria]
Length=861

 Score =   204 bits (518),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 194/347 (56%), Gaps = 26/347 (7%)
 Frame = +3

Query  1296  SQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI  1472
             S  ++L +P +A  AG   FS   A  ++  ++ +GP  +GS   +  A+ Y+L+   GI
Sbjct  47    SHRQLLSQPPAA--AGPRDFSASRARGYLDNITAIGPRTVGSPENEVLAVNYLLEQIRGI  104

Query  1473  KEEAFGDVNVDVEVFHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             + E+     + V++       +   +GG     T  Y+++ +VV++L P++ A       
Sbjct  105   ERESTDAHKISVDIQRPTGSFSIDFLGGF----TSYYANITNVVVKLEPRNGA-------  153

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
               E A+L + H D+V    GA DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE 
Sbjct  154   --EHAVLSNCHFDSVPNTPGASDDAVSCAVMLEILNTLSKSSESLQH-AVIFLFNGAEEN  210

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQV  2006
              L  +H F+TQH W  ++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   V
Sbjct  211   ILQASHGFITQHEWAKSIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASV  270

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             V+Q++F SG+I + TDF++Y++   + G+D AF ++  +YHT+ D    +   S+Q  G+
Sbjct  271   VAQEIFQSGIIPADTDFRIYRDFGNVPGIDLAFIENGYIYHTEYDTSDRILTDSIQRAGD  330

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             N+L  L   A+S       + L+         VV+FDILG +++ YP
Sbjct  331   NILAVLKYLATS-------EKLAKSFEYRHGNVVFFDILGLFVLAYP  370



>ref|XP_003453965.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Oreochromis niloticus]
 ref|XP_005470390.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Oreochromis niloticus]
Length=888

 Score =   204 bits (519),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 177/328 (54%), Gaps = 23/328 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H++ ++  GP P+GS   +   + Y+L+  E I+ E A G   + +++    
Sbjct  86    FNAVRARQHLEQITSAGPRPVGSQENEVLTVGYLLKQIEDIQVETAAGPHQLTIDI---Q  142

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                 T       G T  Y  + ++ +RL PK  A  L         +L + H DTV  + 
Sbjct  143   RPTGTFSIDFLGGFTSFYDHITNIAVRLEPKGGAQHL---------MLANCHFDTVANSP  193

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV   L+ Q+T   N+ VIFLFN  EE  L  +H F+TQHPW   VR
Sbjct  194   GASDDAVSCAVMLEVLHSLANQSTPL-NHGVIFLFNGAEENVLQASHGFITQHPWAKQVR  252

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF++
Sbjct  253   AFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFRI  312

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             +++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A S       
Sbjct  313   FRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKYLAMS-------  365

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             + L+         +V+FD+LG  +V YP
Sbjct  366   EKLADSSEYRHGNMVFFDLLGVIVVAYP  393



>ref|XP_010865313.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Esox 
lucius]
Length=502

 Score =   199 bits (505),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 125/370 (34%), Positives = 192/370 (52%), Gaps = 37/370 (10%)
 Frame = +3

Query  1227  ERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGP  1406
             E  G  +V +F+ V+ G   +   Q       ++    GE  F+ V A  H++ ++ +GP
Sbjct  47    EFGGVALVTVFSLVLLGIVHLSTQQL------VTGTSTGE--FNAVRARKHLENITSIGP  98

Query  1407  HPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVY  1580
              PLGS   +   + Y+L+  E IK   A G  +V V++           G +++     Y
Sbjct  99    RPLGSQENEVVTVNYLLEQIEHIKVYSALGPHSVIVDI-------QKPTGYVFWNH--YY  149

Query  1581  SDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARG  1760
               + ++ +RL PK     L         +L + H DTV  + GA D++   AVMLEV   
Sbjct  150   DRISNIAVRLEPKDGTQHL---------MLANCHFDTVANSPGASDNAVGCAVMLEVLHS  200

Query  1761  LSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQ  1940
             L+  +T  K+  V+F+FN  EE  L G+H F+TQHPW N +R  I+L++ G+GGK  +FQ
Sbjct  201   LANLSTPLKH-GVVFVFNGAEENMLQGSHGFITQHPWANQIRAFINLDSAGVGGKEMMFQ  259

Query  1941  AGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHT  2117
             AGP+ PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y     + G+D AF ++ 
Sbjct  260   AGPNSPWLVQAYVHAAKHPFASVVAQEIFQSGMIPSDTDFRIYSHFGKIPGIDLAFIENG  319

Query  2118  AVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFD  2297
              +YHTK D    +   S+Q  G+N+L  L     S       K L          +V+FD
Sbjct  320   FIYHTKYDTPDRILTDSIQRAGDNILAILKHLMMS-------KELGNFSEAHPGQMVFFD  372

Query  2298  ILGRYMVVYP  2327
             +LG  MV YP
Sbjct  373   LLGMVMVAYP  382



>ref|XP_006788986.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Neolamprologus 
brichardi]
Length=888

 Score =   204 bits (519),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 177/328 (54%), Gaps = 23/328 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H++ ++  GP P+GS   +   + Y+L+  E I+ E A G   + +++    
Sbjct  86    FNAVRARQHLEQITSAGPRPVGSQENEVLTVGYLLKQIEDIQVETAAGPHQLTIDI---Q  142

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                 T       G T  Y  + ++ +RL PK  A  L         +L + H DTV  + 
Sbjct  143   RPTGTFSIDFLGGFTSFYDHITNIAVRLEPKGGAQHL---------MLANCHFDTVANSP  193

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV   L+ Q+T   N+ VIFLFN  EE  L  +H F+TQHPW   VR
Sbjct  194   GASDDAVSCAVMLEVLHSLANQSTPL-NHGVIFLFNGAEENVLQASHGFITQHPWAKQVR  252

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF++
Sbjct  253   AFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFRI  312

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             +++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A S       
Sbjct  313   FRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKYLAMS-------  365

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             + L+         +V+FD+LG  +V YP
Sbjct  366   EKLADSSEYRHGNMVFFDLLGVIVVAYP  393



>ref|XP_007230682.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Astyanax 
mexicanus]
Length=893

 Score =   204 bits (519),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 194/377 (51%), Gaps = 32/377 (8%)
 Frame = +3

Query  1212  EGNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKAL  1391
             E  + + S    V+L    VC  W +       L   L     GE  FS   A  H++ +
Sbjct  51    EAGLQQLSEAAAVLLLGLFVCAQWALVQMSVHQL---LVGTHTGE--FSSERARKHLEHI  105

Query  1392  SQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGD---VNVDVEVFHANSGVNTLVGGLY  1559
             + +GP P+GS   +   + Y+LQ  E ++ E+      V VDV+    +  ++ L GG  
Sbjct  106   TSVGPRPVGSVENEVLTVNYLLQQVELVQAESAAGPHAVTVDVQRPTGSFSIDFL-GGF-  163

Query  1560  FGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAV  1739
                T  Y  + ++ ++L PK+ A            +L + H D+V  + GA DD+ + AV
Sbjct  164   ---TSYYDRVTNIAVKLEPKTGAQHF---------MLANCHFDSVANSPGASDDAVSCAV  211

Query  1740  MLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIG  1919
             MLEV R ++  +T    + VIFLFN  EE  L  +H F+TQHPW   VR  ++LEA G+G
Sbjct  212   MLEVLRSMANLSTPL-THGVIFLFNGAEENVLQASHGFITQHPWAKQVRAFVNLEAAGVG  270

Query  1920  GKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLD  2096
             GK  +FQ GP +PW +Q +   AK+P   VV Q++F SG+I S TDF++Y++   + G+D
Sbjct  271   GKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGIIPSDTDFRIYRDFGNIPGID  330

Query  2097  FAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDE  2276
              AF ++  +YHTK D    +   S+Q  G+N+L  L     S       + L+       
Sbjct  331   LAFIENGFIYHTKYDTPDRIHTDSIQRAGDNILAVLKHLVMS-------EKLADSSEYRH  383

Query  2277  DTVVYFDILGRYMVVYP  2327
               +V+FD+LG  +V YP
Sbjct  384   GNMVFFDLLGVVVVAYP  400



>ref|XP_008101553.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Anolis carolinensis]
Length=713

 Score =   202 bits (514),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 201/375 (54%), Gaps = 31/375 (8%)
 Frame = +3

Query  1215  GNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALS  1394
             G+   RSG   VVL  +     WL       +  + L     G   FS   A  +++ ++
Sbjct  19    GSWRCRSGAWRVVLLLY-----WLALRGLVHLSFQRLVQSARGPKEFSAPRARAYLENIT  73

Query  1395  QLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTL--VGGLYFG  1565
              +GP  +GS   +   + Y+L+  + I+ E+    N+ V+V    +G  +L  +GG    
Sbjct  74    AIGPRAVGSPENEVFTVNYLLEQVKAIERESSRAHNISVDV-QRPTGTFSLDFLGGF---  129

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
              T  Y ++ +VV++L P+S A         E A+L + H D+V    GA DD+ + +VML
Sbjct  130   -TSYYDNITNVVVKLEPRSGA---------EHAVLSNCHFDSVTNTLGASDDAVSCSVML  179

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+   LSK +   K+ +VIFLFN  EE  L  +H F+TQH W  +VR  ++LEA G+GGK
Sbjct  180   EILHALSKSSEPLKH-AVIFLFNGAEESILQASHGFITQHHWAKSVRAFVNLEAAGVGGK  238

Query  1926  SGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFA  2102
               +FQ GP +PW +  +   AK+P G +++Q++F SG+I + TDF++Y++   + G+D A
Sbjct  239   ELVFQTGPENPWLVYAYISAAKHPFGCIMAQEVFQSGIIPAETDFRIYRDFGNIPGIDLA  298

Query  2103  FTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDT  2282
             F ++  +YHTK D    +   S+Q  G+N+L  L   A+S  L   ++            
Sbjct  299   FIENGYIYHTKFDTADRILTDSIQRAGDNILGVLKYLATSDKLARSHEY-------RHGN  351

Query  2283  VVYFDILGRYMVVYP  2327
             VV+FDI G +++ YP
Sbjct  352   VVFFDIFGMFVLAYP  366



>ref|XP_001365350.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Monodelphis domestica]
Length=899

 Score =   203 bits (517),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 190/338 (56%), Gaps = 24/338 (7%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVN  1499
             L A       F+ + A N+++ ++ +GP   GS   +   + Y+L+  + I+ E+     
Sbjct  92    LPAVSGPRPEFNALRARNYLEHITSIGPRTTGSLENEVLTVNYLLEQIKLIRAESNSIHK  151

Query  1500  VDVEVFHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVS  1676
             + ++V H     +   +GG     T  Y ++ +VV++L PK+ A         + A+L +
Sbjct  152   ISIDVQHPTGSFSIDFLGGF----TSYYDNITNVVVKLEPKNGA---------QHAVLSN  198

Query  1677  AHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFV  1856
              H D+V  + GA DD+ + +VMLE+ R +S  +   ++ +VIFLFN  EE  L  +H F+
Sbjct  199   CHFDSVANSPGASDDAVSCSVMLEILRVMSTSSEALQH-AVIFLFNGAEENVLQASHGFI  257

Query  1857  TQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSG  2033
             TQHPW N +R  I+LEA G+GGK  +FQ GP +PW +Q +A  AK+P   VV+Q++F SG
Sbjct  258   TQHPWANLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYALSAKHPFASVVAQEVFQSG  317

Query  2034  VIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQA  2213
             +I S TDF++Y++   + G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   
Sbjct  318   IIPSDTDFRIYRDFGSIPGIDLAFIENGYIYHTRYDTPDRILTDSIQRAGDNILAVLKYL  377

Query  2214  ASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             A+S         L++        +V+FD+LG +++ YP
Sbjct  378   ATSDR-------LASSFEYRHGNMVFFDVLGLFVIAYP  408



>ref|XP_005488226.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum metallopeptidase 
1 [Zonotrichia albicollis]
Length=885

 Score =   203 bits (517),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/333 (35%), Positives = 186/333 (56%), Gaps = 24/333 (7%)
 Frame = +3

Query  1338  AGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEV  1514
             AG   FS   A  ++  ++ +GP  +GS   +  A+ Y+L+   GI+ E+     + V++
Sbjct  83    AGPRDFSASRARGYLDNITAIGPRTVGSPENEVLAVNYLLEQIRGIERESTDAHKISVDI  142

Query  1515  FHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDT  1691
                    +   +GG     T  Y+++ +VV++L P++ A         E A+L + H D+
Sbjct  143   QRPTGSFSIDFLGGF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDS  189

Query  1692  VFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPW  1871
             V    GA DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W
Sbjct  190   VPNTPGASDDAVSCAVMLEILNTLSKSSQSLQH-AVIFLFNGAEENILQASHGFITQHEW  248

Query  1872  INTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSS  2048
               ++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + 
Sbjct  249   AKSIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGIIPAD  308

Query  2049  TDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSD  2228
             TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  
Sbjct  309   TDFRIYRDFGNVPGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILAVLKYLATS--  366

Query  2229  LPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
                  + L+         VV+FDILG +++ YP
Sbjct  367   -----EKLAKSFEYRHGNVVFFDILGLFVLAYP  394



>ref|XP_007649811.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Cricetulus 
griseus]
 ref|XP_007626106.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Cricetulus 
griseus]
Length=803

 Score =   202 bits (515),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 192/326 (59%), Gaps = 26/326 (8%)
 Frame = +3

Query  1362  VAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSG  1532
             V  M++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VD++    +  
Sbjct  9     VPPMDYLEHITAIGPRTTGSAENEILTVQYLLEQIKLIERQSSSLHRISVDIQRPTGSFS  68

Query  1533  VNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGA  1712
             ++ L GG     T  Y ++ +VV++L P+S A         + A+L + H D+V  + GA
Sbjct  69    IDFL-GGF----TSYYDNITNVVVKLEPRSGA---------QHAVLANCHFDSVANSPGA  114

Query  1713  GDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVA  1892
              DD+ + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +R  
Sbjct  115   SDDAVSCAVMLEVLRGMSVSSEPLQH-AVVFLFNGAEENVLQASHGFITQHPWASLIRAF  173

Query  1893  IDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYK  2069
             I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y+
Sbjct  174   INLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYR  233

Query  2070  EVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKT  2249
             +   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+      
Sbjct  234   DFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILA-VLKYLATSDM------  286

Query  2250  LSTGKSEDEDTVVYFDILGRYMVVYP  2327
             L++        VV+FD+ G  ++ YP
Sbjct  287   LASSSEYRHGNVVFFDVFGLLVIAYP  312



>ref|XP_010120214.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like, partial 
[Chlamydotis macqueenii]
Length=403

 Score =   195 bits (496),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 187/322 (58%), Gaps = 26/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSGVNTL  1544
              ++  ++ +GP  +GS   +  A+ Y+LQ    I+ E+     ++VD++    +  ++ L
Sbjct  1     RYLDNITAIGPRTVGSPENEVLAVNYLLQQIRAIERESTDVHKISVDIQRPTGSFSIDFL  60

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y+++ ++V++L P++ A         E A+L + H D+V    GA DD+
Sbjct  61    -GGF----TSYYANITNIVVKLEPRNGA---------EHAVLCNCHFDSVPNTPGASDDA  106

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I+LE
Sbjct  107   VSCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFINLE  165

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + TDF++Y++   
Sbjct  166   AAGVGGKELVFQTGPENPWLVQAYVAAAKHPFASVVAQEIFQSGIIPADTDFRIYRDFGN  225

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD    +     G
Sbjct  226   VPGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILA-VLKYLATSDKLAKSFEYRHG  284

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
             K      VV+FD+LG +++ YP
Sbjct  285   K------VVFFDVLGLFVLAYP  300



>ref|XP_008849413.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Nannospalax 
galili]
Length=897

 Score =   203 bits (517),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/341 (33%), Positives = 192/341 (56%), Gaps = 26/341 (8%)
 Frame = +3

Query  1350  GFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFH  1520
             GF  +A+ ++++ ++ +GP   GS   +   +QY+L   + I  +  +   ++VD++   
Sbjct  99    GFLLIASRDYLEHITSIGPRTTGSAENEILTVQYLLDQIKLIEVQSNSLHKISVDIQRPT  158

Query  1521  ANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFA  1700
              +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  
Sbjct  159   GSFSIDFL-GGF----TSYYDNITNVVVKLEPQDGA---------QHAVLANCHFDSVAN  204

Query  1701  AEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINT  1880
             + GA DD+ + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQHPW + 
Sbjct  205   SPGASDDAVSCAVMLEVLRGMSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASL  263

Query  1881  VRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDF  2057
             +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF
Sbjct  264   IRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDF  323

Query  2058  QVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPT  2237
             ++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S     
Sbjct  324   RIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKHLATSD----  379

Query  2238  PNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
                 L++        +V+FD+ G +++ YP     + +  V
Sbjct  380   ---MLASSSEYQHGNMVFFDVFGLFVIAYPSRVGSIINYMV  417



>ref|XP_006863819.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Chrysochloris 
asiatica]
Length=899

 Score =   203 bits (517),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 199/346 (58%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F    A N+++ ++ +GP   GS   +   ++Y+L+  + I+E++     + VD
Sbjct  96    AGSHGEFDARHARNYLEHITSIGPRTTGSPENEILTVRYLLEQIKVIEEQSNRVHKITVD  155

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             ++    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  156   IQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRRGA---------QHAVLANCHF  201

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS     F +++VIFLFN  EE  L  +H F+TQH
Sbjct  202   DSVPNSPGASDDAVSCSVMLEVLRVLSTSPEAF-HHAVIFLFNGAEENVLQASHGFITQH  260

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW +++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  261   PWASSIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  320

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF+++++   + G+D AF ++  +YHTK D    ++  S+Q  G+N+L  +L+  ++
Sbjct  321   SDTDFRIFRDFGNIPGIDLAFIENGYIYHTKYDTADRIQTDSIQRAGDNILA-VLKYLAT  379

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             SD+      L++        +V+FD+ G +++ YP     + +  V
Sbjct  380   SDM------LASSSKYQHGNMVFFDVFGLFVIAYPSRVGSIINYMV  419



>ref|XP_008286026.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Stegastes partitus]
Length=496

 Score =   197 bits (502),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 179/329 (54%), Gaps = 25/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H++ ++ +GP P+GS   +   + Y+L+  E I+ E A G   + V+V    
Sbjct  86    FNAVRARLHLEQITSVGPRPVGSQENEVLTVGYLLEQIEKIRLETAAGPHQLTVDVQRPT  145

Query  1527  SGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
                +   +GG     T  Y  + ++ +RL PKS    L         +L + H D+V  +
Sbjct  146   GSFSIDFLGGF----TSFYDRVTNIAVRLEPKSGTQHL---------MLANCHFDSVANS  192

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + AVMLEV   L+ Q++   ++ VIFLFN  EE  L  +H F+TQHPW   V
Sbjct  193   PGASDDAVSCAVMLEVLHSLANQSSPL-HHGVIFLFNGAEENVLQASHGFITQHPWAKQV  251

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SG+I S TDF+
Sbjct  252   RAFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGIIPSDTDFR  311

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L     S      
Sbjct  312   IYRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKYLVMS------  365

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              + L+         +V+FD+LG  +V YP
Sbjct  366   -EKLADSSEYRHGNMVFFDLLGVVVVAYP  393



>gb|EGW00424.1| Endoplasmic reticulum metallopeptidase 1 [Cricetulus griseus]
Length=676

 Score =   201 bits (511),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 198/336 (59%), Gaps = 27/336 (8%)
 Frame = +3

Query  1332  EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNV  1502
             E+ G  G+  + ++++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++V
Sbjct  5     EQEGRGGYL-LLSVDYLEHITAIGPRTTGSAENEILTVQYLLEQIKLIERQSSSLHRISV  63

Query  1503  DVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAH  1682
             D++    +  ++ L GG     T  Y ++ +VV++L P+S A         + A+L + H
Sbjct  64    DIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRSGA---------QHAVLANCH  109

Query  1683  VDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQ  1862
              D+V  + GA DD+ + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQ
Sbjct  110   FDSVANSPGASDDAVSCAVMLEVLRGMSVSSEPLQH-AVVFLFNGAEENVLQASHGFITQ  168

Query  1863  HPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVI  2039
             HPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I
Sbjct  169   HPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGII  228

Query  2040  KSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAAS  2219
              S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  +
Sbjct  229   PSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILA-VLKYLA  287

Query  2220  SSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +SD+      L++        VV+FD+ G  ++ YP
Sbjct  288   TSDM------LASSSEYRHGNVVFFDVFGLLVIAYP  317



>ref|XP_010891145.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Esox lucius]
Length=885

