BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24348_g1_i2 len=586 path=[1410:0-11 976:12-42 3339:43-100
1824:101-125 25:126-241 141:242-278 1999:279-318 347:319-382
2102:383-391 2111:392-421 491:422-450 520:451-547 583:548-560
596:561-585]

Length=586
                                                                      Score     E

emb|CDP21314.1|  unnamed protein product                                110   6e-26   
emb|CDP00737.1|  unnamed protein product                                111   2e-24   
emb|CDP00687.1|  unnamed protein product                                107   3e-24   
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...    110   4e-24   
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...    110   5e-24   
emb|CDP00690.1|  unnamed protein product                                107   2e-23   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    107   7e-23   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...    106   9e-23   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    103   5e-22   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    102   1e-21   
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...    101   4e-21   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...    100   1e-20   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  99.0    3e-20   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  99.0    3e-20   
emb|CDP04880.1|  unnamed protein product                              99.0    4e-20   
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...  98.6    4e-20   
emb|CDP00693.1|  unnamed protein product                              92.8    6e-20   
emb|CDP21316.1|  unnamed protein product                              92.8    6e-20   
gb|AAV88066.1|  NBS-LRR protein                                       96.7    2e-19   Ipomoea batatas [batate]
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  97.1    2e-19   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  97.1    2e-19   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  96.7    2e-19   
emb|CDP05521.1|  unnamed protein product                              96.3    3e-19   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  95.9    3e-19   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  95.9    4e-19   
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...  95.5    4e-19   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  95.5    5e-19   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  95.5    5e-19   
emb|CDP00691.1|  unnamed protein product                              95.1    5e-19   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  95.5    5e-19   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2              94.7    9e-19   Capsicum chacoense
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  94.4    1e-18   
emb|CDP05558.1|  unnamed protein product                              94.0    1e-18   
emb|CDP15990.1|  unnamed protein product                              93.2    2e-18   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  93.6    2e-18   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  93.6    3e-18   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  92.8    4e-18   
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg              92.4    4e-18   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  92.8    4e-18   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  92.4    5e-18   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  92.4    5e-18   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  92.4    5e-18   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  87.8    6e-18   
emb|CDP11974.1|  unnamed protein product                              92.8    6e-18   
emb|CDP20153.1|  unnamed protein product                              92.4    8e-18   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  88.2    8e-18   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  91.7    9e-18   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  91.7    1e-17   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  91.7    1e-17   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  91.7    1e-17   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  91.3    1e-17   
ref|XP_006356446.1|  PREDICTED: putative late blight resistance p...  91.7    1e-17   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              91.3    1e-17   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...  90.9    2e-17   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              90.9    2e-17   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  87.4    2e-17   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...  90.9    2e-17   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...  90.9    2e-17   
emb|CDP19728.1|  unnamed protein product                              90.9    2e-17   
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  90.5    3e-17   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  90.1    3e-17   
ref|XP_009796331.1|  PREDICTED: late blight resistance protein R1...  89.4    3e-17   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  89.7    4e-17   
gb|AAT39951.2|  Disease resistance protein, putative                  89.7    6e-17   Solanum demissum
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  89.0    7e-17   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  89.0    8e-17   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  88.6    1e-16   
emb|CDP11163.1|  unnamed protein product                              89.0    1e-16   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  88.2    1e-16   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  87.4    2e-16   
ref|XP_011072559.1|  PREDICTED: putative late blight resistance p...  84.7    2e-16   
gb|EYU22216.1|  hypothetical protein MIMGU_mgv1a019937mg              87.4    3e-16   
emb|CDP08019.1|  unnamed protein product                              87.8    3e-16   
emb|CDP05499.1|  unnamed protein product                              87.0    3e-16   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  87.0    3e-16   
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg              87.0    3e-16   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  87.0    3e-16   
emb|CDP00692.1|  unnamed protein product                              87.0    3e-16   
gb|AAT40487.1|  putative disease resistance protein                   87.4    4e-16   Solanum demissum
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  87.0    4e-16   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...  86.7    4e-16   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  86.7    4e-16   
ref|XP_009625968.1|  PREDICTED: putative late blight resistance p...  84.7    4e-16   
gb|AAV31175.1|  Putative disease resistance protein, identical        86.7    4e-16   Solanum tuberosum [potatoes]
emb|CDP07957.1|  unnamed protein product                              86.7    5e-16   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg              86.3    5e-16   
ref|XP_006365690.1|  PREDICTED: putative late blight resistance p...  85.5    6e-16   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              86.3    6e-16   
ref|XP_011072144.1|  PREDICTED: putative late blight resistance p...  86.3    6e-16   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  85.9    8e-16   
ref|XP_011084836.1|  PREDICTED: putative late blight resistance p...  85.1    8e-16   
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  86.3    8e-16   
gb|EYU20573.1|  hypothetical protein MIMGU_mgv1a000577mg              86.3    8e-16   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...  85.9    9e-16   
ref|XP_006360433.1|  PREDICTED: putative late blight resistance p...  83.6    9e-16   
ref|XP_011072147.1|  PREDICTED: putative late blight resistance p...  85.9    9e-16   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  85.9    9e-16   
ref|XP_009599401.1|  PREDICTED: putative late blight resistance p...  82.4    9e-16   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...  85.5    1e-15   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  85.5    1e-15   
emb|CDP19132.1|  unnamed protein product                              85.9    1e-15   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  85.9    1e-15   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              85.5    1e-15   
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...  82.8    1e-15   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  85.5    1e-15   
emb|CDP04724.1|  unnamed protein product                              84.7    1e-15   
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...  85.5    2e-15   
emb|CDP16510.1|  unnamed protein product                              85.5    2e-15   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  84.7    2e-15   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  84.7    2e-15   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  84.7    2e-15   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  84.7    2e-15   
gb|EYU34208.1|  hypothetical protein MIMGU_mgv1a026654mg              84.7    2e-15   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              84.7    2e-15   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...  84.7    2e-15   
emb|CDP15268.1|  unnamed protein product                              84.7    2e-15   
ref|XP_009594808.1|  PREDICTED: putative late blight resistance p...  81.3    3e-15   
gb|EYU23519.1|  hypothetical protein MIMGU_mgv1a022028mg              84.3    3e-15   
emb|CDP08021.1|  unnamed protein product                              84.3    3e-15   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  84.3    3e-15   
emb|CDP05538.1|  unnamed protein product                              84.3    3e-15   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  84.0    3e-15   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  84.0    4e-15   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  84.0    4e-15   
gb|EYU24175.1|  hypothetical protein MIMGU_mgv1a026011mg              84.0    4e-15   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  84.0    4e-15   
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  83.6    4e-15   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...  83.6    5e-15   
emb|CDP08396.1|  unnamed protein product                              83.2    5e-15   
ref|XP_011072142.1|  PREDICTED: putative late blight resistance p...  83.6    5e-15   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  83.2    6e-15   
emb|CDP11161.1|  unnamed protein product                              83.2    6e-15   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  83.2    7e-15   
emb|CDP16512.1|  unnamed protein product                              83.2    7e-15   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  83.2    7e-15   
emb|CDP05514.1|  unnamed protein product                              83.2    7e-15   
ref|XP_011072134.1|  PREDICTED: putative late blight resistance p...  83.2    7e-15   
emb|CDP11642.1|  unnamed protein product                              83.2    7e-15   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...  82.4    8e-15   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  82.8    8e-15   
emb|CDP08032.1|  unnamed protein product                              81.3    9e-15   
gb|EYU29923.1|  hypothetical protein MIMGU_mgv1a026346mg              79.7    1e-14   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  82.8    1e-14   
emb|CDP21300.1|  unnamed protein product                              82.8    1e-14   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  82.4    1e-14   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2              82.4    1e-14   
gb|AEW48197.1|  disease resistance protein RGH3                       82.4    1e-14   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...  82.4    1e-14   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  82.4    1e-14   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...  82.0    2e-14   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  82.0    2e-14   
ref|XP_011072139.1|  PREDICTED: putative late blight resistance p...  82.0    2e-14   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  81.6    2e-14   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  82.0    2e-14   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  82.0    2e-14   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              81.6    2e-14   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              81.6    2e-14   
emb|CDP08024.1|  unnamed protein product                              81.6    2e-14   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              81.6    2e-14   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  81.6    2e-14   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              81.3    2e-14   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...  81.6    2e-14   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              81.3    2e-14   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  81.6    2e-14   
ref|XP_009762295.1|  PREDICTED: putative late blight resistance p...  77.4    2e-14   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              81.3    2e-14   
emb|CDP21177.1|  unnamed protein product                              80.9    2e-14   
gb|EYU23523.1|  hypothetical protein MIMGU_mgv1a025044mg              81.3    2e-14   
emb|CDP11160.1|  unnamed protein product                              81.6    2e-14   
emb|CDP08020.1|  unnamed protein product                              81.6    3e-14   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  81.3    3e-14   
ref|XP_009608261.1|  PREDICTED: putative late blight resistance p...  81.6    3e-14   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  81.3    3e-14   
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  81.6    3e-14   
ref|XP_009761713.1|  PREDICTED: putative late blight resistance p...  78.6    3e-14   
ref|XP_009616092.1|  PREDICTED: putative late blight resistance p...  81.3    3e-14   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  81.6    3e-14   
ref|XP_009616093.1|  PREDICTED: putative late blight resistance p...  81.3    3e-14   
ref|XP_009616094.1|  PREDICTED: putative late blight resistance p...  81.3    3e-14   
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...  80.5    4e-14   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...  80.5    4e-14   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  80.9    4e-14   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  80.9    4e-14   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...  81.3    4e-14   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg              80.9    4e-14   
gb|EYU31247.1|  hypothetical protein MIMGU_mgv1a017756mg              80.9    5e-14   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  80.5    5e-14   
gb|AEW48205.1|  disease resistance protein RGH2                       80.5    5e-14   
gb|EYU31552.1|  hypothetical protein MIMGU_mgv1a025226mg              80.9    5e-14   
ref|XP_009778434.1|  PREDICTED: putative late blight resistance p...  80.9    5e-14   
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  80.9    5e-14   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  80.5    5e-14   
emb|CDP12799.1|  unnamed protein product                              80.9    5e-14   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...  80.5    5e-14   
emb|CDP00758.1|  unnamed protein product                              80.5    5e-14   
ref|XP_011075674.1|  PREDICTED: late blight resistance protein R1...  80.5    6e-14   
emb|CDP11186.1|  unnamed protein product                              80.9    6e-14   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  80.5    6e-14   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...  80.5    6e-14   
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  80.5    6e-14   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  80.5    6e-14   
gb|EYU39490.1|  hypothetical protein MIMGU_mgv1a0204861mg             78.6    6e-14   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...  80.1    7e-14   
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...  80.1    7e-14   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  80.1    7e-14   
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  79.7    7e-14   
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg              79.7    8e-14   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  79.7    8e-14   
gb|AAL17826.1|  GPA2-like NBS-LRR protein                             79.0    8e-14   Solanum nigrum
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  79.7    8e-14   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  79.7    8e-14   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg              79.7    9e-14   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...  79.7    9e-14   
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg              79.3    9e-14   
emb|CDP04756.1|  unnamed protein product                              80.1    9e-14   
emb|CDP11157.1|  unnamed protein product                              79.7    9e-14   
ref|XP_009764213.1|  PREDICTED: putative late blight resistance p...  75.9    9e-14   
ref|XP_011072138.1|  PREDICTED: putative late blight resistance p...  78.6    9e-14   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  80.1    1e-13   
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  80.1    1e-13   
gb|AAF76163.1|AF266747_1  RGC1                                        79.7    1e-13   Solanum tuberosum [potatoes]
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              79.3    1e-13   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  79.3    1e-13   
emb|CDP08038.1|  unnamed protein product                              79.7    1e-13   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...  79.3    1e-13   
ref|XP_009773003.1|  PREDICTED: protein CHUP1, chloroplastic-like     77.4    1e-13   
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg             79.3    1e-13   
gb|AET22504.1|  hypothetical protein                                  79.3    1e-13   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg              79.3    1e-13   
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg              79.3    1e-13   
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg              79.3    1e-13   
emb|CDP17920.1|  unnamed protein product                              79.3    1e-13   
ref|XP_010677242.1|  PREDICTED: putative late blight resistance p...  79.3    1e-13   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              79.3    1e-13   
emb|CDP04885.1|  unnamed protein product                              79.3    1e-13   
ref|XP_011071886.1|  PREDICTED: uncharacterized protein LOC105157233  77.0    1e-13   
emb|CDP08428.1|  unnamed protein product                              79.3    1e-13   
gb|EYU21829.1|  hypothetical protein MIMGU_mgv1a001470mg              79.0    2e-13   
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg              79.0    2e-13   
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  79.0    2e-13   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg              79.0    2e-13   
emb|CDP08023.1|  unnamed protein product                              79.0    2e-13   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  79.0    2e-13   
emb|CDP12821.1|  unnamed protein product                              79.0    2e-13   
emb|CDP11636.1|  unnamed protein product                              78.6    2e-13   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  78.6    2e-13   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg              78.6    2e-13   
emb|CDP16255.1|  unnamed protein product                              78.6    2e-13   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  78.6    2e-13   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  79.0    3e-13   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  79.0    3e-13   
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...  75.5    3e-13   
emb|CDP17263.1|  unnamed protein product                              78.6    3e-13   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  78.2    3e-13   
ref|XP_010677240.1|  PREDICTED: putative late blight resistance p...  78.6    3e-13   
emb|CDP15122.1|  unnamed protein product                              78.6    3e-13   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  78.2    3e-13   
emb|CDP13141.1|  unnamed protein product                              78.2    3e-13   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  78.2    3e-13   
ref|XP_009602411.1|  PREDICTED: putative late blight resistance p...  78.2    3e-13   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg              78.2    3e-13   
emb|CDP20159.1|  unnamed protein product                              78.6    3e-13   
emb|CDP04755.1|  unnamed protein product                              77.8    3e-13   
gb|AEW48216.1|  disease resistance protein RX3                        78.2    3e-13   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...  77.4    3e-13   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...  77.8    4e-13   
ref|XP_011087137.1|  PREDICTED: putative late blight resistance p...  77.8    4e-13   
emb|CDP16976.1|  unnamed protein product                              78.2    4e-13   
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...  77.8    4e-13   
emb|CDP08033.1|  unnamed protein product                              77.8    4e-13   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...  77.8    4e-13   
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211  74.7    4e-13   
emb|CDP18682.1|  unnamed protein product                              77.8    4e-13   
gb|AEW48218.1|  disease resistance protein RX6                        77.8    5e-13   
gb|AEW48209.1|  disease resistance protein RGH5                       77.4    5e-13   
emb|CDP17260.1|  unnamed protein product                              77.4    5e-13   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  77.4    5e-13   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              77.0    5e-13   
gb|AEW48217.1|  disease resistance protein RX5                        77.4    6e-13   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...  77.4    6e-13   
ref|XP_009774297.1|  PREDICTED: putative late blight resistance p...  77.4    6e-13   
emb|CDP16256.1|  unnamed protein product                              77.0    6e-13   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  77.0    6e-13   
gb|AEW48190.1|  disease resistance protein RX4                        77.0    7e-13   
emb|CAB50786.1|  Rx protein                                           77.0    7e-13   
ref|XP_011072136.1|  PREDICTED: putative late blight resistance p...  77.0    7e-13   
emb|CDP15718.1|  unnamed protein product                              77.0    7e-13   
ref|XP_009603189.1|  PREDICTED: uncharacterized protein LOC104098223  75.1    7e-13   
ref|XP_011073039.1|  PREDICTED: putative late blight resistance p...  77.0    7e-13   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg              77.0    7e-13   
emb|CDP00736.1|  unnamed protein product                              77.0    7e-13   
emb|CDP15579.1|  unnamed protein product                              77.4    7e-13   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  77.4    7e-13   
gb|EPS69440.1|  hypothetical protein M569_05326                       75.9    8e-13   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              76.6    8e-13   
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  76.6    9e-13   
gb|EYU23534.1|  hypothetical protein MIMGU_mgv1a023257mg              76.6    9e-13   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...  76.6    9e-13   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  76.6    9e-13   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...  76.6    9e-13   
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...  76.6    9e-13   
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              76.6    9e-13   
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg              76.6    9e-13   
emb|CDP04753.1|  unnamed protein product                              77.0    9e-13   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  76.6    1e-12   
gb|AEW48201.1|  disease resistance protein RGH9                       76.6    1e-12   
emb|CDP18040.1|  unnamed protein product                              76.6    1e-12   
emb|CDP11548.1|  unnamed protein product                              76.6    1e-12   
ref|XP_004236955.1|  PREDICTED: putative late blight resistance p...  76.6    1e-12   
emb|CAB56299.1|  NBS-LRR protein                                      76.6    1e-12   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  76.3    1e-12   
gb|ABJ99598.1|  NBS-LRR type resistance protein                       76.3    1e-12   
emb|CDP10323.1|  unnamed protein product                              76.3    1e-12   
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...  76.6    1e-12   
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...  76.3    1e-12   
emb|CDP16515.1|  unnamed protein product                              76.3    1e-12   
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...  76.6    1e-12   
gb|ABJ99601.1|  NBS-LRR type resistance protein                       76.3    1e-12   
emb|CDP12798.1|  unnamed protein product                              76.3    1e-12   
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...  74.3    1e-12   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  76.6    1e-12   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  76.6    1e-12   
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  75.9    1e-12   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  76.3    1e-12   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  75.9    1e-12   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg              75.9    2e-12   
emb|CDP19994.1|  unnamed protein product                              75.9    2e-12   
ref|XP_009799903.1|  PREDICTED: putative late blight resistance p...  75.9    2e-12   
emb|CDP19489.1|  unnamed protein product                              75.9    2e-12   
ref|XP_006365678.1|  PREDICTED: putative late blight resistance p...  75.5    2e-12   
ref|XP_004238957.1|  PREDICTED: putative late blight resistance p...  75.5    2e-12   
emb|CDO99208.1|  unnamed protein product                              75.1    2e-12   
emb|CDP08040.1|  unnamed protein product                              75.1    2e-12   
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...  75.5    2e-12   
ref|XP_009800556.1|  PREDICTED: putative late blight resistance p...  75.9    2e-12   
emb|CDP05441.1|  unnamed protein product                              75.5    2e-12   
ref|XP_009800554.1|  PREDICTED: putative late blight resistance p...  75.9    2e-12   
gb|AEW48212.1|  disease resistance protein RGH1                       75.5    2e-12   
gb|EYU24152.1|  hypothetical protein MIMGU_mgv1a018081mg              75.5    2e-12   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...  72.4    2e-12   
gb|EYU24151.1|  hypothetical protein MIMGU_mgv1a019744mg              75.5    3e-12   
emb|CDP17914.1|  unnamed protein product                              75.1    3e-12   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg              75.1    3e-12   
ref|XP_006348816.1|  PREDICTED: putative late blight resistance p...  75.5    3e-12   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              75.1    3e-12   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...  75.1    3e-12   
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg              75.1    3e-12   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              75.1    3e-12   
gb|AAV88068.1|  NBS-LRR protein                                       74.7    4e-12   
ref|XP_006345615.1|  PREDICTED: putative late blight resistance p...  71.6    4e-12   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  74.7    4e-12   
emb|CDP10671.1|  unnamed protein product                              74.3    5e-12   
ref|XP_006365952.1|  PREDICTED: putative late blight resistance p...  71.6    5e-12   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  74.3    5e-12   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  74.3    5e-12   
ref|XP_009610032.1|  PREDICTED: putative late blight resistance p...  74.3    5e-12   
ref|XP_009610033.1|  PREDICTED: putative late blight resistance p...  74.3    5e-12   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...  74.3    5e-12   
emb|CDP10267.1|  unnamed protein product                              74.3    6e-12   
emb|CDP19634.1|  unnamed protein product                              74.3    6e-12   
emb|CDP11825.1|  unnamed protein product                              74.3    6e-12   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              74.3    6e-12   
emb|CDP17919.1|  unnamed protein product                              74.3    6e-12   
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...  73.6    6e-12   
gb|ABY61746.1|  resistance protein PSH-RGH7                           74.3    6e-12   
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg              72.4    7e-12   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  73.9    7e-12   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              73.9    7e-12   
emb|CDP20607.1|  unnamed protein product                              73.6    7e-12   
ref|XP_009608248.1|  PREDICTED: putative late blight resistance p...  72.8    8e-12   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...  73.9    8e-12   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  73.6    8e-12   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg              73.6    8e-12   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg              73.6    9e-12   
ref|XP_009783489.1|  PREDICTED: putative late blight resistance p...  73.6    9e-12   
ref|XP_006349898.1|  PREDICTED: putative late blight resistance p...  72.4    9e-12   
emb|CDP18676.1|  unnamed protein product                              73.9    9e-12   
ref|XP_004239469.1|  PREDICTED: putative late blight resistance p...  73.9    9e-12   
ref|XP_011072123.1|  PREDICTED: putative late blight resistance p...  73.6    9e-12   
gb|EYU20585.1|  hypothetical protein MIMGU_mgv1a019584mg              73.6    9e-12   
gb|EYU21833.1|  hypothetical protein MIMGU_mgv1a009417mg              72.0    1e-11   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...  73.6    1e-11   
ref|XP_011072132.1|  PREDICTED: putative late blight resistance p...  73.2    1e-11   
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  72.4    1e-11   
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...  73.6    1e-11   
ref|XP_010320926.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   
gb|AAF76312.1|AF220603_4  Prf                                         73.9    1e-11   
emb|CDP13440.1|  unnamed protein product                              73.2    1e-11   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  72.4    1e-11   
gb|AAC49408.1|  PRF                                                   73.6    1e-11   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  73.2    1e-11   
gb|AAF76308.1|  Prf                                                   73.6    1e-11   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  73.2    1e-11   
ref|XP_006367977.1|  PREDICTED: putative late blight resistance p...  70.5    1e-11   
emb|CDP12547.1|  unnamed protein product                              73.2    2e-11   
gb|EYU24353.1|  hypothetical protein MIMGU_mgv1a022376mg              72.8    2e-11   
emb|CDP00696.1|  unnamed protein product                              68.2    2e-11   
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg              72.8    2e-11   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  72.8    2e-11   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  72.8    2e-11   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...  72.8    2e-11   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  72.4    2e-11   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  72.4    2e-11   
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...  72.4    2e-11   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...  72.4    2e-11   
gb|EYU24178.1|  hypothetical protein MIMGU_mgv1a024402mg              72.4    2e-11   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              72.4    2e-11   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  72.4    3e-11   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...  72.4    3e-11   
emb|CDP16266.1|  unnamed protein product                              72.0    3e-11   
gb|EYU23506.1|  hypothetical protein MIMGU_mgv1a001122mg              72.0    3e-11   
gb|EYU40390.1|  hypothetical protein MIMGU_mgv1a018316mg              72.0    3e-11   
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...  71.2    3e-11   
emb|CDP18742.1|  unnamed protein product                              72.0    3e-11   
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...  72.0    3e-11   
emb|CDP10807.1|  unnamed protein product                              72.0    3e-11   
ref|XP_009777062.1|  PREDICTED: putative late blight resistance p...  72.0    3e-11   
emb|CDP17943.1|  unnamed protein product                              72.0    3e-11   
gb|EYU23525.1|  hypothetical protein MIMGU_mgv1a018698mg              72.0    3e-11   
emb|CDP11611.1|  unnamed protein product                              72.0    3e-11   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...  71.6    3e-11   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              71.6    4e-11   
ref|XP_009777064.1|  PREDICTED: putative late blight resistance p...  72.0    4e-11   
ref|XP_009777063.1|  PREDICTED: putative late blight resistance p...  72.0    4e-11   
emb|CDP12797.1|  unnamed protein product                              72.0    4e-11   
emb|CDP00592.1|  unnamed protein product                              71.6    4e-11   
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...  71.6    4e-11   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  71.6    4e-11   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              71.6    4e-11   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  71.6    4e-11   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...  71.6    4e-11   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  71.6    4e-11   
emb|CDP10296.1|  unnamed protein product                              71.6    4e-11   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...  71.6    4e-11   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg              71.6    5e-11   
gb|EYU17690.1|  hypothetical protein MIMGU_mgv1a023002mg              71.6    5e-11   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  71.6    5e-11   
gb|ABY61745.1|  resistance protein PSH-RGH6                           71.2    5e-11   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  71.2    5e-11   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg              71.2    5e-11   
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg              71.2    5e-11   
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg              71.2    5e-11   
ref|XP_009779607.1|  PREDICTED: putative late blight resistance p...  71.2    5e-11   
ref|XP_011072171.1|  PREDICTED: putative late blight resistance p...  71.2    5e-11   
gb|AEW48214.1|  disease resistance protein RGH4                       71.2    6e-11   
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...  71.2    6e-11   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              70.9    6e-11   
emb|CDP12800.1|  unnamed protein product                              71.2    6e-11   
ref|XP_006350137.1|  PREDICTED: putative late blight resistance p...  71.2    6e-11   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...  71.2    6e-11   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...  70.9    7e-11   
gb|AEW48206.1|  disease resistance protein RGH4                       70.9    8e-11   
ref|XP_011072172.1|  PREDICTED: putative late blight resistance p...  70.9    8e-11   
ref|XP_010312507.1|  PREDICTED: putative late blight resistance p...  70.9    8e-11   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg              70.9    8e-11   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...  70.9    8e-11   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              70.9    8e-11   
ref|XP_006367044.1|  PREDICTED: putative late blight resistance p...  66.2    9e-11   
emb|CDP15578.1|  unnamed protein product                              70.5    9e-11   
gb|EYU23566.1|  hypothetical protein MIMGU_mgv1a020047mg              70.5    9e-11   
ref|XP_009802868.1|  PREDICTED: putative late blight resistance p...  67.0    9e-11   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...  70.5    9e-11   
ref|XP_009787864.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  70.5    1e-10   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2             70.5    1e-10   
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...  69.3    1e-10   
gb|AEW48200.1|  disease resistance protein RGH7                       70.5    1e-10   
emb|CDP15597.1|  unnamed protein product                              70.5    1e-10   
ref|XP_010320671.1|  PREDICTED: uncharacterized protein LOC101257665  70.5    1e-10   
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...  70.1    1e-10   
emb|CDP21622.1|  unnamed protein product                              70.1    1e-10   
ref|NP_001234273.1|  JJH-R-like protein                               67.0    1e-10   
ref|XP_009613236.1|  PREDICTED: putative late blight resistance p...  69.7    1e-10   
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              69.7    2e-10   
emb|CDP11618.1|  unnamed protein product                              69.7    2e-10   
ref|XP_006346788.1|  PREDICTED: putative late blight resistance p...  69.3    2e-10   
emb|CDP19443.1|  unnamed protein product                              69.3    2e-10   
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...  69.7    2e-10   
ref|XP_009798711.1|  PREDICTED: putative late blight resistance p...  69.3    2e-10   
emb|CDP16498.1|  unnamed protein product                              69.3    2e-10   
ref|XP_009630520.1|  PREDICTED: putative late blight resistance p...  69.3    2e-10   
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg              69.3    2e-10   
gb|EYU22232.1|  hypothetical protein MIMGU_mgv1a002671mg              68.9    2e-10   
emb|CDP05594.1|  unnamed protein product                              69.3    3e-10   
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...  68.9    3e-10   
emb|CDP18959.1|  unnamed protein product                              68.9    3e-10   



>emb|CDP21314.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 94/166 (57%), Gaps = 3/166 (2%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPN  348
            L NL  L +LETL  +F   +    +NL    L + +K L L R+ LPW ++  I MLPN
Sbjct  77   LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHLSLSRSYLPWEDMTFIAMLPN  136