 Score =   203 bits (516),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 130/374 (35%), Positives = 201/374 (54%), Gaps = 35/374 (9%)
 Frame = +3

Query  1221  MAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQL  1400
             + E  G  +V +F  V+ G  LV  S    L + +  +  GE  F+ V A  H++ ++ +
Sbjct  47    LHEGVGVALVTVFIVVLWG--LVHLS----LQQLVIGKSTGE--FNAVRARKHLERITSV  98

Query  1401  GPHPLGSTALDT-ALQYVLQVAEGIKEEAFG---DVNVDVEVFHANSGVNTLVGGLYFGK  1568
             GP P+GS   +   + ++L+  E IK ++      V VDV+    +  ++ L GG     
Sbjct  99    GPRPVGSRENEVLTVNFLLEQIEHIKADSASGPHSVTVDVQKPTGSFSIDFL-GGF----  153

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             T  Y  + ++ +RL PK+ A  L         +L + H D+V  + GA DD+ + AVMLE
Sbjct  154   TSYYDKVSNIAVRLEPKAGAQHL---------MLANCHFDSVANSPGASDDAVSCAVMLE  204

Query  1749  VARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKS  1928
             V   L+  +T  ++  V+FLFN  EE  L  +H F+TQHPW   VR  I+LEA G+GGK 
Sbjct  205   VLHSLANLSTPLRHG-VVFLFNGAEENVLQASHGFITQHPWAKQVRAFINLEAAGVGGKE  263

Query  1929  GIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
              +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF++Y++   + G+D AF
Sbjct  264   VVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFRIYRDFGNIPGIDLAF  323

Query  2106  TDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTV  2285
              ++  +YHTK D    +   S+Q  G+N+L  L   A S +       L+         +
Sbjct  324   IENGFIYHTKYDTPDRILTDSIQRAGDNILAVLKHLAMSVE-------LADSSQYRHGNM  376

Query  2286  VYFDILGRYMVVYP  2327
             V+FD+LG  +V YP
Sbjct  377   VFFDLLGMVVVAYP  390



>ref|XP_010736608.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Larimichthys 
crocea]
Length=888

 Score =   203 bits (516),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 181/336 (54%), Gaps = 25/336 (7%)
 Frame = +3

Query  1329  AEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNV  1502
              + +GE  F+ V A  H++ ++ +GP P+GS   +   + Y+LQ  E I+ E A G   +
Sbjct  80    GKPSGE--FNAVRARRHLEQITSVGPRPVGSHENEVLTVGYLLQQIENIRVETAAGPHQL  137

Query  1503  DVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAH  1682
              V+V        T       G T  Y  + ++ +RL PK     L         +L + H
Sbjct  138   TVDV---QRPTGTFSIDFLGGFTSFYDRVTNIAVRLEPKGGTQHL---------MLANCH  185

Query  1683  VDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQ  1862
              DTV  + GA DD+ + AVMLEV   L+ Q+T   ++ V+FLFN  EE  L  +H F+TQ
Sbjct  186   FDTVANSPGASDDAVSCAVMLEVLHSLANQSTPL-HHGVVFLFNGAEENILQASHGFITQ  244

Query  1863  HPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVI  2039
             HPW   VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SG+I
Sbjct  245   HPWAKQVRAFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGII  304

Query  2040  KSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAAS  2219
              S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +
Sbjct  305   PSDTDFRIYRDFGNIPGIDLAFIENGFIYHTKYDTADRILTDSIQRAGDNILAVLRYLLT  364

Query  2220  SSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             S       + L+         +V+FD+LG  +V YP
Sbjct  365   S-------EKLADSSEYRHGNMVFFDLLGVVVVAYP  393



>ref|XP_002091797.1| GE12041 [Drosophila yakuba]
 gb|EDW91509.1| GE12041 [Drosophila yakuba]
Length=867

 Score =   202 bits (515),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 206/388 (53%), Gaps = 36/388 (9%)
 Frame = +3

Query  1197  KSYTIEGNMAERS---GYEIVVLFTFVVCGTWLVFYSQFKV-----LPEPLSAEEAGE--  1346
             K    + N  ER+   G +I   +     G WL+ Y    +     LP PL+ ++     
Sbjct  8     KRSKAQPNGCERAFVRGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEATHP  67

Query  1347  TGFSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEEAFGDVNVDVEVFHA  1523
               F    A  +++ L  LGP  +GS   +  AL+ + Q  + I+     D+ VDV+V   
Sbjct  68    DQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDIEVDVQVASG  127

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +         +++    +Y  ++++V+++SPK++        +    +LV++H D+V A 
Sbjct  128   SY--------VHWSMVNMYQSIQNIVVKISPKNS--------NSTTYLLVNSHYDSVPAG  171

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GAGDD S VA M+EV R L+K     KN  V+FLFN  EE  L  +H+F+TQH W    
Sbjct  172   PGAGDDGSMVATMMEVLRVLAKSDKPLKN-PVVFLFNGAEENPLQASHAFITQHKWAKYC  230

Query  1884  RVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             +  I+L++ G GG+  +FQ+GP+ PW ++N+ +  K+P    + ++LF    I S TDF+
Sbjct  231   KALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFR  290

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             ++++   + GLD A+T +  VYHT++D   +   GS QH G+NLL  + Q A+S ++   
Sbjct  291   IFRDHGSVPGLDMAYTYNGFVYHTRHDTAEIFPRGSFQHTGDNLLALVRQIANSPEIENS  350

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
              K  + G +      +YFD++G ++V Y
Sbjct  351   AK-YAKGHT------IYFDVMGWFLVFY  371



>ref|XP_005941603.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X1 [Haplochromis burtoni]
Length=888

 Score =   202 bits (515),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 177/328 (54%), Gaps = 23/328 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H++ ++  GP P+GS   +   + Y+L+  + I+ E A G   + +++    
Sbjct  86    FNAVRARQHLEQITSAGPRPVGSQENEVLTVGYLLKQIKDIQVETAAGPHQLSIDI---Q  142

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                 T       G T  Y  + ++ +RL PK  A  L         +L + H DTV  + 
Sbjct  143   RPTGTFSIDFLGGFTSFYDHITNIAVRLEPKGGAQHL---------MLANCHFDTVANSP  193

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV   L+ Q+T   N+ VIFLFN  EE  L  +H F+TQHPW   VR
Sbjct  194   GASDDAVSCAVMLEVLHSLANQSTPL-NHGVIFLFNGAEENVLQASHGFITQHPWAKQVR  252

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF++
Sbjct  253   AFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFRI  312

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             +++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A S       
Sbjct  313   FRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKYLAMS-------  365

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             + L+         +V+FD+LG  +V YP
Sbjct  366   EKLADSSEYRHGNMVFFDLLGVIVVAYP  393



>ref|XP_001947171.2| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Acyrthosiphon 
pisum]
 ref|XP_008185669.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Acyrthosiphon 
pisum]
Length=904

 Score =   202 bits (515),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 196/342 (57%), Gaps = 24/342 (7%)
 Frame = +3

Query  1305  KVLPEP--LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK  1475
             K LPEP  +S E      F    A NH+  L+ +GP P+GS   +  A+Q +L   + I 
Sbjct  75    KSLPEPVTISNEHNHPDRFVAERARNHLVELTSMGPRPVGSKENEILAVQLLLDDIKTII  134

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDE  1655
             ++A     V+ ++    SG  +L      G T VY +++++V+++ P  T+         
Sbjct  135   KQADSAHKVEWDLQRV-SGAFSL--QFLDGMTNVYRNVQNIVVKIGPIQTS---------  182

Query  1656  EDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGL  1835
               ++L++ H D+V  + GA DD ++ A+MLE+ R +S+     KNN +IFLFN  EE  +
Sbjct  183   RHSLLINCHFDSVVDSPGASDDGASCAIMLELLRVISRLKIPLKNN-IIFLFNGAEENMM  241

Query  1836  NGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVS  2012
               +H F+TQH W +++R  I++EA G GGK  +FQ GP+ PW ++ ++    YP    ++
Sbjct  242   QASHGFITQHQWASSIRAFINMEACGAGGKEILFQVGPNHPWLLEAYSDAVPYPLASSMA  301

Query  2013  QDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENL  2192
             Q++F SG+I   TD++++++   +SGLDFA++ +  VYHTK+D V  +  G+ Q  G+N+
Sbjct  302   QEIFQSGIIPGDTDYRIFRDFGRVSGLDFAWSANGYVYHTKSDTVDKIPLGTFQRTGDNM  361

Query  2193  LPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMV  2318
             LP +L+  +S  +    K  STG       +V+FD LG ++V
Sbjct  362   LPLILKLVNSVQISDVEK-YSTGN------LVFFDFLGIFIV  396



>gb|EDL41687.1| mCG124990, isoform CRA_a [Mus musculus]
Length=850

 Score =   202 bits (514),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 192/339 (57%), Gaps = 26/339 (8%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGD  1493
             LS     +  F    A ++++ ++ +GP   GST  +   +QY+L+  + I+ ++     
Sbjct  91    LSRTSGLQGEFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHS  150

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILV  1673
             ++VD++    +  ++ L GG     T  Y ++ +VV++L P+  A         E AIL 
Sbjct  151   ISVDIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------ESAILA  196

Query  1674  SAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSF  1853
             + H D+V  + GA DD+ + AVMLEV R +S      ++ +V+FLFN  EE  L  +H F
Sbjct  197   NCHFDSVANSPGASDDAVSCAVMLEVLRVMSASPEPMQH-AVVFLFNGAEENVLQASHGF  255

Query  1854  VTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSS  2030
             +TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F S
Sbjct  256   ITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQS  315

Query  2031  GVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQ  2210
             G+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L  
Sbjct  316   GIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKH  375

Query  2211  AASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              A+S        TL++       ++V+FD+LG  ++ YP
Sbjct  376   LATSD-------TLASSSEYRHGSMVFFDVLGLLVIAYP  407



>ref|NP_001074682.1| endoplasmic reticulum metallopeptidase 1 [Mus musculus]
 sp|Q3UVK0.2|ERMP1_MOUSE RecName: Full=Endoplasmic reticulum metallopeptidase 1; AltName: 
Full=Felix-ina [Mus musculus]
 gb|AAI56221.1| Endoplasmic reticulum metallopeptidase 1, partial [synthetic 
construct]
 gb|AAI56969.1| Endoplasmic reticulum metallopeptidase 1 [synthetic construct]
 gb|AAI51183.1| Endoplasmic reticulum metallopeptidase 1 [Mus musculus]
 gb|AAI51182.1| Endoplasmic reticulum metallopeptidase 1 [Mus musculus]
 gb|AAI57915.1| Endoplasmic reticulum metallopeptidase 1 [Mus musculus]
Length=898

 Score =   202 bits (515),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 192/339 (57%), Gaps = 26/339 (8%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGD  1493
             LS     +  F    A ++++ ++ +GP   GST  +   +QY+L+  + I+ ++     
Sbjct  91    LSRTSGLQGEFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHS  150

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILV  1673
             ++VD++    +  ++ L GG     T  Y ++ +VV++L P+  A         E AIL 
Sbjct  151   ISVDIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------ESAILA  196

Query  1674  SAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSF  1853
             + H D+V  + GA DD+ + AVMLEV R +S      ++ +V+FLFN  EE  L  +H F
Sbjct  197   NCHFDSVANSPGASDDAVSCAVMLEVLRVMSASPEPMQH-AVVFLFNGAEENVLQASHGF  255

Query  1854  VTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSS  2030
             +TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F S
Sbjct  256   ITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQS  315

Query  2031  GVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQ  2210
             G+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L  
Sbjct  316   GIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKH  375

Query  2211  AASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              A+S        TL++       ++V+FD+LG  ++ YP
Sbjct  376   LATS-------DTLASSSEYRHGSMVFFDVLGLLVIAYP  407



>dbj|BAE23269.1| unnamed protein product [Mus musculus]
Length=898

 Score =   202 bits (515),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 192/339 (57%), Gaps = 26/339 (8%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGD  1493
             LS     +  F    A ++++ ++ +GP   GST  +   +QY+L+  + I+ ++     
Sbjct  91    LSRTSGLQGEFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHS  150

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILV  1673
             ++VD++    +  ++ L GG     T  Y ++ +VV++L P+  A         E AIL 
Sbjct  151   ISVDIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------ESAILA  196

Query  1674  SAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSF  1853
             + H D+V  + GA DD+ + AVMLEV R +S      ++ +V+FLFN  EE  L  +H F
Sbjct  197   NCHFDSVANSPGASDDAVSCAVMLEVLRVMSASPEPMQH-AVVFLFNGAEENVLQASHGF  255

Query  1854  VTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSS  2030
             +TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F S
Sbjct  256   ITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQS  315

Query  2031  GVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQ  2210
             G+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L  
Sbjct  316   GIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKH  375

Query  2211  AASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              A+S        TL++       ++V+FD+LG  ++ YP
Sbjct  376   LATS-------DTLASSSEYRHGSMVFFDVLGLLVIAYP  407



>ref|XP_006527053.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Mus musculus]
Length=899

 Score =   202 bits (515),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 192/339 (57%), Gaps = 26/339 (8%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGD  1493
             LS     +  F    A ++++ ++ +GP   GST  +   +QY+L+  + I+ ++     
Sbjct  91    LSRTSGLQGEFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHS  150

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILV  1673
             ++VD++    +  ++ L GG     T  Y ++ +VV++L P+  A         E AIL 
Sbjct  151   ISVDIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------ESAILA  196

Query  1674  SAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSF  1853
             + H D+V  + GA DD+ + AVMLEV R +S      ++ +V+FLFN  EE  L  +H F
Sbjct  197   NCHFDSVANSPGASDDAVSCAVMLEVLRVMSASPEPMQH-AVVFLFNGAEENVLQASHGF  255

Query  1854  VTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSS  2030
             +TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F S
Sbjct  256   ITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQS  315

Query  2031  GVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQ  2210
             G+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L  
Sbjct  316   GIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKH  375

Query  2211  AASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              A+S        TL++       ++V+FD+LG  ++ YP
Sbjct  376   LATSD-------TLASSSEYRHGSMVFFDVLGLLVIAYP  407



>ref|XP_005522813.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Pseudopodoces 
humilis]
Length=885

 Score =   202 bits (514),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/333 (35%), Positives = 186/333 (56%), Gaps = 24/333 (7%)
 Frame = +3

Query  1338  AGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEV  1514
             AG   FS   A  ++  ++ +GP  +GS   +  A+ Y+L+   GI+ E+     + V++
Sbjct  83    AGPRDFSASRARGYLDNITAIGPRTVGSPENEVLAVNYLLEQIRGIERESTDAHKISVDI  142

Query  1515  FHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDT  1691
                    +   +GG     T  Y+++ +VV++L P++ A         E A+L + H D+
Sbjct  143   QRPTGSFSIDFLGGF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDS  189

Query  1692  VFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPW  1871
             V    GA DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W
Sbjct  190   VPNTPGASDDAVSCAVMLEILNTLSKSSESLQH-AVIFLFNGAEENILQASHGFITQHEW  248

Query  1872  INTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSS  2048
               +VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + 
Sbjct  249   AKSVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGIIPAD  308

Query  2049  TDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSD  2228
             TDF++Y++   + G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S  
Sbjct  309   TDFRIYRDFGNVPGIDLAFIENGYIYHTEYDTSDRILTDSIQRAGDNILAVLKYLATS--  366

Query  2229  LPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
                  + L+         VV+FDILG +++ YP
Sbjct  367   -----EKLAKSFEYRHGNVVFFDILGLFVLAYP  394



>dbj|BAC98257.1| mKIAA1815 protein [Mus musculus]
Length=895

 Score =   202 bits (514),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 192/339 (57%), Gaps = 26/339 (8%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGD  1493
             LS     +  F    A ++++ ++ +GP   GST  +   +QY+L+  + I+ ++     
Sbjct  88    LSRTSGLQGEFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHS  147

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILV  1673
             ++VD++    +  ++ L GG     T  Y ++ +VV++L P+  A         E AIL 
Sbjct  148   ISVDIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------ESAILA  193

Query  1674  SAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSF  1853
             + H D+V  + GA DD+ + AVMLEV R +S      ++ +V+FLFN  EE  L  +H F
Sbjct  194   NCHFDSVANSPGASDDAVSCAVMLEVLRVMSASPEPMQH-AVVFLFNGAEENVLQASHGF  252

Query  1854  VTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSS  2030
             +TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F S
Sbjct  253   ITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQS  312

Query  2031  GVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQ  2210
             G+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L  
Sbjct  313   GIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKH  372

Query  2211  AASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              A+S        TL++       ++V+FD+LG  ++ YP
Sbjct  373   LATSD-------TLASSSEYRHGSMVFFDVLGLLVIAYP  404



>gb|EDL41688.1| mCG124990, isoform CRA_b [Mus musculus]
Length=918

 Score =   202 bits (515),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 192/339 (57%), Gaps = 26/339 (8%)
 Frame = +3

Query  1323  LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGD  1493
             LS     +  F    A ++++ ++ +GP   GST  +   +QY+L+  + I+ ++     
Sbjct  111   LSRTSGLQGEFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHS  170

Query  1494  VNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILV  1673
             ++VD++    +  ++ L GG     T  Y ++ +VV++L P+  A         E AIL 
Sbjct  171   ISVDIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------ESAILA  216

Query  1674  SAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSF  1853
             + H D+V  + GA DD+ + AVMLEV R +S      ++ +V+FLFN  EE  L  +H F
Sbjct  217   NCHFDSVANSPGASDDAVSCAVMLEVLRVMSASPEPMQH-AVVFLFNGAEENVLQASHGF  275

Query  1854  VTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSS  2030
             +TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F S
Sbjct  276   ITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQS  335

Query  2031  GVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQ  2210
             G+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L  
Sbjct  336   GIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILAVLKH  395

Query  2211  AASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              A+S        TL++       ++V+FD+LG  ++ YP
Sbjct  396   LATSD-------TLASSSEYRHGSMVFFDVLGLLVIAYP  427



>ref|XP_010619131.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Fukomys 
damarensis]
Length=793

 Score =   201 bits (512),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/323 (35%), Positives = 191/323 (59%), Gaps = 26/323 (8%)
 Frame = +3

Query  1371  MNHVKALSQLGPHPLGSTALDT-ALQYVLQVAE--GIKEEAFGDVNVDVEVFHANSGVNT  1541
             M++++ ++ +GP   GS   +   + Y+L+  +   I+  +   ++VDV+    +  ++ 
Sbjct  1     MDYLEHITAIGPRTTGSPENEILTVHYLLEQIKLIEIQSSSLHKISVDVQRPTGSFSIDF  60

Query  1542  LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDD  1721
             L GG     T  Y ++ +VV++L P++ A         + A+L + H D+V ++ GA DD
Sbjct  61    L-GGF----TSYYDNITNVVVKLEPRNGA---------QHAVLANCHFDSVPSSPGASDD  106

Query  1722  SSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDL  1901
             + + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW N +R  I+L
Sbjct  107   AVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWANLIRAFINL  165

Query  1902  EAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVA  2078
             EA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF++Y++  
Sbjct  166   EAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFRIYRDFG  225

Query  2079  GLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLST  2258
              + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   +     
Sbjct  226   NIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAFSSEYRH  284

Query  2259  GKSEDEDTVVYFDILGRYMVVYP  2327
             GK      +V+FD+LG +++ YP
Sbjct  285   GK------MVFFDVLGLFVIAYP  301



>gb|ERE77128.1| endoplasmic reticulum metallopeptidase 1-like protein [Cricetulus 
griseus]
Length=780

 Score =   201 bits (511),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 198/336 (59%), Gaps = 27/336 (8%)
 Frame = +3

Query  1332  EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNV  1502
             E+ G  G+  + ++++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++V
Sbjct  109   EQEGRGGYL-LLSVDYLEHITAIGPRTTGSAENEILTVQYLLEQIKLIERQSSSLHRISV  167

Query  1503  DVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAH  1682
             D++    +  ++ L GG     T  Y ++ +VV++L P+S A         + A+L + H
Sbjct  168   DIQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRSGA---------QHAVLANCH  213

Query  1683  VDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQ  1862
              D+V  + GA DD+ + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQ
Sbjct  214   FDSVANSPGASDDAVSCAVMLEVLRGMSVSSEPLQH-AVVFLFNGAEENVLQASHGFITQ  272

Query  1863  HPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVI  2039
             HPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I
Sbjct  273   HPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGII  332

Query  2040  KSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAAS  2219
              S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  +
Sbjct  333   PSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILA-VLKYLA  391

Query  2220  SSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +SD+      L++        VV+FD+ G  ++ YP
Sbjct  392   TSDM------LASSSEYRHGNVVFFDVFGLLVIAYP  421



>gb|ERE77126.1| endoplasmic reticulum metallopeptidase 1-like protein [Cricetulus 
griseus]
Length=927

 Score =   202 bits (514),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 193/326 (59%), Gaps = 26/326 (8%)
 Frame = +3

Query  1362  VAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSG  1532
             +A+ ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VD++    +  
Sbjct  133   IASRDYLEHITAIGPRTTGSAENEILTVQYLLEQIKLIERQSSSLHRISVDIQRPTGSFS  192

Query  1533  VNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGA  1712
             ++ L GG     T  Y ++ +VV++L P+S A         + A+L + H D+V  + GA
Sbjct  193   IDFL-GGF----TSYYDNITNVVVKLEPRSGA---------QHAVLANCHFDSVANSPGA  238

Query  1713  GDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVA  1892
              DD+ + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +R  
Sbjct  239   SDDAVSCAVMLEVLRGMSVSSEPLQH-AVVFLFNGAEENVLQASHGFITQHPWASLIRAF  297

Query  1893  IDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYK  2069
             I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y+
Sbjct  298   INLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYR  357

Query  2070  EVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKT  2249
             +   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+      
Sbjct  358   DFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILA-VLKYLATSDM------  410

Query  2250  LSTGKSEDEDTVVYFDILGRYMVVYP  2327
             L++        VV+FD+ G  ++ YP
Sbjct  411   LASSSEYRHGNVVFFDVFGLLVIAYP  436



>gb|ERE77125.1| endoplasmic reticulum metallopeptidase 1-like protein [Cricetulus 
griseus]
Length=928

 Score =   202 bits (514),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 193/326 (59%), Gaps = 26/326 (8%)
 Frame = +3

Query  1362  VAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSG  1532
             +A+ ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VD++    +  
Sbjct  133   IASRDYLEHITAIGPRTTGSAENEILTVQYLLEQIKLIERQSSSLHRISVDIQRPTGSFS  192

Query  1533  VNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGA  1712
             ++ L GG     T  Y ++ +VV++L P+S A         + A+L + H D+V  + GA
Sbjct  193   IDFL-GGF----TSYYDNITNVVVKLEPRSGA---------QHAVLANCHFDSVANSPGA  238

Query  1713  GDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVA  1892
              DD+ + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +R  
Sbjct  239   SDDAVSCAVMLEVLRGMSVSSEPLQH-AVVFLFNGAEENVLQASHGFITQHPWASLIRAF  297

Query  1893  IDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYK  2069
             I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y+
Sbjct  298   INLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYR  357

Query  2070  EVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKT  2249
             +   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+      
Sbjct  358   DFGNIPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILA-VLKYLATSDM------  410

Query  2250  LSTGKSEDEDTVVYFDILGRYMVVYP  2327
             L++        VV+FD+ G  ++ YP
Sbjct  411   LASSSEYRHGNVVFFDVFGLLVIAYP  436



>ref|XP_003216612.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Anolis carolinensis]
Length=858

 Score =   201 bits (512),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 200/375 (53%), Gaps = 31/375 (8%)
 Frame = +3

Query  1215  GNMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALS  1394
             G+   RSG   VVL  +     WL       +  + L     G   FS   A  +++ ++
Sbjct  19    GSWRCRSGAWRVVLLLY-----WLALRGLVHLSFQRLVQSARGPKEFSAPRARAYLENIT  73

Query  1395  QLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTL--VGGLYFG  1565
              +GP  +GS   +   + Y+L+  + I+ E+    N+ V+V    +G  +L  +GG    
Sbjct  74    AIGPRAVGSPENEVFTVNYLLEQVKAIERESSRAHNISVDV-QRPTGTFSLDFLGGF---  129

Query  1566  KTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVML  1745
              T  Y ++ +VV++L P+S A         E A+L + H D+V    GA DD+ + +VML
Sbjct  130   -TSYYDNITNVVVKLEPRSGA---------EHAVLSNCHFDSVTNTLGASDDAVSCSVML  179

Query  1746  EVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
             E+   LSK +   K+ +VIFLFN  EE  L  +H F+TQH W  +VR  ++LEA G+GGK
Sbjct  180   EILHALSKSSEPLKH-AVIFLFNGAEESILQASHGFITQHHWAKSVRAFVNLEAAGVGGK  238

Query  1926  SGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFA  2102
               +FQ GP +PW +  +   AK+P G +++Q++F SG+I + TDF++Y++   + G+D A
Sbjct  239   ELVFQTGPENPWLVYAYISAAKHPFGCIMAQEVFQSGIIPAETDFRIYRDFGNIPGIDLA  298

Query  2103  FTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDT  2282
             F ++  +YHTK D    +   S+Q  G+N+L  L   A+S         L+         
Sbjct  299   FIENGYIYHTKFDTADRILTDSIQRAGDNILGVLKYLATSDK-------LARSHEYRHGN  351

Query  2283  VVYFDILGRYMVVYP  2327
             VV+FDI G +++ YP
Sbjct  352   VVFFDIFGMFVLAYP  366



>ref|XP_004408048.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Odobenus 
rosmarus divergens]
Length=903

 Score =   202 bits (513),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/348 (34%), Positives = 196/348 (56%), Gaps = 30/348 (9%)
 Frame = +3

Query  1341  GETG----FSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEE--AFGDVN  1499
             G TG    F    A ++++ ++ +GP   GS   +   + Y+L+  + I+++  +   ++
Sbjct  98    GATGRHGEFDARQARDYLEHITSIGPRTTGSPENEIVTVHYLLEQIKLIEDQRNSLHRIS  157

Query  1500  VDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSA  1679
             VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + 
Sbjct  158   VDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANC  203

Query  1680  HVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVT  1859
             H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+T
Sbjct  204   HFDSVANSPGASDDAVSCSVMLEVLRVLSASSDTL-HHAVIFLFNGAEENVLQASHGFIT  262

Query  1860  QHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGV  2036
             QHPW + +R  I+LEA G+GGK  +FQ GP+ PW +Q +   AK+P   VV+Q++F SG+
Sbjct  263   QHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGI  322

Query  2037  IKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAA  2216
             I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A
Sbjct  323   IPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLA  382

Query  2217  SSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +S  LP+ +K            +V+FD+LG +++ YP     + +  V
Sbjct  383   TSDMLPSSSKY-------RHGNMVFFDVLGLFVIAYPSRVGSIINSVV  423



>ref|XP_010832132.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Bison bison 
bison]
Length=848

 Score =   201 bits (511),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/355 (33%), Positives = 200/355 (56%), Gaps = 28/355 (8%)
 Frame = +3

Query  1314  PEPLSAEEAG--ETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA  1484
             PEPL+    G   T        ++++ ++ +GP   GS   +   + Y+L+  + I+ ++
Sbjct  36    PEPLADACGGGARTRKRMCQKTDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEAQS  95

Query  1485  --FGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEE  1658
                  ++VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         +
Sbjct  96    NSLHKISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------Q  141

Query  1659  DAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLN  1838
              A+L + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L 
Sbjct  142   HAVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQ  200

Query  1839  GAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQ  2015
              +H F+TQHPW ++VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q
Sbjct  201   ASHGFITQHPWASSVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQ  260

Query  2016  DLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLL  2195
             ++F SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L
Sbjct  261   EVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNIL  320

Query  2196  PFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               +L+  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  321   A-VLKYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  368



>ref|XP_005060943.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Ficedula 
albicollis]
Length=945

 Score =   202 bits (514),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 192/347 (55%), Gaps = 26/347 (7%)
 Frame = +3

Query  1296  SQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI  1472
             S  ++L  P +A+  G   FS   A  ++  ++ +GP  +GS   +  A+ Y+L+   GI
Sbjct  131   SHRQLLSRPPAAD--GPRDFSAARARGYLDNITAIGPRTVGSPENEVLAVNYLLEQIRGI  188

Query  1473  KEEAFGDVNVDVEVFHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             + E+     + V++       +   +GG     T  Y+++ +VV++L P+  A       
Sbjct  189   ERESTDAHKISVDIQRPTGSFSIDFLGGF----TSYYANITNVVVKLEPRDGA-------  237

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
               E A+L + H D+V    GA DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE 
Sbjct  238   --EHAVLSNCHFDSVPNTPGASDDAVSCAVMLEILNTLSKSSEALQH-AVIFLFNGAEEN  294

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQV  2006
              L  +H F+TQH W  ++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   V
Sbjct  295   ILQASHGFITQHEWAKSIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASV  354

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             V+Q++F SG+I + TDF++Y++   + G+D AF ++  +YHT+ D    +   S+Q  G+
Sbjct  355   VAQEIFQSGIIPADTDFRIYRDFGNVPGIDLAFIENGYIYHTEYDTSDRILTDSIQRAGD  414

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             N+L  L   A+S       + L+         VV+FDILG +++ YP
Sbjct  415   NILAVLKYLATS-------EKLAKSFEYRHGNVVFFDILGLFVLAYP  454



>ref|XP_005983899.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Pantholops hodgsonii]
Length=808

 Score =   201 bits (510),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 200/351 (57%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG--  1490
             L     G+ G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++ G  
Sbjct  1     LRGAAVGQQGEFDAHQARDYLEHITSIGPRITGSPENEILTVHYLLEQIKLIEAQSNGLH  60

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P++ A         + A+L
Sbjct  61    KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRAGA---------QHAVL  106

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  107   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-SHAVIFLFNGAEENVLQASHG  165

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  166   FITQHPWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  225

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  226   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  284

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  285   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  329



>ref|XP_001924252.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Sus scrofa]
Length=905

 Score =   201 bits (512),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 200/346 (58%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG +G F+   A ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VD
Sbjct  102   AGHSGEFNARQARDYLEHITSIGPRTTGSVENEILTVRYLLEQIKLIEVQSNSLHKISVD  161

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  162   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  207

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LSK +    ++++IFLFN  EE  L  +H F+TQH
Sbjct  208   DSVANSPGASDDAVSCSVMLEVLRVLSKSSEAL-HHAIIFLFNGAEENVLQASHGFITQH  266

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  267   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSSAKHPFASVVAQEVFQSGIIP  326

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++
Sbjct  327   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLAT  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  386   SDM------LASSSEYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  425



>ref|XP_009978208.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Tauraco erythrolophus]
Length=646

 Score =   199 bits (505),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 185/322 (57%), Gaps = 26/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG--DVNVDVEVFHANSGVNTL  1544
              ++  L+ +GP  +GS   +  A+ Y+L+    I+ E+ G   V+VDV+    +  ++ L
Sbjct  1     RYLDNLTAIGPRTVGSPENEVLAVNYLLEQIRAIERESTGAHKVSVDVQRPTGSFSIDFL  60

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y+++ +VV++L P++ A         E A+L + H D+V    GA DD+
Sbjct  61    -GGF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDSVPNTPGASDDA  106

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  +VR  I+LE
Sbjct  107   VSCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSVRAFINLE  165

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SGVI + TDF++Y++   
Sbjct  166   AAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGVIPAETDFRIYRDFGN  225

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S         L+  
Sbjct  226   VPGIDLAFIENGYIYHTEYDTSDRILTDSIQRAGDNILAVLKYLATSDK-------LAKS  278

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
                   +VV+FD+LG +++ YP
Sbjct  279   SEYRHGSVVFFDVLGLFVLAYP  300



>gb|KFV00106.1| Endoplasmic reticulum metallopeptidase 1, partial [Tauraco erythrolophus]
Length=646

 Score =   199 bits (505),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 185/322 (57%), Gaps = 26/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG--DVNVDVEVFHANSGVNTL  1544
              ++  L+ +GP  +GS   +  A+ Y+L+    I+ E+ G   V+VDV+    +  ++ L
Sbjct  2     RYLDNLTAIGPRTVGSPENEVLAVNYLLEQIRAIERESTGAHKVSVDVQRPTGSFSIDFL  61

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y+++ +VV++L P++ A         E A+L + H D+V    GA DD+
Sbjct  62    -GGF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDSVPNTPGASDDA  107

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  +VR  I+LE
Sbjct  108   VSCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSVRAFINLE  166

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SGVI + TDF++Y++   
Sbjct  167   AAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGVIPAETDFRIYRDFGN  226

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S         L+  
Sbjct  227   VPGIDLAFIENGYIYHTEYDTSDRILTDSIQRAGDNILAVLKYLATSDK-------LAKS  279

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
                   +VV+FD+LG +++ YP
Sbjct  280   SEYRHGSVVFFDVLGLFVLAYP  301



>ref|XP_003390642.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Amphimedon 
queenslandica]
Length=881

 Score =   201 bits (511),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/375 (35%), Positives = 199/375 (53%), Gaps = 32/375 (9%)
 Frame = +3

Query  1224  AERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLG  1403
             ++RS    + L  F+       F S +  LP P + E  G   FS + A  H+KA++ LG
Sbjct  31    SKRSNTIALGLLVFMGLLVLASFRSHYN-LPAP-NLERDGNQ-FSSLNARRHLKAITSLG  87

Query  1404  PHPLGSTALDTALQYVL-QVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYF----GK  1568
                 GS A D   + +L  + E IK+ +  +V+++  V H +       G  Y     G 
Sbjct  88    IRHAGSEANDIKTKELLVSIIEEIKDSSSPEVSIETSVQHPS-------GHFYLDFLGGM  140

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             T +Y +L +VV+RL           G+  + ++LV+ H D+   +  A DD+ + AV+LE
Sbjct  141   THIYENLTNVVVRLK--------GAGKSPKHSLLVNCHFDSALGSPAASDDAVSCAVLLE  192

Query  1749  VARGLSKQATGFK-NNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGK  1925
               R LS   + +   +SVIFLFN  EE  L  AH F+TQH W   VR  ++LEA G GGK
Sbjct  193   TLRVLSASPSPYLLKHSVIFLFNGAEEMILPAAHGFITQHEWAGQVRAFLNLEAAGAGGK  252

Query  1926  SGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFA  2102
               +FQ GP  PW    +++   YP   VV+Q++F SGVI S TDF+++++  G+ G+D A
Sbjct  253   EILFQTGPKHPWLAAAYSRSVPYPHASVVAQEIFQSGVIPSDTDFRIFRDHGGVPGIDMA  312

Query  2103  FTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDT  2282
             F  +  VYHT+ D    +  GS+Q  GEN+L  + + A+S  L  P +       +    
Sbjct  313   FFVNGYVYHTQYDTADRIPDGSIQRAGENILALIKEIANSDLLADPGE-------DRHGK  365

Query  2283  VVYFDILGRYMVVYP  2327
             VVY+D+LG ++V YP
Sbjct  366   VVYYDVLGLFVVQYP  380



>ref|XP_007499610.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Monodelphis domestica]
Length=827

 Score =   201 bits (510),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 183/320 (57%), Gaps = 22/320 (7%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVG  1550
             N+++ ++ +GP   GS   +   + Y+L+  + I+ E+     + ++V H     +    
Sbjct  37    NYLEHITSIGPRTTGSLENEVLTVNYLLEQIKLIRAESNSIHKISIDVQHPTGSFSIDFL  96

Query  1551  GLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSN  1730
             G   G T  Y ++ +VV++L PK+ A         + A+L + H D+V  + GA DD+ +
Sbjct  97    G---GFTSYYDNITNVVVKLEPKNGA---------QHAVLSNCHFDSVANSPGASDDAVS  144

Query  1731  VAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAM  1910
              +VMLE+ R +S  +   ++ +VIFLFN  EE  L  +H F+TQHPW N +R  I+LEA 
Sbjct  145   CSVMLEILRVMSTSSEALQH-AVIFLFNGAEENVLQASHGFITQHPWANLIRAFINLEAA  203

Query  1911  GIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLS  2087
             G+GGK  +FQ GP +PW +Q +A  AK+P   VV+Q++F SG+I S TDF++Y++   + 
Sbjct  204   GVGGKELVFQTGPENPWLVQAYALSAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGSIP  263

Query  2088  GLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
             G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S         L++   
Sbjct  264   GIDLAFIENGYIYHTRYDTPDRILTDSIQRAGDNILAVLKYLATSDR-------LASSFE  316

Query  2268  EDEDTVVYFDILGRYMVVYP  2327
                  +V+FD+LG +++ YP
Sbjct  317   YRHGNMVFFDVLGLFVIAYP  336



>ref|XP_007094234.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Panthera 
tigris altaica]
Length=827

 Score =   201 bits (510),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/333 (34%), Positives = 189/333 (57%), Gaps = 26/333 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAE--GIKEEAFGDVNVDVEVFHANSGVNTL  1544
             ++++ ++ +GP   GS   +   + Y+L+  +   ++  +   ++VDV+    +  ++ L
Sbjct  37    DYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIQVQSSSLHRISVDVQRPTGSFSIDFL  96

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA DD+
Sbjct  97    -GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGASDDA  142

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + +VMLEV R LS  +   ++ +VIFLFN  EE  L  +H F+TQHPW + +R  I+LE
Sbjct  143   VSCSVMLEVLRVLSTSSEALRH-AVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLE  201

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++   
Sbjct  202   AAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGN  261

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K     
Sbjct  262   IPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDVLPSSSK-----  316

Query  2262  KSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
                    VV+FD+LG +++ YP     + +  V
Sbjct  317   --YRHGNVVFFDVLGLFVIAYPSRVGSIINYMV  347



>ref|XP_008324132.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Cynoglossus 
semilaevis]
Length=889

 Score =   201 bits (511),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 178/328 (54%), Gaps = 23/328 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H+  ++ +GP P+GS   +   + Y+L+  E I+ E A  +  + V+V    
Sbjct  87    FNAVRARRHLTQITSVGPRPVGSEENEVLTVGYLLEQIEQIQVETALSNHQLSVDV---Q  143

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                 T       G T  Y  + ++V++L PK  A  L         +L + H DTV  + 
Sbjct  144   RPTGTFSIDFLGGFTSFYDRVTNIVVKLEPKGGAKHL---------MLANCHFDTVANSP  194

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV   L+ Q++  ++  VIFLFN  EE  L  +H F+TQHPW   VR
Sbjct  195   GASDDAVSCAVMLEVLHSLANQSSPLRHG-VIFLFNGAEENILQASHGFITQHPWAKQVR  253

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SG+I S TDF++
Sbjct  254   AFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGIIPSDTDFRI  313

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +S       
Sbjct  314   YRDFGNIPGIDLAFIENGFIYHTKYDTPDRILTDSIQRAGDNILSVLKYLVTS-------  366

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             + L+         +V+FD+LG  +V YP
Sbjct  367   ERLADWSEYRHGNMVFFDLLGVIVVAYP  394



>ref|XP_006627062.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Lepisosteus 
oculatus]
Length=884

 Score =   201 bits (511),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 183/339 (54%), Gaps = 23/339 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ + A  H++ ++ +GP P+GS   +   + Y+L   E IK E A G  ++ V++    
Sbjct  85    FNAIRARKHLEHITSVGPRPVGSPENEVLTVNYLLSQIEKIKAESASGPHSISVDIQRPT  144

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                +    G   G T  Y  + ++ ++L PK  A         + A+L + H D+V  + 
Sbjct  145   GSFSIDFLG---GFTSYYDKVTNIAVKLEPKQGA---------KHAMLANCHFDSVANSP  192

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV + LS  +T  ++ +VIFLFN  EE  L  +H F+TQHPW   +R
Sbjct  193   GASDDAVSCAVMLEVLQSLSSLSTPLQH-AVIFLFNGAEENVLQASHGFITQHPWAKLIR  251

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SG+I S TDF++
Sbjct  252   AFINLEAAGVGGKEIVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGIIPSDTDFRI  311

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             Y++   + G+D AF +   +YHTK D    +   S+Q  G+N+L  +   A S       
Sbjct  312   YRDFGNIPGIDLAFIESGFIYHTKYDTPDRILTDSIQRAGDNILAVVKHLALSDK-----  366

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L+         +V+FD+LG ++V YP     + +  V
Sbjct  367   --LADSSEYRHGNMVFFDLLGIFVVAYPARMGTIINYMV  403



>ref|XP_008689229.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Ursus maritimus]
Length=846

 Score =   201 bits (510),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/333 (34%), Positives = 190/333 (57%), Gaps = 26/333 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALD-TALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSGVNTL  1544
             ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VDV+    +  ++ L
Sbjct  99    DYLEHITSIGPRTTGSPENEIVTVRYLLEQIKRIEVQSSSVHRISVDVQRPTGSFSIDFL  158

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA DD+
Sbjct  159   -GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGASDDA  204

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  I+LE
Sbjct  205   VSCSVMLEVLRVLSASSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLE  263