Query  347  LEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTK  171
            LEVLKLK  +  GP WEPTE  F  LK L +E  +L  WE      F CL  LVLK C  
Sbjct  137  LEVLKLKNYAFQGPKWEPTEEGFHSLKHLLIENTDLIHWEAIIVRHFPCLQHLVLKPCKL  196

Query  170  LEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            LE IP G E++ TL  +E   C  P++ SA+++ E  E  GI+ II
Sbjct  197  LEEIPFGVEELGTLQRLEAHYCSEPIENSAKEIQEQIE--GIDVII  240



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLE--SLPlnlnikklklKRTCLPWSEINVIGML  354
            L+NL +L  LE L  +F K +    + L    L   L ++KL L  + LPW +I  I ML
Sbjct  840  LKNLANLQYLEALKCSFYKQNAEAPRILRPSVLHFPLTLRKLTLSWSYLPWKDIACIAML  899

Query  353  PNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            PNLEVLKLK  +  GPDWEPTE  FR+LK   +++ NLE+WE    D F CL  LVL+ C
Sbjct  900  PNLEVLKLKNYAFQGPDWEPTEEAFRRLKHFLIDSTNLENWEA-SSDNFPCLEHLVLRGC  958

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQ  78
              L+GIP G E++NTL   EL  C    + SA+
Sbjct  959  KFLKGIPDGIEEINTLQRFELHYCSESAEISAK  991



>emb|CDP00687.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 93/166 (56%), Gaps = 3/166 (2%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPN  348
            L NL  L +LETL  +F   +    +NL    L + +K L L  + LPW ++  I MLPN
Sbjct  214  LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHLSLSWSYLPWEDMTFIAMLPN  273

Query  347  LEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTK  171
            LEVLKLK  +  GP WEPTE  F  LK L +E  +L  WE      F CL  LVLK C  
Sbjct  274  LEVLKLKNYAFQGPKWEPTEEGFHSLKHLLIENTDLIHWEAIIVRHFPCLQHLVLKSCKL  333

Query  170  LEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            LE IP G E++ TL  +E   C  P++ SA+++ E  E  GI+ II
Sbjct  334  LEEIPFGVEELGTLQRLEAHYCSEPIENSAKEIQEQIE--GIDVII  377



>ref|XP_009602412.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602413.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602414.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=895

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 105/187 (56%), Gaps = 7/187 (4%)
 Frame = -3

Query  575  IICGSKPSPEAIEPANL-ENLGSLDKLETLMIAFRK--GSPTGLQNLESLPlnlnikklk  405
            +ICG     E  + + L  NL  L +LETL +   +   SP  + ++ + P  L   KL 
Sbjct  708  VICGYANDYEIFQRSGLFNNLAHLHQLETLSVELVRKWDSPATIPSIAAFPATLKKLKLV  767

Query  404  lKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
               T + W ++N++G LPNLEVLKL +    G +W P EG F +LK L +   +L+ W+ 
Sbjct  768  S--TGVNWEDLNIVGELPNLEVLKLMRNACIGKEWYPIEGGFTRLKLLLIVHCDLKYWKA  825

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
               D F  L RL+++ C +LE IP  F D+ +L  IEL +C   ++ SA ++ + +ED G
Sbjct  826  -TDDNFPVLERLLIRDCHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQEDLG  884

Query  47   IEPIIIR  27
            I+P+ +R
Sbjct  885  IKPVDVR  891



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 105/187 (56%), Gaps = 7/187 (4%)
 Frame = -3

Query  575  IICGSKPSPEAIEPANL-ENLGSLDKLETLMIAFRK--GSPTGLQNLESLPlnlnikklk  405
            +ICG     E  + + L  NL  L +LETL +   +   SP  + ++ + P  L   KL 
Sbjct  751  VICGYANDYEIFQRSGLFNNLAHLHQLETLSVELVRKWDSPATIPSIAAFPATLKKLKLV  810

Query  404  lKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
               T + W ++N++G LPNLEVLKL +    G +W P EG F +LK L +   +L+ W+ 
Sbjct  811  S--TGVNWEDLNIVGELPNLEVLKLMRNACIGKEWYPIEGGFTRLKLLLIVHCDLKYWKA  868

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
               D F  L RL+++ C +LE IP  F D+ +L  IEL +C   ++ SA ++ + +ED G
Sbjct  869  -TDDNFPVLERLLIRDCHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQEDLG  927

Query  47   IEPIIIR  27
            I+P+ +R
Sbjct  928  IKPVDVR  934



>emb|CDP00690.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 93/166 (56%), Gaps = 3/166 (2%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPN  348
            L NL  L +LETL  +F   +    +NL    L + +K L L  + LPW ++  I MLPN
Sbjct  382  LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHLSLSWSYLPWEDMTFIAMLPN  441

Query  347  LEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTK  171
            LEVLKLK  +  GP WEPTE  F  LK L +E  +L  WE      F CL  LVLK C  
Sbjct  442  LEVLKLKNYAFQGPKWEPTEEGFHSLKHLLIENTDLIHWEAIIVRHFPCLQHLVLKSCKL  501

Query  170  LEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            LE IP G E++ TL  +E   C  P++ SA+++ E  E  GI+ II
Sbjct  502  LEEIPFGVEELGTLQRLEAHYCSEPIENSAKEIQEQIE--GIDVII  545



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 93/176 (53%), Gaps = 6/176 (3%)
 Frame = -3

Query  539   EPANLENLGSLDKLETLMIAF-RKGSPTGLQNLESLPlnlnikklklKR---TCLPWSEI  372
             E  +L +L  L +LETL +   R     G       P+     KLK  +   TCL W E+
Sbjct  1692  EVMDLRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIKLKKLKLVGTCLSWEEL  1751

Query  371   NVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTR  195
             N+IG  PNLEVLKLK     G +W P EG F +LKFL +E  NL+ W+    D F  L  
Sbjct  1752  NIIGQWPNLEVLKLKPNACHGLEWRPIEGRFPQLKFLLIEGTNLKCWKA-TNDHFPALEH  1810

Query  194   LVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
             LV++ C  LE IP  F D+ +L  IEL NC   +  SA ++ E +E  G + + +R
Sbjct  1811  LVIRHCFHLEEIPIEFADIYSLQLIELQNCSAKLVASAGRIQEEQESLGSKAVDVR  1866


 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 91/176 (52%), Gaps = 6/176 (3%)
 Frame = -3

Query  539   EPANLENLGSLDKLETLMIAF-RKGSPTGLQNLESLPlnlnikklklKR---TCLPWSEI  372
             E  +L +L  L +LETL +   R     G       P+     KLK  +   TCL W E+
Sbjct  2499  EVMDLRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIKLKKLKLVGTCLSWEEL  2558

Query  371   NVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTR  195
             N+IG  PNLEVLKLK     G +W P EG F +LKFL +E  NL+ W+    D F  L  
Sbjct  2559  NIIGQWPNLEVLKLKPNACHGLEWRPIEGRFPQLKFLLIEGTNLKCWKA-TNDHFPALEH  2617

Query  194   LVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
             LV++ C  LE IP  F D+ +L  IEL NC   +  S   + E +E  G + + +R
Sbjct  2618  LVIRHCFHLEEIPIEFADIYSLQLIELQNCTAKLVASTVLIQEEQESLGSKAVDVR  2673


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 87/185 (47%), Gaps = 26/185 (14%)
 Frame = -3

Query  566  GSKPSPEAIEPANL-ENLGSLDKLETLMIA----FRKGSPTGLQNLESLPlnlnikklkl  402
            G     E  + + L  NL  L  LETL +          P  + + ++ P  L   KL  
Sbjct  781  GDNNDYEGFQESRLFNNLVHLQHLETLSVTIYADLEDSVPVTIPSAKAFPATLKKLKLYG  840

Query  401  KRTCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
              T L W ++N++G LPNLEVLKL   + G                  E  +L+ W +  
Sbjct  841  --TGLRWDDLNIVGELPNLEVLKLIFDAVG------------------EECHLKYWNI-T  879

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
             D F  L RL++  CT+LE IP  F + ++L  IEL +C   ++ SA ++ + +ED G  
Sbjct  880  NDNFPVLERLMIIDCTELEEIPIEFSETSSLKLIELKDCKPHLEASATRIQQEQEDIGNN  939

Query  41   PIIIR  27
            P+ +R
Sbjct  940  PVDVR  944



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 13/193 (7%)
 Frame = -3

Query  575  IICGSKPSPEAIEPANL-ENLGSLDKLETLMIAFRKG--------SPTGLQNLESLPlnl  423
            +I G     E  + + L +NL  L +LETL   FR+         SP  + + ++ P+ L
Sbjct  706  VIHGHANDYEIFQESRLFDNLVHLHQLETLSFEFRRWGSSENWRISPATIPSAKAFPVTL  765

Query  422  nikklklKRTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAEN  246
               KLK   T + W ++N++G LPNLEVLKL  +   G +W P EG F +LK L +E  +
Sbjct  766  RKLKLKS--TYVRWEDLNIVGELPNLEVLKLMWKACIGEEWYPIEGGFTRLKLLLIEHCD  823

Query  245  LESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            L+ W+    D F  L RL+ + C  LE IP  F  +++L  IEL NC   ++ SA ++ E
Sbjct  824  LKYWKA-TDDNFPVLERLLFRHCRSLEEIPIVFAYIDSLQLIELTNCTTELEASAVRIQE  882

Query  65   HREDYGIEPIIIR  27
             +E+ GI+P+ +R
Sbjct  883  EQEELGIKPVDVR  895



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 105/191 (55%), Gaps = 5/191 (3%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTG-LQNLESLPlnlnikkl  408
            +LGI     PS E      LE L +L +LETL + F+  S    + N   L     +K+L
Sbjct  536  ELGISYEVSPS-ENWSKYQLEALVNLHQLETLKLLFKYSSHASEIVNPPKLAFPEKLKRL  594

Query  407  klKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWE  231
             L    +PWS + ++G LPNLEVLKL K    G +WEP E  F +LK L LE  +L  W 
Sbjct  595  ILAGCGIPWSSMTIVGALPNLEVLKLRKNACQGVEWEPVEEQFCQLKHLLLEEVDLVQW-  653

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDY  51
            V     F CL RLV++ C KL+ IP+G  ++ TL  IEL++C      SA+K+ E +E  
Sbjct  654  VANETHFPCLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGL  713

Query  50   GIEPIIIRHVD  18
            G E + + H+D
Sbjct  714  GNEELKV-HID  723



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 100/197 (51%), Gaps = 21/197 (11%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKG--------SPTGL--QNLESL  435
            KL I+       E+  P    +L SL KLE+L    +           P G   QNL+ L
Sbjct  664  KLMILGHMVQYGESEMPDCFNDLASLGKLESLGFHIQTNINHLNLCLPPPGNFPQNLKKL  723

Query  434  PlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYL  258
                         T +PW  ++++GMLPNLEVLKL+  +  G +WEP+E  F +LKFL L
Sbjct  724  TFIF---------TYMPWKNMDIVGMLPNLEVLKLRSSACIGEEWEPSENGFHQLKFLLL  774

Query  257  EAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQ  78
               +   W+    D F  L  LVL+ C  L+ IP  F D  TL SIE+ NC   V  SA+
Sbjct  775  HCSDPNYWKA-TSDHFPLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIENCERSVVTSAE  833

Query  77   KLNEHREDYGIEPIIIR  27
            ++ E + + G++ +I+R
Sbjct  834  QIQEEQRNLGVDDLIVR  850



>ref|XP_009779606.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=906

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 63/177 (36%), Positives = 100/177 (56%), Gaps = 13/177 (7%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKG---------SPTGLQNLESLPlnlnikklklKRTCLPWSE  375
              NL  L +LETL +A  +          SP  + + ++ P+ L   KL+   T + W +
Sbjct  723  FNNLVHLHQLETLSLALVRKWDSSENWRISPATIPSAKAFPVTLRKLKLE--ETSVRWED  780

Query  374  INVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLT  198
            +N++G LP+LEVLKL      G +W P EG F +LK L +E  +L+ W+    D F  L 
Sbjct  781  LNIVGELPSLEVLKLMWNACIGEEWYPIEGGFTRLKLLLIEHCDLKYWKATD-DNFPVLE  839

Query  197  RLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            RL++++C  LE IP  F D+ +L  IEL +C   ++ SA ++ + +E+ GI+P+ IR
Sbjct  840  RLLIRECHMLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQENLGIKPVDIR  896



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 72/131 (55%), Gaps = 2/131 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W E+N++G  PNLEVLKLK     G  W P EG F +LKFL +E  NL  W+    
Sbjct  777  TRLSWEELNIVGQWPNLEVLKLKPNACRGLKWHPIEGGFPRLKFLLIEGTNLTRWKA-TN  835

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
            D F  L  LV+K C  L  IP  F D+ +L  IEL NC   +  S  ++ E +E  G +P
Sbjct  836  DHFPALEHLVIKHCFHLVKIPIEFADIYSLQLIELQNCKAKLMASTVRIQEEQEYLGSKP  895

Query  38   IIIRHVDQIQE  6
            + +R  + + E
Sbjct  896  VDVRSYNDLAE  906



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 104/191 (54%), Gaps = 5/191 (3%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTG-LQNLESLPlnlnikkl  408
            +LGI     PS E      LE L +L +LETL + F+  S    + N   L     +K+L
Sbjct  765  ELGISYEVSPS-ENWSKYQLEALVNLHQLETLKLLFKYSSHASEIVNPPKLAFPEKLKRL  823

Query  407  klKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWE  231
             L    +PWS + ++G LPNLEVLKL K    G +WEP E  F +LK L LE  +L  W 
Sbjct  824  ILAGCGIPWSSMTIVGALPNLEVLKLRKNACQGIEWEPVEEQFCQLKHLLLEEVDLVQW-  882

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDY  51
            V     F  L RLV++ C KL+ IP+G  ++ TL  IEL++C      SA+K+ E +E  
Sbjct  883  VANETHFPRLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGL  942

Query  50   GIEPIIIRHVD  18
            G E + + H+D
Sbjct  943  GNEELKV-HID  952



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 100/190 (53%), Gaps = 10/190 (5%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFR------KGSPTGLQNLESLPlnl  423
            KLGI+          + A  +NL  L +LETL   FR      + SP  + + ++ P  L
Sbjct  684  KLGIVGDGGDYRTFQKSAFFDNLVHLHQLETLKFQFRYVWMSEQISPATIPSAKAFPATL  743

Query  422  nikklklKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAEN  246
               KL    T L W ++N+IG LPNLEVLKL      G +W P EG F +LK L ++  N
Sbjct  744  KNLKLVG--TGLRWEDLNIIGELPNLEVLKLILDACCGQEWHPIEGGFTRLKLLLIQMCN  801

Query  245  LESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            ++ W     D F  L RLV+  C+ LE IP  F D+ +L  IEL +C   +  SA ++ +
Sbjct  802  IKCWNA-TCDSFPVLERLVIISCSDLEEIPFEFADIQSLQLIELDSCTPELMASAVRIQQ  860

Query  65   HREDYGIEPI  36
             +E+ G +P+
Sbjct  861  EQEEIGNKPV  870



>emb|CDP04880.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 101/181 (56%), Gaps = 8/181 (4%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENL-GSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikkl  408
            KLG I  S    E  E +NL  L   L +L +L ++F   +P   +   + P NL    +
Sbjct  822  KLGCII-SNSWQECCEASNLFKLLECLRELRSLKMSFHVRAPYPFKF--TFPSNLKKLTI  878

Query  407  klKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWE  231
               R  LPW EI+VIG L NLEVLKL  +  +G  W+  EG F+KLKFL L++ ++  W 
Sbjct  879  SNAR--LPWDEISVIGQLSNLEVLKLLSKAFEGQQWDMREGEFQKLKFLKLDSLDIVQWS  936

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDY  51
               G+   CL +LV+  C +LE IP+ F +++TL  IEL  C    K+S +++ + + DY
Sbjct  937  A-SGEHLPCLEQLVVLSCQQLEEIPSCFGEISTLQLIELKCCSASAKDSVKQILDDQRDY  995

Query  50   G  48
            G
Sbjct  996  G  996



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 98/178 (55%), Gaps = 9/178 (5%)
 Frame = -3

Query  566  GSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCL  387
            G K +    E     NL  L +LETL +  RK       N  ++ +   +KKLKL +T L
Sbjct  724  GIKGNQNISESGIFNNLVILQQLETLTV--RK-----FYNWSAVTIPTTLKKLKLYKTFL  776

Query  386  PWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQF  210
             WS +++I  LPNLEVLKL      G +W P    F +LK L ++A  LESW+    D F
Sbjct  777  RWSYLDIIAELPNLEVLKLVLNACHGEEWNPNVRVFTQLKVLLIQANYLESWKA-TNDNF  835

Query  209  RCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
              L RLVL  C+ L+ IP  F D+NT   IEL +CP  + ESA ++ + +ED G +PI
Sbjct  836  PVLERLVLGSCSYLKEIPIEFADINTSQLIELDSCPPILAESAARIQQEQEDLGNDPI  893



>emb|CDP00693.1| unnamed protein product [Coffea canephora]
Length=172

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = -3

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
            I MLPNLEVLKLK  +  GP WEPTE  F  LK L +E  +L  WE      F CL  LV
Sbjct  4    IAMLPNLEVLKLKNYAFQGPKWEPTEEGFHSLKHLLIENTDLIHWEAIIVRHFPCLQHLV  63

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            LK C  LE IP G E++ TL  +E   C  P++ SA+++ E  E  GI+ II
Sbjct  64   LKSCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSAKEIQEQIE--GIDVII  113



>emb|CDP21316.1| unnamed protein product [Coffea canephora]
Length=178

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 82/152 (54%), Gaps = 6/152 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNL--ESLPlnlnikklklKRTCLPWSEINVIGML  354
            L+ L  L +LE L + F + S    + L  ++LP NL    +       PW  +  I  L
Sbjct  8    LKELFYLQELELLKLCFYRESTKIRRILFWDALPSNLRKLTISWSNQ--PWQNMTSIASL  65

Query  353  PNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            P LEVLKLK  +  GP WEPTEG FR LK L +E  +L SWE    + F CL  LVLK C
Sbjct  66   PKLEVLKLKNYAFQGPKWEPTEGGFRVLKHLLVEKTDLVSWEA-TSNHFPCLEHLVLKSC  124

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
              L+ +P G  +++TL  IEL NC    + SA
Sbjct  125  KYLKEVPYGITEISTLKRIELHNCSESAEISA  156



>gb|AAV88066.1| NBS-LRR protein [Ipomoea batatas]
Length=846

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIE-------PANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPln  426
            + G+ C   P+ E +E       P  L+NL  L+ L+ L I+   G    L      P  
Sbjct  607  RTGVYC-RFPNIEKLEVFVCCSNPIILDNLEYLEHLKRLSISVSFGCVVTLPKPSMFPSQ  665

Query  425  lnikklklKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAEN  246
            LN  +L    T L   ++ VIGMLP LEVLKL+    G  W+  EG F +LKFL L+   
Sbjct  666  LNKLRLNG--TNLSEGDLKVIGMLPQLEVLKLENAFHGEVWDVEEGLFVRLKFLLLDGIK  723

Query  245  LESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            LE W V G   F  L  LVL+ C +L+ IP    D  TL SIEL +C   +  SA+++ E
Sbjct  724  LEQWRV-GEYSFEYLKHLVLRFCYRLKNIPKVMVDTFTLESIELQSCCHSLITSAKRIQE  782

Query  65   HREDYGI  45
            HR D+G+
Sbjct  783  HRWDFGL  789



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 100/172 (58%), Gaps = 11/172 (6%)
 Frame = -3

Query  527  LENLGSLDKLETLMIA--FR----KGSPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
             +N   L +LETL +   FR    + SP  + +++S P  L   KL    T L W ++N+
Sbjct  733  FDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYG--TDLRWEDLNI  790

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
            IG LPNLE+LKLK+ +  G +W PTE  F +LK L +E  +L+ W     D F  L RLV
Sbjct  791  IGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWN-SPNDNFPVLERLV  849

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL-NEHREDYGIEPI  36
            ++ C++LE IP  F  +++L  IEL +C   ++ SA ++ +E  E+ G +P+
Sbjct  850  IRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPV  901



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 100/172 (58%), Gaps = 11/172 (6%)
 Frame = -3

Query  527  LENLGSLDKLETLMIA--FR----KGSPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
             +N   L +LETL +   FR    + SP  + +++S P  L   KL    T L W ++N+
Sbjct  733  FDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYG--TDLRWEDLNI  790

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
            IG LPNLE+LKLK+ +  G +W PTE  F +LK L +E  +L+ W     D F  L RLV
Sbjct  791  IGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWN-SPNDNFPVLERLV  849

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL-NEHREDYGIEPI  36
            ++ C++LE IP  F  +++L  IEL +C   ++ SA ++ +E  E+ G +P+
Sbjct  850  IRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPV  901



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 100/172 (58%), Gaps = 11/172 (6%)
 Frame = -3

Query  527  LENLGSLDKLETLMIA--FR----KGSPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
             +N   L +LETL +   FR    + SP  + +++S P  L   KL    T L W ++N+
Sbjct  733  FDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYG--TDLRWEDLNI  790

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
            IG LPNLE+LKLK+ +  G +W PTE  F +LK L +E  +L+ W     D F  L RLV
Sbjct  791  IGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWN-SPNDNFPVLERLV  849

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL-NEHREDYGIEPI  36
            ++ C++LE IP  F  +++L  IEL +C   ++ SA ++ +E  E+ G +P+
Sbjct  850  IRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPV  901



>emb|CDP05521.1| unnamed protein product [Coffea canephora]
Length=1020

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 92/178 (52%), Gaps = 9/178 (5%)
 Frame = -3

Query  539   EPANLENLGSLDKLETLMIAFRKGS--PTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
             +P N  +L  L+ LE L   ++     P  + + +  P +L    L      + W E+++
Sbjct  839   DPFNFFDLSGLNVLEKLKFEYQTYGMVPVTISSSDKFPSSLKKLTLVGSH--VNWEEMSI  896

Query  365   IGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
             IGMLPNLEVLK+K    +GP WE  EG FR+L+FL     +L+ W +   D F  L +LV
Sbjct  897   IGMLPNLEVLKVKDNFFNGPKWETCEGGFRRLRFLKFSHMDLQEW-IATADDFPSLEKLV  955

Query  188   LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG---IEPIIIRH  24
             L  C  L  IP+ F D  TL  IE+      V +SA ++ E + ++G    +  I RH
Sbjct  956   LNGCLALTEIPSAFGDSCTLQVIEVYRSSDTVADSACQIQESQRNWGNDEFKVFIYRH  1013



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 74/132 (56%), Gaps = 2/132 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            RTCLPW+ +N+   LPNLEVL+LK  +  G +WE TE  F KLK L LE   L  W    
Sbjct  743  RTCLPWNCMNIFSKLPNLEVLELKNYAFSGDEWEITEMGFPKLKCLLLEDLYLRYWTA-T  801

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
             D F+CL R+ +++C  L+ IP GF D  TL  IEL  C  P+   A+++ E  E+ G  
Sbjct  802  DDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCYHPLVTFAKQIQETHEELGNN  861

Query  41   PIIIRHVDQIQE  6
             + +   D   E
Sbjct  862  MLKVYAFDSTSE  873



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 100/189 (53%), Gaps = 14/189 (7%)
 Frame = -3

Query  536  PANLENLGSLDKLETLMIAFRKGSPTGLQNLE-SLPlnlni----kklklKRTCLPWSEI  372
            P  L+NL  L +LETL IA   G    L + +  LP  ++     KKL L +T LPW ++
Sbjct  694  PECLDNLIHLHELETLKIA---GFNMDLLDFDFRLPRLVSFPPNLKKLTLSKTYLPWEDM  750

Query  371  NVIGMLPNLEVLKLKQVS-----DGPDWEPTEGNFRKLKFLYLEAENLESWEV-DGGDQF  210
             +I  LP LEVL+LK  +         WE TE  F +LKF+ LE  +L+ W   D  D F
Sbjct  751  TIISKLPKLEVLQLKNSAFVEAWSAERWEVTEMGFPELKFVLLEKLDLKYWRAADIDDNF  810

Query  209  RCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIII  30
             CL R+V++ C+ L+ IP  F D  TL  IEL  C   +   A+K+ E+ ED G   + +
Sbjct  811  PCLERVVIRNCSYLKQIPKVFADSGTLQRIELWGCSPSLVTFAKKIQENHEDLGNNMLKV  870

Query  29   RHVDQIQEV  3
               D I EV
Sbjct  871  YAFDTIGEV  879



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 95/194 (49%), Gaps = 16/194 (8%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAF-------RKGSPTGLQNLESLPln  426
            KLGI+     S E        N   L KLETL   F       RK  P  L    + PL+
Sbjct  565  KLGILYVHDSSTEW-STYEFNNFVHLHKLETLKCLFSAKDDLVRKPLPLNL----AFPLD  619

Query  425  lnikklklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAE  249
            L    L   R  L W ++ VIG LPNL+VLKL+  + +G  WEP EG F KLK+L ++  
Sbjct  620  LKKLTLSGCR--LSWEKMTVIGSLPNLQVLKLRDYAFEGSVWEPNEGEFTKLKYLLIDRN  677

Query  248  NLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN  69
             LE W  D    F  L  L L  C +LE IPT   D+ TL  +EL  C   V  SA  + 
Sbjct  678  KLERWCADYT-HFPQLQHLCLCHCFELEAIPTEVGDIGTLEMLELFRCRSSVVASAMLIQ  736

Query  68   EHREDYGIEPIIIR  27
            E + + G E +I+R
Sbjct  737  EEQRNLGNEGLIVR  750



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 91/163 (56%), Gaps = 6/163 (4%)
 Frame = -3

Query  521  NLGSLDKLETLMIAFRKGSPTG----LQNLESLPlnlnikklklKRTCLPWSEINVIGML  354
            NL  L +LE LM+    G  +     L N  S     N+KKL L RTCLPW+ +N+   L
Sbjct  698  NLKYLKELEALMVTVPPGFISNRLPCLINPSSGSFPPNLKKLTLSRTCLPWNCMNIFSKL  757

Query  353  PNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            PNLEVL+LK ++  G +WE TE  F KLK L LE   L  W     D F+CL R+ +++C
Sbjct  758  PNLEVLELKNLACSGNEWEITEMGFPKLKCLLLEDLYLRYWTA-TDDYFQCLERVCIREC  816

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              L+ IP GF D  TL  IEL  C  P+   A+++ E  E+ G
Sbjct  817  KLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQEKHEELG  859



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 107/192 (56%), Gaps = 12/192 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANL-ENLGSLDKLETLMIA--FR----KGSPTGLQNLESLPln  426
            KL I  G     E+     L +N   L +LETL +   FR    + SP  + +++S P  
Sbjct  672  KLRINRGEDDEYESFHVCRLFDNFVHLHQLETLSLELDFRGVLYEISPATIPSVKSFPPM  731

Query  425  lnikklklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAE  249
            L   KL    T L W ++N+IG L NLE+LKLK+ +  G +W P+E  F +LK L +E  
Sbjct  732  LKKLKLYG--TGLRWEDLNIIGELRNLEILKLKRYACRGEEWHPSENGFTRLKLLLIEYN  789

Query  248  NLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL-  72
            +L+ W     D F  L RLV++ C++LE IP  F  +++L  IEL +C   ++ SA ++ 
Sbjct  790  DLKYWS-SPNDSFPVLERLVIRHCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQ  848

Query  71   NEHREDYGIEPI  36
            +E +E+ G +P+
Sbjct  849  HEQKENLGKKPV  860