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++   
Sbjct  264   AAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGN  323

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K     
Sbjct  324   IPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDMLPSSSK-----  378

Query  2262  KSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
                    +V+FD+LG +++ YP     + +  V
Sbjct  379   --YRHGNMVFFDVLGLFVIAYPSRVGSIINSVV  409



>gb|EFN89465.1| Endoplasmic reticulum metallopeptidase 1 [Harpegnathos saltator]
Length=858

 Score =   201 bits (510),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 194/355 (55%), Gaps = 23/355 (6%)
 Frame = +3

Query  1305  KVLPEP--LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK  1475
             K LPEP  ++ EE     F    A NH+  L+  GP   GS   +  A++++      + 
Sbjct  26    KNLPEPVTINTEELHPERFVAERARNHIINLTSFGPRIAGSYENEVLAVKFLRTTINSLI  85

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDE  1655
             +EA  +  + ++V   +SG  +L      G T VY ++++V++++ P             
Sbjct  86    KEAHENHKILLDV-TKHSGAFSL--KFLDGMTNVYRNVQNVIVKIGPH---------RPT  133

Query  1656  EDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGL  1835
               ++L++ H DT F + G  DDS+  AVMLE+ R ++ Q+     +S++FLFN  EE  L
Sbjct  134   MHSLLLNCHFDTFFESPGGSDDSAGCAVMLEILRIIT-QSPKLLKHSIVFLFNGAEENIL  192

Query  1836  NGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVS  2012
               AH F+TQHPW   ++  I+LEA G GG+  +FQAGP +PW ++ +AK   YP    ++
Sbjct  193   EAAHGFITQHPWAKEIKTFINLEACGAGGRELLFQAGPHNPWILEVYAKSVPYPYASSLA  252

Query  2013  QDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENL  2192
             Q++F SG++   TDF+++++   +SGLDFA++ +  VYHTK D V  +  G+LQ  G+N+
Sbjct  253   QEIFESGIVPGDTDFRIFRDFGKVSGLDFAWSTNGYVYHTKFDNVDQIPLGTLQRTGDNI  312

Query  2193  LPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKA  2357
             L      A +  +   N  L T        +V+FD LG ++V +P+  A   + A
Sbjct  313   L------ALTQAIVLENYLLDTSIHGTLGNLVFFDFLGAFVVRWPQYIASTINVA  361



>ref|XP_004373539.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Trichechus 
manatus latirostris]
Length=901

 Score =   201 bits (511),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 196/340 (58%), Gaps = 26/340 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANS  1529
             F    A ++++ ++ +GP   GS   +   ++Y+L+  + I++++     + V+V    +
Sbjct  104   FDARQARDYLEHITSIGPRTTGSPENEVLTVRYLLEQIKLIQDQSNSIHKIAVDV-QRPT  162

Query  1530  GVNTL--VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             G  +L  +GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  163   GTFSLDFLGGF----TSYYDNITNVVVKLEPRGGA---------QHAVLANCHFDSVPNS  209

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +   ++ +VIFLFN  EE  L  +H F+TQHPW ++V
Sbjct  210   PGASDDAVSCSVMLEVLRVLSASSEALRH-AVIFLFNGAEENILQASHGFITQHPWASSV  268

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  269   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFR  328

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +  GS+Q  G+N+L  +L+  ++SD+   
Sbjct  329   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRIPTGSIQRAGDNILA-VLKYLATSDM---  384

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
                L++        +V+FD+ G +++ YP     + +  V
Sbjct  385   ---LASSSKYQHGHMVFFDVFGLFVIAYPSRVGSIINYMV  421



>ref|XP_003312035.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Pan troglodytes]
Length=904

 Score =   201 bits (511),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/346 (34%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  424



>dbj|BAB47444.2| KIAA1815 protein [Homo sapiens]
Length=881

 Score =   201 bits (510),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  78    AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  137

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  138   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  183

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  184   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  242

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  243   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  302

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  303   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  362

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  363   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  401



>ref|XP_007568786.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Poecilia formosa]
Length=889

 Score =   201 bits (510),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 177/329 (54%), Gaps = 25/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+   A  H++ ++ +GP P+GS   +   + Y+L+  E I+   A G   V V+V    
Sbjct  87    FNAERARRHLEQITSVGPRPVGSQENEVLTVGYLLEQIEDIRARTAAGPHRVTVDVQRPT  146

Query  1527  SGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
                +   +GG     T  Y  + ++ ++L PK  A  L         +L + H DTV  +
Sbjct  147   GSFSIDFLGGF----TSFYDRISNIAVKLEPKRGAQHL---------MLANCHFDTVANS  193

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + AVMLEV   L+ Q+T   ++ V+FLFN  EE  L  +H F+TQHPW   V
Sbjct  194   PGASDDAVSCAVMLEVLHALANQSTPL-HHGVVFLFNGAEENVLQASHGFITQHPWAKQV  252

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF+
Sbjct  253   RAFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFR  312

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +S      
Sbjct  313   IYRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKHLVTS------  366

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              + L+         +V+FD+LG   V YP
Sbjct  367   -EKLADSSEYRHGNMVFFDLLGVIAVAYP  394



>ref|XP_008975268.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Pan paniscus]
Length=904

 Score =   201 bits (510),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/346 (34%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  424



>ref|XP_003995403.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Felis catus]
Length=818

 Score =   200 bits (508),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 187/325 (58%), Gaps = 26/325 (8%)
 Frame = +3

Query  1365  AAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSGV  1535
             A  ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VDV+    +  +
Sbjct  25    AVRDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSSSLHRISVDVQRPTGSFSI  84

Query  1536  NTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAG  1715
             + L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA 
Sbjct  85    DFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGAS  130

Query  1716  DDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAI  1895
             DD+ + +VMLEV R LS  +   ++ +VIFLFN  EE  L  +H F+TQHPW + +R  I
Sbjct  131   DDAVSCSVMLEVLRVLSTSSEALRH-AVIFLFNGAEENVLQASHGFITQHPWASLIRAFI  189

Query  1896  DLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKE  2072
             +LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++
Sbjct  190   NLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRD  249

Query  2073  VAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTL  2252
                + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K  
Sbjct  250   FGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDVLPSSSK--  307

Query  2253  STGKSEDEDTVVYFDILGRYMVVYP  2327
                       +V+FD+LG +++ YP
Sbjct  308   -----YRHGHMVFFDVLGLFVIAYP  327



>gb|EHH57410.1| Endoplasmic reticulum metallopeptidase 1, partial [Macaca fascicularis]
Length=823

 Score =   200 bits (508),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  20    AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  79

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  80    VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  125

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  126   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  184

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  185   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  244

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  245   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  304

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  305   DMLAAASK-------YRHGNMVFFDVLGLFVIAYPSRIGSIINYMV  343



>ref|XP_008193819.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X2 [Tribolium castaneum]
Length=850

 Score =   200 bits (508),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 199/355 (56%), Gaps = 28/355 (8%)
 Frame = +3

Query  1305  KVLPEPLS-AEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIK  1475
             K LP PL  A+EA     F    A N +K L+++GP   GS A + TA+Q +    + I 
Sbjct  25    KQLPTPLKIADEAKNPDRFIAERAHNVLKKLTKIGPRIAGSYANEVTAVQLLKGAVQEII  84

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYF--GKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             + A  +  ++++V  A+   N     L F  G T VY D+++VV+++S K  +       
Sbjct  85    DNAHENHVIELDVQKASGDFN-----LEFLDGMTNVYRDVQNVVVKVSSKIKSPH-----  134

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
                 ++L++ H D+V  + G  DD +  AVMLE+ R LSK     ++N +IFLFN GEE 
Sbjct  135   ----SLLINCHFDSVVDSPGGSDDGAGCAVMLEILRVLSKSPKILRHN-IIFLFNGGEEN  189

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQV  2006
              +  +H F+TQH W + VR  I+LEA G GG+  +FQAGP+ PW ++ +++   YP    
Sbjct  190   FMPASHGFITQHKWASEVRTFINLEACGAGGREVLFQAGPNHPWILETYSEEVPYPYASS  249

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             ++Q++F SGVI   TD++++++   +SGLDFA++ +  VYHTK D +  +  GSLQ  G+
Sbjct  250   LAQEIFQSGVIPGDTDYRIFRDFGNVSGLDFAWSANGYVYHTKFDSIEHIPLGSLQRTGD  309

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFH  2351
             N+L      A    L   +K  +         +V+FD LG ++V +P   AD+ +
Sbjct  310   NILALAKGMAQGHQLSEVDKYRA-------GNLVFFDFLGAFVVRWPMIVADLIN  357



>ref|XP_009242735.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Pongo abelii]
Length=904

 Score =   201 bits (510),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ ++V++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNIVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            VV+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------RHGNVVFFDVLGLFVIAYPSRIGSIINYMV  424



>gb|EFA07296.1| hypothetical protein TcasGA2_TC014536 [Tribolium castaneum]
Length=872

 Score =   200 bits (509),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 199/355 (56%), Gaps = 28/355 (8%)
 Frame = +3

Query  1305  KVLPEPLS-AEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIK  1475
             K LP PL  A+EA     F    A N +K L+++GP   GS A + TA+Q +    + I 
Sbjct  58    KQLPTPLKIADEAKNPDRFIAERAHNVLKKLTKIGPRIAGSYANEVTAVQLLKGAVQEII  117

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYF--GKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             + A  +  ++++V  A+   N     L F  G T VY D+++VV+++S K  +       
Sbjct  118   DNAHENHVIELDVQKASGDFN-----LEFLDGMTNVYRDVQNVVVKVSSKIKS-------  165

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
                 ++L++ H D+V  + G  DD +  AVMLE+ R LSK     ++N +IFLFN GEE 
Sbjct  166   --PHSLLINCHFDSVVDSPGGSDDGAGCAVMLEILRVLSKSPKILRHN-IIFLFNGGEEN  222

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQV  2006
              +  +H F+TQH W + VR  I+LEA G GG+  +FQAGP+ PW ++ +++   YP    
Sbjct  223   FMPASHGFITQHKWASEVRTFINLEACGAGGREVLFQAGPNHPWILETYSEEVPYPYASS  282

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             ++Q++F SGVI   TD++++++   +SGLDFA++ +  VYHTK D +  +  GSLQ  G+
Sbjct  283   LAQEIFQSGVIPGDTDYRIFRDFGNVSGLDFAWSANGYVYHTKFDSIEHIPLGSLQRTGD  342

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFH  2351
             N+L      A    L   +K  +         +V+FD LG ++V +P   AD+ +
Sbjct  343   NILALAKGMAQGHQLSEVDKYRA-------GNLVFFDFLGAFVVRWPMIVADLIN  390



>ref|NP_079172.2| endoplasmic reticulum metallopeptidase 1 [Homo sapiens]
 sp|Q7Z2K6.2|ERMP1_HUMAN RecName: Full=Endoplasmic reticulum metallopeptidase 1; AltName: 
Full=Felix-ina [Homo sapiens]
 gb|AAI36772.1| Endoplasmic reticulum metallopeptidase 1 [Homo sapiens]
 gb|AAI36774.1| Endoplasmic reticulum metallopeptidase 1 [Homo sapiens]
 dbj|BAG54455.1| unnamed protein product [Homo sapiens]
Length=904

 Score =   200 bits (509),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  424



>ref|XP_005251644.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Homo sapiens]
Length=782

 Score =   199 bits (507),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAE--GIKEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  +   ++  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  424



>ref|XP_010363393.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X4 
[Rhinopithecus roxellana]
Length=811

 Score =   199 bits (507),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  102   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  161

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  162   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  207

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  208   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  266

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  267   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  326

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  327   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  386

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  387   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  425



>ref|XP_010156520.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like, partial 
[Eurypyga helias]
Length=334

 Score =   190 bits (483),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 183/321 (57%), Gaps = 26/321 (8%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG--DVNVDVEVFHANSGVNTLV  1547
             ++  ++ +GP  +GS   +  A+ Y+L+    I+ E+     ++VD++    +  ++ L 
Sbjct  2     YLDNITAIGPRTVGSPENEVLAVNYLLKQIRAIERESTDAHKISVDIQRPTGSFSIDFL-  60

Query  1548  GGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSS  1727
             GG     T  Y+++ +VV++L P++ A         E A+L + H D+V    GA DD+ 
Sbjct  61    GGF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDSVPNTPGASDDAV  107

Query  1728  NVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEA  1907
             + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I+LEA
Sbjct  108   SCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFINLEA  166

Query  1908  MGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGL  2084
              G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + TDF++Y++   +
Sbjct  167   AGVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGIIPADTDFRIYRDFGNV  226

Query  2085  SGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGK  2264
              G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S         L+   
Sbjct  227   PGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILAVLKYLATSDK-------LAKSF  279

Query  2265  SEDEDTVVYFDILGRYMVVYP  2327
                   VV+FD+LG +++ YP
Sbjct  280   EYRHGNVVFFDVLGLFVLAYP  300



>ref|XP_003472227.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum metallopeptidase 
1 [Cavia porcellus]
Length=902

 Score =   200 bits (509),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 199/346 (58%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F+   A ++++ ++ +GP   GS   +   +QY+L+  + I  +  +   ++VD
Sbjct  98    AGHRGEFNARQARDYLEHITAVGPRTTGSPENEILTVQYLLEQIKLIEVQSSSLHKISVD  157

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  158   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRGGA---------QHAVLANCHF  203

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V ++ GA DD+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQH
Sbjct  204   DSVPSSPGASDDAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQH  262

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW IQ +   A++P   VV+Q++F SG+I 
Sbjct  263   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLIQAYVSAARHPFASVVAQEVFQSGIIP  322

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++
Sbjct  323   SETDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLAT  381

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             SD+   +     GK      +V+FD+LG +++ YP     + +  V
Sbjct  382   SDMLAFSSEYRHGK------MVFFDVLGLFVIAYPYRIGSIINCMV  421



>ref|XP_004047830.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Gorilla 
gorilla gorilla]
Length=904

 Score =   200 bits (509),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  424



>gb|KFO34702.1| Endoplasmic reticulum metallopeptidase 1, partial [Fukomys damarensis]
Length=794

 Score =   199 bits (506),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 191/324 (59%), Gaps = 26/324 (8%)
 Frame = +3

Query  1368  AMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAE--GIKEEAFGDVNVDVEVFHANSGVN  1538
             + ++++ ++ +GP   GS   +   + Y+L+  +   I+  +   ++VDV+    +  ++
Sbjct  1     SRDYLEHITAIGPRTTGSPENEILTVHYLLEQIKLIEIQSSSLHKISVDVQRPTGSFSID  60

Query  1539  TLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGD  1718
              L GG     T  Y ++ +VV++L P++ A         + A+L + H D+V ++ GA D
Sbjct  61    FL-GGF----TSYYDNITNVVVKLEPRNGA---------QHAVLANCHFDSVPSSPGASD  106

Query  1719  DSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAID  1898
             D+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW N +R  I+
Sbjct  107   DAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWANLIRAFIN  165

Query  1899  LEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEV  2075
             LEA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF++Y++ 
Sbjct  166   LEAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFRIYRDF  225

Query  2076  AGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLS  2255
               + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   +    
Sbjct  226   GNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAFSSEYR  284

Query  2256  TGKSEDEDTVVYFDILGRYMVVYP  2327
              GK      +V+FD+LG +++ YP
Sbjct  285   HGK------MVFFDVLGLFVIAYP  302



>ref|XP_008193818.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like isoform 
X1 [Tribolium castaneum]
Length=883

 Score =   200 bits (508),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 199/355 (56%), Gaps = 28/355 (8%)
 Frame = +3

Query  1305  KVLPEPLS-AEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIK  1475
             K LP PL  A+EA     F    A N +K L+++GP   GS A + TA+Q +    + I 
Sbjct  58    KQLPTPLKIADEAKNPDRFIAERAHNVLKKLTKIGPRIAGSYANEVTAVQLLKGAVQEII  117

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYF--GKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             + A  +  ++++V  A+   N     L F  G T VY D+++VV+++S K  +       
Sbjct  118   DNAHENHVIELDVQKASGDFN-----LEFLDGMTNVYRDVQNVVVKVSSKIKS-------  165

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
                 ++L++ H D+V  + G  DD +  AVMLE+ R LSK     ++N +IFLFN GEE 
Sbjct  166   --PHSLLINCHFDSVVDSPGGSDDGAGCAVMLEILRVLSKSPKILRHN-IIFLFNGGEEN  222

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQV  2006
              +  +H F+TQH W + VR  I+LEA G GG+  +FQAGP+ PW ++ +++   YP    
Sbjct  223   FMPASHGFITQHKWASEVRTFINLEACGAGGREVLFQAGPNHPWILETYSEEVPYPYASS  282

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             ++Q++F SGVI   TD++++++   +SGLDFA++ +  VYHTK D +  +  GSLQ  G+
Sbjct  283   LAQEIFQSGVIPGDTDYRIFRDFGNVSGLDFAWSANGYVYHTKFDSIEHIPLGSLQRTGD  342

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFH  2351
             N+L      A    L   +K  +         +V+FD LG ++V +P   AD+ +
Sbjct  343   NILALAKGMAQGHQLSEVDKYRA-------GNLVFFDFLGAFVVRWPMIVADLIN  390



>ref|XP_003783088.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Otolemur 
garnettii]
Length=877

 Score =   200 bits (508),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 194/345 (56%), Gaps = 27/345 (8%)
 Frame = +3

Query  1341  GETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDV  1508
             G+ G F    A ++++ ++ +GP   GS   +   +QY+L+  + I  +  +   ++VDV
Sbjct  75    GQRGEFDARQARDYLEHITSIGPRTTGSPENEILTVQYLLEQIKLIELQSHSLHKISVDV  134

Query  1509  EVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVD  1688
             +    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D
Sbjct  135   QRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRGGA---------QHAVLANCHFD  180

Query  1689  TVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHP  1868
             +V  + GA DD+ + +VMLEV R LS  +    +++++FLFN  EE  L  +H F+TQHP
Sbjct  181   SVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAIVFLFNGAEENVLQASHGFITQHP  239

Query  1869  WINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKS  2045
             W + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S
Sbjct  240   WASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPS  299

Query  2046  STDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSS  2225
              TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S 
Sbjct  300   DTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSD  359

Query  2226  DLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
              L + +K            +V+FD+LG +++ YP     + +  V
Sbjct  360   ILASSSKY-------QHGNMVFFDVLGLFVIAYPSRIGSIINYMV  397



>gb|ERE77127.1| endoplasmic reticulum metallopeptidase 1-like protein [Cricetulus 
griseus]
Length=895

 Score =   200 bits (508),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 190/322 (59%), Gaps = 26/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSGVNTL  1544
             ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VD++    +  ++ L
Sbjct  104   DYLEHITAIGPRTTGSAENEILTVQYLLEQIKLIERQSSSLHRISVDIQRPTGSFSIDFL  163

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y ++ +VV++L P+S A         + A+L + H D+V  + GA DD+
Sbjct  164   -GGF----TSYYDNITNVVVKLEPRSGA---------QHAVLANCHFDSVANSPGASDDA  209

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + AVMLEV RG+S  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +R  I+LE
Sbjct  210   VSCAVMLEVLRGMSVSSEPLQH-AVVFLFNGAEENVLQASHGFITQHPWASLIRAFINLE  268

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++   
Sbjct  269   AAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGN  328

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+      L++ 
Sbjct  329   IPGIDLAFIENGYIYHTKYDTADRILIDSIQRAGDNILA-VLKYLATSDM------LASS  381

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
                    VV+FD+ G  ++ YP
Sbjct  382   SEYRHGNVVFFDVFGLLVIAYP  403



>ref|XP_010785513.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Notothenia 
coriiceps]
Length=1104

 Score =   201 bits (512),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 179/328 (55%), Gaps = 23/328 (7%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+ V A  H++ ++ +GP P+GS   +   + Y+L+  E I+ E A G   + V+V    
Sbjct  86    FNAVRARQHLEKITSVGPRPVGSHENEVLTVGYLLEQIENIRVETAAGPHKITVDV---Q  142

Query  1527  SGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAE  1706
                 T       G T  Y  + ++ +RL PKS +            +L + H DTV  + 
Sbjct  143   RPTGTFSIDFLGGFTSFYDRVTNIAVRLEPKSGSQHF---------MLANCHFDTVANSP  193

Query  1707  GAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVR  1886
             GA DD+ + AVMLEV   L+ Q+T   +  V+FLFN  EE  L  +H F+TQHPW   VR
Sbjct  194   GASDDAVSCAVMLEVLHSLANQSTPLLH-GVVFLFNGAEENILQASHGFITQHPWAKQVR  252

Query  1887  VAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQV  2063
               I+LEA G+GGK  +FQ GP +PW +Q + + AK+P   VV Q++F SG+I S TDF++
Sbjct  253   AFINLEAAGVGGKEVVFQTGPENPWLVQAYVQAAKHPFASVVGQEVFQSGIIPSDTDFRI  312

Query  2064  YKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPN  2243
             Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +S       
Sbjct  313   YRDFGNIPGIDLAFIENGFIYHTKYDTADRILTDSIQRAGDNILAVLKYLVNS-------  365

Query  2244  KTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             + L+         +V++D+LG ++V YP
Sbjct  366   EKLADSSEYRHGNMVFYDLLGVFVVAYP  393



>ref|XP_005683816.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Capra hircus]
Length=831

 Score =   199 bits (507),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 199/351 (57%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FG  1490
             L     G+ G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++    
Sbjct  24    LRGAAVGQQGEFDAHQARDYLEHITSIGPRITGSPENEILTVHYLLEQIKLIEAQSNSLH  83

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P++ A         + A+L
Sbjct  84    KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRAGA---------QHAVL  129

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  130   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-SHAVIFLFNGAEENVLQASHG  188

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  189   FITQHPWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  248

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  249   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  307

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  308   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  352



>ref|XP_006918434.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Pteropus 
alecto]
 gb|ELK07014.1| Endoplasmic reticulum metallopeptidase 1 [Pteropus alecto]
Length=904

 Score =   200 bits (508),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 117/348 (34%), Positives = 194/348 (56%), Gaps = 30/348 (9%)
 Frame = +3

Query  1341  GETG----FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAE--GIKEEAFGDVN  1499
             G TG    F    A ++++ ++ +GP   GS   +   ++Y+L+  +   I+  +   ++
Sbjct  99    GATGHHREFDARQARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEIQSNSLHKIS  158

Query  1500  VDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSA  1679
             VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + 
Sbjct  159   VDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANC  204

Query  1680  HVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVT  1859
             H D+V  + GA DD+ + +VMLEV R LS  +   ++ +VIFLFN  EE  L  +H F+T
Sbjct  205   HFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEALRH-AVIFLFNGAEENVLQASHGFIT  263

Query  1860  QHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGV  2036
             QHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+
Sbjct  264   QHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGI  323

Query  2037  IKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAA  2216
             I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A
Sbjct  324   IPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLA  383

Query  2217  SSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +S  L + +K            +V+FDILG +++ YP     + +  V
Sbjct  384   TSDMLVSSSKY-------QHGNMVFFDILGLFVIAYPSRVGSIINYMV  424



>gb|ELR59520.1| Endoplasmic reticulum metallopeptidase 1, partial [Bos mutus]
Length=863

 Score =   199 bits (507),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 198/351 (56%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FG  1490
             L     G  G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++    
Sbjct  55    LRGAAVGHQGEFDAHQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEAQSNSLH  114

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L
Sbjct  115   KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVL  160

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  161   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHG  219

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW ++VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  220   FITQHPWASSVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  279

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  280   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  338

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  339   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  383



>ref|XP_009044249.1| hypothetical protein LOTGIDRAFT_103045 [Lottia gigantea]
 gb|ESP05704.1| hypothetical protein LOTGIDRAFT_103045 [Lottia gigantea]
Length=890

 Score =   200 bits (508),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/352 (31%), Positives = 185/352 (53%), Gaps = 22/352 (6%)
 Frame = +3

Query  1293  YSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGI  1472
             +++    P+PL+   +  + F E      + +L  LGP   GS A   A   +L V E +
Sbjct  64    HNRLNSFPQPLTIRGSEPSDFVEERVRVTLDSLVSLGPRVTGSDANIKARDVILGVIEDV  123

Query  1473  KEEA--FGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREG  1646
             +  +     ++++ +    +  ++ L  G +   T  Y ++ +++++L+ K         
Sbjct  124   QRNSNNVHQISINQQTVDGDFAIDFLEAGHF---TSAYKNIHNIMVKLTAKD--------  172

Query  1647  EDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEE  1826
             +    ++LV+ H D+V A+ GA DD+ +  VMLE+ R  S+    F++N VIFLFN  EE
Sbjct  173   KPSNHSLLVNCHYDSVHASPGASDDAVSCCVMLELLRSFSQHNQAFRHN-VIFLFNGAEE  231

Query  1827  EGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQ  2003
               L  +H F+T+H W +++R  ++LEA G GG   +FQ GP +PW I+ +    KYPS  
Sbjct  232   NVLQASHGFITKHKWGSSIRAFVNLEATGAGGWEMVFQTGPENPWLIRKYIDSVKYPSAS  291

Query  2004  VVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLG  2183
             + SQ++F +G I   TDF+++++   + G+D A   +  VYHT ND    ++PG +Q  G
Sbjct  292   IFSQEIFQTGKIPGDTDFRIFRDYGNIPGIDIAHIKYGYVYHTPNDLPRYIQPGCIQRGG  351

Query  2184  ENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFA  2339
             ENL   +    S  +L  P         +   TVV++D +G +M+ YP   A
Sbjct  352   ENLYSLITSLISGDELVDPGP-------QKHGTVVFYDFIGYFMISYPMRMA  396



>ref|XP_008204688.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Nasonia 
vitripennis]
 ref|XP_008204693.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Nasonia 
vitripennis]
 ref|XP_008204697.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Nasonia 
vitripennis]
 ref|XP_008204700.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Nasonia 
vitripennis]
 ref|XP_008204706.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Nasonia 
vitripennis]
 ref|XP_008204711.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Nasonia 
vitripennis]
Length=882

 Score =   199 bits (507),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/356 (33%), Positives = 198/356 (56%), Gaps = 25/356 (7%)
 Frame = +3

Query  1305  KVLPEP--LSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK  1475
             K+LPEP  +  E      F    A  HV  L+ LGP   GS   +  A++++      I 
Sbjct  59    KILPEPQLIDTERFHPERFIAERARAHVHNLTSLGPRVAGSYENEVLAVKFLTDTINSII  118

Query  1476  EEAFGDVNVDVEV-FHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGED  1652
             ++   +  + ++V  H+ S   T + G+    T +Y  +++V++RL P          + 
Sbjct  119   KDTNPNHKIQMDVTRHSGSFSLTFLDGM----THIYKGVQNVIVRLGPN---------QP  165

Query  1653  EEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEG  1832
              + ++L++ H D+   + G  DD++  AVMLEV R +S+ +T +  +++IFLFN  EE  
Sbjct  166   SKHSLLLNCHFDSFVESPGGSDDAAGCAVMLEVLRVMSR-STKYLRHNIIFLFNGAEENI  224

Query  1833  LNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVV  2009
             L  +H F+TQHPW   VR  I+LEA G GG+  +FQAGP +PW ++ +++   YP    +
Sbjct  225   LQASHGFITQHPWAKEVRAFINLEACGAGGRELLFQAGPGNPWILEVYSQSVPYPYASSL  284

Query  2010  SQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGEN  2189
             +Q++F SG++   TDF+++++   +SGLDFA++ +  VYHTK D +  +  GSLQ  G+N
Sbjct  285   AQEIFQSGIVPGETDFRIFRDFGKVSGLDFAWSTNGYVYHTKFDSIDQIPLGSLQRTGDN  344

Query  2190  LLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKA  2357
             +L   L   S   L   +++L +     E ++V+FD LG +++ +P   A   + A
Sbjct  345   ILALSLGIVSGHYL--ADESLQS----SEGSLVFFDFLGAFVIRWPEYMAKFVNVA  394



>ref|XP_007967512.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Chlorocebus 
sabaeus]
Length=1059

 Score =   201 bits (511),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 117/346 (34%), Positives = 195/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  256   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  315

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  316   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  361

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  362   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  420

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP+ PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  421   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  480

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  481   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  540

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L T +K            +V+FD+LG +++ YP     + +  V
Sbjct  541   DMLATASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  579



>gb|EHB04984.1| Endoplasmic reticulum metallopeptidase 1, partial [Heterocephalus 
glaber]
Length=813

 Score =   199 bits (505),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 193/329 (59%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VDV+    
Sbjct  15    FDARQARDYLEHITAIGPRTTGSPENEILTVQYLLEQIKLIEVQSSRLHKISVDVQRPTG  74

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V ++
Sbjct  75    SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVPSS  120

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +
Sbjct  121   PGASDDAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASLI  179

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  180   RAFINLEAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFR  239

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  240   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAF  298

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +     GK      +V+FD+LG +++ YP
Sbjct  299   SSEYRHGK------MVFFDVLGLFVIAYP  321



>ref|XP_004363632.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW45920.1| hypothetical protein CAOG_03904 [Capsaspora owczarzaki ATCC 30864]
Length=977

 Score =   200 bits (509),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 195/376 (52%), Gaps = 27/376 (7%)
 Frame = +3

Query  1245  IVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGST  1424
             + +LF     G W      +  LPEP SA     + FSE  A  H+ A++  G   +G+ 
Sbjct  65    LAMLFVVTAIGGW-----TYTRLPEPKSAAIPA-SDFSEARARQHLHAITSFGVRTVGTR  118

Query  1425  ALDT-ALQYVLQVAEGIKE--EAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKH  1595
             A +    +Y+L     +K   +A  D  V++EV    SGV  L      G T  Y ++ +
Sbjct  119   ANEELTPKYILDQLASMKATADAKEDFLVEIEV-QRPSGVFPL--AFLGGFTNAYQNVTN  175

Query  1596  VVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQA  1775
             V+MR+S KS           + A LVSAH D+     GA DD+ ++A  +E+A  L    
Sbjct  176   VLMRISSKS------RPASRDSAFLVSAHFDSSLGTVGASDDAVSIATAMELASNLCALP  229

Query  1776  TGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-D  1952
             +  ++N++IF+FN  EE  L  AH F+TQHPW  T+   +++EA G GG+  +FQ GP +
Sbjct  230   SPPRHNAIIFIFNGAEETILQAAHGFITQHPWAKTIVAFLNMEAAGAGGRELVFQTGPKN  289

Query  1953  PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHT  2132
              W  + + + + YP   V+ Q++F SGV+ S TDF+VY++   + GLD A T +  VYHT
Sbjct  290   AWLARAYVRASPYPYASVIGQEIFQSGVVPSDTDFRVYRDFGNIPGLDMARTANGYVYHT  349

Query  2133  KNDKVALLKPGSLQHLGENLLPFLLQ--------AASSSDLPTPNKTLSTGKSEDEDTVV  2288
               D  A +  G +Q  GEN+L  LL            S+   T +  ++  ++E +   V
Sbjct  350   ALDDEAHVTEGCIQRCGENVLATLLDLLHYNGDVVGESASSTTVSPLMAAIQAEADVVPV  409

Query  2289  YFDILGRYMVVYPRSF  2336
             +FDILG + VVY  S 
Sbjct  410   FFDILGLFAVVYSHSL  425



>ref|XP_001108869.2| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Macaca 
mulatta]
Length=905

 Score =   199 bits (507),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  102   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  161

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  162   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  207

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  208   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  266

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP+ PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  267   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  326

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  327   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  386

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  387   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  425



>ref|XP_005891434.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Bos mutus]
Length=891

 Score =   199 bits (507),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 198/351 (56%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FG  1490
             L     G  G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++    
Sbjct  83    LRGAAVGHQGEFDAHQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEAQSNSLH  142

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L
Sbjct  143   KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVL  188

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  189   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHG  247

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW ++VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  248   FITQHPWASSVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  307

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  308   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  366

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  367   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  411



>ref|XP_003488180.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Bombus 
impatiens]
Length=882

 Score =   199 bits (506),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/347 (35%), Positives = 188/347 (54%), Gaps = 23/347 (7%)
 Frame = +3

Query  1305  KVLPEPLSAEEAG--ETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK  1475
             K LPEPL  ++ G     F    A NH+  ++ +GP  +GS   +  A++Y+  +   I 
Sbjct  59    KKLPEPLMIDKEGLYPGRFIAERAHNHLLNITYIGPRIVGSYENEVLAIKYLTNIINNIV  118

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDE  1655
             ++A  +  + V V   +SG   L      G T VY ++++V++++ P             
Sbjct  119   KDANENHKILVNV-TKHSGAFPL--KFLDGMTNVYRNVQNVIVKIGPH---------RPT  166

Query  1656  EDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGL  1835
             + ++L++ H DT   + G  DD +  AVMLE+ R +S     FK+N VIFLFN  EE  L
Sbjct  167   KSSLLINCHFDTFPESPGGSDDGAGCAVMLEILRVISHSPKLFKHN-VIFLFNGAEENLL  225

Query  1836  NGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDP-WAIQNFAKVAKYPSGQVVS  2012
               +H F+TQHPW   VR  I+LEA G GG+  +FQAGPD  W +Q +AK   YP    ++
Sbjct  226   QASHGFITQHPWAKEVRAFINLEACGAGGRELLFQAGPDSSWMLQIYAKSVPYPYASSLA  285

Query  2013  QDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENL  2192
             Q++F SG++   TDF+++++   +SGLDFA+  +  VYHTK D +  +  GSLQ  G+N+
Sbjct  286   QEIFESGIVPGDTDFRIFRDFGNVSGLDFAWATNGYVYHTKFDNIHQIPLGSLQRTGDNI  345

Query  2193  LPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRS  2333
             L  L      + L        TG        V+FD LG ++V +P++
Sbjct  346   LALLQGIVLDNYLSEVPLQDHTGNP------VFFDFLGTFVVRWPQN  386



>gb|ERL94535.1| hypothetical protein D910_11812 [Dendroctonus ponderosae]
Length=413

 Score =   192 bits (487),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 128/349 (37%), Positives = 195/349 (56%), Gaps = 37/349 (11%)
 Frame = +3

Query  1305  KVLPEPLSA--EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK  1475
              +LP PL+   E      F    A   +K L+ +GP  +GS   +  A++Y+ +    I 
Sbjct  47    NILPTPLTVLDESRYPHAFIAERASWDLKNLTDIGPRVVGSYENEVLAVEYLTKTINSIM  106

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYF-----GKTPVYSDLKHVVMRLSPKSTADKLR  1640
             +E+  +  ++ ++         +V G Y+     G   VY ++++VV++L          
Sbjct  107   QESHPNQYLEQDI--------QIVTGSYYLSAKQGVINVYENVQNVVVKL----------  148

Query  1641  EGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTG  1820
              G++   ++LV+AH D+V  + GA DD  NVAVMLE+ R +SK      +N VIFLFN  
Sbjct  149   HGKNGSSSVLVNAHFDSVPTSPGASDDGINVAVMLEILRIMSKLEDRPIHN-VIFLFNGA  207

Query  1821  EEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPS  1997
             EE  L  +H F+TQH W    +V I++++ G GGK  +FQ GP  PW ++ +  V  +P 
Sbjct  208   EETPLQASHGFITQHKWAKDCKVVINMDSTGSGGKIILFQTGPKTPWLLKYYNGVP-HPY  266

Query  1998  GQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQH  2177
             GQV  ++LF SG + S TDF+++++   L GLD AF      YHTKND+ A +  GS QH
Sbjct  267   GQVAGEELFQSGFLPSGTDFRIFRDFGKLVGLDMAFIKDGYRYHTKNDQFAYIPLGSYQH  326

Query  2178  LGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
             +G+N L FL++  S S+ P   + +STG    E+T VYFDILG YM+ Y
Sbjct  327   VGDNAL-FLIK--SFSNAPELYEPVSTG----EET-VYFDILGLYMISY  367



>ref|XP_004887987.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Heterocephalus 
glaber]
Length=835

 Score =   199 bits (505),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 193/329 (59%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VDV+    
Sbjct  37    FDARQARDYLEHITAIGPRTTGSPENEILTVQYLLEQIKLIEVQSSRLHKISVDVQRPTG  96

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V ++
Sbjct  97    SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVPSS  142

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +
Sbjct  143   PGASDDAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASLI  201

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  202   RAFINLEAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFR  261

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  262   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAF  320

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +     GK      +V+FD+LG +++ YP
Sbjct  321   SSEYRHGK------MVFFDVLGLFVIAYP  343



>ref|XP_009490247.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like, partial 
[Pelecanus crispus]
Length=329

 Score =   189 bits (481),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 184/321 (57%), Gaps = 26/321 (8%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG--DVNVDVEVFHANSGVNTLV  1547
             ++  ++ +GP  +GS   +  A+ Y+L+    I+ E+     ++VD++    +  ++ L 
Sbjct  2     YLDNITAIGPRTVGSPENEVLAVNYLLEQIRAIERESTDAHKISVDIQRPTGSFSIDFL-  60

Query  1548  GGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSS  1727
             GG     T  Y+++ +VV++L P++ A         E A+L + H D+V  + GA DD+ 
Sbjct  61    GGF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDSVPNSPGASDDAV  107

Query  1728  NVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEA  1907
             + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I+LEA
Sbjct  108   SCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFINLEA  166

Query  1908  MGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGL  2084
              G+GGK  +FQ GP+ PW +Q +   AK+P   VV+Q++F SG+I + TDF++Y++   +
Sbjct  167   AGVGGKELVFQTGPESPWLVQAYVVAAKHPFASVVAQEIFQSGIIPADTDFRIYRDFGNV  226

Query  2085  SGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGK  2264
              G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S         L+   
Sbjct  227   PGIDLAFIENGYIYHTEYDTSDRIVTDSIQRAGDNILAVLKYLATSD-------KLAKSF  279

Query  2265  SEDEDTVVYFDILGRYMVVYP  2327
                   VV+FD+LG +++ YP
Sbjct  280   EYRHGNVVFFDVLGLFVLAYP  300



>ref|XP_007568794.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Poecilia formosa]
Length=802

 Score =   198 bits (504),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 174/322 (54%), Gaps = 25/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHANSGVNT-L  1544
              H++ ++ +GP P+GS   +   + Y+L+  E I+   A G   V V+V       +   
Sbjct  7     RHLEQITSVGPRPVGSQENEVLTVGYLLEQIEDIRARTAAGPHRVTVDVQRPTGSFSIDF  66

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
             +GG     T  Y  + ++ ++L PK  A  L         +L + H DTV  + GA DD+
Sbjct  67    LGGF----TSFYDRISNIAVKLEPKRGAQHL---------MLANCHFDTVANSPGASDDA  113

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + AVMLEV   L+ Q+T   ++ V+FLFN  EE  L  +H F+TQHPW   VR  I+LE
Sbjct  114   VSCAVMLEVLHALANQSTPL-HHGVVFLFNGAEENVLQASHGFITQHPWAKQVRAFINLE  172

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF++Y++   
Sbjct  173   AAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFRIYRDFGN  232

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +S       + L+  
Sbjct  233   IPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKHLVTS-------EKLADS  285

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
                    +V+FD+LG   V YP
Sbjct  286   SEYRHGNMVFFDLLGVIAVAYP  307



>ref|XP_004766223.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Mustela putorius furo]
Length=808

 Score =   198 bits (504),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/324 (35%), Positives = 187/324 (58%), Gaps = 26/324 (8%)
 Frame = +3

Query  1368  AMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSGVN  1538
             A  +++ ++ +GP   GS   +   ++Y+L+  + I+ ++     ++VDV+    +  ++
Sbjct  16    AREYLEHITSIGPRTTGSPENEIVTVRYLLEQIKLIEAQSNSLHRISVDVQRPTGSFSID  75

Query  1539  TLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGD  1718
              L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA D
Sbjct  76    FL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGASD  121

Query  1719  DSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAID  1898
             D+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  I+
Sbjct  122   DAVSCSVMLEVLRVLSVSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFIN  180

Query  1899  LEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEV  2075
             LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++ 
Sbjct  181   LEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDF  240

Query  2076  AGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLS  2255
               + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K   
Sbjct  241   GNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDMLPSSSK---  297

Query  2256  TGKSEDEDTVVYFDILGRYMVVYP  2327
                      +V+FD+LG  ++ YP
Sbjct  298   ----YRHGNMVFFDVLGLCVIAYP  317



>ref|XP_005803825.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Xiphophorus 
maculatus]
Length=889

 Score =   199 bits (506),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 178/330 (54%), Gaps = 27/330 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG---DVNVDVEVFH  1520
             F+   A  H++ ++ +GP P+GS   +   + Y+L+  E I+         V VDV+   
Sbjct  87    FNAERARRHLEQITGVGPRPVGSQENEVLTVGYLLEQIEDIRARTAAGPHQVTVDVQRPT  146

Query  1521  ANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFA  1700
              +  ++ L GG     T  Y  + ++ ++L PK  A  L         +L + H DTV  
Sbjct  147   GSFSIDFL-GGF----TSFYDRVTNIAVKLEPKRGAQHL---------MLANCHFDTVAN  192