>emb|CDP00691.1| unnamed protein product [Coffea canephora]
Length=693

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 89/166 (54%), Gaps = 6/166 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPN  348
            L NL  L +LETL  +F   +    + L    L + +K L L  + LPW  +  I MLPN
Sbjct  524  LNNLVYLQELETLECSFHTQNREVRRILGLALLPVTLKHLSLSWSYLPWKYMTSIAMLPN  583

Query  347  LEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTK  171
            LEVL+LK  +  GP W PTE  FR LK L +E   L  WE      FRCL  LVLK C  
Sbjct  584  LEVLELKNYAFQGPKWGPTEEGFRSLKHLLIENMALIHWEATIFRHFRCLQHLVLKSCKL  643

Query  170  LEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            LE  P G E+   L  +E+  C  P++ SA+++ E  E  GI+ II
Sbjct  644  LEKFPFGVEN---LQRLEVHYCSGPIENSAKEIQEEIE--GIDVII  684



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 97/186 (52%), Gaps = 3/186 (2%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI        ++    NL +L  L+KL   ++   K     + + +S P  L   +L 
Sbjct  736  KLGIYGDKDDCEDSRLFDNLVHLHQLEKLRFGLLTPWKFGDATIPSAKSFPAMLKKLELN  795

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
               TCL W ++N+I  LPNLEVLK+  V    +W P  G F +LK L +++ +L  W+  
Sbjct  796  G--TCLRWEDMNIISELPNLEVLKVLSVIHDNEWYPVAGGFTQLKLLLIDSTSLNYWKA-  852

Query  224  GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
              D F  L  LVL+ C  L  +P  F  +N+L  IEL NC   ++ SA ++ + +ED G 
Sbjct  853  TDDNFPALECLVLRSCYFLAEMPIEFAYINSLQLIELYNCMPKLEASAAQIQQEQEDIGN  912

Query  44   EPIIIR  27
            +P+ IR
Sbjct  913  KPLDIR  918



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 106/197 (54%), Gaps = 8/197 (4%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANL-ENLGSLDKLETLMIAFRKGS--PTGLQNLESLPlnlnik  414
            KLGI  G+K   ++   + L  NL  L +LE L +     S  P  + + ++ P  L   
Sbjct  705  KLGI-SGNKDDYKSFRDSGLPNNLVYLQQLEILSLISVDYSLLPVIISSAKAFPATLKKL  763

Query  413  klklKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLES  237
            KL+  RT L WS +++I  LPNLEVLKL      G +W P    F +LK L ++   L+ 
Sbjct  764  KLE--RTYLSWSYLDIIAELPNLEVLKLMDDACCGEEWHPIVMGFNRLKLLLIKYSFLKF  821

Query  236  WEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE  57
            W+    D F  L RL+++ C  L+ IP  F D++TL  IEL  CP  + ESA ++ + +E
Sbjct  822  WKA-TNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELRECPPKLGESAARIQKEQE  880

Query  56   DYGIEPIIIRHVDQIQE  6
            D G  P+ +R  + ++E
Sbjct  881  DLGNNPVDVRISNPLKE  897



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 70/118 (59%), Gaps = 4/118 (3%)
 Frame = -3

Query  392  CLPWSEIN-VIGMLPNLEVLKLK-QVSDGPDWE-PTEGNFRKLKFLYLEAENLESWEVDG  222
            C PW +I+ ++ MLPNLE LKLK   ++   W    E  F  LKFL     NL+ WE   
Sbjct  709  CFPWDDISTLLVMLPNLEELKLKDHAANDHVWRLSAETKFESLKFLLFHGLNLKYWEA-S  767

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F  L RLVLKKCTKL  IP  F ++ TL SIEL  C V  +ESA+K+ + +ED G
Sbjct  768  SDNFPNLRRLVLKKCTKLNEIPIDFGEICTLESIELYQCGVGAEESARKIEQEQEDMG  825


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 62/133 (47%), Gaps = 17/133 (13%)
 Frame = -3

Query  398  RTCLPWSEINV-IGMLPNLEVLKLKQVSDGPD---------WEPTEGNFRKLKF----LY  261
            + C   +EI +  G +  LE ++L Q   G +          E    NF K+       Y
Sbjct  780  KKCTKLNEIPIDFGEICTLESIELYQCGVGAEESARKIEQEQEDMGNNFLKIFIHGIEAY  839

Query  260  LEAEN--LESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKE  87
             E  +  L  WE    D F  L RL LKKC  L  IPT F ++ T  SIEL  C +  +E
Sbjct  840  FEGRSGILSIWEA-SSDSFPNLKRLALKKCNYLNEIPTDFGEICTFESIELYQCSIGAEE  898

Query  86   SAQKLNEHREDYG  48
            SA+K+ + +ED G
Sbjct  899  SARKIEQEQEDMG  911



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 87/166 (52%), Gaps = 14/166 (8%)
 Frame = -3

Query  527  LENLGSLDKLETLMIA--------FRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEI  372
             +NL  LD LETL +         F+   P   Q+ +  P    +       T L WSE+
Sbjct  708  FDNLAKLDHLETLKLLNDTFPLDPFKCHIPGLPQSYKFPPNLKKLTLSD---TLLDWSEM  764

Query  371  NVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTR  195
            + +GMLPNLEVLKLK  +  G  WEP +G FR L+ L L   +L  W       F  L R
Sbjct  765  STLGMLPNLEVLKLKDYAFKGSRWEPLDGGFRLLRVLQLGRSDLVHWHA-SSHHFPRLER  823

Query  194  LVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE  57
            +VLK CT LE IP GF +V+ L ++EL   P P   ++ +L +H++
Sbjct  824  VVLKHCTHLEEIPCGFGEVSALQNMELY-WPTPAAAASARLIQHQK  868



>emb|CDP15990.1| unnamed protein product [Coffea canephora]
Length=716

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 2/122 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESW-EVDGGD  216
            LPWS+I++I  LPNLEVLKL   S  G  W  TEG FRKL+FL LE  ++  W + D  D
Sbjct  593  LPWSKISLIEELPNLEVLKLLYDSFKGERWILTEGGFRKLRFLALENLDVVEWTDTDPDD  652

Query  215  QFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
             F CL +L++   +KLE +P+  E ++ L  IEL +C   VK+  QK+ E ++D G E +
Sbjct  653  HFPCLQKLLMSGLSKLELMPSCLEQISALEVIELRSCKASVKDLVQKIEEEQKDCGNEDL  712

Query  35   II  30
             I
Sbjct  713  RI  714



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 97/179 (54%), Gaps = 12/179 (7%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFR-------KGSPTGLQNLESLPlnlnikklklKRTCLPWSEIN  369
             +NL +L +LETL +             P  + + ++ P  L   KL    TCL W +++
Sbjct  669  FDNLANLHQLETLSLKISVPLQTKINKVPLTIPSAKAFPATLKKLKLD--NTCLRWEDMD  726

Query  368  VIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAE-NLESWEVDGGDQFRCLTR  195
            +IG LP+LEVLKL      G +W P  G F +LK L ++   +L+ W+    D F  L R
Sbjct  727  IIGELPDLEVLKLMLNACCGQEWHPIAGGFTRLKLLLIKHNYHLKYWKA-TNDNFPVLER  785

Query  194  LVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIRHVD  18
            LV+  CT+LE +P  F D+++L  IEL  C   ++ SA ++ + +ED G +P+ +R  D
Sbjct  786  LVITYCTELEEMPIEFADMDSLQLIELSYCTAQLEASAARIQQEQEDLGNKPVDVRISD  844



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 90/167 (54%), Gaps = 4/167 (2%)
 Frame = -3

Query  527   LENLGSLDKLETLMIAFRKG--SPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGML  354
             LE+L +L +LETL I  +      +   N   L     +K+L L    LPW  + ++G L
Sbjct  910   LESLVNLHQLETLKIVIKNDPYRTSKFVNPPQLAFPQKLKRLTLSGCGLPWETMTIVGSL  969

Query  353   PNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
             PNLEVLKLK+    G +WEP E  F +LK+L LE  +L  W  +    F CL  L+++ C
Sbjct  970   PNLEVLKLKKDACRGQEWEPVEEQFCRLKYLLLEELDLVQWRTNEA-HFPCLQSLIIRSC  1028

Query  176   TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
              +L  IP+   D+ TL  IEL++C      SA+++ E +E    E +
Sbjct  1029  FRLREIPSAIGDITTLQMIELVDCHPSAVTSAKQIQEEQESMANEDL  1075



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TCLPW+ +N+   LPNLEVL+LK     G +WE TE  F KLKFL LE   L  W     
Sbjct  747  TCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMGFPKLKFLLLEHLFLSYWTA-TD  805

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F+CL R+ ++ C  L+ IP GF D  TL  IEL  C + +   A+++ E  E+ G
Sbjct  806  DYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVIFAEQIQEMHEELG  862



>gb|EYU31596.1| hypothetical protein MIMGU_mgv1a025161mg [Erythranthe guttata]
Length=754

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 98/171 (57%), Gaps = 3/171 (2%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL-ESLPlnlnikklklKRTCLPWSE  375
            P+      ++N+G L KLE+L  +        + +L +++ L  ++ KL L RTCL W +
Sbjct  573  PQGYLSYRVDNIGHLHKLESLRFSLYSLKKPSVNDLVQNIILPNSLMKLTLHRTCLKWED  632

Query  374  INV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCL  201
            +   IG+LPNL+VLKLK+ S  G +WE  EG FR LKFL +   +   W   G + F  L
Sbjct  633  MKTKIGLLPNLQVLKLKEYSFVGTEWETVEGQFRNLKFLLIYMCSDLEWWTTGSNHFPRL  692

Query  200  TRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              L L+   KL+ IP+   +++TL SI+L+ C      SA+++ + ++D+G
Sbjct  693  EHLHLQLLDKLKEIPSCIGEISTLQSIQLIWCSKSAVISAKEILKEQQDFG  743



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TCLPW+ +N+   LPNLEVL+LK     G +WE TE  F KLKFL LE   L  W     
Sbjct  758  TCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMGFPKLKFLLLEHLFLSYWTA-TD  816

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F+CL R+ ++ C  L+ IP GF D  TL  IEL  C + +   A+++ E  E+ G
Sbjct  817  DYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVIFAEQIQEMHEELG  873



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            RTCLPW+ + +   LPNLEVL+LK     G +WE TE  F KLK L LE   L  W    
Sbjct  743  RTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEITEMGFPKLKCLLLEDLYLRYWTA-T  801

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F+CL R+ +++CT L+ IP GF D  TL  IEL  C  P+   A+++ E  E+ G
Sbjct  802  DDYFQCLERVCIRECTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQEKHEELG  859



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            RTCLPW+ + +   LPNLEVL+LK     G +WE TE  F KLK L LE   L  W    
Sbjct  742  RTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEITEMGFPKLKCLLLEDLYLRYWTA-T  800

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F+CL R+ +++CT L+ IP GF D  TL  IEL  C  P+   A+++ E  E+ G
Sbjct  801  DDYFQCLERVCIRECTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQEKHEELG  858



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TCLPW+ +N+   LPNLEVL+LK     G +WE TE  F KLKFL LE   L  W     
Sbjct  747  TCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMGFPKLKFLLLEHLFLSYWTA-TD  805

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F+CL R+ ++ C  L+ IP GF D  TL  IEL  C + +   A+++ E  E+ G
Sbjct  806  DYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVIFAEQIQETHEELG  862



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W ++  +G LPNLEVL+LK  +  G +W   EG F+KLK L +  +NL  WE    
Sbjct  63   TRLLWEDMTTLGQLPNLEVLRLKCFAFQGRNWNLNEGGFKKLKLLQINRKNLVLWEASSE  122

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
               R L  L+LK C KLE IPT   D+ T+  IEL NC      SA+++ E ++  G E 
Sbjct  123  SLPR-LEFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLGNEV  181

Query  38   IIIRHVD  18
            +++R  +
Sbjct  182  LVVRAYN  188



>emb|CDP11974.1| unnamed protein product [Coffea canephora]
Length=1481

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS+I+ IG LP+LEVLKL  +  DG  WE TEG F+ LK+L L+   +  W+    D 
Sbjct  1355  LPWSQISTIGKLPHLEVLKLLSRAFDGQIWEMTEGEFQSLKYLKLDNLWIAQWKA-SNDH  1413

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
               CL  LVL++C KLE +P+   D+ TL  IE+  C      S +++ + + D G E ++
Sbjct  1414  LPCLRHLVLQRCKKLEEVPSSLGDIRTLERIEVHWCSQSAAVSVKEIEDEQRDIGNEELM  1473

Query  32    I  30
             +
Sbjct  1474  V  1474



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 88/167 (53%), Gaps = 16/167 (10%)
 Frame = -3

Query  518   LGSLDKLETLMIAF--RKGSPTGLQ---NLESLPlnlnikklklKRTCLPWSEINVIGML  354
             LG L +LE L + +  R   P       NL+ L L+         + CLPW  ++ IG L
Sbjct  1287  LGFLTQLEALKVTYSGRFCHPRKFDFPLNLKKLTLS---------KFCLPWDCVSEIGRL  1337

Query  353   PNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
             PNLEVLKL  +  +G  W   EG F KLKFL L++ N+  W+    D    L +LVL+ C
Sbjct  1338  PNLEVLKLLSRAFEGERWNMKEGEFLKLKFLKLDSLNIAQWKA-SADHLPKLQQLVLRNC  1396

Query  176   TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
               LE +P+GF D+ TL  IE+  C    +ES + L E +   GI+ +
Sbjct  1397  RHLEEVPSGFADIPTLVMIEMQLCRSSAEESVRILKEEQLGLGIDDL  1443



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TCL W ++  +G LPN+EVL+LK  +  G +W   EG F+KLK L +   NL  WE    
Sbjct  107  TCLLWEDMTTLGQLPNVEVLRLKCFAFQGRNWNLNEGGFKKLKLLQINETNLVHWEASSE  166

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
               R L  L+LK C KLE IPT   D+ TL   EL NC      S++++ E ++  G E 
Sbjct  167  SLPR-LEFLILKYCYKLEDIPTEIGDIPTLKLTELHNCSQAAAPSSEEIGEEQQSLGNEV  225

Query  38   IIIRHVD  18
            +++R  +
Sbjct  226  LVVRAYN  232



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            RTCLPW+ +N+   LPNLEVL+LK +   G +WE TE  F KLK L LE   L  W    
Sbjct  744  RTCLPWNCMNIFSKLPNLEVLELKARAFSGNEWEITETGFPKLKCLLLEDLYLRYWTA-T  802

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F CL R+ +++C  L+ IP GF D  TL  IEL  C  P+   A+++    E+ G
Sbjct  803  DDYFECLERVCIRECILLKEIPEGFADSETLQLIELHKCGRPLVTFAKQIQGKHEELG  860



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 97/194 (50%), Gaps = 18/194 (9%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLEN-LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikkl  408
            KLGI+   K       P N  N L SL  LETL ++F       LQN +S  ++      
Sbjct  723  KLGILVSKKNDEH---PTNFLNYLSSLHCLETLNLSF------SLQNEKSSTISQWNAFP  773

Query  407  klKR------TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAE  249
               R      + LPW E+  +G +PNLEVLKLK +   G  WEP +G F  LKFL LE  
Sbjct  774  PNLRALTLSGSHLPWEEMVTVGKIPNLEVLKLKDRAFSGQVWEPIDGGFLALKFLLLENN  833

Query  248  NLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN  69
             LE W+      +  L  LVL+ C  L  IP G  ++ TL  IEL +C      SA++++
Sbjct  834  ELEIWKATS-THYPSLQHLVLRLCDALIEIPCGIGEIPTLQIIELYSCGHSAVRSAKRIH  892

Query  68   EHREDYGIEPIIIR  27
            E ++  G + + +R
Sbjct  893  EEQQSIGNDDLEVR  906



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TC+PW+ +N+   LPNLEVL+LK     G +WE TE  F KLK L LE   L  W     
Sbjct  744  TCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEITEMGFPKLKCLLLEDLYLRYWTA-SD  802

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F+CL R+ +++C  L+ IP GF D  TL  IEL  C  P+   A+++ E+ E+ G
Sbjct  803  DYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQENHEELG  859



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TC+PW+ +N+   LPNLEVL+LK     G +WE TE  F KLK L LE   L  W     
Sbjct  754  TCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEITEMGFPKLKCLLLEDLYLRYWTA-SD  812

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F+CL R+ +++C  L+ IP GF D  TL  IEL  C  P+   A+++ E+ E+ G
Sbjct  813  DYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQENHEELG  869



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -3

Query  527  LENLGSLDKLETL-MIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            L +L  L +LE L +I  RK  P  L +   LP +L    L+   T LPW ++  I MLP
Sbjct  714  LNSLYCLPQLEILKIICSRKLYPHPLPSTYVLPTSLVRLTLRC--TYLPWEDMANIVMLP  771

Query  350  NLEVLKLKQVS-DGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            NL+VLK+K    DG  W  + E  F +LK+L ++  N++SW+  G   F  L RLVLK+C
Sbjct  772  NLQVLKIKDNGFDGDAWRLSDEQIFNQLKYLLIDRTNVKSWKA-GSVNFPKLQRLVLKRC  830

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIRHVDQ  15
              LE IP    +V TL SIELLNC     +S +++ E +E  G + + +R  D+
Sbjct  831  IYLEEIPKDIGEVYTLESIELLNCRTSAAKSVKEIQEEQESMGNDCLSVRIHDK  884



>ref|XP_006356446.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1645

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = -3

Query  503   KLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLK-  327
             +LE+L +      P  L ++ S P  L    L   R  LPWS+I  IG LPNL++LKL  
Sbjct  1477  QLESLKVV-SNSYPEKLPHVFSFPSRLRELTLSKFR--LPWSQILSIGELPNLKILKLLL  1533

Query  326   QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGF  147
             +  +G +WE  +  FR+LK+L LE  N+  W V   D F  L RLVL KC +L+ IP+ F
Sbjct  1534  RTFEGDEWEVKDSEFRELKYLELENLNIAQWSV-SEDAFPILERLVLTKCKRLKKIPSHF  1592

Query  146   EDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             +D  +L SIE+  C + V  SA+++   + D
Sbjct  1593  DDAVSLKSIEVNWCSLGVANSAKEIQAFQHD  1623



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 102/183 (56%), Gaps = 7/183 (4%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEI  372
            P+     +L+NLG L KLE+L ++    +   LQN   LP +L    L    TCL W ++
Sbjct  673  PQGFLSYSLDNLGQLHKLESLRLSIYSENKHLLQNF-ILPNSLKKLTLMG--TCLKWEDM  729

Query  371  NV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEA-ENLESWEVDGGDQFRCL  201
               I +LPNL+VLKLK+ S  G +WE  EG F  L++L + +  +LE W  D    F  L
Sbjct  730  KTKICLLPNLQVLKLKEYSFVGTEWETVEGQFCNLRYLLIRSCRDLEWWTTDSS-HFPRL  788

Query  200  TRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIRHV  21
              L L+   KL+ IP+   +++TL SIEL++C      SA+++ + +ED+G E   ++  
Sbjct  789  EHLHLRYLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGNEDFRVQVF  848

Query  20   DQI  12
            D +
Sbjct  849  DTM  851



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 95/170 (56%), Gaps = 6/170 (4%)
 Frame = -3

Query  527  LENLGSLDKLETL-MIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            L NL  L+KLE L +I  RK  P  L +  +LP +L    L+   T LPW ++  I  LP
Sbjct  695  LNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTSLKRLTLRC--TYLPWEDMANIVTLP  752

Query  350  NLEVLKLKQVS-DGPDWE-PTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            NL+VLK+K    DG  W    + NF +LKFL ++  NL+ W+  G   F  L RLVLK+C
Sbjct  753  NLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNLKHWDA-GSVNFPKLKRLVLKRC  811

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
              LE IP    ++ TL SIEL NC   V +S +++ E +E    + + +R
Sbjct  812  LYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQEEQESMANDILSVR  861



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 100/191 (52%), Gaps = 6/191 (3%)
 Frame = -3

Query  584  KLGI-ICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQ-NLESLPlnlnikk  411
            KLG+  C S    E IE   LENL  L +LE L        P+ ++ +    P+ L    
Sbjct  725  KLGLAFCTSDKPYEDIEHYCLENLVYLHQLEKLKFVVESDFPSPVKLHFPVFPMKLRKLT  784

Query  410  lklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESW  234
            L   R  LPW ++ ++G LPNL+VLKL++ +  G  WE  EG F +L FL +E  +L +W
Sbjct  785  LSGWR--LPWKDMTIVGSLPNLQVLKLRESACVGDTWETIEGEFLELNFLMIEESDLRNW  842

Query  233  EVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             +     F  L  LV+++C  L  IP G  ++ TL  IE+      + ESA+++ E +E 
Sbjct  843  -ITESSHFPNLKWLVIRRCRYLREIPDGIGEIATLELIEVEMRNKYLVESAKRIQEEQES  901

Query  53   YGIEPIIIRHV  21
             G + + +R V
Sbjct  902  LGNDALQVRFV  912



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W ++  +G LPNLEVL+LK  +  G +W   EG F+KLK L +  +NL  WE    
Sbjct  107  TRLLWEDMTTLGQLPNLEVLRLKCFAFQGRNWNLNEGGFKKLKLLQINRKNLVLWEASSE  166

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
               R L  L+LK C KLE IPT   D+ T+  IEL NC      SA+++ E ++  G E 
Sbjct  167  SLPR-LEFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLGNEV  225

Query  38   IIIRHVD  18
            +++R  +
Sbjct  226  LVVRAYN  232



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 95/171 (56%), Gaps = 6/171 (4%)
 Frame = -3

Query  530  NLENLGSLDKLETL-MIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGML  354
             L NL  L+KLE L +I  RK  P  L +  +LP +L    L+   T LPW ++  I  L
Sbjct  710  TLNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTSLKRLTLRC--TYLPWEDMANIVTL  767

Query  353  PNLEVLKLKQVS-DGPDWE-PTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            PNL+VLK+K    DG  W    + NF +LKFL ++  NL+ W+  G   F  L RLVLK+
Sbjct  768  PNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNLKHWDA-GSVNFPKLKRLVLKR  826

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            C  LE IP    ++ TL SIEL NC   V +S +++ E +E    + + +R
Sbjct  827  CLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQEEQESMANDILSVR  877



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 95/171 (56%), Gaps = 6/171 (4%)
 Frame = -3

Query  530  NLENLGSLDKLETL-MIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGML  354
             L NL  L+KLE L +I  RK  P  L +  +LP +L    L+   T LPW ++  I  L
Sbjct  710  TLNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTSLKRLTLRC--TYLPWEDMANIVTL  767

Query  353  PNLEVLKLKQVS-DGPDWE-PTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            PNL+VLK+K    DG  W    + NF +LKFL ++  NL+ W+  G   F  L RLVLK+
Sbjct  768  PNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNLKHWDA-GSVNFPKLKRLVLKR  826

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            C  LE IP    ++ TL SIEL NC   V +S +++ E +E    + + +R
Sbjct  827  CLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQEEQESMANDILSVR  877



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 3/126 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW  I+ IG LPNLEVLKL  +  DG  WE  EG F KLKFL L++ NL  W     D 
Sbjct  972   LPWDCISDIGRLPNLEVLKLLSKAFDGKVWEMKEGEFLKLKFLKLDSLNLSEWNA-SSDH  1030

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE-PI  36
                L  L+L+ C +L+ +P GF D  TL  IE+  C   ++ES ++L E +++ G E  +
Sbjct  1031  LPQLQHLILQSCWQLKEVPPGFGDSFTLEIIEVQMCTSSLEESVKRLEEEQQEMGNELKV  1090

Query  35    IIRHVD  18
             ++ H D
Sbjct  1091  LVDHSD  1096



>ref|XP_009800104.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800105.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800106.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1741

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 87/157 (55%), Gaps = 7/157 (4%)
 Frame = -3

Query  518   LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
             L SL  LE+L +      P  L ++ S P  L    L   R  LPWS+I+ IG LPNLE+
Sbjct  1564  LESLSHLESLKLV-SNSYPAKLPHVFSFPSRLRELTLSKFR--LPWSQISTIGELPNLEI  1620

Query  338   LKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
             LKL  +  +G  WE  +  F +L +L L+  N+  W V   D F  L  LVL KC +LE 
Sbjct  1621  LKLHLRAFEGNHWEVKDSEFPELTYLELDDINIAQWSV-SDDAFPKLKCLVLTKCKRLEK  1679

Query  161   IPTGFEDVNTLASIELLNCPVPVKESAQKL--NEHRE  57
             IP+ F+D  +L SIE+  C + V ESAQ++   +H E
Sbjct  1680  IPSHFDDSVSLRSIEVNWCNLSVAESAQEIQTTQHEE  1716



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGL---QNLESLPlnlnikklklKRTCLPWSEINVIGM  357
              NL  L +LE L I   K     L   ++L++LP NL    L    T LPW  +  +  
Sbjct  750  FRNLALLPQLEALKIFGLKPPVQELKLARHLDALPENLKKLTLSF--TYLPWESMTSLCR  807

Query  356  LPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            LPNLEVLKLK  +  GP WE  E  F  LK L +E  +LE W     D F CL  LVLK 
Sbjct  808  LPNLEVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEHWSA-SNDHFPCLEHLVLKG  866

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            C  L+ IP    D+ TL  IEL N       SA+++ E ++ YG + + +R
Sbjct  867  CLHLDSIPHELGDIPTLQIIELENSSQSALLSAKEIQEEQQSYGNDALEVR  917



>ref|XP_009796331.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=571

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 70/130 (54%), Gaps = 6/130 (5%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TCL W +++++G LP LEVLKL      G +WE  +  F +LKFLYL   + + W   G 
Sbjct  441  TCLWWKDLSIVGKLPKLEVLKLIGDACKGKEWEAADHGFPRLKFLYLRDVDFQYWRA-GC  499

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED-YGIE  42
              F  L RL +  C  L+ IP  F D+ TLA I L  CP     SA+++ +   D YG  
Sbjct  500  HHFPFLERLAILYCPYLDSIPQDFADITTLARISLTGCPESFGNSAKQIQQDMLDNYGNS  559

Query  41   PI---IIRHV  21
             +   I+RH+
Sbjct  560  SLVVNIVRHL  569



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 3/125 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            +TCL W +++++G LP LEVLKL        +WE  +  F +LKFLYLE  + + W    
Sbjct  789  KTCLWWKDLSIVGKLPKLEVLKLIGDACKDKEWEVADHGFPRLKFLYLEEVDFQYWRA-S  847

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED-YGI  45
               F CL RLV+  C  L+ IP  F D+ TLA I + +C   V  SA+++ +   D YG 
Sbjct  848  CHHFPCLERLVIGGCYSLDSIPRDFADITTLAHIVVWSCAESVGNSAKQIQQDMLDNYGS  907

Query  44   EPIII  30
              +++
Sbjct  908  SSLVV  912



>gb|AAT39951.2| Disease resistance protein, putative [Solanum demissum]
Length=2544

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = -3

Query  392   CLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGD  216
             CLPWSEI+++G L NLEVLKL  +  +G  W   +  F +L++L L++ N   W +   D
Sbjct  2410  CLPWSEISIVGTLCNLEVLKLLNKAFEGIQWNVNDTEFPELRYLKLDSLNFAQWSI-SED  2468

Query  215   QFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL-NEHREDYG  48
              F  L RLVL  C +LE IP+ FEDV +L SIE+  C   V  SA ++    RED  
Sbjct  2469  SFPSLERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANSAGEIQTTQREDMA  2525



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 4/160 (3%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            +L+NL  L KLE L + F    P     L +L    ++K+L L  + L W ++++IG LP
Sbjct  712  DLKNLVRLSKLENLKLVF--NWPLNEVLLPNLSFPQSLKELTLNASKLSWEDMSIIGSLP  769

Query  350  NLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            +LEVLKLK+ +  G  WEP EG F +LKFL ++   L  W +     F CL  L+++ C 
Sbjct  770  HLEVLKLKEHAFTGGVWEPVEGEFSRLKFLLMDRMEL-VWWIAENTHFPCLEHLIIRSCH  828

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             L+ IP+G  D+ TL  I++ +C      S +++ E + D
Sbjct  829  NLQAIPSGIGDIATLKMIDIDDCSSSAVTSVEQILEEQRD  868



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 99/195 (51%), Gaps = 19/195 (10%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAF----RKGS-PTGLQ---NLESLPl  429
            KL I      S          NL SL+ LETL  +F    RK   P+G     NL+ L L
Sbjct  689  KLEIFATESNSKAEQTSEYFSNLASLNLLETLKCSFLYRPRKHRLPSGDHFPANLKKLTL  748

Query  428  nlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEA  252
            +          + LPW ++  + +LP LEVLKL+  + +G  W   EG F +LK L +E 
Sbjct  749  SG---------SFLPWEDMAKLAVLPKLEVLKLRSFAFEGQIWGAVEGGFFQLKLLLVEN  799

Query  251  ENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
             +  SW+ D    F  L +LVL++C +L  IP G  D+ TL  IE+ +C   +  SA+K+
Sbjct  800  SDPMSWDADAS-HFPSLQQLVLRECHRLTEIPQGIGDITTLQMIEVQDCSFYIVRSARKI  858

Query  71   NEHREDYGIEPIIIR  27
            ++ ++  G + + IR
Sbjct  859  HQQQQILGNDELGIR  873



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 3/126 (2%)
 Frame = -3

Query  398  RTC-LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
            R C LPW+++ ++ MLP LEVLKLK  +  G +WE T+  F++LKFL L+  +L  W VD
Sbjct  756  RGCQLPWNQMTILCMLPELEVLKLKDYAFQGSEWESTDERFQQLKFLLLDGTDLIHWIVD  815

Query  224  GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
               QF  L  LVLK C  L  IP    ++ TL  IEL +C      SA ++ E +   G 
Sbjct  816  SI-QFPKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSADVSANRIQEEQHSMGN  874

Query  44   EPIIIR  27
            + +++R
Sbjct  875  DDLVVR  880



>emb|CDP11163.1| unnamed protein product [Coffea canephora]
Length=2495

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 86/156 (55%), Gaps = 6/156 (4%)
 Frame = -3

Query  518   LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
             L  L  LE+L +++  G+P    ++  LPLNL    L   R  LPW  I+VIG LPNLEV
Sbjct  1230  LDCLTNLESLRVSYY-GTPLT-TSMFCLPLNLKELTLSYFR--LPWDHISVIGRLPNLEV  1285

Query  338   LKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
             LKL     +G  WE  E  FR+LKFL L+A N+  WE    D    L RLVL+ C  L  
Sbjct  1286  LKLLSGAFEGKRWEMREEEFRELKFLKLDALNIAEWEA-CCDHLPKLERLVLQNCKDLMQ  1344

Query  161   IPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             IP  FE + TL  IE+  C    +ESA+++ E   D
Sbjct  1345  IPYDFESITTLEVIEVHWCGESAEESAKEIGEATGD  1380


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 80/152 (53%), Gaps = 7/152 (5%)
 Frame = -3

Query  518   LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
             L SL  LE+L I F  G P        LP NL    L      LPW+ I+ IG LP LEV
Sbjct  2313  LSSLTHLESLNI-FYYGRPINTTEF-ILPSNLRKLTLSNFH--LPWNRISAIGKLPKLEV  2368

Query  338   LK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
             LK L    +GP W+  +  F++LKFL L++ N+  W     D    L RLVL+ C +LE 
Sbjct  2369  LKLLSGAFEGPIWDMGDEEFQELKFLKLDSLNVAQWNA-SCDHLPKLERLVLQNCKELEK  2427

Query  161   IPTGFEDVNTLASIELLNCP-VPVKESAQKLN  69
             IP  F +++ L  IE++N   +P  +S+  L 
Sbjct  2428  IPHDFAEISMLEMIEIVNILWIPSLQSSTHLQ  2459



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L WS I+ +GMLPNLEVLKLK  +  G  WEP +G FR L+ L++   NLE W    G
Sbjct  757  TFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNA-SG  815

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              F  L ++ LK C+ L  IP G  +V++L +IEL   P P   ++ ++ +  +  G
Sbjct  816  HHFPRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELF-WPTPAAAASARIIQQEKQEG  871



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 92/166 (55%), Gaps = 5/166 (3%)
 Frame = -3

Query  536  PANLENLGSLDKLETLMIAFR-KGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIG  360
             ++L +  SL KLE L    +   S   L ++ SLP++L    L    +   W++I+ + 
Sbjct  698  ASSLVDTSSLTKLEALKFVKKLSWSARTLISIRSLPISLKRLTLAGWHS-FRWTDISALV  756

Query  359  MLPNLEVLKLKQ-VSDGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVL  186
            MLPNLE LKLK   ++G  W    E  F+ L+ L     N+E WE    D F  L RLVL
Sbjct  757  MLPNLEELKLKNYAANGYVWRLNDEDKFQSLELLLFCNINVEHWEA-SSDNFPNLKRLVL  815

Query  185  KKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            K+C KL+ IP  F ++ +L SIEL NC    +ESA+K+ + +ED G
Sbjct  816  KECRKLKEIPIDFGEICSLESIELHNCSTLAEESARKIEQEQEDMG  861



>ref|XP_011072559.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=318

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 97/169 (57%), Gaps = 6/169 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINV-IGMLP  351
            LENLG L KLE+L + F K    G+  LESL +  +++KL L    L W +I   IG+LP
Sbjct  124  LENLGHLQKLESLDLGFIK--VRGIHLLESLSIMHSLRKLTLWGCLLQWEDITTSIGLLP  181

Query  350  NLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYL-EAENLESWEVDGGDQFRCLTRLVLKKC  177
            +L+VL+ L++   G +WE  EG+F  L  L + + ++LE W+ +    F CL +L+L+  
Sbjct  182  HLQVLRLLRESVTGHEWETVEGHFCHLTSLIIDDIKDLEYWKSESS-HFPCLNQLLLRHL  240

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIII  30
              L  IP  F  + TL  I L +C      SA+++ E +E+ G E +++
Sbjct  241  RTLNEIPLSFGGIQTLELIALYDCSDSAVISAKEIAEQQEELGNEDLLV  289



>gb|EYU22216.1| hypothetical protein MIMGU_mgv1a019937mg [Erythranthe guttata]
Length=868

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGN---FRKLKFLYLEAENLESWEVDG  222
              W  + VIG LPNLEVLKL+  +  G +WE   G    F +LKFL +E  ++E WE + 
Sbjct  732  FQWRSMGVIGELPNLEVLKLRWCAFSGAEWEIAGGEGELFPRLKFLLMEDLDVEVWETNS  791

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
            G  FR L+RLV++ C KL+ IP G  D   L  IE+ +C   +  SA+ +   + D+  +
Sbjct  792  GGGFRRLSRLVIRHCYKLKEIPRGIADSAALEVIEVDDCSSSLANSARGIYMAKHDWVND  851

Query  41   PIIIR  27
             + IR
Sbjct  852  HVKIR  856



>emb|CDP08019.1| unnamed protein product [Coffea canephora]
Length=1758

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 98/184 (53%), Gaps = 13/184 (7%)
 Frame = -3

Query  569   CGSKPSPEAIEPAN-LENLGSLDKLETLMIAFRKGSPTGLQNLE-SLPlnlnikklklKR  396
             C    SP++    N    L  L  LE+L I F  GSP  L N E SLPLNL    L   R
Sbjct  1136  CIFYESPDSSMNCNHFPRLNCLTHLESLKI-FYYGSP--LNNGEFSLPLNLKKLTLSNFR  1192

Query  395   TCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
               LPWS I+ IG LPNL+VLKL     +G  W+  E  F+ LKFL L+  N+  W     
Sbjct  1193  --LPWSHISTIGRLPNLKVLKLLSGAFEGKIWD-VEEEFQNLKFLRLDNLNIAQWNA-SC  1248

Query  218   DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
             D F  L RLVL+ C  LE IP  F ++ TL  IE+  C    +ESA+K+    E+YG   
Sbjct  1249  DDFPKLERLVLQNCKDLEEIPEDFGNIYTLGMIEVHWCGRSAEESAKKIE---EEYGDIE  1305

Query  38    IIIR  27
             ++IR
Sbjct  1306  VLIR  1309


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 81/148 (55%), Gaps = 8/148 (5%)
 Frame = -3

Query  518   LGSLDKLETLMIAFRKGSPTGLQNLE-SLPlnlnikklklKRTCLPWSEINVIGMLPNLE  342
             L  L  LE+L I F  G+P  L N E +LPL+L    L   R CLPW+ I+ I  LPNLE
Sbjct  1596  LKFLSHLESLKI-FYYGNP--LHNAEFNLPLSLKELTLS--RFCLPWTHISAISSLPNLE  1650

Query  341   VLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLE  165
             VLK L     G  W+  E  F+KLKFL LE  ++  W     D    L RLVL+ C  LE
Sbjct  1651  VLKLLSGAFMGRTWDMMEDEFQKLKFLSLETLDIAEWNA-SYDHLPRLERLVLQHCKDLE  1709

Query  164   GIPTGFEDVNTLASIELLNCPVPVKESA  81
              IP    D+ +L +IE+  C   V+ESA
Sbjct  1710  KIPEDLSDITSLETIEVHWCGQSVEESA  1737



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            + + W E+++IGMLPNLEVLK+K    + P WE  +  F  LKFL L   +L+ W     
Sbjct  736  SYVDWKEMSIIGMLPNLEVLKIKDNFFNAPRWEVMDEAFSHLKFLKLSNTDLQQWSASSS  795

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              F CL +LVL  C  L+ IP+ F  ++TL +IEL      V +SA+++ + +   G
Sbjct  796  S-FPCLQQLVLDGCPNLQEIPSSFRSIDTLEAIELYYSSQSVADSARQIQDSQRYMG  851



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 95/186 (51%), Gaps = 12/186 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlni----  417
            KLGI CG     +      L NL  L +LE L I+    S +     + +P   +     
Sbjct  643  KLGI-CGRASHFKDAPKKFLNNLIYLPELEALRISLYDRSSSDFLLRQPVPCVGSFPPNL  701

Query  416  kklklKRTCLPWSEINVIGMLPNLEVLKLKQVS------DGPDWEPTEGNFRKLKFLYLE  255
            KKL L+ T L WS++ VI  LPNLEVLKLK +           WE ++  F KLKFL +E
Sbjct  702  KKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEVSKIEFPKLKFLLIE  761

Query  254  AENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQK  75
             + LE W  +  D F CL R+++K C  L+ IP GF D  TL  IEL  C   +   A++
Sbjct  762  KKGLEYWTAED-DSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNFARE  820

Query  74   LNEHRE  57
            + E ++
Sbjct  821  IQEEQQ  826



>gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Erythranthe guttata]
Length=745

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 97/172 (56%), Gaps = 5/172 (3%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL-ESLPlnlnikklklKRTCLPWSE  375
            P+      L+NLG L KLE+L  +    +   L ++ ++  L  ++KKL L  T L W +
Sbjct  544  PQEFLSYTLDNLGHLHKLESLRFSLHSENKPSLNDMVQNFILPNSLKKLTLIGTKLKWED  603

Query  374  INV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLE-AENLESWEVDGGDQFRC  204
            +N  IG+LPNL+VLKLK+ S  G +WE  EG F  LKFL +     LE W  D    F  
Sbjct  604  MNTKIGLLPNLQVLKLKEYSFVGTEWETVEGQFCNLKFLLIHMCSELEWWATDSS-HFPR  662

Query  203  LTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            L  L L+   KL+ IP+   +++TL SI+LL C      SA+++ + +ED+G
Sbjct  663  LEHLQLQFLDKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKEILKEQEDFG  714



>ref|XP_011072173.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=869

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 84/170 (49%), Gaps = 21/170 (12%)
 Frame = -3

Query  527  LENLGSLDKLETL------MIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
            L NL  L +LE+L      ++  +   PT L+ L             L +  +PW  I +
Sbjct  698  LHNLAHLHRLESLSLIAEDLLLEKTAFPTSLKRLS------------LSKCRIPWGHITI  745

Query  365  IG-MLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRL  192
            IG +LPNLEVLKL      G +W P EG F +LK L++   +L SW  D    F  L  L
Sbjct  746  IGSLLPNLEVLKLLNNAFRGSEWSPVEGQFPRLKVLFISDSDLVSWRADDF-HFPHLESL  804

Query  191  VLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
             L+   KLE IP+G   + TL SI L  C   V  SA+++ E +  YG E
Sbjct  805  FLRLMHKLEEIPSGIGHIETLRSIHLNKCSELVVNSAKQILEEQSSYGNE  854



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 93/184 (51%), Gaps = 9/184 (5%)
 Frame = -3

Query  572   ICGSKPSPEAIEPANL-ENLGSLDKLETLMIAFRKGSPTGLQ--NLESLPlnlnikklkl  402
             IC ++      EP+ L  NL  L +LETL   F K      Q     +LP +L    L  
Sbjct  939   ICETEEDCGICEPSVLLGNLQYLKELETLECCFYKQRVEARQISFFSALPCSLRQLSLSW  998

Query  401   KRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
               + LPW + ++IGMLP LEVLKLK  +  GP WEP    F +L  L +E  +L  WE  
Sbjct  999   --SYLPWEDTSLIGMLPRLEVLKLKHFAFHGPKWEPKTKGFCRLTHLLIENTDLVHWEA-  1055

Query  224   GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
                 F  L  LVLK C  LE IP   E++ TL  IEL +C    +  A+++ E  E  GI
Sbjct  1056  TVHHFPRLQYLVLKSCKLLEEIPFDVEEIGTLQRIELHHCNKTTEILAREIQEQVE--GI  1113

Query  44    EPII  33
             E +I
Sbjct  1114  EVVI  1117



>gb|AAT40487.1| putative disease resistance protein [Solanum demissum]
Length=2607

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = -3

Query  392   CLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGD  216
             CLPWSEI+++G L NLEVLKL  +  +G  W   +  F +L++L L++ N   W +   D
Sbjct  2390  CLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSI-SED  2448

Query  215   QFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
              F  L RLVL  C +LE IP+  EDV +L SIE+  C   V  SA+++
Sbjct  2449  SFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEI  2496



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 95/186 (51%), Gaps = 12/186 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlni----  417
            KLGI CG     +      L NL  L +LE L I+    S +     + +P   +     
Sbjct  776  KLGI-CGRASHFKDAPKKFLNNLIYLPELEALRISLYDRSSSDFLLRQPVPCVGSFPPNL  834

Query  416  kklklKRTCLPWSEINVIGMLPNLEVLKLKQVS------DGPDWEPTEGNFRKLKFLYLE  255
            KKL L+ T L WS++ VI  LPNLEVLKLK +           WE ++  F KLKFL +E
Sbjct  835  KKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEVSKIEFPKLKFLLIE  894

Query  254  AENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQK  75
             + LE W  +  D F CL R+++K C  L+ IP GF D  TL  IEL  C   +   A++
Sbjct  895  KKGLEYWTAED-DSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNFARE  953

Query  74   LNEHRE  57
            + E ++
Sbjct  954  IQEEQQ  959



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             PW ++ ++  LPNLE LKL   +  GP+WE  E +F +LKFL LE  ++ +W  +G   
Sbjct  740  FPWEDMKILAQLPNLEALKLGCYAFQGPEWELDEEDFIRLKFLLLEDMDIANWRANGQIL  799

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             R L RLV++ C  L+ IP G + + TL  +E+++C   V +SA ++ E +ED
Sbjct  800  HR-LERLVVRHCYNLQEIPYGIDYITTLQLVEVVDCSPSVVDSAMRIKEMQED  851



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 84/162 (52%), Gaps = 4/162 (2%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            +L++L  L +LE L   ++      L    SLP +L    L    T  P  ++  I MLP
Sbjct  684  HLDSLSCLKELEILKFRYQGAYRRQLPRKFSLPTSLKRLTLT--NTLFPPEDMTNITMLP  741

Query  350  NLEVLKLKQVSDGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            NLEVLK+K V D  +W    E  F +LKFL +    L  WE  G   F  L R+VL+ C 
Sbjct  742  NLEVLKMKDVFDSDEWRLNDEEIFSQLKFLLISVTFLRHWEA-GSVNFPKLQRVVLRSCI  800

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             LE IP  F ++ +L SIEL +C +   +S ++L E +E  G
Sbjct  801  GLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQEEQESMG  842



>ref|XP_009625968.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=378

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            L W  +N+   LPNL+VL+LK     G +WE TE  F KLKFL LE   +  W     D 
Sbjct  223  LSWKRMNIFSKLPNLKVLELKDHAFLGYEWEVTETGFPKLKFLLLEYLFIRYWR-STDDY  281

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            F+CL  + +K C  LE IP GF D  TL  IEL  C  P+   A+++ E  E+ G
Sbjct  282  FQCLEHVYIKDCRFLEEIPEGFADSVTLQLIELHQCCHPLVTFAKQIQETHEELG  336



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 88/170 (52%), Gaps = 12/170 (7%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFR------KGSPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
            ++NL  L  LE+L IA +            L + +S P  L   KL   RTCLPW  +++
Sbjct  614  IDNLKYLQDLESLSIAIQYWYIINSTRFFSLTSPDSFPQKLKKLKLS--RTCLPWEYMSI  671

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEG-NFRKLKFLYLEAENLESWEVD--GGDQFRCLT  198
            I  LP LEVL+LK+ +  G  W+ T+   F+KL+FL LE   L+ W +     D F  L 
Sbjct  672  ISKLPVLEVLQLKRYAFRGHKWKATDQIGFQKLRFLLLENLMLDKWTITTVSHDHFPSLE  731

Query  197  RLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            R+++  C  L+ IP GF D   L  IEL  C   +   A+K+ E  ED G
Sbjct  732  RVLITDCIYLKEIPQGFADSKKLELIELHRCDPSLVAFAEKIQEKHEDLG  781



>emb|CDP07957.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS ++ IG LPNLEVLKL   S +G  W+  E  F KLKFL LE+ ++  W     D 
Sbjct  1142  LPWSAVSAIGKLPNLEVLKLLHASFEGKTWDMKEEEFLKLKFLKLESLDIAHWNA-SEDH  1200

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
               CL  LV+KKC  L  IP    D+ TL  IEL NC      SA+ + E +++ G
Sbjct  1201  LPCLETLVVKKCHALTEIPLCLGDIPTLQRIELQNCTRSAWISARTVKEKQKEMG  1255



>gb|EYU24432.1| hypothetical protein MIMGU_mgv1a023729mg [Erythranthe guttata]
Length=860

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 99/188 (53%), Gaps = 9/188 (5%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRK---GSPTGLQNLESLPlnlnik  414
            KL I      S  +    +L N+G L KLE+L   FR    GS + L NL +LP +L   
Sbjct  657  KLKITFNDVLSERSSRHYSLYNIGRLHKLESLKCCFRNILDGSNSPL-NLMALPTSLKKL  715

Query  413  klklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEA-ENLE  240
             L+    CL   ++ +IG LP+L+ LKL  VS  G +W+P EG F +LKFL + +  +L+
Sbjct  716  TLQG--CCLHSEDLAMIGSLPHLQFLKLAYVSIVGSEWDPVEGGFLQLKFLKIYSCRDLK  773

Query  239  SWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHR  60
             W  D    F  L  +   +  +L  +P G  ++ TL +IEL+ C   V  SA ++ E +
Sbjct  774  YWNADSS-HFPVLENIKFVEVDRLVEVPLGVGEIPTLGAIELVRCTESVAMSAVRILEEQ  832

Query  59   EDYGIEPI  36
            E +G E I
Sbjct  833  ESFGNEAI  840



>ref|XP_006365690.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=573

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 69/117 (59%), Gaps = 1/117 (1%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGN-FRKLKFLYLEAENLESWEVDGG  219
            T +PW  +N++  LPNLEVLK      G DW   E   FRKLK L + +++L+ WE  G 
Sbjct  443  TKIPWEVMNLLSNLPNLEVLKGYYAFSGTDWTLNEDVVFRKLKHLLIRSKDLQRWEAAGS  502

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F  L +L+L    +LE IP    D+ TL  I++++C   V+ SA+++ + ++ +G
Sbjct  503  DNFPMLEKLILNWLFELEEIPESIGDIMTLKLIQIVDCSSAVENSAKRIRKEQQSFG  559



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 99/178 (56%), Gaps = 5/178 (3%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL-ESLPlnlnikklklKRTCLPWSE  375
            P+      L+NLG L KLE+L  +    +   L +L E+  L  ++KKL L+ T L W E
Sbjct  575  PQGFLSYCLDNLGHLHKLESLRFSLNPINKPSLNDLVENFILPNSLKKLTLEGTYLKWEE  634

Query  374  INV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLE-AENLESWEVDGGDQFRC  204
            +N  IG+LPNL+VLKLK  S  G +WE  EG F  L++L +    +LE W  D    F  
Sbjct  635  MNTKIGLLPNLQVLKLKASSFVGAEWETVEGQFCNLRYLLINMCSDLEWWTTDSS-SFPR  693

Query  203  LTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIII  30
            L  LVL++  KL  IP+G  ++ TL SIEL  C      SA+ + + +ED G+   ++
Sbjct  694  LEHLVLQQLDKLNEIPSGIGEIPTLQSIELNLCHDDAVISAKSIFDEQEDLGLRVRVV  751



>ref|XP_011072144.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=873

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 99/173 (57%), Gaps = 11/173 (6%)
 Frame = -3

Query  521  NLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM-LPNL  345
            +L  L+KLE+L + F       + +LE++    ++KKL L    +PW ++ +IG  LPNL
Sbjct  693  SLAQLNKLESLCLCF-------ISSLEAIGFPTSLKKLTLWYCQIPWGKMTIIGSSLPNL  745

Query  344  EVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLE  165
            EVLKL     GP W P +G F +LK L++E+  LE WE +    F  L  L L +  +L+
Sbjct  746  EVLKLNNAFMGPKWSPNDGEFLQLKVLFIESLELEHWEAEDT-HFPNLHGLYLYQMMRLK  804

Query  164  GIPTGFEDVNTLASIEL-LNCPVPVKESAQKLNEHREDYGIEPIIIRHVDQIQ  9
             IP    D+NTL SI L + C V  K SA ++ + +++ G E I+  ++D+ Q
Sbjct  805  EIPLSIGDINTLQSIHLRVWCSVSAKNSALEIVKDQKEKGNE-ILQVYIDEKQ  856



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 85/168 (51%), Gaps = 12/168 (7%)
 Frame = -3

Query  527  LENLGSLDKLETLMI---AF----RKGSPTGLQNLESLPlnlnikklklKRTCLPWSEIN  369
             +NL  LD LETL +    F     +   +GL      P NL    L    T L WS I+
Sbjct  708  FDNLAKLDNLETLKLLNDTFPLPPSQCQISGLPQSYKFPPNLKKLTLSD--TFLDWSHIS  765

Query  368  VIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRL  192
             +GMLPNLEVLKLK  +  G  WEP +G FR L+ L++   NLE W    G  F  L ++
Sbjct  766  TLGMLPNLEVLKLKDYAFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNA-SGHHFPRLQQV  824

Query  191  VLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             LK C+ L  IP G  +V +L ++EL   P P   ++ +  +  +  G
Sbjct  825  FLKHCSSLNEIPFGLVEVPSLQNMELF-WPTPAAAASARFIQQEKQKG  871



>ref|XP_011084836.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=481

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPW  + VI  L NLEVLKL+ ++  G +WE ++G F++LKFL +E  NL SW V+    
Sbjct  282  LPWQGMAVIRSLLNLEVLKLRYIAIIGEEWEYSDGEFQRLKFLLMEKLNLRSWSVE-STH  340

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            F CL RLV+K+C +LE IP    D+ TL  IE+        +SA  + E +   G
Sbjct  341  FPCLERLVIKQCLQLEDIPCEIGDIPTLELIEVDGGSKSAADSAVFIQEEQRSLG  395



>ref|XP_010320562.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Solanum lycopersicum]
Length=1687

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 2/104 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW EI+++G LPNLE+L+L  +  +G +WE  +  FR LK+L L+  N+  W +   D 
Sbjct  1554  LPWYEISIVGELPNLEILRLLSRAFEGNEWEVNDSEFRVLKYLNLDNINISQWSL-SNDA  1612

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
             F  L  LVL KC +LE IP+ F D  TL SIE+  C   V  SA
Sbjct  1613  FPKLEHLVLTKCKQLEEIPSHFGDAVTLKSIEVNRCGRSVSNSA  1656



>gb|EYU20573.1| hypothetical protein MIMGU_mgv1a000577mg [Erythranthe guttata]
Length=1062

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 2/123 (2%)
 Frame = -3

Query  398   RTCLPWSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
             R  LPW  ++ IG +PNLE+L+L+  S  G  WE  EG F+KL+FL +    L+ W V+ 
Sbjct  935   RLGLPWEMMSAIGKMPNLEILRLRCGSFVGKKWETKEGEFQKLRFLVMYKLELDEWNVES  994

Query  221   GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLN-CPVPVKESAQKLNEHREDYGI  45
              + F  L RLVL +C  LE +P+   D+ TL  IE+   C   + ESA ++ E + D G 
Sbjct  995   SEHFPKLQRLVLFECYNLEEVPSEIGDIGTLQFIEIRGWCLKTLVESAVRIEEEQRDMGN  1054

Query  44    EPI  36
             E +
Sbjct  1055  EEL  1057



>ref|XP_011072130.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=864

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 100/203 (49%), Gaps = 29/203 (14%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGS-------PTGLQNLESLPln  426
            KLGI+   K S        LENL  L KLE+L++  +  S       PT L+ L      
Sbjct  678  KLGIVYLEKGS------GGLENLARLQKLESLLVIEKDVSLLANITFPTSLKKL------  725

Query  425  lnikklklKRTCLPWSEINVIG-MLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEA  252
                   L   C+PW E+ V G +LPNLE LKL      GP+W P EG F +LK L +  
Sbjct  726  ------TLTSCCIPWEEMTVFGSVLPNLEKLKLYGNAFKGPEWSPVEGQFPRLKVLIIWE  779

Query  251  ENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
             +L  W  +    F  L RL L +   LE IP+G  D+ TL SI L +C      SA+++
Sbjct  780  NDLVWWRAESI-HFPKLERLDLYEMHCLEEIPSGIGDIPTLLSIHLWDCSDSSINSAKQI  838

Query  71   NEHREDYGIEPIIIRHVDQIQEV  3
             E ++  G E I+  +VD+ Q V
Sbjct  839  LEEQQSSGNE-ILQLYVDEGQVV  860



>ref|XP_006360433.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=358

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 87/158 (55%), Gaps = 5/158 (3%)
 Frame = -3

Query  518  LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
            L SL +LETL + F   S  G   L + P NL    L   +  LP  EI  I  L NLEV
Sbjct  196  LDSLSQLETLKVVFVGISEVGPSRL-NFPENLKKLTLC--KFPLPPEEIATIAKLVNLEV  252