Query  1701  AEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINT  1880
             + GA DD+ + AVMLEV   L+ Q+T   ++ V+FLFN  EE  L  +H F+TQHPW   
Sbjct  193   SPGASDDAVSCAVMLEVLHSLANQSTPL-HHGVVFLFNGAEENVLQASHGFITQHPWAKQ  251

Query  1881  VRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDF  2057
             VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF
Sbjct  252   VRAFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDF  311

Query  2058  QVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPT  2237
             ++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +S     
Sbjct  312   RIYRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKHLVTS-----  366

Query  2238  PNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
               + L+         +V+FD+LG   V YP
Sbjct  367   --EKLADSSEYRHGNMVFFDLLGVIAVAYP  394



>ref|XP_002806535.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum metallopeptidase 
1 [Callithrix jacchus]
Length=904

 Score =   199 bits (506),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 193/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VD
Sbjct  101   AGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHRISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ ++V++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNIVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP+ PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   DMLAAASKY-------QHGNMVFFDVLGLFVIAYPSRIGSIINYMV  424



>ref|XP_002192981.2| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Taeniopygia 
guttata]
Length=920

 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 191/347 (55%), Gaps = 26/347 (7%)
 Frame = +3

Query  1296  SQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI  1472
             S  ++L  P  A  AG   FS   A  ++  ++ +GP  +GS   +  A+ Y+L+    I
Sbjct  106   SHRQLLSRPPGA--AGPRDFSASRARGYLDNITAIGPRTVGSPENEVLAVNYLLEQIRRI  163

Query  1473  KEEAFGDVNVDVEVFHANSGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGE  1649
             + E+     + V++       +   +GG     T  Y+++ +VV++L P++ A       
Sbjct  164   ERESTDAHKISVDIQRPTGSFSIDFLGGF----TSYYANITNVVVKLEPRNGA-------  212

Query  1650  DEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEE  1829
               E A+L + H D+V    GA DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE 
Sbjct  213   --EHAVLSNCHFDSVPNTPGASDDAVSCAVMLEILNTLSKSSESLQH-AVIFLFNGAEEN  269

Query  1830  GLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQV  2006
              L  +H F+TQH W  ++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   V
Sbjct  270   ILQASHGFITQHEWAKSIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVVAAKHPFASV  329

Query  2007  VSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGE  2186
             V+Q++F SG+I + TDF++Y++   + G+D AF ++  +YHT+ D    +   S+Q  G+
Sbjct  330   VAQEIFQSGIIPADTDFRIYRDFGNVPGIDLAFIENGYIYHTEYDTSDRILTDSIQRAGD  389

Query  2187  NLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             N+L  L   A+S       + L+         VV+FDILG +++ YP
Sbjct  390   NILAVLKYLATS-------EKLAKSFEYRHGNVVFFDILGLFVLAYP  429



>gb|EHH24122.1| Endoplasmic reticulum metallopeptidase 1 [Macaca mulatta]
Length=905

 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  102   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  161

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  162   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  207

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  208   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  266

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  267   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  326

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  327   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  386

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  387   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  425



>ref|XP_004838305.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Heterocephalus glaber]
Length=906

 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 193/329 (59%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VDV+    
Sbjct  108   FDARQARDYLEHITAIGPRTTGSPENEILTVQYLLEQIKLIEVQSSRLHKISVDVQRPTG  167

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V ++
Sbjct  168   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVPSS  213

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +
Sbjct  214   PGASDDAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASLI  272

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  273   RAFINLEAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFR  332

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  333   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAF  391

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +     GK      +V+FD+LG +++ YP
Sbjct  392   SSEYRHGK------MVFFDVLGLFVIAYP  414



>gb|KFP74251.1| Endoplasmic reticulum metallopeptidase 1, partial [Acanthisitta 
chloris]
Length=782

 Score =   198 bits (503),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 181/320 (57%), Gaps = 24/320 (8%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNT-LVG  1550
             ++  ++ +GP  +GS   +  A+ Y+L+   GI+ E+ G   + V++       +   +G
Sbjct  4     YLDNITAIGPRTVGSPENEVIAVNYLLEQIRGIERESTGAHKISVDIQRPTGSFSIDFLG  63

Query  1551  GLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSN  1730
             G     T  Y+++ +VV++L P+  A         E A+L + H D+V    GA DD+ +
Sbjct  64    GF----TSYYANITNVVVKLEPRDGA---------EHAVLSNCHFDSVPNTPGASDDAVS  110

Query  1731  VAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAM  1910
              AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I+LEA 
Sbjct  111   CAVMLEILNTLSKSSESLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFINLEAA  169

Query  1911  GIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLS  2087
             G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + TDF++Y++   + 
Sbjct  170   GVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGIIPADTDFRIYRDFGNVP  229

Query  2088  GLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
             G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S       + L+    
Sbjct  230   GIDLAFIENGYIYHTEYDTSDRILTDSIQRAGDNILSVLKYLATS-------EKLAKSFE  282

Query  2268  EDEDTVVYFDILGRYMVVYP  2327
                  VV+FDILG +++ YP
Sbjct  283   YRHGNVVFFDILGLFVLAYP  302



>ref|XP_004838304.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Heterocephalus glaber]
Length=907

 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 193/329 (59%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VDV+    
Sbjct  108   FDARQARDYLEHITAIGPRTTGSPENEILTVQYLLEQIKLIEVQSSRLHKISVDVQRPTG  167

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V ++
Sbjct  168   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVPSS  213

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +
Sbjct  214   PGASDDAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASLI  272

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  273   RAFINLEAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFR  332

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  333   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAF  391

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +     GK      +V+FD+LG +++ YP
Sbjct  392   SSEYRHGK------MVFFDVLGLFVIAYP  414



>ref|XP_004838306.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X3 
[Heterocephalus glaber]
Length=785

 Score =   198 bits (503),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 193/329 (59%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   +QY+L+  + I+ ++     ++VDV+    
Sbjct  108   FDARQARDYLEHITAIGPRTTGSPENEILTVQYLLEQIKLIEVQSSRLHKISVDVQRPTG  167

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V ++
Sbjct  168   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVPSS  213

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +
Sbjct  214   PGASDDAVSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASLI  272

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  273   RAFINLEAAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGIIPSETDFR  332

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  333   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDMLAF  391

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +     GK      +V+FD+LG +++ YP
Sbjct  392   SSEYRHGK------MVFFDVLGLFVIAYP  414



>ref|XP_008253296.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Oryctolagus cuniculus]
Length=904

 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 114/335 (34%), Positives = 193/335 (58%), Gaps = 27/335 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG+ G F    A ++++ ++ +GP   GS   +   ++Y+L+  + I+ ++     ++VD
Sbjct  101   AGDRGEFDASQARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEAQSSSLHMISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R L+  +    +++V+FLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLATSSEAL-HHAVVFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
               L T +K            +V+FD+LG +++ YP
Sbjct  386   EMLATSSKY-------QHGNMVFFDVLGLFVIAYP  413



>ref|XP_002923724.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Ailuropoda 
melanoleuca]
Length=896

 Score =   199 bits (505),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 195/354 (55%), Gaps = 26/354 (7%)
 Frame = +3

Query  1311  LPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGI--KEE  1481
             LP    +   G    S     ++++ ++ +GP   GS   +   ++Y+L+  + I  +  
Sbjct  85    LPGEAGSRRDGPIRRSLALCRDYLEHITSIGPRTTGSPENEIVTVRYLLEQIKLIEVQSS  144

Query  1482  AFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEED  1661
             +   ++VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + 
Sbjct  145   SVHRISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QH  190

Query  1662  AILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNG  1841
             A+L + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  
Sbjct  191   AVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSASSEAL-HHAVIFLFNGAEENVLQA  249

Query  1842  AHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQD  2018
             +H F+TQHPW + +R  I+LEA G+GGK  +FQ GP +PW ++ +   AK+P   VV+Q+
Sbjct  250   SHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVRAYVSAAKHPFASVVAQE  309

Query  2019  LFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLP  2198
             +F SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L 
Sbjct  310   VFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNVLA  369

Query  2199  FLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
              L   A+S  LP+ +K            +V+FD+LG +++ YP     + +  V
Sbjct  370   VLKYLATSDMLPSSSK-------YRHGNMVFFDVLGLFVIAYPSRVGSIINSVV  416



>ref|XP_002708148.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Oryctolagus cuniculus]
Length=904

 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 196/346 (57%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG+ G F    A ++++ ++ +GP   GS   +   ++Y+L+  + I+ ++     ++VD
Sbjct  101   AGDRGEFDASQARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEAQSSSLHMISVD  160

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  161   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  206

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R L+  +    +++V+FLFN  EE  L  +H F+TQH
Sbjct  207   DSVANSPGASDDAVSCSVMLEVLRVLATSSEAL-HHAVVFLFNGAEENVLQASHGFITQH  265

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  266   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  325

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  326   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATS  385

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L T +K            +V+FD+LG +++ YP     + +  V
Sbjct  386   EMLATSSKY-------QHGNMVFFDVLGLFVIAYPSRVGSIINYMV  424



>ref|XP_002050780.1| GJ20011 [Drosophila virilis]
 gb|EDW61973.1| GJ20011 [Drosophila virilis]
Length=892

 Score =   199 bits (505),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 214/407 (53%), Gaps = 41/407 (10%)
 Frame = +3

Query  1152  TQALNNIVLWDCPHLKSYTIE-GNMAER---SGYEIVVLFTFVVCGTWLVFYSQFKV---  1310
             T A N   L   P L  Y  E  N  ER   S  +I   +     G WL+ YS   +   
Sbjct  16    TDASNADPLLRQPQLHLYEDEQANCCERVFVSREKIKWYWAPAFIGFWLLIYSAISIPAS  75

Query  1311  --LPEPLSAEEAG---ETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI  1472
               LP PLS ++     E   +E A +N ++ L  LGP  +GS   +  ++Q +    + +
Sbjct  76    NHLPRPLSIKDEAKYPERFIAERAELN-LQRLVALGPRVVGSRENEMGSIQVITSTMQKV  134

Query  1473  KEE--AFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREG  1646
             + E  A  ++ +DV+V    SG       +++    +Y  +++ V+++SPK        G
Sbjct  135   RAELGAVHEIEMDVQV---ASG-----SYIHWSAVNMYQSIQNFVVKISPK--------G  178

Query  1647  EDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEE  1826
              +    +LV++H DTV A  GAGDD S VAVM+E  R L+K     K+  V+FLFN  EE
Sbjct  179   SNSSTYLLVNSHFDTVPAGPGAGDDGSMVAVMMETLRVLAKSKYALKH-PVVFLFNGAEE  237

Query  1827  EGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQ  2003
               L  +H+F+TQH W    +  I+L++ G GG+  +FQ+GP+ PW ++++ +  K+P   
Sbjct  238   NPLQASHAFITQHKWAKNCKALINLDSAGNGGREILFQSGPNHPWLMKSYRRAIKHPYAS  297

Query  2004  VVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLG  2183
              +++++F    I S TDF+++++   + GLD A+  +  VYHT+ D+  +   GS Q+ G
Sbjct  298   TIAEEMFQHNFIPSDTDFRIFRDHGAVPGLDMAYQYNGYVYHTRYDRAEIFPRGSFQNTG  357

Query  2184  ENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVY  2324
             +NLL  + + +S+ +L   +K         E   VY+D++G ++V Y
Sbjct  358   DNLLALIREISSAPELEDTSK-------HAEGHTVYYDVMGWFLVFY  397



>ref|XP_007536139.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Erinaceus 
europaeus]
Length=893

 Score =   199 bits (505),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 189/346 (55%), Gaps = 25/346 (7%)
 Frame = +3

Query  1335  EAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAE--GIKEEAFGDVNVD  1505
                 + F    A ++++ ++ +GP   GS   +   ++Y+L+  +   I+  +   V VD
Sbjct  89    RGAASAFDARRARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEIQSNSLHRVLVD  148

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  +N L GG     T  Y ++ +VV++L P +           + A+L + H 
Sbjct  149   VQRPTGSFSINFL-GGF----TSYYDNITNVVVKLEPAAGG--------AQHAVLANCHF  195

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + AVMLEV R LS  +   +  +VIFLFN  EE  L  +H F+TQH
Sbjct  196   DSVPNSPGASDDAVSCAVMLEVLRVLSTSSEALQQ-AVIFLFNGAEENVLQASHGFITQH  254

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW  ++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  255   PWTTSIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  314

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  315   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILSVLKYLATS  374

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L + +K            +V+FD+LG +++ YP     + +  V
Sbjct  375   DILASSSK-------YQHGNMVFFDVLGLFVIAYPSRVGSIINCMV  413



>ref|XP_009022161.1| hypothetical protein HELRODRAFT_176575 [Helobdella robusta]
 gb|ESN99808.1| hypothetical protein HELRODRAFT_176575 [Helobdella robusta]
Length=826

 Score =   198 bits (504),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 131/415 (32%), Positives = 218/415 (53%), Gaps = 25/415 (6%)
 Frame = +3

Query  1245  IVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGETGFSEVAAMNHVKALSQLGPHPLGST  1424
             I++++ F  C  ++  Y+     PEP+SA+      FSE  A +++     LG   +GS 
Sbjct  55    IILVYFFAACFIYVRNYT----FPEPISAKLGSADVFSEERARDYLNGFVDLGSRIVGSR  110

Query  1425  ALDT-ALQYVLQVAEGIKEE----AFGDVNVDVEVFHANSGVN-TLVGGLYFGKTPVYSD  1586
               +  A+Q++++  E IK       +    ++ E+  A+   +   +GG     T VY +
Sbjct  111   ENEVLAVQFLMREIEKIKRRNERIVWNKKKIEAEIQTASGSFDLDFLGGF----TNVYQN  166

Query  1587  LKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLS  1766
             +++V++RLS  S     +  E    A+LV+ H DT     G  DD+ + A+MLEV R L 
Sbjct  167   IQNVIVRLSSSSDGGGNKTSE-LNPALLVNCHYDTFINTPGTSDDAVSCAIMLEVLRALV  225

Query  1767  KQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAG  1946
             ++      + VIFLFN  EE  L G+H+FVT H W + VR  I+LE  G GGK  +FQ+ 
Sbjct  226   ERQDTSLIHDVIFLFNGAEETILQGSHAFVTSHRWFHDVRAFINLEGAGAGGKELLFQSS  285

Query  1947  PD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAV  2123
                PW +  + +   +P   +++Q++F SG+I+S TDF+++++   L GLD A+  +  V
Sbjct  286   SQHPWLLNMYVENVPHPFASILAQEIFQSGLIQSETDFRIFRDFGKLPGLDIAYIKNGYV  345

Query  2124  YHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDIL  2303
             YHT++D   ++  G +Q  GENL   +   ASS+ L  P+       S     +V+FD++
Sbjct  346   YHTRHDTPRMIPAGCIQRGGENLFSLVRSIASSAYLTNPD-------SFPYKQLVFFDLI  398

Query  2304  GRYMVVYPRSFADMFHKAViilsllisiaslYMGGLSALISLVFSALSIVLMWIG  2468
             G  +V +  SF   ++  + +L  L  ++SL   G   L  L  S LS +L W+ 
Sbjct  399   GYSVVCFRASFLFAYNNLLCLLVHLKVLSSLARKGY--LFHLTTSVLSTILSWVA  451



>ref|XP_010363391.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Rhinopithecus roxellana]
Length=897

 Score =   199 bits (505),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  102   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  161

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  162   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  207

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  208   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  266

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  267   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  326

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  327   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  386

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  387   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  425



>ref|XP_010363390.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Rhinopithecus roxellana]
Length=905

 Score =   199 bits (505),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  102   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  161

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  162   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  207

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  208   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  266

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  267   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  326

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  327   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  386

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  387   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  425



>ref|XP_005388805.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Chinchilla 
lanigera]
Length=825

 Score =   198 bits (503),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 113/333 (34%), Positives = 192/333 (58%), Gaps = 26/333 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSGVNTL  1544
             ++++ ++  GP   GS   +   +QY+L+  + I  +  +   ++VDV+    +  ++ L
Sbjct  34    DYLEHITAFGPRTTGSPENEILTVQYLLEQIKLIEVQSSSLHKISVDVQRPTGSFSIDFL  93

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y ++ +VV++L P+  A         + A+L + H D+V ++ GA DD+
Sbjct  94    -GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVPSSPGASDDA  139

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + +VMLEV R LS  +   ++ +V+FLFN  EE  L  +H F+TQHPW + +R  I+LE
Sbjct  140   VSCSVMLEVLRVLSTSSEALQH-AVVFLFNGAEENVLQASHGFITQHPWASLIRAFINLE  198

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW IQ +   AK+P   VV+Q++F SGVI S TDF++Y++   
Sbjct  199   AAGVGGKELVFQTGPENPWLIQAYVSAAKHPFASVVAQEVFQSGVIPSETDFRIYRDFGS  258

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   +     G
Sbjct  259   IPGIDLAFIENGYIYHTKYDTADRISTDSIQRAGDNILA-VLKYLATSDMLAFSSEYRHG  317

Query  2262  KSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             K      +V+FD+LG +++ YP     + +  V
Sbjct  318   K------MVFFDVLGLFVIAYPSRVGSIINYMV  344



>ref|XP_004317942.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Tursiops truncatus]
Length=803

 Score =   198 bits (503),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 111/329 (34%), Positives = 191/329 (58%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VDV+    
Sbjct  109   FDARQARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEVQSNSLHRISVDVQRPTG  168

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  169   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANS  214

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +
Sbjct  215   PGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLI  273

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  274   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFR  333

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  334   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDM---  389

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
                L++        +V+FD+LG +++ YP
Sbjct  390   ---LASSSKYQHGNMVFFDVLGLFVIAYP  415



>ref|XP_001958897.1| GF12612 [Drosophila ananassae]
 gb|EDV35719.1| GF12612 [Drosophila ananassae]
Length=861

 Score =   198 bits (504),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 185/327 (57%), Gaps = 29/327 (9%)
 Frame = +3

Query  1368  AMNHVKALSQLGPHPLGS-TALDTALQYVLQVAEGIKEEAFGD---VNVDVEVFHANSGV  1535
             A N +  LS++GP  +GS T    A+Q++L     I EEA GD   +  DV++   N  +
Sbjct  65    AENTLLRLSKIGPKVVGSPTNEQVAVQFLLNEISDIMEEARGDLYDIERDVQIASGNYLL  124

Query  1536  NTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAG  1715
              ++V         VY  +++VV++L+PK++          E A+LV++H D+V  + GAG
Sbjct  125   WSMVN--------VYQSIQNVVVKLTPKNST--------SEAALLVNSHFDSVPGSSGAG  168

Query  1716  DDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAI  1895
             D      +MLEV R ++K  T     SV+FLFN  EE  L G+H+F+TQHPW   V+  I
Sbjct  169   DAGMMCVIMLEVLRVIAKNETPL-TYSVVFLFNGAEENPLQGSHAFITQHPWAKNVKAVI  227

Query  1896  DLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKE  2072
             +L++ G GG+  +FQ+GPD PW ++ + K   +P    + ++LF +G + S TD++V+++
Sbjct  228   NLDSAGSGGREILFQSGPDNPWLMKYYGKNIVHPFASTIGEELFQNGFVPSETDYRVFRD  287

Query  2073  VAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTL  2252
                + GLD A T +  VYHTK D+  L+   + Q  GEN+L  +   A++ +L  P+   
Sbjct  288   FGEIPGLDMAQTLNGYVYHTKYDRFNLIPRRTYQLTGENVLALVKALANAEELENPS---  344

Query  2253  STGKSEDEDTVVYFDILGRYMVVYPRS  2333
                    E  +++FD+LG + V YP S
Sbjct  345   ----DHAEGHMIFFDVLGWFFVYYPES  367



>ref|XP_004004415.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Ovis aries]
Length=905

 Score =   199 bits (505),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 199/351 (57%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FG  1490
             L     G+ G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++    
Sbjct  98    LRGAAVGQQGEFDAHQARDYLEHITSIGPRITGSPENEILTVHYLLEQIKLIEAQSNSLH  157

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P++ A         + A+L
Sbjct  158   KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRAGA---------QHAVL  203

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  204   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-SHAVIFLFNGAEENVLQASHG  262

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  263   FITQHPWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  322

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  323   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  381

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  382   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  426



>gb|KDR16698.1| Endoplasmic reticulum metallopeptidase 1 [Zootermopsis nevadensis]
Length=889

 Score =   198 bits (504),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 204/373 (55%), Gaps = 24/373 (6%)
 Frame = +3