Query  338  LKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
            LKL+QV+ +  +WE  +  F +LK L LE   L  WEV   + F  L +LVL+ C  LE 
Sbjct  253  LKLRQVAFEMGEWEVRDQEFSQLKLLELENLQLSKWEV-SEEAFDRLEKLVLRGCLHLEA  311

Query  161  IPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            IP  F++++ L  IE+ +C   V +SA+ + E RE YG
Sbjct  312  IPDSFQELSCLRYIEVKSCSEDVADSARIIKETREGYG  349



>ref|XP_011072147.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=872

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM-L  354
            +L NL  LDKLE+L +A+         +LE++    ++KKL L    + W ++ +IG  L
Sbjct  704  SLNNLAHLDKLESLYVAY-------YSHLENIAFPTSLKKLDLSFCAISWDKMTIIGSSL  756

Query  353  PNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            PNLEV KL   + G  W P EG F +LK L++    L  W  +    F  L  L L+K  
Sbjct  757  PNLEVFKLYDATSGQVWNPIEGEFLRLKTLFIWNCYLVRWGAEDV-HFPNLQSLSLEKVR  815

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQK-LNEHRED  54
            KLE IP    D+NTL SI L NC   V  SA + LN  RE+
Sbjct  816  KLEEIPLSIGDINTLQSIHLDNCSESVINSAMEILNVQREN  856



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRK---GSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
              NL  L +LE L I   K     P   ++L++LP NL    L    T LPW  +  +  
Sbjct  801  FRNLALLPQLEALKIFGLKPPVQEPKLARHLDALPENLKKLTLSF--TYLPWESMTSLCR  858

Query  356  LPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            LPNLEVLKLK  +  GP WE  E  F  LK L +E  +LE W     D F CL  LVLK 
Sbjct  859  LPNLEVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSA-SNDHFPCLEHLVLKG  917

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            C  L+ IP     + TL  IEL N       SA+++ E ++  G + + +R
Sbjct  918  CLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVR  968



>ref|XP_009599401.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Nicotiana tomentosiformis]
Length=253

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDG----PDWEPTEGNFRKLKFLYL-EAENLESWE  231
            TCLPW  ++++GMLPNLE+L+L+  + G      W+P+EG F +LKFL L        W+
Sbjct  105  TCLPWEAMDIVGMLPNLEILELEDDACGVKPKTTWKPSEGGFPRLKFLSLCHMLCFTEWK  164

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE  57
                  F  L RL +  C +LE IP  F ++ TL  IEL +C + +  SAQ++ + +E
Sbjct  165  AT-EYHFPVLERLFISHCPQLEQIPQDFANIFTLQLIELHDCCIHLAISAQQIEQEQE  221



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 92/175 (53%), Gaps = 14/175 (8%)
 Frame = -3

Query  521  NLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLE  342
            +L  L +LE L  + RK S T +  L+  P    +      +  + W  +  IG+LPNLE
Sbjct  558  DLSHLHRLEILKCSARKWSRTSISKLDFPPSIRKLTLS---KLTIHWGFMTTIGLLPNLE  614

Query  341  VLKLKQVS---------DGPDWEPTEGNFRKLKFLYLEA-ENLESWEVDGGDQFRCLTRL  192
            VLK+++ +         D  +W  TEG F  L+FL LE  +NL  W+ D     R L  L
Sbjct  615  VLKIRKCTFKGQEMQPRDDEEWVLTEGEFCSLQFLLLEKLKNLVHWQADETHLPR-LRHL  673

Query  191  VLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            +++ C+ LE IP+G  ++ TL  IEL  C   V  SA+++ E + +YG + + +R
Sbjct  674  LIRGCSALEEIPSGIGEIPTLEIIELDECSPSVVASAKQIQEDQREYGNDGLEVR  728



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRK---GSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
              NL  L +LE L I   K     P   ++L++LP NL    L    T LPW  +  +  
Sbjct  786  FRNLALLPQLEALKIFGLKPPVQEPKLARHLDALPENLKKLTLSF--TYLPWESMTSLCR  843

Query  356  LPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            LPNLEVLKLK  +  GP WE  E  F  LK L +E  +LE W     D F CL  LVLK 
Sbjct  844  LPNLEVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSA-SNDHFPCLEHLVLKG  902

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            C  L+ IP     + TL  IEL N       SA+++ E ++  G + + +R
Sbjct  903  CLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVR  953



>emb|CDP19132.1| unnamed protein product [Coffea canephora]
Length=1249

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW E++ I  LPNLEVLKL  +  +G  W   +  F KLKFL L+   L  W     D 
Sbjct  1123  LPWDEMSTILKLPNLEVLKLLHRAFEGEQWNMGDAEFLKLKFLKLDTLKLVQWNA-SSDN  1181

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
             F CL +LVL+KC +LE IP+ F D+ TL  IE+  C +   +SA  +     D  +
Sbjct  1182  FPCLEQLVLQKCKQLEEIPSSFGDIATLEKIEVQWCSISASKSATDIEAEEPDIKV  1237



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 93/182 (51%), Gaps = 11/182 (6%)
 Frame = -3

Query  584   KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
             KL I+  S+ S  A+    L++L  L  LETL I  +   P  +    SLP    +    
Sbjct  1139  KLKILDISEHSDWAV---ILDSLSILQDLETLHI--QNIDPMIISEDISLPNLKELNLS-  1192

Query  404   lKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGN-FRKLKFLYLEA-ENLESWE  231
                TC+PW  +N++  LPNLE L      DG DW+  E   F KLK+L L    +LE WE
Sbjct  1193  --NTCIPWEVVNLLANLPNLEKLYGHAAFDGTDWKVDEDVVFHKLKYLRLYTCRDLERWE  1250

Query  230   VDGG-DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             +  G D F  L  L+L +  KLE IP    +V TL  I ++NC   VK SA+K+ E +E 
Sbjct  1251  LAAGSDNFPMLENLILFELPKLEEIPESIGEVMTLKFIRIVNCGSGVKTSAKKIQEEQES  1310

Query  53    YG  48
              G
Sbjct  1311  LG  1312


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KL I+  S+ S  A+    L++L  L  LETL I  +   P  +    SLP    +    
Sbjct  666  KLKILDISEHSDWAV---ILDSLSILQDLETLHI--QNIDPMIISEDISLPNLKELNLS-  719

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEG-NFRKLKFLYLEA-ENLESWE  231
               TC+PW  +N++  LPNLE L      DG DW+  E   F KLK+L L    +LE WE
Sbjct  720  --NTCIPWEVVNLLANLPNLEKLYGHAAFDGTDWKVDEDVVFHKLKYLRLYTCRDLERWE  777

Query  230  VDGG-DQFRCLTRLVLKKCTKLEGIP  156
            +  G D F  L  L+L +  KLE IP
Sbjct  778  LAAGSDNFPMLENLILFELPKLEEIP  803



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 96/172 (56%), Gaps = 5/172 (3%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL-ESLPlnlnikklklKRTCLPWSE  375
            P+      L+NLG L KLE+L       +   L +L ++  L  ++KKL L  T L W +
Sbjct  606  PQEFLSYCLDNLGHLHKLESLRFILYPRNKASLNDLVQNFILPNSLKKLTLMGTKLKWED  665

Query  374  INV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLE-AENLESWEVDGGDQFRC  204
            +N  IG+LPNL+VLKLK+ S  G +WE  EG F  LKFL +     LE W  D    F  
Sbjct  666  MNTKIGLLPNLQVLKLKEYSFVGTEWETVEGQFCNLKFLLIHMCSELEWWTTDSS-HFPR  724

Query  203  LTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            L  L L+   KL+ IP+   +++TL SI+LL C      SA+++ + +ED+G
Sbjct  725  LEHLQLQFLDKLKEIPSCIGEISTLQSIQLLRCSNEAVISAKEILKEQEDFG  776



>ref|XP_009784309.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=330

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVS-DGPDWE-PTEGNFRKLKFLYLEAENLESWEVDGGD  216
             PW++I+ + MLPNLE LKLK  +  G  W    E  F  LK L      LE WE    D
Sbjct  201  FPWADISTLVMLPNLEELKLKDYAVKGEVWRLRDEDKFESLKLLVFSGLYLERWEA-SSD  259

Query  215  QFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F  L RLVLKKC  L+ IP  F ++ TL SIEL NC +  ++SA  + + + D G
Sbjct  260  SFPNLKRLVLKKCFLLKEIPIDFGEICTLESIELHNCSIAAEDSATIIEQEQADMG  315



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQIQ  9
             ++ + +ED G +P+ +R  + ++
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDLE  952



>emb|CDP04724.1| unnamed protein product [Coffea canephora]
Length=613

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            + W  ++VIGMLPNLE+LK+K    +GP WE  +  F  LKFL L   +L+ W +     
Sbjct  485  IDWKGMSVIGMLPNLEILKIKDNFFNGPKWETGDEGFCHLKFLKLSHTDLQQW-IASSSS  543

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            F CL +LVL  C  LE IP+  E++ TL  IE+ +    V +SA++L E
Sbjct  544  FPCLEQLVLNGCLDLEEIPSSLEEIYTLEIIEVYHSCQSVADSARRLQE  592



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 98/188 (52%), Gaps = 12/188 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnl------  423
            KLGI+C  K  P   +P  ++NL  L +LE L IA  +G     + +E   L        
Sbjct  679  KLGILCTRKEYPR--DPKWIDNLQYLPELEELSIA-TQGYLFEREEVECFSLTSPDALPL  735

Query  422  nikklklKRTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEG-NFRKLKFLYLEAE  249
            N+KKLKL +T L W  + VIG LP LEVL+LK     G +W+ T+   F +LKFL L+  
Sbjct  736  NLKKLKLSKTYLQWKYMAVIGKLPKLEVLQLKDHAFVGNEWKATDQVRFHELKFLLLDCL  795

Query  248  NLESWEV-DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
             L +W   D  D F  L R+++K C  L+ IP GF     L  IEL  C   V   AQK+
Sbjct  796  YLRNWRTTDSNDHFSSLERVIIKGCNFLKEIPEGFAGSKNLELIELHKCTPSVVAIAQKI  855

Query  71   NEHREDYG  48
             E  E YG
Sbjct  856  QEKHEYYG  863



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009618258.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618266.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618270.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana tomentosiformis]
Length=1741

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 85/157 (54%), Gaps = 7/157 (4%)
 Frame = -3

Query  518   LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
             L SL  LE+L +      P  L ++ S P  L    L   R  LPW +I+ IG LPNLE+
Sbjct  1564  LESLSHLESLKL-ISNSYPAKLPHVFSFPSRLRELTLSKFR--LPWGQISTIGELPNLEI  1620

Query  338   LKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
             LKL  +  +G  WE  +  F +LK+L L+  N+  W V   D F  L  LVL KC +LE 
Sbjct  1621  LKLHLRAFEGNHWEVKDSEFPELKYLELDDINIAQWSV-SDDAFPKLKCLVLIKCKRLEK  1679

Query  161   IPTGFEDVNTLASIELLNCPVPVKESAQKL--NEHRE  57
             IP+ F+D  +L SIE+  C   V  SAQ++   +H E
Sbjct  1680  IPSHFDDSVSLRSIEVNWCNWFVANSAQEIQTTQHEE  1716



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLEVLK L +  +G  WE  EG F  LKFL L++ NL  W     D 
Sbjct  1291  LPWSYISEIGKLPNLEVLKLLSKAFEGEVWEMKEGEFLNLKFLKLDSLNLAEWNA-SSDH  1349

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
                L  L+L+ C +L+ +P+GF ++ TL  IE+  C   V +S ++L     D G E
Sbjct  1350  LPQLQHLILRSCRQLKEVPSGFGEICTLEMIEVQLCTRSVGKSVRRLQTESLDMGNE  1406



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 86/160 (54%), Gaps = 4/160 (3%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            +L+NL  L KLE L   F    P     L +L    ++KKL L  + L W  +++IG LP
Sbjct  712  DLKNLVRLSKLENLKCVF--NWPPNETLLPNLSFPQSLKKLTLDGSNLSWKGMSIIGSLP  769

Query  350  NLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            +LEVLKLKQ +  G  W+P E  F +LKFL +E   L  W +     F CL  L++  C 
Sbjct  770  HLEVLKLKQYAFTGAVWKPVEREFSRLKFLLIEKMRLVRW-IAENTHFPCLEHLIISACH  828

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             L+ IP+G  D+ TL  I++ +C      S +++ E + D
Sbjct  829  DLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQILEEQRD  868



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 101/199 (51%), Gaps = 12/199 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETL-MIAFRKGSPTGLQNLE---SLPlnlni  417
            KLGI  G+K     IEP  LENL  L +LE L ++++RK        L    S P NL  
Sbjct  734  KLGIY-GTKDDFN-IEPRCLENLMDLFELEALTIVSYRKFKADTFLRLPCPGSFPPNLKK  791

Query  416  kklklKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPD--WEPTEGNFRKLKFLYLEAENL  243
              L    T L W ++ ++ MLP L+VL+L+  +  P+  WE TE  F KLKFL LE  N+
Sbjct  792  LTLCC--TFLLWKDMTIVSMLPKLKVLQLRNNAFVPNIVWEVTEMQFPKLKFLLLEQLNI  849

Query  242  ESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN-E  66
              W     D F CL R++++ C  L+ IP  F D  TL  IEL  C   +  SA+ +  E
Sbjct  850  RYWRA-TDDCFPCLERIIIRNCRFLKEIPQEFADSMTLQLIELHQCSPSLVNSAELIQKE  908

Query  65   HREDYGIEPIIIRHVDQIQ  9
              E  G   + +   D I+
Sbjct  909  QLESLGNNMLKVYAFDTIK  927



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANL-ENLGSLDKLETL--------------MIAFRKGSPTGLQNLES  438
            I G K   +  + + L +NL  L +LETL               I+  K  P  L+ L  
Sbjct  762  IFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATLKKLTL  821

Query  437  LPlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLY  261
            L            RT L W ++N+IG LPNLE LKL +    G  W P+ G F +LK L 
Sbjct  822  L------------RTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWCPSPGGFTRLKLLQ  869

Query  260  LEAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESA  81
            +    ++ W+    D F  L RL ++ C  LE IP  F ++ +L  + L +C   +K SA
Sbjct  870  IHHHKIKYWKA-TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASA  928

Query  80   QKLNEHREDYGIEPIIIRHVDQI  12
             ++ + +ED G +P+ +R  + +
Sbjct  929  ARIQQEQEDLGNKPVDVRFYNDL  951



>gb|EYU34208.1| hypothetical protein MIMGU_mgv1a026654mg [Erythranthe guttata]
Length=849

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPW  ++ IG +PNLE+L+LK  S  G  WE  EG F KL+FL +    L+ W V+  + 
Sbjct  725  LPWEMMSAIGGMPNLEILRLKCGSFVGKKWETKEGEFEKLRFLMMYKLELDEWNVESSEH  784

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLN-CPVPVKESAQKLNEHREDYGIEPI  36
            F  L RLVL +C  LE +P    D+ TL  IE+   C   + ESA ++ E + D G E +
Sbjct  785  FPKLQRLVLYECYNLEVVPNEIGDIGTLQFIEIRGWCLKTLVESAVRIEEEQRDMGNEDL  844



>gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial [Erythranthe 
guttata]
Length=834

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 9/170 (5%)
 Frame = -3

Query  566  GSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCL  387
            G     + I P    NL  L KLE+L++ F  G    +   +SL      +        +
Sbjct  670  GVHYRTDEIGPFCWTNLAGLRKLESLVLEFSAGISDNIAFPDSLKKLALSECK------V  723

Query  386  PWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQF  210
            PW +++++G LPNLEVLKLK   + G  W P EG F +LKFL ++   LE WE D    F
Sbjct  724  PWEDMSIVGSLPNLEVLKLKSGAAKGEKWNPIEGQFGRLKFLLIDQCELEIWEADNT-HF  782

Query  209  RCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHR  60
             CL  LVL   + L+ IP  F ++  L  I L      +  SA++++E R
Sbjct  783  PCLEHLVLGDVS-LKEIPIDFAEILNLRVIVLPRVKSSLWTSAEEISEER  831



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 94/175 (54%), Gaps = 6/175 (3%)
 Frame = -3

Query  530  NLENLGSLDKLETLMI-AFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGML  354
             L +L  L +LE L I   RK  P  L +   LP +L    L+   T LPW ++  I  L
Sbjct  713  TLNSLYCLTELEILKIKCSRKLYPHPLPSKYVLPNSLMRLTLRC--TYLPWEDMANIVTL  770

Query  353  PNLEVLKLKQVS-DGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            PNL+VLK+K    DG  W  + E  F +LKFL ++  NL+ W+  G   F  L  LVLK+
Sbjct  771  PNLQVLKIKDNGFDGDAWRLSDEEIFNQLKFLLIDRTNLKRWKA-GSVNFPKLQHLVLKR  829

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIRHVDQ  15
            C  LE IP    ++ TL SIELLNC     +S +++ E +E  G + + +R  D+
Sbjct  830  CIYLEEIPKDIGEIYTLESIELLNCRTSAAKSVKEIQEEQESMGNDCLSVRIHDK  884



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW  I+ IG LPNLEVLK L +  +G  WE   G F KLKFL L++ N+  W     D 
Sbjct  1357  LPWDSISEIGRLPNLEVLKLLSRAFEGKVWEMKGGEFLKLKFLKLDSLNVAQWNA-SSDH  1415

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE-PI  36
                L  L+L+ C +L+ +P+GF +  TL  IE+  C   V+ES + L + +   G E  +
Sbjct  1416  LPQLQHLILRSCRQLKEVPSGFAESCTLEMIEVQLCTHTVEESVKSLQDGQLGMGYELKV  1475

Query  35    IIRHVD  18
             +I H D
Sbjct  1476  LIDHSD  1481



>ref|XP_009594808.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=262

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 84/160 (53%), Gaps = 5/160 (3%)
 Frame = -3

Query  518  LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
            L SL +LETL + F      G   L + P+NL    L   +  LP + I+ I  L NLEV
Sbjct  100  LDSLSQLETLKVVFISKPEIGPSRL-NFPMNLKKLTLC--KFPLPPARISTIASLLNLEV  156

Query  338  LKLKQVSDGPD-WEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
            LKL+QV+   D WE  +  F +LKFL LE   L  WEV   + F CL +LVL  C+ LE 
Sbjct  157  LKLQQVAFEMDEWEVRDNEFPQLKFLELENLKLSKWEV-SEEAFCCLEKLVLHGCSHLEA  215

Query  161  IPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
            IP  FED   L  IE+ +C   V +S   + E R   G +
Sbjct  216  IPDCFEDQGYLQYIEVKSCSKVVADSVGDIKEKRVQNGYK  255



>gb|EYU23519.1| hypothetical protein MIMGU_mgv1a022028mg [Erythranthe guttata]
Length=872

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = -3

Query  530  NLENLGS-LDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGML  354
            +L N+G  L KLE+L   F  G    LQ L + P +L    L+  +    W ++ VIG+L
Sbjct  686  SLYNIGKYLHKLESLT-CFSYGLDNVLQKL-TFPSSLKKLHLQGYKA--DWKDLRVIGLL  741

Query  353  PNLEVLKLKQVSDGPD-WEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            PNLEVLKLK +S G   W P EG F +LKFL++ + +L +W  D    F  L +L L   
Sbjct  742  PNLEVLKLKYLSAGERVWNPVEGGFIRLKFLFIRSIDLVNWNADSS-HFPVLEKLFLIGM  800

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             +LE IP    ++ TL  I+L+ C      SA K+ E +E+ G
Sbjct  801  FELEEIPLDIGEIPTLGLIQLVWCSESAAISAMKIAEEQENAG  843



>emb|CDP08021.1| unnamed protein product [Coffea canephora]
Length=854

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 82/148 (55%), Gaps = 8/148 (5%)
 Frame = -3

Query  518  LGSLDKLETLMIAFRKGSPTGLQNLE-SLPlnlnikklklKRTCLPWSEINVIGMLPNLE  342
            L  L  LE+L I F  G+P  L N E +LPL+L    L   R CLPWS I+ IG LPNLE
Sbjct  692  LKFLSHLESLKI-FYYGNP--LHNGEFNLPLSLKELTLS--RFCLPWSHISAIGTLPNLE  746

Query  341  VLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLE  165
            VLK L     G  W+  E  F+KLKFL L+  ++  W     D    L RLVL+ C  LE
Sbjct  747  VLKLLSGTFVGRTWDMMEDEFQKLKFLSLDTLDIAEWNA-SYDHLPKLERLVLRNCKGLE  805

Query  164  GIPTGFEDVNTLASIELLNCPVPVKESA  81
             IP    ++ +L +IE+  C   V+ESA
Sbjct  806  KIPEDLSNIASLETIEVHWCGQSVEESA  833



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 82/167 (49%), Gaps = 10/167 (6%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKG------SPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
             E L  L +LETL  AF          P  L +  S P  L    L    T LPW ++  
Sbjct  729  FEQLVHLQELETLKYAFSNPFVSSALKPDRLPSWRSFPPKLVKLTLSG--TSLPWEDMVE  786

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
            + MLP LEVLKL+  +  G  W+  EG F +LKFL + + NLE W+ DG   F  L +LV
Sbjct  787  LSMLPKLEVLKLRNYAFSGSVWKSREGGFPRLKFLLIGSTNLEIWDADGT-HFPNLQQLV  845

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            L+ C  L+ IP G  +   L  IEL  C      SA+ L E ++  G
Sbjct  846  LRHCKFLKEIPYGISEAPLLEKIELHCCKDSAVISARHLQEEQQSLG  892



>emb|CDP05538.1| unnamed protein product [Coffea canephora]
Length=1220

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 75/127 (59%), Gaps = 5/127 (4%)
 Frame = -3

Query  398   RTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
             R  +PWS I+VIG LPNLE+LKL++ S  GP W+  +G F+KLKFL L   N++ W V  
Sbjct  1095  RFSVPWSAISVIGQLPNLEILKLRRNSFSGPRWDVEDGEFQKLKFLELWQLNIQEWNV-S  1153

Query  221   GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG--  48
              + F  L +L ++ C  L+ IP+   D+ TL  +E+  C      SA+ + E + D G  
Sbjct  1154  SEPFPRLEQLTIRDCYSLQEIPSSIGDIPTLEKLEVHWC-FDAASSAKHILEEQRDMGND  1212

Query  47    IEPIIIR  27
             +  +IIR
Sbjct  1213  LLEVIIR  1219



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 4/162 (2%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            +L++L  L +LE L   ++      L    SLP +L    L    T  P  ++  I MLP
Sbjct  683  HLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPTSLKRLTLT--NTLFPLEDMTNIVMLP  740

Query  350  NLEVLKLKQVSDGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            NLEVLK+K V +  +W    E  F +LKFL +    L  WE  G   F  L RLVL+ C 
Sbjct  741  NLEVLKIKDVFENDEWRLNDEEIFSQLKFLLISVTFLRHWEA-GSVNFPKLQRLVLRSCI  799

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             LE IP  F ++ +L SIEL +C +   +S ++L E ++  G
Sbjct  800  GLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQEEQKSMG  841



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 4/162 (2%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            +L++L  L +LE L   ++      L    SLP +L    L    T  P  ++  I MLP
Sbjct  683  HLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPTSLKRLTLT--NTLFPLEDMTNIVMLP  740

Query  350  NLEVLKLKQVSDGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            NLEVLK+K V +  +W    E  F +LKFL +    L  WE  G   F  L RLVL+ C 
Sbjct  741  NLEVLKIKDVFENDEWRLNDEEIFSQLKFLLISVTFLRHWEA-GSVNFPKLQRLVLRSCI  799

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             LE IP  F ++ +L SIEL +C +   +S ++L E ++  G
Sbjct  800  GLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQEEQKSMG  841



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETL-MIAFRKGSPTGLQNLE---SLPlnlni  417
            KLGI  G+K    + EP  LENL  L +LE L ++++RK +     +L    S P NL  
Sbjct  736  KLGIY-GTKDDFNS-EPRCLENLMDLHELEALTIVSYRKFNSNTFLSLPCPGSFPPNLKK  793

Query  416  kklklKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPD--WEPTEGNFRKLKFLYLEAENL  243
              L    T L W ++ ++ MLP LEVL+L+  +  P+  W+ TE  F KLKFL LE  N+
Sbjct  794  LTLCC--TFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKVTEMQFPKLKFLLLEQLNI  851

Query  242  ESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN-E  66
            + W     D F CL R++++ C  L  IP  F D  TL  IEL  C   +  SA+ +  E
Sbjct  852  KYWRA-TDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQKE  910

Query  65   HREDYGIEPIIIRHVDQIQ  9
              E  G   + +   D I+
Sbjct  911  QLESLGNNMLKVYAFDTIK  929



>gb|EYU24175.1| hypothetical protein MIMGU_mgv1a026011mg [Erythranthe guttata]
Length=860

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 99/196 (51%), Gaps = 30/196 (15%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGS--------PTGLQNLESLPl  429
            KL I+CG+      I    L NLG L KLE L +    G+        P+ L+ L     
Sbjct  639  KLEIVCGT------IGSNCLRNLGLLHKLEQLNLELITGTSCCGEIVFPSSLKEL-----  687

Query  428  nlnikklklKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEA  252
                    L    +PW +++V+G LPNL+VL+L K  + G  W P EG F +LKFL++  
Sbjct  688  -------ILSECKIPWEDMSVVGSLPNLQVLELHKNAAIGKKWIPKEGEFIRLKFLWINM  740

Query  251  ENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELL-NCPVPVKESAQK  75
              LE WE D    F CL +L L     L+ IP  F+++  L +I L  N    ++ SA +
Sbjct  741  CELEIWEAD-NTHFPCLVKLNLGYLN-LKEIPLDFDEILPLRAINLYHNSSNDLRASANE  798

Query  74   LNEHREDYGIEPIIIR  27
            ++E RE+ G + + ++
Sbjct  799  ISERRENLGYDALYVQ  814



>ref|XP_011071868.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=859

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 94/199 (47%), Gaps = 29/199 (15%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGS-------PTGLQNLESLPln  426
            KLGI+   K S        LENL  L KLE+L +     S       PT L+ L      
Sbjct  674  KLGIVHLKKGS------GGLENLARLQKLESLYLLEENVSLLANISFPTSLKKLS-----  722

Query  425  lnikklklKRTCLPWSEINVIG-MLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEA  252
                   L   C+PW ++ V G +LPNLE L L      GP+W P EG F +LK L +  
Sbjct  723  -------LSNCCIPWEKMTVFGSILPNLEKLTLNCNAFKGPEWSPVEGQFPQLKVLRIWE  775

Query  251  ENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
             +L  W  D    F  L RL L     LE IP G  D+ TL SI LL C      SA+++
Sbjct  776  SDLVKWRADSI-HFPNLERLHLYNMFCLEEIPWGIGDIPTLLSIHLLKCSDSCVNSAKQI  834

Query  71   NEHREDYGIEPIIIRHVDQ  15
             E ++ +G E + + +VD+
Sbjct  835  LEEQQSFGNETLQL-YVDK  852



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETL-MIAFRKGSPTGLQNLE---SLPlnlni  417
            KLGI  G+K    + EP  LENL  L +LE L ++++RK +     +L    S P NL  
Sbjct  644  KLGIY-GTKDDFNS-EPRCLENLMDLHELEALTIVSYRKFNSNTFLSLPCPGSFPPNLKK  701

Query  416  kklklKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPD--WEPTEGNFRKLKFLYLEAENL  243
              L    T L W ++ ++ MLP LEVL+L+  +  P+  W+ TE  F KLKFL LE  N+
Sbjct  702  LTLCC--TFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKVTEMQFPKLKFLLLEQLNI  759