Query  1218  NMAERSGYEIVVLFTFVVCGTWLVFYSQFKVLPEPLSAEEAGE--TGFSEVAAMNHVKAL  1391
             N+ +   Y  +V+F   V    L +   ++ LP PLS ++ G     F    ++NH++ +
Sbjct  35    NVIKLPTYAALVVFIIGVLLYGLAYALHYR-LPTPLSLKDIGSHPDQFIAERSLNHLRQI  93

Query  1392  SQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNTLVGGLYFGK  1568
             +  G  P+GS   +  A++++ +    I + A  D  +  ++    +G   L    Y G 
Sbjct  94    AGYGSKPVGSYENEILAVEFLTREISFIMQRASPDQRISFDI-QKCTGSYPLAYKPY-GF  151

Query  1569  TPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLE  1748
             T  YS ++++++         KL    +   ++L++ H D+V  + G  DD  N AVMLE
Sbjct  152   TNYYSQVQNLLV---------KLSSNANSSSSLLINCHFDSVPTSPGGSDDGLNCAVMLE  202

Query  1749  VARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKS  1928
             V   LS+  T  K+N VIFLFN  EE  L  +H F+TQH W + V+  I+LEA G GG+ 
Sbjct  203   VLEILSRSKTPLKHN-VIFLFNGAEESPLQASHGFITQHKWAHEVKAFINLEACGAGGRE  261

Query  1929  GIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAF  2105
              +FQAGP+ PW IQ +A    +P G V+ +D+F SG++ S TD++++++   + GLDFA 
Sbjct  262   TLFQAGPNHPWLIQMYADSVPHPHGHVLGEDIFQSGLVPSDTDYRIFRDFGKIPGLDFAH  321

Query  2106  TDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTV  2285
               +  VYHT+ D +  +  G+LQH G+NLL    + ASS  L  P +  + G++      
Sbjct  322   AMNGYVYHTRYDNLHAIPTGTLQHTGDNLLALTKRIASSDILSNPQE-YAAGRT------  374

Query  2286  VYFDILGRYMVVY  2324
             VYFD+LG +MV Y
Sbjct  375   VYFDVLGLFMVSY  387



>gb|KFV16877.1| Endoplasmic reticulum metallopeptidase 1, partial [Pterocles 
gutturalis]
Length=791

 Score =   197 bits (502),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 183/325 (56%), Gaps = 34/325 (10%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEV------FHANSGV  1535
             ++  ++ +GP  +GS   +  A+ Y+L+    I+ E+     + V+V      FH N   
Sbjct  3     YLDNITAIGPRTVGSPENEVLAVNYLLEQIRAIERESTEAHKISVDVQRPTGSFHLN---  59

Query  1536  NTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAG  1715
                VGG     T  Y+++ +VV++L P++ A         E+A+L + H D+V  + GA 
Sbjct  60    --FVGGF----TSYYANITNVVVKLEPRNGA---------ENAVLSNCHFDSVPNSPGAS  104

Query  1716  DDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAI  1895
             DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I
Sbjct  105   DDAVSCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFI  163

Query  1896  DLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKE  2072
             +LEA G+GGK  +FQ GP +PW ++ +   AK+P   VV+Q++F SG+I + TDF++Y++
Sbjct  164   NLEAAGVGGKELVFQTGPENPWLVEAYVTAAKHPFASVVAQEVFQSGIIPADTDFRIYRD  223

Query  2073  VAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTL  2252
                + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S         L
Sbjct  224   FGNVPGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILSVLKYLATSDK-------L  276

Query  2253  STGKSEDEDTVVYFDILGRYMVVYP  2327
             +         VV+FD+LG ++V YP
Sbjct  277   AKSFEYRHGNVVFFDVLGLFVVAYP  301



>ref|XP_009083093.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum metallopeptidase 
1, partial [Acanthisitta chloris]
Length=790

 Score =   197 bits (502),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 181/320 (57%), Gaps = 24/320 (8%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNT-LVG  1550
             ++  ++ +GP  +GS   +  A+ Y+L+   GI+ E+ G   + V++       +   +G
Sbjct  2     YLDNITAIGPRTVGSPENEVIAVNYLLEQIRGIERESTGAHKISVDIQRPTGSFSIDFLG  61

Query  1551  GLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSN  1730
             G     T  Y+++ +VV++L P+  A         E A+L + H D+V    GA DD+ +
Sbjct  62    GF----TSYYANITNVVVKLEPRDGA---------EHAVLSNCHFDSVPNTPGASDDAVS  108

Query  1731  VAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAM  1910
              AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I+LEA 
Sbjct  109   CAVMLEILNTLSKSSESLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFINLEAA  167

Query  1911  GIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLS  2087
             G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + TDF++Y++   + 
Sbjct  168   GVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGIIPADTDFRIYRDFGNVP  227

Query  2088  GLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
             G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S       + L+    
Sbjct  228   GIDLAFIENGYIYHTEYDTSDRILTDSIQRAGDNILSVLKYLATS-------EKLAKSFE  280

Query  2268  EDEDTVVYFDILGRYMVVYP  2327
                  VV+FDILG +++ YP
Sbjct  281   YRHGNVVFFDILGLFVLAYP  300



>ref|XP_010083619.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Pterocles gutturalis]
Length=790

 Score =   197 bits (502),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 183/325 (56%), Gaps = 34/325 (10%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEV------FHANSGV  1535
             ++  ++ +GP  +GS   +  A+ Y+L+    I+ E+     + V+V      FH N   
Sbjct  2     YLDNITAIGPRTVGSPENEVLAVNYLLEQIRAIERESTEAHKISVDVQRPTGSFHLN---  58

Query  1536  NTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAG  1715
                VGG     T  Y+++ +VV++L P++ A         E+A+L + H D+V  + GA 
Sbjct  59    --FVGGF----TSYYANITNVVVKLEPRNGA---------ENAVLSNCHFDSVPNSPGAS  103

Query  1716  DDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAI  1895
             DD+ + AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I
Sbjct  104   DDAVSCAVMLEILNTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFI  162

Query  1896  DLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKE  2072
             +LEA G+GGK  +FQ GP +PW ++ +   AK+P   VV+Q++F SG+I + TDF++Y++
Sbjct  163   NLEAAGVGGKELVFQTGPENPWLVEAYVTAAKHPFASVVAQEVFQSGIIPADTDFRIYRD  222

Query  2073  VAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTL  2252
                + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S         L
Sbjct  223   FGNVPGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILSVLKYLATSDK-------L  275

Query  2253  STGKSEDEDTVVYFDILGRYMVVYP  2327
             +         VV+FD+LG ++V YP
Sbjct  276   AKSFEYRHGNVVFFDVLGLFVVAYP  300



>gb|EFB13836.1| hypothetical protein PANDA_012915 [Ailuropoda melanoleuca]
Length=793

 Score =   197 bits (502),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/335 (33%), Positives = 191/335 (57%), Gaps = 26/335 (8%)
 Frame = +3

Query  1368  AMNHVKALSQLGPHPLGSTALD-TALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSGVN  1538
             + ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VDV+    +  ++
Sbjct  1     SRDYLEHITSIGPRTTGSPENEIVTVRYLLEQIKLIEVQSSSVHRISVDVQRPTGSFSID  60

Query  1539  TLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGD  1718
              L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA D
Sbjct  61    FL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGASD  106

Query  1719  DSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAID  1898
             D+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  I+
Sbjct  107   DAVSCSVMLEVLRVLSASSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFIN  165

Query  1899  LEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEV  2075
             LEA G+GGK  +FQ GP +PW ++ +   AK+P   VV+Q++F SG+I S TDF++Y++ 
Sbjct  166   LEAAGVGGKELVFQTGPENPWLVRAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDF  225

Query  2076  AGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLS  2255
               + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K   
Sbjct  226   GNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNVLAVLKYLATSDMLPSSSK---  282

Query  2256  TGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
                      +V+FD+LG +++ YP     + +  V
Sbjct  283   ----YRHGNMVFFDVLGLFVIAYPSRVGSIINSVV  313



>ref|XP_002689655.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Bos taurus]
 tpg|DAA26920.1| TPA: endoplasmic reticulum metallopeptidase 1 [Bos taurus]
Length=925

 Score =   199 bits (505),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 197/351 (56%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FG  1490
             L     G  G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++    
Sbjct  117   LRGAAVGHQGEFDAHQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEAQSNSLH  176

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L
Sbjct  177   KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVL  222

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  223   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHG  281

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  282   FITQHPWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  341

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  342   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  400

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  401   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  445



>ref|XP_003762184.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Sarcophilus 
harrisii]
Length=909

 Score =   198 bits (504),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 186/322 (58%), Gaps = 26/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSGVNTL  1544
             N+++ ++ +GP   GS   +   + Y+L+  + IK E+     ++VDV+    +  ++ L
Sbjct  119   NYLEHITSIGPRTTGSLENEVLTVNYLLEQIKLIKAESSSIHKISVDVQRPTGSFSIDFL  178

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y ++ +VV++L P++ A         + A+L + H D+V  + GA DD+
Sbjct  179   -GGF----TSYYDNITNVVVKLEPRNGA---------QHAVLSNCHFDSVANSPGASDDA  224

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + +VMLE+ R LS  +   ++ +VIFLFN  EE  L  +H F+TQHPW N +R  I+LE
Sbjct  225   VSCSVMLEILRVLSTSSEALQH-AVIFLFNGAEENVLQASHGFITQHPWANLIRAFINLE  283

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++   
Sbjct  284   AAGVGGKELVFQTGPENPWLVQAYVLAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGS  343

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHT+ D    +   S+Q  G+N+L  L   A+S         L++ 
Sbjct  344   IPGIDLAFIENGYIYHTRYDTSDRILTDSIQRAGDNILAVLKYLATSDR-------LASS  396

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
                    +V+FD+LG +++ YP
Sbjct  397   FEYRHGNMVFFDVLGLFVIAYP  418



>ref|XP_007428185.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X1 
[Python bivittatus]
Length=890

 Score =   198 bits (503),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/331 (34%), Positives = 187/331 (56%), Gaps = 26/331 (8%)
 Frame = +3

Query  1347  TGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVF  1517
             T F    A  +++ ++ +GP  +GS   +   + Y+L+  + I  K      ++V+++  
Sbjct  90    TEFDAPRARAYLENITAIGPRSVGSPENEIFTVDYLLKQVKAIEIKSNHVHTISVNIQRP  149

Query  1518  HANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVF  1697
                  ++ L GG     T  Y ++ +V ++L P+S A         E A++++ H D+V 
Sbjct  150   TGTFSIDFL-GGF----TSYYDNITNVAVKLEPRSGA---------EHAVMLNCHFDSVP  195

Query  1698  AAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWIN  1877
                GA DD+ + ++MLE+   LSK +   ++ SVIFLFN  EE  L  +H F+TQHPW  
Sbjct  196   NTLGASDDAVSCSIMLEILYTLSKSSEPLQH-SVIFLFNGAEENVLQASHGFITQHPWAK  254

Query  1878  TVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTD  2054
             +VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P G +V+Q++F SG+I + TD
Sbjct  255   SVRAFINLEAAGVGGKELVFQTGPENPWLVQAYISAAKHPFGSIVAQEVFQSGIIPAETD  314

Query  2055  FQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLP  2234
             F++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  + SD+ 
Sbjct  315   FRIYRDFGNVPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLAKSDI-  372

Query  2235  TPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
                  LS         +VYFD LG +++ YP
Sbjct  373   -----LSKSHEYRHGNIVYFDFLGMFVMAYP  398



>ref|XP_001864514.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS40295.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=885

 Score =   198 bits (503),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/356 (34%), Positives = 191/356 (54%), Gaps = 29/356 (8%)
 Frame = +3

Query  1311  LPEPLSAEEAGE--TGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEE  1481
             LP+ L           F    A   +K L+  GP P GS A +  A+ ++L+    I++ 
Sbjct  59    LPDALRNSHLASFPNAFIAERAYKDLKILNDFGPKPTGSYANEVLAVDFLLREISYIEQL  118

Query  1482  AFGDVNVDVEVFHANSGVNTLVGGLYFGK--TPVYSDLKHVVMRLSPKSTADKLREGEDE  1655
                + N+ V+    + G      G+Y  K  T VY ++++V+++L+          G++ 
Sbjct  119   RNKNQNLQVDKQIVSGGYV----GVYMNKSATSVYRNVQNVIVKLA----------GKNS  164

Query  1656  EDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGL  1835
             + A+L++ H D+V  + GA DD S  AVMLE+ R LS+Q+     NS++FLFN  EE  L
Sbjct  165   DQALLLNCHFDSVATSPGASDDLSGCAVMLEILRVLSRQSE-INQNSILFLFNGAEETPL  223

Query  1836  NGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVS  2012
               +H F+T+H W   V+  I+LE+ G GGK  +FQ+GP +PW I+ +AK   YP  Q  +
Sbjct  224   QASHGFITKHRWAKEVKAFINLESAGSGGKEMLFQSGPRNPWLIEMYAKAIMYPFAQAAA  283

Query  2013  QDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENL  2192
             +++F SGVI S TDF+V+++  G+ G+DFA+T +   YHTK D +  +    LQ  G+N+
Sbjct  284   EEVFQSGVIPSDTDFRVFRDAGGVPGMDFAYTANGYRYHTKYDSIDYIPMAVLQRTGDNI  343

Query  2193  LPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             L      A+S  L          + ++ +  VYFD LG   + Y    A M + +V
Sbjct  344   LSLTRTMANSDKLGQ--------QGQNREHTVYFDFLGLIFIFYSADTAFMINLSV  391



>ref|XP_002705017.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum metallopeptidase 
1 isoform X1 [Bos taurus]
Length=930

 Score =   198 bits (504),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 197/351 (56%), Gaps = 27/351 (8%)
 Frame = +3

Query  1323  LSAEEAGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FG  1490
             L     G  G F    A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++    
Sbjct  122   LRGAAVGHQGEFDAHQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEAQSNSLH  181

Query  1491  DVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAIL  1670
              ++VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L
Sbjct  182   KISVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVL  227

Query  1671  VSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHS  1850
              + H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H 
Sbjct  228   ANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHG  286

Query  1851  FVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFS  2027
             F+TQHPW + VR  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F 
Sbjct  287   FITQHPWASLVRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQ  346

Query  2028  SGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLL  2207
             SG+I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L
Sbjct  347   SGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VL  405

Query  2208  QAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +  ++SD+      L++        +V+FD+LG +++ YP     + +  V
Sbjct  406   KYLATSDM------LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  450



>ref|XP_004766224.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 isoform X2 
[Mustela putorius furo]
Length=803

 Score =   197 bits (501),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/321 (35%), Positives = 186/321 (58%), Gaps = 26/321 (8%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALD-TALQYVLQVAEGIKEEA--FGDVNVDVEVFHANSGVNTLV  1547
             +++ ++ +GP   GS   +   ++Y+L+  + I+ ++     ++VDV+    +  ++ L 
Sbjct  14    YLEHITSIGPRTTGSPENEIVTVRYLLEQIKLIEAQSNSLHRISVDVQRPTGSFSIDFL-  72

Query  1548  GGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSS  1727
             GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA DD+ 
Sbjct  73    GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGASDDAV  119

Query  1728  NVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEA  1907
             + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  I+LEA
Sbjct  120   SCSVMLEVLRVLSVSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEA  178

Query  1908  MGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGL  2084
              G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++   +
Sbjct  179   AGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNI  238

Query  2085  SGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGK  2264
              G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K      
Sbjct  239   PGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDMLPSSSK------  292

Query  2265  SEDEDTVVYFDILGRYMVVYP  2327
                   +V+FD+LG  ++ YP
Sbjct  293   -YRHGNMVFFDVLGLCVIAYP  312



>ref|XP_003397081.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Bombus 
terrestris]
Length=882

 Score =   197 bits (502),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 187/346 (54%), Gaps = 23/346 (7%)
 Frame = +3

Query  1305  KVLPEPLSAEEAG--ETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK  1475
             K LPEPL  ++ G     F    A NH+  ++ +GP  +GS   +  A++Y+  +   I 
Sbjct  59    KKLPEPLMTDKEGLYPGRFIAERAHNHLLNITYIGPRIVGSYENEVLAIKYLTNIINNII  118

Query  1476  EEAFGDVNVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDE  1655
             ++A  +  + V V   +SG   L      G T VY ++++V++++ P             
Sbjct  119   KDANENHKILVNV-TKHSGAFPL--KFLDGMTNVYRNVQNVIVKIGPH---------RPT  166

Query  1656  EDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGL  1835
             + ++L++ H DT   + G  DD +  AVMLE+ R +S     FK+N VIFLFN  EE  L
Sbjct  167   KSSLLINCHFDTFPESPGGSDDGAGCAVMLEILRVISHSPKLFKHN-VIFLFNGAEENLL  225

Query  1836  NGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPDP-WAIQNFAKVAKYPSGQVVS  2012
               +H F+TQHPW   V+  I+LEA G GG+  +FQAGPD  W +Q +AK   YP    ++
Sbjct  226   QASHGFITQHPWAKEVKAFINLEACGAGGRELLFQAGPDSSWMLQIYAKSVPYPYASSLA  285

Query  2013  QDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENL  2192
             Q++F SG++   TDF+++++   +SGLDFA+  +  VYHTK D +  +  GSLQ  G+N+
Sbjct  286   QEIFESGIVPGDTDFRIFRDFGNVSGLDFAWATNGYVYHTKFDNIHQIPLGSLQRTGDNI  345

Query  2193  LPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPR  2330
             L  L      + L        TG        V+FD LG +++ +P+
Sbjct  346   LALLQGIVLDNYLSEVPPQDHTGNP------VFFDFLGTFVIRWPQ  385



>ref|XP_008539211.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Equus przewalskii]
Length=831

 Score =   197 bits (501),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/326 (34%), Positives = 189/326 (58%), Gaps = 26/326 (8%)
 Frame = +3

Query  1362  VAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSG  1532
             V + ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VDV+    +  
Sbjct  37    VTSRDYLEHITAIGPRTTGSPENEILTVHYLLEQIKLIEVQSSSLHKISVDVQRPTGSFS  96

Query  1533  VNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGA  1712
             ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA
Sbjct  97    IDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGA  142

Query  1713  GDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVA  1892
              DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  
Sbjct  143   SDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAF  201

Query  1893  IDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYK  2069
             I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y+
Sbjct  202   INLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYR  261

Query  2070  EVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKT  2249
             +   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+      
Sbjct  262   DFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDM------  314

Query  2250  LSTGKSEDEDTVVYFDILGRYMVVYP  2327
             L+T        +V+FD+ G +++ YP
Sbjct  315   LATSSKYRHGNMVFFDVFGLFVIAYP  340



>ref|XP_005581835.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Macaca fascicularis]
Length=1059

 Score =   199 bits (506),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 194/346 (56%), Gaps = 27/346 (8%)
 Frame = +3

Query  1338  AGETG-FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVD  1505
             AG  G F  + A ++++ ++ +GP   GS   +   + Y+L+  + I+ ++     ++VD
Sbjct  256   AGHHGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNRLHKISVD  315

Query  1506  VEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHV  1685
             V+    +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H 
Sbjct  316   VQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHF  361

Query  1686  DTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQH  1865
             D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQH
Sbjct  362   DSVANSPGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQH  420

Query  1866  PWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYPSGQVVSQDLFSSGVIK  2042
             PW + +R  I+LEA G+GGK  +FQ GP+ PW +Q +   AK+P   VV+Q++F SG+I 
Sbjct  421   PWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIP  480

Query  2043  SSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASS  2222
             S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S
Sbjct  481   SDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATS  540

Query  2223  SDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
               L   +K            +V+FD+LG +++ YP     + +  V
Sbjct  541   DMLAAASKY-------RHGNMVFFDVLGLFVIAYPSRIGSIINYMV  579



>ref|XP_001851536.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS33671.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=883

 Score =   197 bits (502),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/362 (34%), Positives = 194/362 (54%), Gaps = 35/362 (10%)
 Frame = +3

Query  1305  KVLPEPLSA---EEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDTALQYVLQVAEGIK  1475
             + LP+ LS    E++ E  F    A   +++ ++LGP   GS A D       ++A GI 
Sbjct  51    RNLPDALSVADLEQSPEAVFIGERAWKDLRSFTELGPRTTGSRAND-------ELAVGIF  103

Query  1476  EEAFGDV----NVDVEVFHANSGVNTLVGGLYFGK--TPVYSDLKHVVMRLSPKSTADKL  1637
             +     +    + D EV   N  V       ++G   T VY ++++VV++L  KS     
Sbjct  104   KREIAAIQEGKHPDQEVLMENQVVTGAFNFTFYGTSMTTVYRNVQNVVVKLVGKS-----  158

Query  1638  REGEDEEDAILVSAHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNT  1817
                   EDA+L++ H DTV  + G+ DD ++  VMLE+ R +S+   G   NSVIFLFN 
Sbjct  159   ------EDAVLLNCHFDTVPGSPGSSDDVASCTVMLEILRVMSR-LPGRNRNSVIFLFNG  211

Query  1818  GEEEGLNGAHSFVTQHPWINTVRVAIDLEAMGIGGKSGIFQAGPD-PWAIQNFAKVAKYP  1994
              EE  L  +H F+TQHPW   V+  ++LE+ G GGK  +FQ+GP+ PW +  +A+  ++P
Sbjct  212   AEETLLQASHGFITQHPWAKQVKAFLNLESAGSGGKEVLFQSGPNAPWMVDVYARTVRHP  271

Query  1995  SGQVVSQDLFSSGVIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQ  2174
               QV++++LF +G+I S TDF+++++   + G+D A   +   YHT+ D +  L  G LQ
Sbjct  272   FAQVMAEELFKTGLIPSDTDFRIFRDYGNIPGMDLAHFLNGFRYHTRYDSMEYLSVGVLQ  331

Query  2175  HLGENLLPFLLQAASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHK  2354
               G+N+L      A+S  L T     ST + +   T V+FD LG + V YP     + + 
Sbjct  332   RTGDNVLALTRGMANSKHLST-----STDEGQGSST-VFFDFLGLFFVNYPARLGQLINA  385

Query  2355  AV  2360
              V
Sbjct  386   VV  387



>ref|XP_005425650.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Geospiza 
fortis]
Length=843

 Score =   197 bits (501),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 181/320 (57%), Gaps = 24/320 (8%)
 Frame = +3

Query  1377  HVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGVNT-LVG  1550
             ++  ++ +GP  +GS   +  A+ Y+L+   GI+ E+     + V++       +   +G
Sbjct  54    YLDNITAIGPRTVGSPENEVLAVNYLLEQIRGIERESTDAHKISVDIQRPTGSFSIDFLG  113

Query  1551  GLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDSSN  1730
             G     T  Y+++ +VV++L P++ A         E A+L + H D+V    GA DD+ +
Sbjct  114   GF----TSYYANITNVVVKLEPRNGA---------EHAVLSNCHFDSVPNTPGASDDAVS  160

Query  1731  VAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLEAM  1910
              AVMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  ++R  I+LEA 
Sbjct  161   CAVMLEILNTLSKSSESLQH-AVIFLFNGAEENILQASHGFITQHEWAKSIRAFINLEAA  219

Query  1911  GIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAGLS  2087
             G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + TDF++Y++   + 
Sbjct  220   GVGGKELVFQTGPENPWLVQAYVVAAKHPFASVVAQEIFQSGIIPADTDFRIYRDFGNVP  279

Query  2088  GLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTGKS  2267
             G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S       + L+    
Sbjct  280   GIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILAVLKYLATS-------EKLAKSFE  332

Query  2268  EDEDTVVYFDILGRYMVVYP  2327
                  VV+FDILG +++ YP
Sbjct  333   YRHGNVVFFDILGLFVLAYP  352



>ref|XP_010723941.1| PREDICTED: endoplasmic reticulum metallopeptidase 1, partial 
[Meleagris gallopavo]
Length=806

 Score =   197 bits (500),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/331 (34%), Positives = 186/331 (56%), Gaps = 22/331 (7%)
 Frame = +3

Query  1341  GETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVF  1517
             GE  FS   A  ++  ++ +GP  +GS   +   + Y+LQ  + I+ E+     + V++ 
Sbjct  5     GEREFSAQRARGYLDNITAIGPRTVGSPENEVLTVNYLLQQIKAIETESTDAHKIFVDIQ  64

Query  1518  HANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVF  1697
                   +    G   G T  Y+++ +VV++L P+  A         E A+L + H D+V 
Sbjct  65    RPTGSFSIDFLG---GFTSYYANITNVVVKLEPRGGA---------EHAVLSNCHFDSVP  112

Query  1698  AAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWIN  1877
                GA DD+ + +VMLE+   LSK +   ++ +VIFLFN  EE  L  +H F+TQH W  
Sbjct  113   NTPGASDDAVSCSVMLEILYTLSKSSEPLQH-AVIFLFNGAEENILQASHGFITQHEWAK  171

Query  1878  TVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTD  2054
             ++R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I + TD
Sbjct  172   SIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVFAAKHPFASVVAQEIFQSGIIPADTD  231

Query  2055  FQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLP  2234
             F++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+ 
Sbjct  232   FRIYRDFGNVPGIDLAFIENGYIYHTKYDTSDRILTDSIQRAGDNILA-MLKYLATSDM-  289

Query  2235  TPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
                  L+         VV+FD+LG +++ YP
Sbjct  290   -----LAKSFEYRHGNVVFFDVLGLFVLAYP  315



>ref|XP_004677704.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Condylura 
cristata]
Length=904

 Score =   197 bits (502),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 191/338 (57%), Gaps = 28/338 (8%)
 Frame = +3

Query  1326  SAEEAGETGFSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDV  1496
             S+ + GE  F    A ++++ ++ +GP   GS   +   +QY+L+  + I  +  +   +
Sbjct  100   SSGDPGE--FDARQARDYLEHITSIGPRTTGSPENEILTVQYILEQIKLIEVQSSSLHKI  157

Query  1497  NVDVEVFHANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVS  1676
             +VDV+    +  ++ L GG     T  Y ++ +VV++L P+  A         +  +L +
Sbjct  158   SVDVQRPTGSFSIDFL-GGF----TSYYDNITNVVVKLEPRVGA---------QHGVLAN  203

Query  1677  AHVDTVFAAEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFV  1856
              H D+V  + GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+
Sbjct  204   CHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEVL-HHAVIFLFNGAEENVLQASHGFI  262

Query  1857  TQHPWINTVRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSG  2033
             TQHPW + +R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG
Sbjct  263   TQHPWASMIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSG  322

Query  2034  VIKSSTDFQVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQA  2213
             +I S TDF++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   
Sbjct  323   IIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYL  382

Query  2214  ASSSDLPTPNKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             A+S  L   +K            +V+FD+LG ++V YP
Sbjct  383   ATSDMLAASSKY-------QHGNMVFFDVLGLFVVAYP  413



>ref|XP_005616879.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Canis lupus 
familiaris]
Length=1000

 Score =   198 bits (504),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 187/322 (58%), Gaps = 26/322 (8%)
 Frame = +3

Query  1374  NHVKALSQLGPHPLGSTALD-TALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSGVNTL  1544
             ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VDV+    +  ++ L
Sbjct  210   DYLEHITSIGPRTTGSPENEIVTVRYLLEQIKLIEVQSNSLHRISVDVQRPTGSFSIDFL  269

Query  1545  VGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAGDDS  1724
              GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA DD+
Sbjct  270   -GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGASDDA  315

Query  1725  SNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAIDLE  1904
              + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  I+LE
Sbjct  316   VSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLE  374

Query  1905  AMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKEVAG  2081
             A G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++   
Sbjct  375   AAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGN  434

Query  2082  LSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTLSTG  2261
             + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  LP+ +K     
Sbjct  435   IPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDMLPSSSKY----  490

Query  2262  KSEDEDTVVYFDILGRYMVVYP  2327
                    +V+FD+LG +++ YP
Sbjct  491   ---RHGNMVFFDVLGLFVIAYP  509



>ref|XP_004591927.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Ochotona 
princeps]
Length=777

 Score =   196 bits (499),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/337 (32%), Positives = 185/337 (55%), Gaps = 24/337 (7%)
 Frame = +3

Query  1359  EVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFGDVNVDVEVFHANSGV  1535
              V   N+++ ++ +GP   GS   +   + Y+L+    I+ ++     + V+V       
Sbjct  14    RVGGENYLEHITAIGPRTTGSPENEVLTVGYLLEQIRRIEAQSHSLHRISVDVQRPTGSF  73

Query  1536  N-TLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGA  1712
             +   +GG     T  Y ++ +VV++L P++ A         + A+L + H D+V  + GA
Sbjct  74    SLDFLGGF----TSYYDNITNVVVKLEPRAGA---------QHAVLANCHFDSVANSPGA  120

Query  1713  GDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVA  1892
              DD+ + +VMLE  R ++  A   ++ +V+FLFN  EE  L  +H F+TQHPW ++VR  
Sbjct  121   SDDAVSCSVMLEALRVMATSAEALRH-AVVFLFNGAEENVLQASHGFITQHPWASSVRAF  179

Query  1893  IDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYK  2069
             I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y+
Sbjct  180   INLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYR  239

Query  2070  EVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKT  2249
             +   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S       + 
Sbjct  240   DFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATS-------EM  292

Query  2250  LSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             L+         +V+FD+LG +++ YP     + +  V
Sbjct  293   LAASSEYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  329



>ref|XP_007450274.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Lipotes 
vexillifer]
Length=909

 Score =   197 bits (501),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 187/329 (57%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VDV+    
Sbjct  112   FDARQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHRISVDVQRPTG  171

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  172   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANS  217

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +
Sbjct  218   PGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLI  276

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  277   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFR  336

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  L + 
Sbjct  337   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDMLASS  396

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +K            +V+FD+LG +++ YP
Sbjct  397   SKY-------QHGNMVFFDVLGLFVIAYP  418



>ref|XP_007108140.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Physeter 
catodon]
Length=905

 Score =   197 bits (501),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/340 (33%), Positives = 194/340 (57%), Gaps = 26/340 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VDV+    
Sbjct  108   FDARQARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEVQSNSLHRISVDVQRPTG  167

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  168   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANS  213

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +
Sbjct  214   PGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLI  272

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  273   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFR  332

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  333   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDM---  388

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
                L++        +V+FD+LG +++ YP     + +  V
Sbjct  389   ---LASSSKYQHGNMVFFDVLGLFVIAYPSRVGSIINYMV  425



>ref|XP_005173917.2| PREDICTED: endoplasmic reticulum metallopeptidase 1-like, partial 
[Danio rerio]
Length=569

 Score =   194 bits (492),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 182/338 (54%), Gaps = 27/338 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEAFG---DVNVDVEVFH  1520
             F+ + A  H+  ++ +GP  +GS   +   + Y+L+  E I+ E+      + VDV+   
Sbjct  87    FNALRARKHLDQITSVGPRTVGSPENEILTVNYLLEQIEQIRSESRSGPHSITVDVQKPT  146

Query  1521  ANSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFA  1700
              +  ++ L GG     T  Y  + ++ ++L PKS+A            +L + H D+V  
Sbjct  147   GSFSIDFL-GGF----TSYYDRVTNIAVKLEPKSSAQHF---------MLANCHFDSVAN  192

Query  1701  AEGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINT  1880
             + GA DD+ + +VMLEV   L+  +T  K+  VIFLFN  EE  L  +H F+TQHPW   
Sbjct  193   SPGASDDAVSCSVMLEVLHSLANLSTPIKH-GVIFLFNGAEENILQASHGFITQHPWAQQ  251

Query  1881  VRVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDF  2057
             VR  I+LEA G+GGK  +FQ GP +PW +Q + + A +P   VV Q++F SG+I S TDF
Sbjct  252   VRAFINLEAAGVGGKEVVFQTGPENPWLVQAYVRAAVHPFASVVGQEVFQSGIIPSDTDF  311

Query  2058  QVYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPT  2237
             ++Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L     S +   
Sbjct  312   RIYRDFGNIPGIDLAFIENGFIYHTKYDTPERIHTDSIQRAGDNILSVLQHLVMSDE---  368

Query  2238  PNKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFH  2351
                 L+         +V+FD+LG  +V YP   A + +
Sbjct  369   ----LADSSVYRHGNMVFFDVLGLMVVAYPARVAAIIN  402



>ref|XP_008422503.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Poecilia 
reticulata]
Length=896

 Score =   197 bits (501),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/329 (35%), Positives = 176/329 (53%), Gaps = 25/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIK-EEAFGDVNVDVEVFHAN  1526
             F+   A  H++ ++ +GP P+GS   +   + Y+L+  E I+   A G   V ++V    
Sbjct  94    FNAERARRHLEQITGVGPRPVGSQENEVLTVGYLLEQIEDIRARTAAGPHRVTLDVQRPT  153

Query  1527  SGVNT-LVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
                +   +GG     T  Y  + ++ ++L PK  A            +L + H DTV  +
Sbjct  154   GSFSIDFLGGF----TSFYDRVSNIAVKLEPKRGAQHF---------MLANCHFDTVANS  200

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + AVMLEV   L+ Q+T   ++ V+FLFN  EE  L  +H F+TQHPW   V
Sbjct  201   PGASDDAVSCAVMLEVLHALANQSTPL-HHGVVFLFNGAEENVLQASHGFITQHPWAKQV  259

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV Q++F SGVI S TDF+
Sbjct  260   RAFINLEAAGVGGKEVVFQTGPENPWLVQAYVHAAKHPFASVVGQEVFQSGVIPSDTDFR  319

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L    +S      
Sbjct  320   IYRDFGNIPGIDLAFIENGFIYHTKYDTANRILTDSIQRAGDNILAVLKHLVTS------  373

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
              + L+         +V+FD+LG   V YP
Sbjct  374   -EKLADSSEYRHGNMVFFDLLGVIAVAYP  401



>ref|XP_001493226.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Equus caballus]
Length=893

 Score =   197 bits (501),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 189/325 (58%), Gaps = 26/325 (8%)
 Frame = +3

Query  1365  AAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHANSGV  1535
             AA ++++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VDV+    +  +
Sbjct  100   AAKDYLEHITAIGPRTTGSPENEILTVHYLLEQIKLIEVQSSSLHKISVDVQRPTGSFSI  159

Query  1536  NTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAAEGAG  1715
             + L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  + GA 
Sbjct  160   DFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANSPGAS  205

Query  1716  DDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTVRVAI  1895
             DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +R  I
Sbjct  206   DDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFI  264

Query  1896  DLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQVYKE  2072
             +LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF++Y++
Sbjct  265   NLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRD  324

Query  2073  VAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTPNKTL  2252
                + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+      L
Sbjct  325   FGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDM------L  377

Query  2253  STGKSEDEDTVVYFDILGRYMVVYP  2327
             +T        +V+FD+ G +++ YP
Sbjct  378   ATSSKYRHGNMVFFDVFGLFVIAYP  402



>ref|XP_007182259.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Balaenoptera 
acutorostrata scammoni]
Length=905

 Score =   197 bits (501),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 189/329 (57%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGIKEEA--FGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   ++Y+L+  + I+ ++     ++VDV+    
Sbjct  108   FDARRARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEVQSNNLHRISVDVQRPTG  167

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  168   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANS  213

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +
Sbjct  214   PGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLI  272

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  273   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFR  332

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  L + 
Sbjct  333   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDMLASS  392

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
             +K            +V+FD+LG +++ YP
Sbjct  393   SKY-------QHGNMVFFDVLGLFVIAYP  414



>ref|XP_008143280.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Eptesicus 
fuscus]
Length=870

 Score =   197 bits (500),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 190/340 (56%), Gaps = 26/340 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHA  1523
             F+   A +H++ ++ +GP   GS   +   + Y+L+  + I  +  +   ++VDV+    
Sbjct  73    FNARQARDHLEQITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTG  132

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  133   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANS  178

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV   LS  +    +++VIFLFN  EE  L  +H F+TQH W N++
Sbjct  179   PGASDDAVSCSVMLEVLHVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHSWANSI  237

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  238   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSTAKHPFASVVAQEVFQSGIIPSDTDFR  297

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  L   A+S  L + 
Sbjct  298   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKYLATSDVLVSS  357

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYPRSFADMFHKAV  2360
             +K            +V+FD+LG +++ YP     + +  V
Sbjct  358   SKY-------RHGNMVFFDVLGLFVIAYPSRVGSIINCMV  390



>ref|XP_004279161.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Orcinus 
orca]
Length=906

 Score =   197 bits (501),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/329 (34%), Positives = 190/329 (58%), Gaps = 26/329 (8%)
 Frame = +3

Query  1353  FSEVAAMNHVKALSQLGPHPLGSTALDT-ALQYVLQVAEGI--KEEAFGDVNVDVEVFHA  1523
             F    A ++++ ++ +GP   GS   +   ++Y+L+  + I  +  +   ++VDV+    
Sbjct  109   FDARQARDYLEHITSIGPRTTGSPENEILTVRYLLEQIKLIEVQSNSLHRISVDVQRPTG  168

Query  1524  NSGVNTLVGGLYFGKTPVYSDLKHVVMRLSPKSTADKLREGEDEEDAILVSAHVDTVFAA  1703
             +  ++ L GG     T  Y ++ +VV++L P+  A         + A+L + H D+V  +
Sbjct  169   SFSIDFL-GGF----TSYYDNITNVVVKLEPRDGA---------QHAVLANCHFDSVANS  214

Query  1704  EGAGDDSSNVAVMLEVARGLSKQATGFKNNSVIFLFNTGEEEGLNGAHSFVTQHPWINTV  1883
              GA DD+ + +VMLEV R LS  +    +++VIFLFN  EE  L  +H F+TQHPW + +
Sbjct  215   PGASDDAVSCSVMLEVLRVLSTSSEAL-HHAVIFLFNGAEENVLQASHGFITQHPWASLI  273

Query  1884  RVAIDLEAMGIGGKSGIFQAGP-DPWAIQNFAKVAKYPSGQVVSQDLFSSGVIKSSTDFQ  2060
             R  I+LEA G+GGK  +FQ GP +PW +Q +   AK+P   VV+Q++F SG+I S TDF+
Sbjct  274   RAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFR  333

Query  2061  VYKEVAGLSGLDFAFTDHTAVYHTKNDKVALLKPGSLQHLGENLLPFLLQAASSSDLPTP  2240
             +Y++   + G+D AF ++  +YHTK D    +   S+Q  G+N+L  +L+  ++SD+   
Sbjct  334   IYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILA-VLKYLATSDM---  389

Query  2241  NKTLSTGKSEDEDTVVYFDILGRYMVVYP  2327
                L+         +V+FD+LG +++ YP
Sbjct  390   ---LAASSKYQHGNMVFFDVLGLFVIAYP  415



>gb|KDO44694.1| hypothetical protein CISIN_1g0024292mg, partial [Citrus sinensis]
 gb|KDO44695.1| hypothetical protein CISIN_1g0024292mg, partial [Citrus sinensis]
 gb|KDO44696.1| hypothetical protein CISIN_1g0024292mg, partial [Citrus sinensis]
Length=267

 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 156/267 (58%), Gaps = 12/267 (4%)
 Frame = +3

Query  3102  AKSPFVITTCVLFVVSLGMVAMQMVPAFVDDTARAVNIVQVVDHTGN----SSVVSHISL  3269
             AK P    + +L  +S+ MV+  ++P F ++TARAVNIV +VD +G         S+I+L
Sbjct  1     AKGPIAFASFILVGLSIIMVSSGIIPPFSEETARAVNIVHIVDASGKFGGKQEPSSYIAL  60

Query  3270  FSTTPGNLDVEAEKLG-GFVCGRDKAFDFVTFSVKYSCWTEPTAKLGWKESRIPALRVGR  3446
             +S TPG L  E E++  GFVCGRD   DFVT S+KY C T+  ++ GW +S IP + V  
Sbjct  61    YSATPGKLTKEVEQIKEGFVCGRDNVIDFVTSSMKYGCLTDDNSEGGWSQSDIPTIHVNS  120

Query  3447  ---DMEG--DTRATLIHIDTAYSTRWSLGINTNEIKDFELKDESGVLVSVGGEKNGVDGW  3611
                D EG  + R T + ID   + R +L IN  EI+DF  K +S  LV     K+ + GW
Sbjct  121   DTVDTEGNENERITQVSIDMKGAKRLTLAINAKEIEDFTFKVDSEELVPRDA-KSSIYGW  179

Query  3612  HVLRFAGGKNSPTEFNLTLQWHKNSS-GKRIMEGSEGENLLLKLRADVNTKTPEMVAVLE  3788
             H++ F+GGKN+ ++F + L W KNS+       G E +  L+KLR D +  TP+   VL 
Sbjct  180   HIIEFSGGKNAASKFEIALYWAKNSTRAAGNSNGKEKQQPLVKLRTDFDRLTPKTERVLS  239

Query  3789  KLLSWCSQYGKSSSPFTLAYLDAISVD  3869
             KL  WCS +  S S   L++L+++ V+
Sbjct  240   KLPPWCSLFEGSISSQPLSFLNSLPVN  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14210171730000