Query  242  ESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN-E  66
            + W     D F CL R++++ C  L  IP  F D  TL  IEL  C   +  SA+ +  E
Sbjct  760  KYWRA-TDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQKE  818

Query  65   HREDYGIEPIIIRHVDQIQ  9
              E  G   + +   D I+
Sbjct  819  QLESLGNNMLKVYAFDTIK  837



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 85/170 (50%), Gaps = 12/170 (7%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPT------GLQNLESLPlnlnikklklKRTCLPWSEINV  366
            ++NL  L  LE+L I  +  S         L + +S P  L   KL   RTCLPW  +++
Sbjct  696  IDNLKHLQDLESLSIEIQYWSTINGTRFFSLTSSDSFPQKLKKLKLS--RTCLPWEYMSI  753

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEG-NFRKLKFLYLEAENLESWEVDGG--DQFRCLT  198
            I  LP LEVLKLK  +  G +W+ T+     KL+FL L   NLE W    G  D F  L 
Sbjct  754  ISKLPELEVLKLKYDALVGDEWKATDQIGLPKLRFLLLANLNLEKWRTTAGSHDHFPGLE  813

Query  197  RLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             +++  C  L+ IP GF D   L  IEL  C   +   A+K+ E  ED G
Sbjct  814  CVIITNCKFLKEIPQGFADSKKLELIELHKCDPSLVAFAEKIQEKHEDLG  863



>emb|CDP08396.1| unnamed protein product [Coffea canephora]
Length=649

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 85/164 (52%), Gaps = 11/164 (7%)
 Frame = -3

Query  518  LGSLDKLETLMIAFRKGSPTGL-QNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLE  342
            L SL +LE+L +    G    +  NL+ L          L R   PWSEI+ IG LPNLE
Sbjct  485  LDSLSRLESLQLHRFYGCKFEVPMNLKKL---------TLSRNKWPWSEISTIGKLPNLE  535

Query  341  VLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLE  165
            VLKL++ S  G  WE  EG F KL+FL L   NL +W     D F  L +LVL  C +LE
Sbjct  536  VLKLEKKSFMGEKWEMQEGEFSKLRFLELSRLNLCNWTAYNSDNFSHLEKLVLYSCLRLE  595

Query  164  GIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
             +P    + +T+  IE+  C   +    +++ + + + G + +I
Sbjct  596  EVPLCLGESSTIEMIEVEFCRKSLVSYVEQIQQEQMEMGNQDLI  639



>ref|XP_011072142.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=872

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM-L  354
            +L NL  LDKLE+L +A+         +LE++    ++KKL L    +PW ++ +IG  L
Sbjct  704  SLYNLARLDKLESLYVAY-------YSHLENIAFPTSLKKLDLSFCSIPWHKMTIIGSSL  756

Query  353  PNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCT  174
            PNLEV KL   + G +W P EG F +LK L +    L  W  +    F  L  L L+K  
Sbjct  757  PNLEVFKLHDATTGQEWNPIEGEFLRLKTLSIWDCYLVRWGAEDV-HFPNLQSLSLEKIR  815

Query  173  KLEGIPTGFEDVNTLASIELLNCPVPVKESAQK-LNEHRED  54
            KL+ IP    D+NTL SI L  C   V  SA + LN  RE+
Sbjct  816  KLKEIPLSIGDINTLQSIHLDKCSESVINSAMEILNVQREN  856



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 84/178 (47%), Gaps = 20/178 (11%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL---ESLPlnlnik  414
            KLGI C  K         ++ +L  L KL +L         T   NL   +SL       
Sbjct  651  KLGIFCDEKVD-------HVRDLSRLHKLHSLKCTSVYDGRTHFSNLIFPDSLKKLTL--  701

Query  413  klklKRTC-LPWSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLE  240
                 R C +   ++N IG LPNLE+LKL+        WEP EG F +L+FL +E  NL 
Sbjct  702  -----RDCGIRDPDMNRIGKLPNLEILKLQGCQFVSRKWEPDEGEFHRLRFLLMENLNLV  756

Query  239  SWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            +W  D    FR L  L ++ C+ LE IP    D+ TL  IE+ NC   V  SA+ + E
Sbjct  757  NWVADES-HFRRLQHLFIQHCSDLEAIPLVIRDIPTLQVIEVHNCRPSVMNSARMIQE  813



>emb|CDP11161.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPWS I+ IG LPNLEVLKL      G  W+  E  F++LKFL L+  N+  W     D 
Sbjct  746  LPWSHISTIGRLPNLEVLKLLLDAFKGLIWDMEEEQFKELKFLKLDNLNVCQWNA-TCDH  804

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
               L RLVL+ C  LE IP  F D+ TL  IE+  C   V+ESAQ++ E   D
Sbjct  805  LPKLERLVLQNCKGLEEIPYDFADIGTLEVIEVHWCRQSVEESAQRIAEATGD  857



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -3

Query  398  RTC-LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
            R C LPW ++ ++  LP LEVLKLK  +  G +WE T+  F++LKFL L+  +L  W+  
Sbjct  736  RGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKA-  794

Query  224  GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
               QF  L  LVLK C  L  IP    ++ TL  IEL +C     +SA ++ E +   G 
Sbjct  795  SSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQISMGN  854

Query  44   EPIIIR  27
            + +++R
Sbjct  855  DDLVVR  860



>emb|CDP16512.1| unnamed protein product [Coffea canephora]
Length=907

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 70/117 (60%), Gaps = 2/117 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPW+ I+ IG LPNLEVLK L +  +G  WE  EG F KLKFL L+  ++  W+    D 
Sbjct  766  LPWNCISEIGRLPNLEVLKLLSKAFEGKVWEMKEGEFLKLKFLKLDTLSIAEWK-SSSDH  824

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
               L  L+L+ C +L+ +P+GF D ++L  IE+  C   V+ES + L + + + G E
Sbjct  825  LPQLQHLILRNCRQLKEVPSGFGDSSSLEMIEVQLCTRSVEESVRLLQKEQHEMGNE  881



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -3

Query  398  RTC-LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
            R C LPW ++ ++  LP LEVLKLK  +  G +WE T+  F++LKFL L+  +L  W+  
Sbjct  736  RGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKA-  794

Query  224  GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
               QF  L  LVLK C  L  IP    ++ TL  IEL +C     +SA ++ E +   G 
Sbjct  795  SSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQISMGN  854

Query  44   EPIIIR  27
            + +++R
Sbjct  855  DDLVVR  860



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            L W E++ IG LPNLEVLK+K    +G  WE ++  F  LKFL L   NL+ W +     
Sbjct  747  LDWKEMSTIGRLPNLEVLKVKNNFFNGQQWETSDEGFHHLKFLKLSHTNLQRW-IASSSS  805

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            F CL  LVL +C  LE IP    D+ TL  IE+ +  +   +S  ++ E ++  G
Sbjct  806  FPCLGHLVLHRCLVLEEIPPSIGDIQTLQMIEVSHSSLAAADSVWQIQESQKSMG  860



>ref|XP_011072134.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=938

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 90/187 (48%), Gaps = 21/187 (11%)
 Frame = -3

Query  548  EAIEPANLENLGSLDKLETLMIAFRK------GSPTGLQNLESLPlnlnikklklKRTCL  387
              I P +L+ L   +KLE+  + +        G PT L+ L             L R   
Sbjct  737  HVIWPLSLDKLALFNKLESFSLRYNYCRLEDIGFPTSLKKLS------------LSRCIF  784

Query  386  PWSEINVIGM-LPNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQF  210
            PW ++ +IG  LPNLEVLKL     GP+W P EG F  LK L +   NLE W  +    F
Sbjct  785  PWEKMTIIGSSLPNLEVLKLDDAFKGPEWSPIEGGFLGLKVLSITNHNLEQWGAEDI-HF  843

Query  209  RCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIII  30
              L  L L++  +L+ IP    D+ TL SI L  C    K SA ++ + +++ G E + +
Sbjct  844  PNLHGLYLEEMYELKEIPLSIGDIYTLQSIHLDRCSEFAKNSAVEIVKDQKEKGNESLKV  903

Query  29   RHVDQIQ  9
             +VD  Q
Sbjct  904  -YVDGKQ  909



>emb|CDP11642.1| unnamed protein product [Coffea canephora]
Length=1450

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 96/195 (49%), Gaps = 27/195 (14%)
 Frame = -3

Query  575   IICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGS--------PTGLQNLESLPlnln  420
             I   S+ S +  +   LE L    +LE+L I +R  +        P GL+ L  +     
Sbjct  1272  IFSKSRGSRDYYQFPRLEKLT---QLESLKIVYRGRTIKTSPFNFPLGLKKLTLINFF--  1326

Query  419   ikklklKRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENL  243
                       L W  I+ IG L NLE+LKL     +   WE  EG F KLK+L L++ N+
Sbjct  1327  ----------LRWDHISTIGSLENLEILKLLSSTFEDTRWEMKEGEFHKLKYLKLDSPNI  1376

Query  242   ESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEH  63
              +W V   D    L +LVL+KC  L+ +P  F  + TL  IE+  C   V+E+ ++L + 
Sbjct  1377  VNW-VASCDDLPNLQQLVLQKCENLKEVPIDFVRIPTLQLIEVQRCGDSVEEAIRRLQQE  1435

Query  62    REDYGIE--PIIIRH  24
             + +YGIE   ++I H
Sbjct  1436  QFEYGIEDLKVLINH  1450



>ref|XP_011084823.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=557

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 93/177 (53%), Gaps = 18/177 (10%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRT----CLPWSEINVIG  360
            L NL  L  LETL + FR   P GL+ +   P N  +     K T     LPW ++ VI 
Sbjct  385  LSNLVHLCLLETLSLMFR---PVGLE-VNPFPANFALPSTLQKLTLTDCALPWQDMAVIH  440

Query  359  MLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLK  183
             LPNLEVLKL+     G  WE +EG F +LKFL +E  NL+ W+V+    F  L RL++K
Sbjct  441  SLPNLEVLKLRDDAFMGEKWECSEGEFPRLKFLLMELLNLKCWQVESS-HFPRLERLIIK  499

Query  182  KCTKLEGIPTGFEDVNTLASIELLNCPV-----PVKESAQKLNEHREDYGIEPIIIR  27
            +C +L+ IP    D+ TL   EL+  P+        +SA  + E +   G + + +R
Sbjct  500  RCWRLDEIPCEIGDIPTL---ELIEVPIGLGRKSAADSAVLIQEEQRSLGNDLLQVR  553



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -3

Query  398  RTC-LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
            R C LPW ++ ++  LP LEVLKLK  +  G +WE T+  F++LKFL L+  +L  W+  
Sbjct  736  RGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKA-  794

Query  224  GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
               QF  L  LVLK C  L  IP    ++ TL  IEL +C     +SA ++ E +   G 
Sbjct  795  SSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQISMGN  854

Query  44   EPIIIR  27
            + +++R
Sbjct  855  DDLVVR  860



>emb|CDP08032.1| unnamed protein product [Coffea canephora]
Length=419

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W +++++G L  LEVLKLK  +  G DW+  EG FR LK L++ A +L+ WE    
Sbjct  282  TSLGWDQMSILGKLQYLEVLKLKDYAFTGDDWQTEEGGFRSLKVLFIGATDLKCWEAQAT  341

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
            D F  L RL+L++C +L+ IP  F D+  L  I L +    V  SA+++ + + D
Sbjct  342  D-FPELRRLILRQCKQLQRIPPDFVDMKKLEDIHLEHTTGSVISSARRIRQLQID  395



>gb|EYU29923.1| hypothetical protein MIMGU_mgv1a026346mg, partial [Erythranthe 
guttata]
Length=303

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 91/184 (49%), Gaps = 18/184 (10%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAF---------------RKGSPTGLQNLESLPlnlnikklklKR  396
            +L N+G L KLE+L + F                   P G   L++L    ++KKL L  
Sbjct  120  HLYNIGRLHKLESLRVYFCGDFSVFQILKYIVCSPLRPRG-NLLKNLKFPTSLKKLTLSG  178

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            + L W E+  IG LPNLEVLKL+  S  G  W P EG F +LK+L +    L+ W  +  
Sbjct  179  SNLDWEELKGIGSLPNLEVLKLEYHSVRGSKWNPIEGQFLRLKYLRIAHSTLKYWNAESF  238

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
              F  L  LVL+K  KL  IP+G  ++ TL  I L +C      SA  + E ++  G E 
Sbjct  239  -HFPALENLVLQKLHKLAEIPSGIGEIPTLGLIHLYDCSKSAAISAMGILEEQQSQGNED  297

Query  38   IIIR  27
            + +R
Sbjct  298  LRVR  301



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 65/124 (52%), Gaps = 2/124 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T LPW  +  +  LPNLEVLKLK  +  GP WE  E  F  LK L +E  +++ W     
Sbjct  790  TYLPWESMASLCRLPNLEVLKLKNYAFTGPKWEQVEEGFGSLKLLLIEISDIKHWSA-SN  848

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
            D F  L  LVLK C  L+ IP    D+ TL  IEL N       SA+++ E ++  G E 
Sbjct  849  DHFPVLEHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQSMGNET  908

Query  38   IIIR  27
            + +R
Sbjct  909  LEVR  912



>emb|CDP21300.1| unnamed protein product [Coffea canephora]
Length=1433

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 69/124 (56%), Gaps = 4/124 (3%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLEVLKL     +G  WE  E  F++LKFL L+  N+  W     D 
Sbjct  1312  LPWSHISTIGRLPNLEVLKLLLGAFEGLIWEMEEEQFKELKFLKLDDLNICQWNA-TCDH  1370

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
                L RLVL+ C  LE +P  F D+ TL  IE+  C    +ESA+ + E   D  IE II
Sbjct  1371  LPKLERLVLQNCKDLEEVPNDFADIGTLKVIEVHWCGQSAEESAKGIREAVGD--IEVII  1428

Query  32    IRHV  21
               H+
Sbjct  1429  SSHL  1432



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 12/134 (9%)
 Frame = -3

Query  398  RTC-LPWSEINVIGMLPNLEVLKLK---------QVSDGPDWEPTEGNFRKLKFLYLEAE  249
            R+C + W  I  IG LPNL+VLK++         Q SD  +WEPTEG F  L+FL LE  
Sbjct  723  RSCTITWEFIKSIGSLPNLQVLKMRICDFKTKEMQSSD-EEWEPTEGEFSSLQFLLLEKL  781

Query  248  NLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN  69
             L  W+ D    F  L  LV+++C+ LE IP    D+ TL  IEL  C   V  SA+++ 
Sbjct  782  KLVRWKADKT-HFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVVASARQIQ  840

Query  68   EHREDYGIEPIIIR  27
            E + + G + + +R
Sbjct  841  EDQSENGNDGLEVR  854



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W++++ +GML NLE+LKLK     G  W+P +G FR L+ L++   +L SW     
Sbjct  758  TLLDWNDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNA-SA  816

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
              F  L  L +K C+ LE +P+GF D+++L  +EL         SA+ + E ++   +E
Sbjct  817  RHFPRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKKKQMQVE  875



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            L W +++++G LP LEVLKL      G +WE  E  F  LKFL L+   ++ W     D 
Sbjct  781  LAWRDLSIVGKLPKLEVLKLSGNAFKGKEWEVVEEGFPHLKFLSLDDVYIQYWRA-SSDH  839

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED-YG  48
            F  L RL LK C  L+ IP  F D+ TLA I++  C   V  SA+++ +  +D YG
Sbjct  840  FPYLERLFLKDCYSLDSIPRDFADITTLALIDISKCQQSVGNSAKQIQQDIQDNYG  895



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W++++ +GML NLE+LKLK     G  W+P +G FR L+ L++   +L SW     
Sbjct  758  TLLDWNDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNA-SA  816

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
              F  L  L +K C+ LE +P+GF D+++L  +EL         SA+ + E ++   +E
Sbjct  817  RHFPRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKKKQMQVE  875



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 86/168 (51%), Gaps = 4/168 (2%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKG--SPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
            NLE+L +L +LETL I  +      +   N   L     + +L L    LPW  + ++G+
Sbjct  810  NLESLANLHQLETLKIIIKNDPYRTSKFVNPPKLSFPRKLNRLTLSGCGLPWERMTIVGL  869

Query  356  LPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            LP LEVLKLK+    G +WE  E  F +LK+L LE  +L  W       F  L  L+++ 
Sbjct  870  LPCLEVLKLKKDACRGQEWETVEEQFCRLKYLLLEELDLVQWRTKEA-PFPRLQSLIIRS  928

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
            C +L  IP+   D+ TL  IEL++C       A+++ E +E    E +
Sbjct  929  CFRLREIPSAIGDITTLQMIELVDCHPSAVTWAKQIQEEQESMANEDL  976



>ref|XP_011087330.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087331.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087332.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=837

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 94/182 (52%), Gaps = 10/182 (5%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            +LGIICG   SPE        +L    KLE L  +    S T +  L  L     +KKL 
Sbjct  658  ELGIICGCPSSPE-------RDLTLPHKLEKLKCSSTDLSYTQV-FLSCLIFPSTLKKLT  709

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
            +    +    +N IG LPNLEVLKL++   D   WEP+EG F +L+FL LE  +L +W  
Sbjct  710  VSGCIIMDGHMNKIGELPNLEVLKLRKDHFDSSMWEPSEGGFSRLRFLLLEDLDLVNWIA  769

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C+ LE IP G  ++ TL  IE+         SA K+ E + DYG
Sbjct  770  DYS-HFPRLEHLVIRGCSDLEEIPPGIGEITTLEIIEVQRSSASAVASALKIQEEQADYG  828

Query  47   IE  42
            ++
Sbjct  829  VQ  830



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPT-EGNFRKLKFLYLEAENLESWEVDG  222
            T LPW ++  I MLPNL+ LK+K    DG  W+   E  F +LKFL + A NL+ WE   
Sbjct  754  TSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLNDEEVFNQLKFLLISAINLKHWEASS  813

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             + F  L RLVLK+C  LE IP    ++ TLASIEL  C +   +S  ++ E +E  G
Sbjct  814  VN-FPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQEEQESMG  870



>ref|XP_011072139.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=825

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 85/172 (49%), Gaps = 22/172 (13%)
 Frame = -3

Query  524  ENLGSLDKLETLMIAFRKGS-------PTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
            ENL  L KLE+  +  +  S       PT L+ L             L   C+PW ++ V
Sbjct  654  ENLARLQKLESFYLFEKNVSLLANISFPTSLKKLR------------LSNCCIPWEKMTV  701

Query  365  IG-MLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRL  192
             G +LPNLE LKL +    GP+W P EG F +LK L +   +LE W  +    F  L RL
Sbjct  702  FGSILPNLEKLKLYRNAFKGPEWSPVEGQFPRLKVLIIWYNDLERWRAESL-HFPNLERL  760

Query  191  VLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
             L+    LE IP G  D+ TL SI L +C      SA+++ E ++ +G E +
Sbjct  761  HLEFMQCLEEIPWGIGDIPTLLSIHLEDCSDSSVNSAKQILEEQQSFGNETL  812



>ref|XP_011087329.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=789

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  609  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  661

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  662  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTA  719

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  720  DDI-CFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWG  778

Query  47   IEPIIIR  27
             E + +R
Sbjct  779  NEYLEVR  785



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 99/201 (49%), Gaps = 13/201 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlni----  417
            KLGI CG +       P  L+NL  L +LE L I           +   +P   +     
Sbjct  678  KLGI-CG-RTGHFYDAPKCLDNLIYLPELEVLKILLYDAYGVDFLHKHPVPCVGSFPPNL  735

Query  416  kklklKRTCLPWSEINVIGMLPNLEVLKLKQVSDGPD------WEPTEGNFRKLKFLYLE  255
            KKL L+ T L WS++ +I  LP LEVL+LK +    D      WE ++  F KL+FL +E
Sbjct  736  KKLTLQGTHLLWSQLTIISKLPKLEVLQLKALLFFGDELGETVWEVSDMGFPKLRFLLVE  795

Query  254  AENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQK  75
             + L++W     D F CL R+++K C  L+ IP GF D  TL  IEL  C   +   A++
Sbjct  796  NKGLKNWNA-SDDSFPCLERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVNFAKE  854

Query  74   LNEHREDYGIEPIIIRHVDQI  12
            + E +E  G   + +   D I
Sbjct  855  IQEEQEILGNNILQVYAYDTI  875



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPT-EGNFRKLKFLYLEAENLESWEVDG  222
            T LPW ++  I MLPNL+ LK+K    DG  W+   E  F +LKFL + A NL+ WE   
Sbjct  754  TSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLNDEEVFNQLKFLLISAINLKHWEASS  813

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             + F  L RLVLK+C  LE IP    ++ TLASIEL  C +   +S  ++ E +E  G
Sbjct  814  VN-FPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQEEQESMG  870



>gb|AGX27495.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27497.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27498.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  521  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  573

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  574  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTA  631

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  632  D-DICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWG  690

Query  47   IEPIIIR  27
             E + +R
Sbjct  691  NEYLEVR  697



>gb|AGX27496.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  521  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  573

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  574  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTA  631

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  632  D-DICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWG  690

Query  47   IEPIIIR  27
             E + +R
Sbjct  691  NEYLEVR  697



>emb|CDP08024.1| unnamed protein product [Coffea canephora]
Length=703

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPWS I+ IG L NLE+LKL+    +G  WE  EG F++L+FL L+  ++  W     D 
Sbjct  580  LPWSHISAIGSLANLEILKLQSGAFEGQTWEMEEGEFQRLRFLSLDTLDIVQWNA-SCDH  638

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
               L RLVL+ C  LE IP    D+ +L  IE+  C   V+ESA+++ E     G   ++
Sbjct  639  LPRLERLVLQNCNDLEEIPFDLADILSLQMIEVNCCAQSVEESAKEIGEAT---GEVKVL  695

Query  32   IRHVD  18
            IR  D
Sbjct  696  IRSSD  700



>gb|AGX27494.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  521  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  573

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  574  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTA  631

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  632  D-DICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWG  690

Query  47   IEPIIIR  27
             E + +R
Sbjct  691  NEYLEVR  697



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TCL W +++++G LP LE LKL      G +W+  +  F  LKFL LE   +  W     
Sbjct  790  TCLQWKDLSIVGKLPKLEALKLGISACIGMEWKVVKDGFPSLKFLLLERLKVRYWRA-SC  848

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            D F CL RL L+ C  L+ IP  F D+ TLA I++  C   V  SA+++ E
Sbjct  849  DHFPCLERLFLEHCWDLDSIPQDFADITTLALIDIRWCAESVGNSAKQIQE  899



>gb|AGX27493.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  521  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  573

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  574  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTA  631

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  632  D-DICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWG  690

Query  47   IEPIIIR  27
             E + +R
Sbjct  691  NEYLEVR  697



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 2/114 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W++++V+G L +LEVLKLK+    G  WEP  G F  L  L++E  NL SW     
Sbjct  748  TRLGWNDMSVLGQLEHLEVLKLKENGFMGECWEPKVGGFSSLLVLWIERTNLVSWNA-SA  806

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE  57
            DQF  L RLVL  C +L+ IP G  D+ +L ++EL N       SA++L + ++
Sbjct  807  DQFPRLKRLVLISCDRLKEIPIGLADIRSLQAVELYNSTKTAAISARELQDKKD  860



>gb|AGX27492.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=700

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  520  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  572

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  573  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKRLIMEKLNLVFWTA  630

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  631  D-DICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWG  689

Query  47   IEPIIIR  27
             E + +R
Sbjct  690  NEYLEVR  696



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 88/169 (52%), Gaps = 7/169 (4%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTC-LPWSEINV-IGM  357
            ++ENLG   KLE+L   F   S     ++       N  K    R C L W +I   IG 
Sbjct  711  SVENLGRFQKLESL--CFSLSSMVRRSDMLERLCFPNSLKKLSLRGCRLQWEDITRKIGP  768

Query  356  LPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYL-EAENLESWEVDGGDQFRCLTRLVLK  183
            LP L+VLKL + S  G +WE  EG FR+L  L + + ++LE W VD    F CL RL L+
Sbjct  769  LPLLQVLKLHKDSVIGSEWETVEGQFRRLSVLEITDIDDLEYWTVDNS-HFPCLHRLCLR  827

Query  182  KCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
               KL+ IP GF ++ TL  IEL  C      S +++ E +E+ G E +
Sbjct  828  HLRKLKKIPWGFAEIQTLELIELAMCSDSAVISVKEIAEQQEELGNEDL  876



>ref|XP_009762295.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=169

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 5/117 (4%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQ--VSDGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGG  219
              W +I+++ MLPNLE LKLK   V+    W  + E  F+ LK L+ +  +LE WE    
Sbjct  41   FHWDDISILVMLPNLEELKLKVAVVTGDQVWRLSDEDKFQSLKLLF-KGIHLERWEA-SS  98

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F  L RLVLK C  L+ IPT F +  TL SIE  NC    ++SA+ + + +ED G
Sbjct  99   DSFPNLRRLVLKNCNYLKEIPTNFGEFCTLESIEFHNCSSLAEDSARNIEQEQEDMG  155



>gb|AGW28124.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 11/187 (6%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklk  405
            KLGI C  K     I+ + L NL +L+   +  +         L NL + P +L    L 
Sbjct  521  KLGIFCDEKLD-HVIDLSRLHNLHTLNCTSSKYL-----KDNLLSNL-NFPYSLKKLCLD  573

Query  404  lKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEV  228
                C  + ++++IG LPNL++LKL+    +  +WEP EG+F +LK L +E  NL  W  
Sbjct  574  DCGIC--YRDMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTA  631

Query  227  DGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D    F  L  LV++ C  L  IP+G  D+ TL  IE+  C   V +SA+ + E +E +G
Sbjct  632  D-DICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECRRSVLDSARMIQEEQESWG  690

Query  47   IEPIIIR  27
             E + +R
Sbjct  691  NEYLEVR  697



>emb|CDP21177.1| unnamed protein product [Coffea canephora]
Length=532

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 88/180 (49%), Gaps = 21/180 (12%)
 Frame = -3

Query  572  ICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRT  393
            +C +    E +E   L + G L   E + ++F    PT L+ L             L R 
Sbjct  359  VCCNMSRLECLESLGLGDYGFLGSREHVELSF----PTNLKKL------------CLYRL  402

Query  392  CLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESW---EVD  225
             LP  ++++I  LPNLEVLKL++   DG  WE  EG F KLK L LE E +E W   + D
Sbjct  403  GLPCRKMSLIEQLPNLEVLKLREEAMDGQRWELMEGGFPKLKVLTLEYERIEKWIEADPD  462

Query  224  GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED-YG  48
              D F CL RL L     L+ +P       TL +I++ +C   VK    K+ E +ED YG
Sbjct  463  SYDYFPCLQRLKLFGIFNLKMMPACLGSTPTLETIQVAHCGYGVKSLVWKIEEAQEDNYG  522



>gb|EYU23523.1| hypothetical protein MIMGU_mgv1a025044mg [Erythranthe guttata]
Length=727

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 9/167 (5%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTC-LPWSEINVIGMLP  351
            L N   L KLE+L   + +     LQ+L  L     +      R C + W ++  IG LP
Sbjct  530  LYNCCRLQKLESLKFQYPR-EHDALQDLTFLSSLKKLYL----RCCTIKWEDLTTIGSLP  584

Query  350  NLEVLKLKQV--SDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            +LEVLKL+    + G  W P EG F +LKFL++E   L +W  D    F  L +LVL++ 
Sbjct  585  HLEVLKLRLSPNTAGHVWNPIEGEFLRLKFLFIECIYLVNWNADSS-HFPVLEKLVLEEM  643

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
             KLE IP    ++  L +I L +C      SA K+ E RE+ G E +
Sbjct  644  EKLEEIPLDIGEIPALGAISLKSCSESSAISAVKIAEERENGGNEAL  690



>emb|CDP11160.1| unnamed protein product [Coffea canephora]
Length=1430

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLEVLKL+    +G  WE  E  F++LKFL L+  N+  W     D 
Sbjct  1308  LPWSHISTIGGLPNLEVLKLRLGAFEGLIWEMEEEQFKELKFLKLDDLNICRWNATC-DH  1366

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
                L RLVL+ C  LE IP  F D+ TL  IE+  C    +ESA+ + E   D  +
Sbjct  1367  LPKLERLVLQNCKDLEEIPNDFADIGTLELIEVHWCRQSAEESAKGIREATGDIKV  1422



>emb|CDP08020.1| unnamed protein product [Coffea canephora]
Length=1459

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 92/178 (52%), Gaps = 10/178 (6%)
 Frame = -3

Query  569   CGSKPSPEAIEPAN-LENLGSLDKLETLMIAFRKGSPTGLQNLE-SLPlnlnikklklKR  396
             C    SP +    N    L  L  LE+L I F  GSP  L N E SLPLNL    L   R
Sbjct  1280  CIFYESPNSSTNCNQFPRLNCLTHLESLKI-FYCGSP--LNNGEFSLPLNLKKLTLSDFR  1336

Query  395   TCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
               LPWS I+ IG LPNLEVLKL      G  W+  E  F+ LKFL L++ N+  W     
Sbjct  1337  --LPWSHISTIGRLPNLEVLKLLSGAFVGKLWK-VEEKFQNLKFLSLDSLNIAQWNA-SC  1392

Query  218   DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
             D F  L RL+L+ C  LE IP  F ++ TL  IE+  C    ++SA K+ E  E+  +
Sbjct  1393  DDFPKLERLILQNCKDLEEIPAEFANIYTLEMIEVHWCSELAEKSAIKIGEETEEIKV  1450



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 7/122 (6%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDG----PDWEPTEGNFRKLKFLYL-EAENLESWE  231
            TCLPW  ++++GMLPNLE+L+L+  + G      W+P+E  F +LKFL L        W+
Sbjct  760  TCLPWEAMDIVGMLPNLEILELEDDACGVKPKTAWKPSEEGFPQLKFLSLCHMLCFTEWK  819

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE-D  54
                D F  L RL +  C +LE IP  F ++ TL  IEL +C + +  SAQ++ + +E  
Sbjct  820  ATE-DHFPVLERLFISHCPRLEEIPQEFANIFTLQLIELHDCCIHLAISAQQIEQEQEAT  878

Query  53   YG  48
            YG
Sbjct  879  YG  880



>ref|XP_009608261.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1228

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLKQVSDGPD-WEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LP +EI+ I  L  LEVL+L++V+   D WE     FRKLK L LE   L  W V   + 
Sbjct  1106  LPHAEISTIANLLTLEVLQLQEVAFEMDEWEVIANEFRKLKILKLENLKLSEWSV-SDEA  1164

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F CL RLVL +C  LE IP+ FED+  L  IE+ +C   V  SA+ + +   +YG
Sbjct  1165  FCCLERLVLVRCLHLEEIPSCFEDLEKLQYIEVNSCSESVANSARDIRDTIVEYG  1219



>ref|XP_004250464.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=848

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 64/117 (55%), Gaps = 1/117 (1%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGN-FRKLKFLYLEAENLESWEVDGG  219
            T LPW  +N++  LPNLEVLK      G +W   E   FRKLK L + A +L+ WEV G 
Sbjct  707  TRLPWEVVNLLANLPNLEVLKGNDAFKGTNWRLNEDVVFRKLKHLKIVAGDLQRWEVAGS  766

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F  L +L+L +   LE IP    ++ TL  I++  C   V  SA K+ E ++  G
Sbjct  767  DNFPMLEQLILHQLRDLEEIPVSIGEIMTLKFIQINCCGSGVDTSATKIQEEQQSLG  823



>ref|XP_009788590.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana sylvestris]
Length=1675

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 2/113 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLE+LKL  +  +G  WE  +  F KLK+L L+  N+  W V   D 
Sbjct  1553  LPWSAISTIGELPNLEILKLLFRAFEGNQWEVKDSEFPKLKYLNLDNINISQWSV-YDDA  1611

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             F  +  LVL KC +LE IP+ F D  +L  IE+  C   V  SA ++     D
Sbjct  1612  FPMIEHLVLTKCERLEEIPSHFGDAISLKRIEVNRCCWSVANSALEIQTTHHD  1664



>ref|XP_009761713.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Nicotiana sylvestris]
Length=320

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 84/164 (51%), Gaps = 4/164 (2%)
 Frame = -3

Query  536  PANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
            PA L+ L  L +LETL I    GS   + + +  P NL   KL      L W ++ V+  
Sbjct  151  PAILDPLSLLQELETLTIEADLGSDLMILSRDIFPPNLKQLKLSY--ATLQWEDMVVLAN  208

Query  356  LPNLEVLKLKQVSDGPDWEPTEGN-FRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            LPNLEVLK     +G +W+  E   F+KLK+L L+   LE WE    D F  L +L+L  
Sbjct  209  LPNLEVLKAYSAFEGTNWKLNEDVVFQKLKYLRLQYGGLERWEA-TNDNFSMLEQLLLYG  267

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              KLE IP    D+  L  I++  C      SA+K+ + +E +G
Sbjct  268  FRKLEEIPQSIGDIMILKLIQIERCSAAAVTSAKKIQQEQESWG  311



>ref|XP_009616092.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana tomentosiformis]
Length=1144

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW EI+ I  LPNLEVLK L +  +G +W  ++  F KLKFL L   N+  W +   D 
Sbjct  1015  LPWVEISAISALPNLEVLKLLSEAFEGGEWNVSDEEFAKLKFLKLGNLNITLWNI-SDDA  1073

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F  L  +VL+ C +L  IP+ F D  +L  IE+  C   V +SA+ + E ++D G
Sbjct  1074  FPSLEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGESVSQSARNIEESQQDNG  1128



>ref|XP_009788587.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788588.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788589.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=1721

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 2/113 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLE+LKL  +  +G  WE  +  F KLK+L L+  N+  W V   D 
Sbjct  1599  LPWSAISTIGELPNLEILKLLFRAFEGNQWEVKDSEFPKLKYLNLDNINISQWSV-YDDA  1657

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             F  +  LVL KC +LE IP+ F D  +L  IE+  C   V  SA ++     D
Sbjct  1658  FPMIEHLVLTKCERLEEIPSHFGDAISLKRIEVNRCCWSVANSALEIQTTHHD  1710



>ref|XP_009616093.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=1101

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW EI+ I  LPNLEVLK L +  +G +W  ++  F KLKFL L   N+  W +   D 
Sbjct  972   LPWVEISAISALPNLEVLKLLSEAFEGGEWNVSDEEFAKLKFLKLGNLNITLWNI-SDDA  1030

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F  L  +VL+ C +L  IP+ F D  +L  IE+  C   V +SA+ + E ++D G
Sbjct  1031  FPSLEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGESVSQSARNIEESQQDNG  1085



>ref|XP_009616094.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana tomentosiformis]
Length=1093

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW EI+ I  LPNLEVLK L +  +G +W  ++  F KLKFL L   N+  W +   D 
Sbjct  964   LPWVEISAISALPNLEVLKLLSEAFEGGEWNVSDEEFAKLKFLKLGNLNITLWNI-SDDA  1022

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F  L  +VL+ C +L  IP+ F D  +L  IE+  C   V +SA+ + E ++D G
Sbjct  1023  FPSLEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGESVSQSARNIEESQQDNG  1077



>ref|XP_006365681.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEG-NFRKLKFLYLEAENLESWEVDGG  219
            T +PW  +N++  LPNLEVLKL     G DW+  E   F KLK+L + ++ LE WE+ G 
Sbjct  559  TRIPWEAMNLLANLPNLEVLKLDYAFAGTDWKVDEDVVFHKLKYLQIASDCLERWEI-GS  617

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F  L +L+L    KLE IP    ++ TL  I+L +C   V  SA+K+ + ++  G
Sbjct  618  DNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQQEQQSLG  674



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 69/115 (60%), Gaps = 3/115 (3%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            T L W++++V+G L +LEVLKLK+    G  WEP  G F  L  L++E  NL SW     
Sbjct  569  TWLGWNDMSVLGQLEHLEVLKLKENGFIGECWEPKVGGFSSLLVLWIERTNLVSWNA-SA  627

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
            DQF  L RLVL  C +L+ IP G  D+ +L ++EL N       SA++L ++++D
Sbjct  628  DQFPRLKRLVLISCDRLKEIPIGLADIRSLQTVELYNSTKTAAISAREL-QYKKD  681



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEG-NFRKLKFLYLEAENLESWEVDGG  219
            T +PW  +N++  LPNLEVLKL     G DW+  E   F KLK+L + ++ LE WE+ G 
Sbjct  735  TRIPWEAMNLLANLPNLEVLKLDYAFAGTDWKVDEDVVFHKLKYLQIASDCLERWEI-GS  793

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F  L +L+L    KLE IP    ++ TL  I+L +C   V  SA+K+ + ++  G
Sbjct  794  DNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQQEQQSLG  850



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 100/188 (53%), Gaps = 7/188 (4%)
 Frame = -3

Query  584  KLGIICG-SKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikkl  408
            KLG+I    +   +  +  NL +L  L+KL+  + ++    P      E L     ++KL
Sbjct  712  KLGLIYNRDRIFLQVYQLHNLIHLRQLEKLKICIGSYWDRHPLW----EKLAFPTTLQKL  767

Query  407  klKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWE  231
             L    L   ++  +G LPNL VLKL++ S     WE TEG F +LKFL +E+ENL+ W 
Sbjct  768  TLSGCVLSQQDMATVGSLPNLHVLKLRRCSFRRGKWETTEGEFPRLKFLQIESENLKHWV  827

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDY  51
             D    F  L RLVL  C +L  IP G  ++ TL  IE+ + P  + +SA ++ E +++ 
Sbjct  828  TDSS-HFPNLERLVLHDCGELGEIPDGIGEIPTLELIEVPHWPKSLVDSAMRIKEEQQES  886

Query  50   GIEPIIIR  27
            G + + +R
Sbjct  887  GNDFLQVR  894



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGN-FRKLKFLYLE-AENLESWEVDG  222
            T LPW ++ V+  LPNLEVLK      G DW+  E   F+KLK+L ++ A++LE WE   
Sbjct  324  TSLPWEDMAVLANLPNLEVLKADHAFTGTDWDLNEDVVFQKLKYLRIKRADDLEMWEA-A  382

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F  L +LVL+   +LE IP  F ++ TL  +++  C   V +SA+ + E ++ +G
Sbjct  383  SDSFPMLEQLVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARNILEDQQSWG  440


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 3/118 (3%)
 Frame = -3

Query  395   TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEG-NFRKLKFLYL-EAENLESWEVDG  222
             T LPW E++V+  LPNLEVLK     +G DW   E   F+KLK+L +  A++LE WE   
Sbjct  1170  TSLPWEEMDVLANLPNLEVLKADSAFNGTDWTLNEDVVFQKLKYLRIWSADDLERWEA-T  1228

Query  221   GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              D F  L +LVL+   +LE IP    ++ TL  +++ NC   V  SA+ + + ++ +G
Sbjct  1229  SDNFPMLEKLVLQHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSARNILQEQQGWG  1286



>gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Erythranthe guttata]
 gb|EYU17762.1| hypothetical protein MIMGU_mgv1a000811mg [Erythranthe guttata]
Length=977

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPW ++++I  LP LEVLKL++++ +G +W P +  FR+LKFL LE  +L+ W+ D    
Sbjct  851  LPWEDMSIIAKLPLLEVLKLREIAFEGDEWIPEKKEFRELKFLLLEYLDLKGWDADHT-H  909

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            +  L RL+L+ C +L  IP  F+ +  L  IEL++C     E+A+++ +  +  G
Sbjct  910  YPKLQRLILRHCYELVDIPEKFDLLGCLELIELVDCSPDAVEAAEEMKKKLKKSG  964



>gb|EYU31247.1| hypothetical protein MIMGU_mgv1a017756mg [Erythranthe guttata]
Length=1064

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 92/179 (51%), Gaps = 10/179 (6%)
 Frame = -3

Query  569   CGSKPSPEAIEPAN----LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklkl  402
             C +KP  ++ E  +    L++   L  LE+L I++  G    L +  +LP +L    L  
Sbjct  886   CATKPLWDSSEKCHRYVALDD--CLTMLESLNISYLGGEYLKLPDTLNLPSSLKKLTLHD  943

Query  401   KRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
              +  L   E+++IG LP LE LKL   V DG +W+  +  FR+LKFL L+A  +  W   
Sbjct  944   FK--LSRDEMSMIGRLPKLEALKLLYTVFDGKEWKTNDDEFRELKFLKLDALKIRRWNT-  1000

Query  224   GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
               D F  L RLV+ KC KL+  P    D+ TL  +++ +C   V  SA  +   + +YG
Sbjct  1001  SDDHFPRLQRLVMHKCWKLKKFPRSLGDIPTLQVVDIHSCSKSVANSALDVQREQLEYG  1059



>ref|XP_011072163.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=866

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 83/173 (48%), Gaps = 20/173 (12%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRK------GSPTGLQNLESLPlnlnikklklKRTCLPWSEINV  366
            L NL  L KLE+L +  +       G PT L+ LE            L    +PW ++ +
Sbjct  696  LYNLVHLHKLESLYVRAKDLSLKNMGFPTSLKKLE------------LYECKVPWEDMII  743

Query  365  IGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLV  189
            IG LPNLEVL LK     G +W P EG F +LK L L   NLE W  +    F  L +L 
Sbjct  744  IGSLPNLEVLMLKGCGFKGSEWNPIEGQFPRLKVLELSMSNLECWRAENV-HFPNLEKLS  802

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIII  30
            L+    LE IP+G   + TL  IE+  C   +  SA ++ E +   G E + +
Sbjct  803  LRLMDDLEEIPSGIGYIATLGLIEVYYCSDSIVNSAMQILEEQRSNGNEDLHV  855



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 67/130 (52%), Gaps = 2/130 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            L W +++++G LP LEVLKL      G  WE  E  F  LKFL+L+   +  W     D 
Sbjct  744  LAWKDLSIVGKLPKLEVLKLSGHAFIGEGWEVVEEGFPHLKFLFLDEVYIRYWRA-SSDH  802

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            F  L RL L+ C  L+ IP  F D+ TLA  ++ +C   V  SA+++ +  +D     I 
Sbjct  803  FPYLERLFLRDCYFLDSIPRDFADITTLALTDISSCRQSVVNSAKQIQQDIQDNYGSSIE  862

Query  32   IRHVDQIQEV  3
            +   D +Q +
Sbjct  863  VHTRDTLQHI  872



>gb|EYU31552.1| hypothetical protein MIMGU_mgv1a025226mg [Erythranthe guttata]
Length=1038

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 91/179 (51%), Gaps = 10/179 (6%)
 Frame = -3

Query  569   CGSKPSPEAIEPANLENLGSLDK----LETLMIAFRKGSPTGLQNLESLPlnlnikklkl  402
             C +KP  ++ E  +     +LD     LE+L I++  G    L +  +LP +L    L  
Sbjct  852   CATKPLWDSSEKCH--RYVALDDCLTMLESLNISYLGGEYLKLPDTLNLPSSLKKLTLHD  909

Query  401   KRTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVD  225
              +  L   E+++IG LP LE LKL   V DG +W+  +  FR+LKFL L+A  +  W   
Sbjct  910   FK--LSRDEMSMIGRLPKLEALKLLYTVFDGKEWKTNDDEFRELKFLKLDALKIRRWNT-  966

Query  224   GGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
               D F  L RLV+ KC KL+  P    D+ TL  +++ +C   V  SA  +   + +YG
Sbjct  967   SDDHFPRLQRLVMHKCWKLKKFPRSLGDIPTLQVVDIHSCSKSVANSALDVQREQLEYG  1025



>ref|XP_009778434.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1204

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW EI+ I  LPNLE+LK L +  +G +W  ++  F KLK+L L   N+  W +   D 
Sbjct  1077  LPWVEISAIAALPNLEILKLLSKAFEGEEWNASDEEFPKLKYLKLGNLNITHWNI-SDDA  1135

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F  L  +VL+ C +L  IP+ F D  +L  IE+  C   V +SA+ + E ++D G
Sbjct  1136  FPSLEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGDSVSQSARSIEESQQDNG  1190



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 66/114 (58%), Gaps = 4/114 (4%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLK-LKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWSEI++IG LPNLE+LK L +  +G  WE  +  F KLK+L L+  N   W +   D 
Sbjct  1600  LPWSEISIIGELPNLEILKLLFRAFEGDRWEVKDAEFPKLKYLILDNINFSQWSI-SDDA  1658

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL--NEHRE  57
             F  L  L L KC +LE IP+ F +  ++ SIE+  C   V  SA ++   +H E
Sbjct  1659  FPELENLSLTKCERLEEIPSHFGEAVSIKSIEVNRCGSSVANSALEIQTTQHEE  1712



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            TC  W +++++G LP LE LKL      G +W+  +  F  LKFL LE   +  W     
Sbjct  791  TCFQWKDLSIVGKLPKLEALKLGISACIGIEWKVVKDGFPSLKFLLLERLKVRYWRA-SC  849

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNE  66
            D F CL RL L+ C  L+ IP  F D+ TLA I++  C   V  SA+++ E
Sbjct  850  DHFPCLERLFLEHCWDLDSIPQDFADITTLALIDIRWCAESVGNSAKQIQE  900



>emb|CDP12799.1| unnamed protein product [Coffea canephora]
Length=1156

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 2/120 (2%)
 Frame = -3

Query  386   PWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQF  210
             PWS I+ IG LPNLEVLKL+ Q   G  WE  EG F  L+FL L + ++  W     D F
Sbjct  1036  PWSSISRIGKLPNLEVLKLRYQAFVGEKWEVEEGEFPNLRFLKLSSLDIHRWTA-SSDNF  1094

Query  209   RCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIII  30
               L +LVL  C KLE +P+   +  TL  IE+ +C      + +++ + + D G E + I
Sbjct  1095  SLLEKLVLHDCVKLEEVPSCLGESPTLEMIEVSSCGKSTVNAIKQIQQEQMDMGNEALKI  1154



>ref|XP_006345285.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like, 
partial [Solanum tuberosum]
Length=873

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LP  +++++G LP LE LKL+     G +WE  E  F +LKFL L   +   W     D 
Sbjct  740  LPLKDLSIVGKLPKLESLKLEYDAFIGDEWEVAEEGFPRLKFLLLRCLHFRHWRA-SSDH  798

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE-DYG  48
            F CL RL++  C KL  IP  F ++ TLA I++  C   V  SA+++ +  E DYG
Sbjct  799  FPCLERLIIDACWKLHSIPQDFANITTLALIDIKICAQAVGNSAKQIQQDIEDDYG  854



>emb|CDP00758.1| unnamed protein product [Coffea canephora]
Length=1248

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 65/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLKQ-VSDGPDWE--PTEGNFRKLKFLYLEAENLESWEVDGG  219
             LPW  +++I  LP LEVLKL++    G  W+  P E  F  LK+L L   NL  W V   
Sbjct  1122  LPWRAMSIIRQLPKLEVLKLREEAFRGKRWDMTPEEEEFCNLKYLELSNLNLRQWSV-AY  1180

Query  218   DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F CL +LV+  C +L  IP  FE V TL  IEL  C   VK SA+ + + + D+G
Sbjct  1181  DPFPCLEQLVVGDCYRLVEIPHCFERVTTLQMIELCRCSDRVKSSAEVILKEQRDWG  1237



>ref|XP_011075674.1| PREDICTED: late blight resistance protein R1-A-like [Sesamum 
indicum]
Length=863

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 85/178 (48%), Gaps = 21/178 (12%)
 Frame = -3

Query  518  LGSLDKLETLMIAFRK------GSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
            L   +KLE+L + F K      G PT L  L  +                 W ++ +IG 
Sbjct  692  LAQFNKLESLHLGFGKSGLEDIGFPTSLTKLSLVF------------CTFHWEKMTIIGS  739

Query  356  -LPNLEVLKLKQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
             LPNLEVLKL    +G +W P EG F +LK L + +E LE W  +    F  L  L L  
Sbjct  740  SLPNLEVLKLHSAFEGAEWSPIEGEFLRLKVLVIFSEELEHWGAEDI-HFPNLHALYLHH  798

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIRHVDQIQE  6
               LE IP    D+NTL SI L  C V    SA ++ + +++ G E + I +V+ + E
Sbjct  799  MKNLEEIPLSIGDINTLQSIYLDKCRVSTINSAMEILKDQKEKGNESLQI-YVNVVNE  855



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 2/112 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW  I+ IG LPNL+VLKL  +  DG  W+  E  F +L+FL L++ NL  W     D 
Sbjct  1345  LPWDHISTIGRLPNLQVLKLASEAFDGESWDMREDEFPELRFLQLDSLNLVQWNA-SYDH  1403

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRE  57
                L +LVL+ C +L+ +P  F D+ TL  I++  C   ++ES + + E  E
Sbjct  1404  LPKLAQLVLRNCKRLQEVPYDFADIPTLELIQVQQCGKSLEESVRSIGEATE  1455



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 100/197 (51%), Gaps = 13/197 (7%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIA-----FRKGSPTGLQN-----LESL  435
            KLG+I G K      E   L NL  L +LE L I+     +   SPT +        E L
Sbjct  701  KLGLIYG-KDRVLNWEFYGLHNLVHLHQLEKLKISMPISSWESHSPTWIPESRVPLWEKL  759

Query  434  PlnlnikklklKRTCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYL  258
                 +KKL L    L   ++  IG LPNL VLKL++ S  G  WE TEG F +LKFL +
Sbjct  760  AFPRMLKKLTLGGFMLSQQDMATIGSLPNLHVLKLRRCSFRGGKWETTEGEFAQLKFLKI  819

Query  257  EAENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQ  78
            E+ NL+ W  D    F  L RL+L  C +L  IP    ++ TL  IE+ +    +  SA+
Sbjct  820  ESTNLKHWVTDSS-HFPTLERLLLYHCPELYEIPNVIGEIPTLELIEVKSWDEFLGNSAK  878

Query  77   KLNEHREDYGIEPIIIR  27
            ++ + +ED G E + +R
Sbjct  879  RIKQEQEDSGNECLRVR  895



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 5/129 (4%)
 Frame = -3

Query  395   TCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
             TCL W +++++G LP LEVLKL+     G +WE  +  F  LK L LE   +  W     
Sbjct  941   TCLQWMDLSIVGKLPKLEVLKLENDACIGDEWEVVDEGFPYLKLLLLERLKIRYWRA-SC  999

Query  218   DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED-YG--  48
             D F CL RL L++C  L+ IP  F D+ TLA I + +C   V  S +++ +  +D YG  
Sbjct  1000  DHFPCLERLFLERCLGLDSIPQDFTDITTLALINVSSCAESVGNSTKQIQQDIQDNYGTS  1059

Query  47    IEPIIIRHV  21
             +E  I+RHV
Sbjct  1060  VEVTIVRHV  1068



>ref|XP_009611917.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611918.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611919.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1727

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLE+L L  +  +G  WE  +  F KLK+L L+  N+  W V   D 
Sbjct  1601  LPWSAISTIGELPNLEILNLLFRDFEGNQWEVKDSEFPKLKYLNLDNINISQWSV-YDDA  1659

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             F  +  LVL KC +LE IP+ F D  +L SIE+  C   V +SA ++     D
Sbjct  1660  FPMIEHLVLTKCERLEEIPSHFGDAISLKSIEVNRCCWSVAKSAVEIRTTHHD  1712



>ref|XP_009611920.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1665

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG LPNLE+L L  +  +G  WE  +  F KLK+L L+  N+  W V   D 
Sbjct  1539  LPWSAISTIGELPNLEILNLLFRDFEGNQWEVKDSEFPKLKYLNLDNINISQWSV-YDDA  1597

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED  54
             F  +  LVL KC +LE IP+ F D  +L SIE+  C   V +SA ++     D
Sbjct  1598  FPMIEHLVLTKCERLEEIPSHFGDAISLKSIEVNRCCWSVAKSAVEIRTTHHD  1650



>gb|EYU39490.1| hypothetical protein MIMGU_mgv1a0204861mg, partial [Erythranthe 
guttata]
Length=369

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            L   ++ ++G LPNL+VLKLK  + DG  WE TEG F +LKFL L   +L  W +     
Sbjct  246  LSCEDMRIVGSLPNLQVLKLKNFALDGDTWETTEGEFSQLKFLLLHYTDLGHW-ISESSH  304

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            F  L  L L  C  L  IP G  D+ TL  IE+    + + +SA+++ E + +YG
Sbjct  305  FPILKCLFLHHCQYLSEIPDGIGDIPTLELIEVKGDNIYLAQSAKQIQEIQREYG  359



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 85/155 (55%), Gaps = 9/155 (6%)
 Frame = -3

Query  539  EPANLENLGSLDKLETLMIA-----FRKGSPTGLQNLESLPlnlnikklklKRTCLPWSE  375
            +P  ++NL  LD+LE L IA      R      L + +SLP +L   KL    T LPW  
Sbjct  694  DPEWIDNLKYLDELEALSIADNNYPSRTCPFFRLTSQDSLPPSLKKLKLTT--THLPWEY  751

Query  374  INVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLT  198
            + +IG LPNLEVL+LK+ + +G +W+ TE  F+ LK+  L+    + W+ D  D F  L 
Sbjct  752  MAIIGKLPNLEVLQLKKWAFEGNEWKVTEI-FKNLKYFLLDQSYFQYWKSDSNDHFPNLE  810

Query  197  RLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPV  93
            +L+++ C+ L+ IP  F    TL  IE+  C   V
Sbjct  811  QLIIRDCSFLKEIPQEFNTSKTLELIEVHGCTRRV  845



>ref|XP_009782925.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=795

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQVSDGPD-WE-PTEGNFRKLKFLYLEAENLESWEVDGGD  216
             PW +I+ + MLP LE LKLK+   G + W    E  F +L FL     +   WE    D
Sbjct  666  FPWEDISTLVMLPYLEELKLKRWVVGDEVWRLSNEDKFERLNFLLFCQLDFRCWEA-SSD  724

Query  215  QFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             F  L RLVL  C  LE IPT F ++ TL SIEL NC    ++SA+ + + +ED G
Sbjct  725  SFPNLKRLVLNHCPYLEEIPTDFGEICTLESIELHNCSTSAEDSARNIEQEQEDMG  780



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 90/165 (55%), Gaps = 6/165 (4%)
 Frame = -3

Query  533  ANLENLGSLDKLETLMIAF-RKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
            + L +L  L+KLETL IA  R+      Q+  +LP +L    L+   T LPW ++  I M
Sbjct  720  SELNSLSCLNKLETLKIACNRRYYERPPQSKFALPTSLKRLTLES--TYLPWEDMANIVM  777

Query  356  LPNLEVLKLKQVS-DGPDWEPT-EGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLK  183
            LPNL+VLK+K    DG  W    E  F +LKFL +   NL+ W+  G   F  L  LVLK
Sbjct  778  LPNLQVLKIKDNGFDGDVWRLNDEMIFNQLKFLLIYETNLKQWKA-GSVNFPELQCLVLK  836

Query  182  KCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            +C  L+ IP    ++ TL SIEL NC    ++S + + + ++  G
Sbjct  837  ECRSLKTIPQDIGEIYTLESIELHNCSTSAEKSVKNIQKEQKSMG  881



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 80/163 (49%), Gaps = 5/163 (3%)
 Frame = -3

Query  530  NLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLP  351
            +L N   L +LE L     +     +    SLP +LN   L    T LPW +I  I MLP
Sbjct  391  HLSNFSRLKELEILKFRGNRQYFRRMPGKYSLPTSLNSLTLTD--TYLPWEDIANIVMLP  448

Query  350  NLEVLKLKQVS-DGPDWEPTEGN-FRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            NLEVLK+K     G  W   +   F +LK L +    L+ W+  G   F  L RLVLK+C
Sbjct  449  NLEVLKIKYHGFYGAFWRLNDNEIFNQLKLLLINETYLKHWDA-GSVNFPKLQRLVLKRC  507

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              LE IP  F ++ TL SIEL  C      SA+ + E +E  G
Sbjct  508  FDLEEIPKDFGEICTLESIELHKCKTSAAASAKNIQEEQESMG  550



>gb|EYU23607.1| hypothetical protein MIMGU_mgv1a019784mg [Erythranthe guttata]
Length=814

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 85/165 (52%), Gaps = 8/165 (5%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPN  348
            L NL  L KLE+L  +        L NL + P +L    L   + C  W ++  IG LP+
Sbjct  564  LHNLCRLHKLESLKCS-SYHQDDFLHNL-TFPSSLKKLSLHGSKVC--WEDLTKIGSLPH  619

Query  347  LEVLKLKQV--SDG-PDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKC  177
            LEVLKL  +  +DG  +W P EG F +LKFL +E  +L  W  D    F  L  LVL++ 
Sbjct  620  LEVLKLDYMCSADGVHEWNPIEGEFLRLKFLLIEHCDLVYWNADCS-HFPVLETLVLRRL  678

Query  176  TKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
             KLE IP    ++ TL  I+L  C      SA K+ E +E+ G E
Sbjct  679  HKLEEIPLDIGEIPTLGVIDLYCCNESTAISAMKIAEEQENAGNE  723



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 74/130 (57%), Gaps = 2/130 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            RTCLPW+ + +   LPNLEVL+LK +   G +WE TE  F KLKFL LE   L  W+   
Sbjct  740  RTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEITEMGFPKLKFLLLEDLLLIYWKATD  799

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
             D F+CL  + +++C  L+ IP GF D  TL  IEL  C  P+   A+++ E  E+ G  
Sbjct  800  -DYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQEKHEELGNN  858

Query  41   PIIIRHVDQI  12
             + +   D +
Sbjct  859  MLKVYAFDSM  868



>gb|AAL17826.1| GPA2-like NBS-LRR protein [Solanum nigrum]
Length=477

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 2/105 (2%)
 Frame = -3

Query  383  WSEINVIGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFR  207
            W  ++++G LP L+VLKL   +  G  WE  E  F  LKFL L++  +  W     D F 
Sbjct  373  WKNLSIVGKLPKLDVLKLSNTAFVGEKWEVVEEGFPCLKFLLLDSVYIRYWRA-SSDHFP  431

Query  206  CLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
            CL RL LK C  L+ IP  F D+ TLA I++  C   V  SA+++
Sbjct  432  CLERLFLKDCFALDSIPRDFADITTLALIDICKCRQSVGNSAKQI  476



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 3/119 (3%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            + L W +  V+G LPNLEVLKLK  S  GP+WE  E  F +LK+L +E+ +L  W+    
Sbjct  758  SLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEGFHRLKYLLVESRDLVVWKQAST  817

Query  218  DQ--FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D   F  L  LV + C KL+ IP    D+ +L  IEL +C       A+ + + + D G
Sbjct  818  DSYPFPALQHLVFRFCNKLKEIPYEIGDIPSLQVIELYSCSPYATRLARMIQQDQIDSG  876



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 83/168 (49%), Gaps = 7/168 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKG---SPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM  357
            L NL  L +LE L I   +     P    +L++LP NL    L    T LPW  +  +  
Sbjct  753  LRNLALLPQLEALKIVGLRAPVQVPKLAFHLDALPENLKKLTLSF--TYLPWESMTSLCR  810

Query  356  LPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKK  180
            LPNLEVLKLK  +  G  WE  E  F  LK L +E  +LE W     D F  L  LVLK 
Sbjct  811  LPNLEVLKLKPYAFTGTKWEQVEEGFCSLKLLQIEMFDLEHWSA-SNDHFPVLEHLVLKC  869

Query  179  CTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPI  36
            C  L+ IP    D+ TL  IEL N       SA+++ E +++ G E +
Sbjct  870  CLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQNIGNETL  917



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 87/168 (52%), Gaps = 6/168 (4%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPN  348
            L NL  L KLE+L  ++   S   LQ L + P ++    L   R  + W ++ +IG L N
Sbjct  602  LHNLSLLCKLESLTCSY-SISNNLLQKL-TFPSSIKKLSLIFCR--VNWEDLTLIGSLQN  657

Query  347  LEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTK  171
            LEVLKLK  S  G  W P EG F +LKFL +   +L  W  D  + F  L +LVLK   K
Sbjct  658  LEVLKLKYDSVRGAVWNPIEGEFLRLKFLLIHYSDLVYWNADSSN-FPVLEKLVLKGMEK  716

Query  170  LEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            LE IP    ++ TL  + +  C      SA K+ E +E+ G E + IR
Sbjct  717  LEEIPLDIGEIPTLGFVHVNCCSESAAISALKIVEEQENVGNEGLRIR  764



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 66/117 (56%), Gaps = 1/117 (1%)
 Frame = -3

Query  395  TCLPWSEINVIGMLPNLEVLKLKQVSDGPDWEPTEGN-FRKLKFLYLEAENLESWEVDGG  219
            T +PW  +N++  LPNLEV++ +    G DW+  E   F KLK+L +   +LE WE    
Sbjct  744  TYIPWEVVNLLAYLPNLEVIEGEYAFSGTDWKLDEDVVFSKLKYLLIGEADLERWEAAAS  803

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            D F  L +L+L    KL+ IP    D+ TL  I++ +C   V+ SA+++ + ++  G
Sbjct  804  DNFPMLEKLILYGFNKLDEIPESIGDIMTLKLIKIDDCSSSVENSAKRIQQEQQSLG  860



>gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial [Erythranthe 
guttata]
Length=692

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 94/171 (55%), Gaps = 7/171 (4%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEI  372
            P+      L+NL  L KLE+L  +    +   +QN   LP +L    L    T L W ++
Sbjct  502  PQGFLSYCLDNLDHLHKLESLRFSLYSKNKHLVQNF-ILPNSLKKLTLWG--TMLKWDDM  558

Query  371  NV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEA-ENLESWEVDGGDQFRCL  201
               IG+LP+L+VLKLK  S  G +WE  EG F  L++L + +  +LE W  D  + F  L
Sbjct  559  KTKIGLLPSLQVLKLKASSFVGTEWETIEGQFCNLRYLLIRSCRDLEWWTTD-SNHFPRL  617

Query  200  TRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              L L+   KL+ IP+   +++TL SIEL++C      SA+++ + +ED+G
Sbjct  618  EHLHLQFLDKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFG  668



>emb|CDP04756.1| unnamed protein product [Coffea canephora]
Length=1312

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 86/171 (50%), Gaps = 20/171 (12%)
 Frame = -3

Query  512   SLDKLETLMIAFRKGS----PTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNL  345
             SL +LE+L ++F  G     P  L+ L             L R   PWSEI+ IG LPNL
Sbjct  1085  SLSQLESLNLSFFVGYGFKFPLNLKKL------------TLSRNHQPWSEISTIGKLPNL  1132

Query  344   EVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKL  168
             EVLKL   S DG +WE  +G F  L+ L L      SW +     F  L +LV+  CTKL
Sbjct  1133  EVLKLLHRSFDGEEWEMKDGEFPNLRVLKLSGLQFCSW-IASSAIFPRLEKLVVHDCTKL  1191

Query  167   EGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE--PIIIRHV  21
             E +P+   +  TL  I +  C   V+ S +++ + + D G E   I+I ++
Sbjct  1192  EEVPSCLGECPTLEMINVRRCSESVESSVEQIQQEQMDMGNEVLRIVIEYI  1242



>emb|CDP11157.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPWS I+ IG LPNLEVLKL     +G  W+  E  F++LKFL L+  N+  W     D 
Sbjct  751  LPWSHISTIGRLPNLEVLKLLLDAFEGLIWDMEEEQFKELKFLKLDNLNVSQWNA-TCDH  809

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGI  45
               L RLVL+ C  LE IP  F  + TL  IE+  C    +ESA+++ E   D  +
Sbjct  810  LPKLERLVLQNCKDLEEIPDDFAAIGTLKLIEVHWCGQSAEESAKRIREETGDIKV  865



>ref|XP_009764213.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764214.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764216.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764217.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=173

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = -3

Query  374  INVIGMLPNLEVLKLKQ--VSDGPD-----WEPTEGNFRKLKFLYLEAENLESWEVDGGD  216
            + +I MLP LEVLKLK+   +DG +     WE TE  F KLKFL LE   L  W     D
Sbjct  1    MTIISMLPKLEVLKLKKNAFADGENVGEDVWEVTEMGFPKLKFLLLEWLYLHYWRA-TDD  59

Query  215  QFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLN-EHREDYGIEP  39
             F  L R++++ C  ++ IP GF D  TL  IEL  C   +  SA+++  E  E+ G + 
Sbjct  60   YFPRLERIIIRSCFFIKEIPEGFADSMTLQLIELHQCSSSLVNSAKRIQKEQLENLGNDM  119

Query  38   IIIRHVDQIQE  6
            + +   D I E
Sbjct  120  LKVYAYDTISE  130



>ref|XP_011072138.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=427

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 85/180 (47%), Gaps = 28/180 (16%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGS-------PTGLQNLESLPln  426
            KLGII   K S      + LENL  L KLE+L +  +  S       PT L+ L      
Sbjct  267  KLGIIRYEKSS------SGLENLARLQKLESLYLFEKNVSLLANITFPTSLKKLS-----  315

Query  425  lnikklklKRTCLPWSEINVIG-MLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEA  252
                   L   C+PW E+ V G +LPNLE L L +    G +W P EG F +LK L +  
Sbjct  316  -------LSNCCIPWEEMTVFGSVLPNLEKLTLYRNAFKGAEWSPVEGQFPRLKVLIIVC  368

Query  251  ENLESWEVDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
             +L  W  +    F  L RL L+    LE IP+G  D+ TL SI L  C      SA+++
Sbjct  369  NDLVRWRAESI-HFPNLERLHLESMECLEEIPSGIGDIPTLLSIHLWKCSDSSVNSAKQI  427



>ref|XP_009763533.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763534.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763535.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763536.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763537.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763538.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763539.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763540.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=1747

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 87/165 (53%), Gaps = 8/165 (5%)
 Frame = -3

Query  518   LGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGMLPNLEV  339
             L  L+ LE+L +      P  L ++ S P  L    L   R  LPW +I+ I  LPNLE+
Sbjct  1576  LEFLNHLESLKL-ISNSCPAKLPHVFSFPSRLRELTLSKFR--LPWYQISTIAELPNLEI  1632

Query  338   LKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLTRLVLKKCTKLEG  162
             LKL  +  +G +WE  +  F +LK+L L+  N+  W V   D F  L  LVL KC KL+ 
Sbjct  1633  LKLLLRAFEGDEWEVKDSEFPELKYLELDDLNIARWSV-SEDAFPMLEHLVLTKCKKLKE  1691

Query  161   IPTGFEDVNTLASIELLNCPVPVKESAQKLNE-HREDYGIEPIII  30
             IP+ F++  +L  IE+  C  P   SAQ++   H ED   + + I
Sbjct  1692  IPSQFDNAISLRRIEVNWCSWP--NSAQEIQRTHHEDMTNDALTI  1734



>ref|XP_009799885.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1B-16 [Nicotiana sylvestris]
Length=1826

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 68/122 (56%), Gaps = 3/122 (2%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPW++I+ I  LPNL +LKL  +  +G  WE  + +F +LK+L L+   +  W V   D 
Sbjct  1693  LPWNQISTIAELPNLVILKLSLRAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSV-SYDA  1751

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL-NEHREDYGIEPI  36
             F  L  LVL KC  LE IP+ F+D  +L SIE+  C   V  SAQ++    RED   +  
Sbjct  1752  FPKLEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSF  1811

Query  35    II  30
              +
Sbjct  1812  TV  1813



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            L W +++++G LP LEVLKL      G +WE     F  LKFL+L+   +  W     D 
Sbjct  780  LAWKDLSIVGKLPKLEVLKLSYNPFKGEEWEVVAEGFPHLKFLFLDKVYIRYWRA-SSDH  838

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHRED-YG  48
            F  L RL L+ C  L+ IP  F D+ TLA I++  C   V  SA+++ +  +D YG
Sbjct  839  FPYLERLFLRACYFLDSIPRDFADITTLALIDITRCQQSVGNSAKQIQQDIQDNYG  894



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  386  PWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQF  210
            PWSE+ V+G LPNL+VLK++    DG  WE +EG F +LK L +E   L+ W V   + F
Sbjct  693  PWSEMTVVGSLPNLQVLKIRNHGFDGETWETSEGGFIELKHLMIEYSKLKYW-VTESNHF  751

Query  209  RCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDY  51
              L R++L  C+ L  I  G  ++ TL  IE+  C   +   A+++ E ++DY
Sbjct  752  PKLERVLLHDCSYLIEISDGVGEIPTLELIEVKFCTESIAGWAKRMREEQQDY  804



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            RTCLPW+ + +   LPNLEVL+LK +   G +WE TE  F KLKFL LE   L  W+   
Sbjct  740  RTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEITEMGFPKLKFLLLEDLLLIYWKATD  799

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             D F+CL  + +++C  L+ IP GF D  TL  IEL  C  P+   A+++ E  E+ G
Sbjct  800  -DYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQEKHEELG  856



>emb|CDP08038.1| unnamed protein product [Coffea canephora]
Length=1468

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -3

Query  389   LPWSEINVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
             LPWS I+ IG L NLE+LKL+  + +G  WE  EG F+ L+FL L+  ++  W     D 
Sbjct  1345  LPWSHISAIGSLANLEILKLQSSAFEGQTWEMKEGEFQSLRFLSLDTLDIVQWNA-SCDH  1403

Query  212   FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
                L RLVL+ C  LE IP    ++ +L  IE+  C   V+ESA+++ E     G   ++
Sbjct  1404  LPRLERLVLQNCNDLEEIPLDLAEILSLQMIEVNFCAQSVEESAKEIGEAT---GEVKVL  1460

Query  32    IRHVD  18
             IR  D
Sbjct  1461  IRSSD  1465



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 85/173 (49%), Gaps = 26/173 (15%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFRKGS-----------PTGLQNLESLPlnlnikklklKRTCLPW  381
            L +L  L+KLETL I   +G            PT L+ L             L+ T LPW
Sbjct  729  LNSLSCLNKLETLKITCYRGYYERPPQSKFALPTSLKRL------------TLESTYLPW  776

Query  380  SEINVIGMLPNLEVLKLKQ--VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFR  207
             ++  I MLPNL+VLK+K     DG      E  F +LKFL +   +LE W+  G   F 
Sbjct  777  EDMANIVMLPNLQVLKIKDNGFVDGRWRLNDEMIFNQLKFLLIHKTDLEQWKA-GSVNFP  835

Query  206  CLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
             L  LVLK+C  L+ IP    ++ TL SIEL NC    + S +K+ + ++  G
Sbjct  836  ELQCLVLKECISLKKIPQDIGEIYTLESIELHNCSTSAENSVKKIQKEQKSMG  888



>ref|XP_009773003.1| PREDICTED: protein CHUP1, chloroplastic-like [Nicotiana sylvestris]
Length=358

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = -3

Query  374  INVIGMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQFRCLT  198
            + ++G LPNLE+L+LK  +  G +W  +EG F+KLK L++   NL  W+    D    L 
Sbjct  1    MTMLGRLPNLEMLRLKYFAIQGTNWNLSEGGFKKLKLLHILMTNLVQWKA-TSDSLPNLE  59

Query  197  RLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
             LV++ C KL+ IP    D+ TL  IEL +C   V  SA+++ E ++  G E +++R
Sbjct  60   CLVIRHCYKLKEIPAEIGDIPTLKLIELHHCSQAVVTSAEEILEEQQSMGNEVLVVR  116



>gb|EYU21831.1| hypothetical protein MIMGU_mgv1a0261622mg, partial [Erythranthe 
guttata]
Length=817

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 5/172 (3%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL-ESLPlnlnikklklKRTCLPWSE  375
            P+      L+NLG L KLE+L  +   G+     ++ ++  L  ++KKL L  T L W +
Sbjct  646  PQGFLSYCLDNLGQLHKLESLRFSLYPGNKRSRNDMVQNFILPNSLKKLTLMGTKLKWED  705

Query  374  INV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLEA-ENLESWEVDGGDQFRC  204
            +   I +LPNL+VLKL + S  G +WE  EG F  L++L + +  +LE W  D  + F  
Sbjct  706  MKTKICLLPNLQVLKLLKYSFVGTEWETVEGQFCNLRYLLIRSCRDLEWWTTD-SNHFPR  764

Query  203  LTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            L  L L+   KL+ IP+   +++TL SI+L+ C      SA+K+ + +ED+G
Sbjct  765  LEHLHLEDLDKLKEIPSCIGEISTLQSIQLIWCSKSAVSSAKKILKEQEDFG  816



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 84/168 (50%), Gaps = 10/168 (6%)
 Frame = -3

Query  527  LENLGSLDKLETLMIAFR--KGSP---TGLQNLESLPlnlnikklklKRTCLPWSEINVI  363
            L NL  +  LETL + F     +P     +Q   + P NL    L    + L W +  V+
Sbjct  709  LNNLHQMYSLETLKLLFNLPMKNPLPHNSIQRWNAFPPNLKNLTLSC--SLLLWQDARVL  766

Query  362  GMLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ--FRCLTRL  192
            G LPNLEVLKLK  S  GP+WE  E  F +LK+L +E+ +L  W+    D   F  L  L
Sbjct  767  GNLPNLEVLKLKYFSFQGPEWETDEEGFHRLKYLLVESRDLVIWKQASTDSYPFPALQHL  826

Query  191  VLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            V + C KL+ IP    D+ +L  IEL +C       A+ + + + D G
Sbjct  827  VFRFCNKLKEIPFEIGDIPSLQVIELYSCSPYATRLARMIQQDQIDSG  874



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 2/128 (2%)
 Frame = -3

Query  389  LPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGGDQ  213
            LPW  + ++G LPNLEVLKLK+    G  WE TEG F +LK L ++  +   W +     
Sbjct  711  LPWESMTIVGSLPNLEVLKLKKGAFRGLKWETTEGEFCRLKVLVMDRTDPRIW-ITESSH  769

Query  212  FRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPII  33
            F  L  LVL+KC  L  IP    ++ TL  I++  C   + ESA+++ E  + +G E  +
Sbjct  770  FPTLEVLVLRKCYTLSEIPYSICEIQTLEQIKVDCCNSSIGESAKRIQEEVQSFGNELEV  829

Query  32   IRHVDQIQ  9
            +    Q++
Sbjct  830  LTITSQLE  837



>gb|EYU24428.1| hypothetical protein MIMGU_mgv1a001134mg [Erythranthe guttata]
Length=880

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 93/174 (53%), Gaps = 16/174 (9%)
 Frame = -3

Query  524  ENLGSLDKLETLMIAF----RKGSPTGLQNLESLPlnlnikklklKRTC-LPWSEINVIG  360
            +NL  L KLE+L   F    R+     L+NL S P++L    L   R C L W ++ +IG
Sbjct  687  KNLRRLSKLESLKCEFLVIPRRS--LLLKNL-SFPISLKKLSL---RGCSLHWGDLTMIG  740

Query  359  MLPNLE--VLKLKQVSDGPDWEPTEGNFRKLKFLYLE-AENLESWEVDGGDQFRCLTRLV  189
             LP LE  VL +  VS G +W+P EG F +LKFL L    +L+ W  D    F  L +LV
Sbjct  741  SLPYLEGLVLGVNSVS-GSEWDPVEGEFLRLKFLELYYVTDLKHWNADSC-HFPVLEKLV  798

Query  188  LKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEPIIIR  27
            L +  KLE IP G  ++ TL  IEL+ C      SA K+ E +E  G E + +R
Sbjct  799  LTEINKLEEIPLGIGEIPTLGFIELVRCSESAAISAVKILEEQESLGNEGLFVR  852



>gb|EYU21836.1| hypothetical protein MIMGU_mgv1a023326mg [Erythranthe guttata]
Length=923

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 96/172 (56%), Gaps = 5/172 (3%)
 Frame = -3

Query  551  PEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQNL-ESLPlnlnikklklKRTCLPWSE  375
            P+      ++NLG L KLE+L           + ++ ++  L  ++KKL L  TCL W +
Sbjct  744  PQGFLSYRVDNLGHLHKLESLRFYIYSLKMRSVNDMVQNFILPNSLKKLTLMGTCLKWED  803

Query  374  INV-IGMLPNLEVLKLKQVSD-GPDWEPTEGNFRKLKFLYLE-AENLESWEVDGGDQFRC  204
            + + IG+LPNL+VLKL++ S  G  WE  EG F  LK L +    +L+ W  D  + F  
Sbjct  804  MKLKIGLLPNLQVLKLEKESFVGHKWETIEGQFCNLKVLLISLCRDLQWWTTDN-NHFPR  862

Query  203  LTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
            L  L L+   KL+ IP+   +++TL SI+LL C      SA+++ + +ED+G
Sbjct  863  LEHLHLQGLHKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKQILKEQEDFG  914



>emb|CDP17920.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 94/184 (51%), Gaps = 13/184 (7%)
 Frame = -3

Query  569   CGSKPSPEAIEPAN-LENLGSLDKLETLMIAFRKGSPTGLQNLE-SLPlnlnikklklKR  396
             C    SP++    N    L  L  LE+L I F  GSP  L N E +LPLNL    L    
Sbjct  1310  CIFYESPDSSTNCNQFPRLNCLTHLESLKI-FYCGSP--LNNGEFNLPLNLKKLTLSNF-  1365

Query  395   TCLPWSEINVIGMLPNLEVLKLKQ-VSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
              CL W  I+ IG LPNLEVLKL     +G  W   E  F+ LKFL L+  N+  W     
Sbjct  1366  -CLQWIRISTIGRLPNLEVLKLHSGAFEGKIWN-VEEEFKNLKFLSLDNLNIAQWNASCH  1423

Query  218   DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
             + F  L RLVL+ C  LE IP  F  + +L  IE+  C    +ESA+++   +EDYG   
Sbjct  1424  N-FPKLERLVLQNCKDLEEIPEDFGMIGSLRMIEVHWCGKSAEESAEQI---KEDYGDIK  1479

Query  38    IIIR  27
             + IR
Sbjct  1480  VFIR  1483



>ref|XP_010677242.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010677243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
Length=1165

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 86/165 (52%), Gaps = 5/165 (3%)
 Frame = -3

Query  527   LENLGSLDKLETLMIAFRKGSPTGLQNLESLPlnlnikklklKRTCLPWSEINVIGM-LP  351
                L  L+ LE L +++RK          +L    ++K+L L   CLPW +++V+   +P
Sbjct  984   FHALDFLNHLEILHLSYRKSWRDRKNKAATLSFPPSLKQLTLSEFCLPWKQMSVLAKSMP  1043

Query  350   NLEVLKLKQVS---DGPDWEPTEGNFRKLKFLYLEAENLESWEVD-GGDQFRCLTRLVLK  183
              LEVLKL  ++   +  D +  E  F +LKF  L+  N+ +W +    D F  L  LV+K
Sbjct  1044  KLEVLKLVNIAFEGEQCDMDTDEVEFSELKFFKLKGINIHNWIISCSADAFPKLECLVIK  1103

Query  182   KCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYG  48
              C KL  IP+ F D   L  I L  C   V++SA ++ E ++DYG
Sbjct  1104  YCDKLRKIPSSFVDNKKLRLILLEGCKSSVEKSANQIKEEQQDYG  1148



>gb|EYU21178.1| hypothetical protein MIMGU_mgv1a019709mg [Erythranthe guttata]
Length=889

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 91/173 (53%), Gaps = 9/173 (5%)
 Frame = -3

Query  584  KLGIICGSKPSPEAIEPANLENLGSLDKLETLMIAFRKGSPTGLQN-LESLPlnlnikkl  408
            KL I   S P   + E   L N+  L KLE+L        P  + N L+ L    ++KKL
Sbjct  699  KLNIKYVSDPQRSSTE-YRLYNICRLHKLESLTCC-----PYDVDNVLQKLTFPSSLKKL  752

Query  407  klKRTCLPWSEINVIGMLPNLEVLKLK-QVSDGPDWEPTEGNFRKLKFLYLEAENLESWE  231
             L+ + + W ++ VIG LPNLEVLKLK ++  G  W P EG F +LKFL ++  +L +W 
Sbjct  753  CLEGSMIRWEDLTVIGSLPNLEVLKLKNRLVKGSVWNPVEGEFLRLKFLLIQWSDLVNWN  812

Query  230  VDGGDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKL  72
             D    F  L +LVL+   KLE IP    ++ TL  I++  C      SA K+
Sbjct  813  ADSS-HFPVLEKLVLESLKKLEEIPLDIGEIPTLGLIQVHWCSESAAISAMKI  864



>emb|CDP04885.1| unnamed protein product [Coffea canephora]
Length=989

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 8/128 (6%)
 Frame = -3

Query  398  RTCLPWSEINVIGMLPNLEVLKL-KQVSDGPDWEPTEGNFRKLKFLYLEAENLESWEVDG  222
            R  LPW  ++ IG L NLEVLKL     +G  W+  EG F KLKFL L++ N+  W    
Sbjct  867  RLRLPWKHMSAIGRLQNLEVLKLLSNAFEGRIWDMREGEFLKLKFLKLDSLNVVEWNA-T  925

Query  221  GDQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIE  42
             D    L +LVL+ C +LE +P  F ++ TL  I++  C +  +ES + + E     GIE
Sbjct  926  CDHLLNLQQLVLRHCKELEAVPFSFGEIPTLLMIQVQRCGLSTEESVRDIEEQ----GIE  981

Query  41   --PIIIRH  24
               I I H
Sbjct  982  GLKIFISH  989



>ref|XP_011071886.1| PREDICTED: uncharacterized protein LOC105157233 [Sesamum indicum]
Length=336

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = -3

Query  392  CLPWSEINVIG-MLPNLEVLKLKQVS-DGPDWEPTEGNFRKLKFLYLEAENLESWEVDGG  219
            C+PW E+ V G +LPNLE LKL   +  G +W P EG F +LK L +    L  W  +  
Sbjct  212  CIPWEEMTVFGSVLPNLEKLKLYHSACKGSEWSPVEGQFPRLKVLIIWNNILVRWRAESI  271

Query  218  DQFRCLTRLVLKKCTKLEGIPTGFEDVNTLASIELLNCPVPVKESAQKLNEHREDYGIEP  39
              F  L RL L     LE IP+G  D+ TL SI+L +C      SA+++ E ++ +G E 
Sbjct  272  -HFPNLERLHLSSMQCLEEIPSGIGDIPTLLSIDLYDCSDSCVNSAKQILEEQQSFGNET  330

Query  38   I  36
            +
Sbjct  331  L  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 679482509436