BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24346_g1_i2 len=1837 path=[1959:0-511 2471:512-557 2517:558-578
2538:579-660 2620:661-858 2818:859-895 2855:896-898 @2858@!:899-1374
4982:1375-1407 5015:1408-1431 3391:1432-1471 91:1472-1508
128:1509-1512 132:1513-1579 4390:1580-1621 4432:1622-1726
3693:1727-1750 4560:1751-1836]

Length=1837
                                                                      Score     E

ref|XP_002323910.2|  hypothetical protein POPTR_0017s04320g             243   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007030131.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    243   3e-69   
ref|XP_007030134.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    242   3e-69   
ref|XP_009610450.1|  PREDICTED: vinorine synthase-like                  239   3e-68   
ref|XP_002308780.1|  hypothetical protein POPTR_0006s01190g             239   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011008627.1|  PREDICTED: vinorine synthase-like                  239   5e-68   
ref|XP_011001807.1|  PREDICTED: vinorine synthase-like                  239   6e-68   
ref|XP_006372816.1|  hypothetical protein POPTR_0017s05330g             238   1e-67   
ref|XP_007037900.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    236   7e-67   
gb|KDP40899.1|  hypothetical protein JCGZ_24898                         234   4e-66   
ref|XP_004294207.1|  PREDICTED: vinorine synthase-like                  232   3e-65   
ref|XP_002511243.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    229   3e-64   Ricinus communis
ref|XP_006482086.1|  PREDICTED: vinorine synthase-like                  227   1e-63   
ref|XP_011041297.1|  PREDICTED: vinorine synthase-like                  225   7e-63   
ref|XP_008353036.1|  PREDICTED: vinorine synthase-like                  225   8e-63   
ref|XP_011037141.1|  PREDICTED: vinorine synthase-like                  225   8e-63   
ref|XP_008368264.1|  PREDICTED: vinorine synthase-like                  224   1e-62   
gb|KDO53588.1|  hypothetical protein CISIN_1g048249mg                   224   1e-62   
ref|XP_009342764.1|  PREDICTED: vinorine synthase-like                  223   4e-62   
ref|XP_007044963.1|  HXXXD-type acyl-transferase family protein, ...    222   8e-62   
ref|XP_006430560.1|  hypothetical protein CICLE_v10011796mg             222   1e-61   
ref|XP_008389785.1|  PREDICTED: vinorine synthase-like                  221   2e-61   
ref|XP_007044964.1|  HXXXD-type acyl-transferase family protein, ...    221   3e-61   
ref|XP_002511241.1|  Anthranilate N-benzoyltransferase protein, p...    219   1e-60   Ricinus communis
ref|XP_008222084.1|  PREDICTED: BAHD acyltransferase At5g47980-like     218   5e-60   
ref|XP_006430562.1|  hypothetical protein CICLE_v10013397mg             217   8e-60   
ref|XP_008360182.1|  PREDICTED: vinorine synthase-like                  216   1e-59   
ref|XP_010044504.1|  PREDICTED: vinorine synthase-like                  216   2e-59   
ref|XP_009359305.1|  PREDICTED: vinorine synthase                       216   2e-59   
gb|KDO45520.1|  hypothetical protein CISIN_1g039563mg                   216   3e-59   
ref|XP_008240535.1|  PREDICTED: vinorine synthase-like                  216   3e-59   
ref|XP_006380880.1|  hypothetical protein POPTR_0006s01180g             214   4e-59   
ref|XP_008222021.1|  PREDICTED: BAHD acyltransferase At5g47980-like     215   4e-59   
ref|XP_006292162.1|  hypothetical protein CARUB_v10018368mg             214   6e-59   
ref|XP_008222087.1|  PREDICTED: vinorine synthase-like                  214   9e-59   
ref|XP_008222013.1|  PREDICTED: vinorine synthase-like                  214   1e-58   
ref|XP_008222012.1|  PREDICTED: vinorine synthase-like                  214   1e-58   
ref|XP_009359286.1|  PREDICTED: vinorine synthase-like                  213   1e-58   
ref|XP_006443121.1|  hypothetical protein CICLE_v10023671mg             214   1e-58   
ref|XP_002267341.1|  PREDICTED: vinorine synthase                       213   2e-58   Vitis vinifera
ref|XP_006438136.1|  hypothetical protein CICLE_v10033777mg             212   4e-58   
ref|XP_006484023.1|  PREDICTED: vinorine synthase-like                  213   4e-58   
ref|XP_008222015.1|  PREDICTED: vinorine synthase-like                  212   5e-58   
ref|XP_011071304.1|  PREDICTED: vinorine synthase-like                  212   6e-58   
ref|XP_011071181.1|  PREDICTED: vinorine synthase-like isoform X1       211   6e-58   
ref|XP_007037899.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    212   6e-58   
ref|XP_006395599.1|  hypothetical protein EUTSA_v10005565mg             211   1e-57   
ref|XP_008389833.1|  PREDICTED: vinorine synthase-like                  210   3e-57   
ref|XP_008226170.1|  PREDICTED: vinorine synthase-like                  211   3e-57   
ref|XP_008226167.1|  PREDICTED: vinorine synthase-like                  210   4e-57   
ref|XP_010554168.1|  PREDICTED: vinorine synthase                       210   7e-57   
ref|XP_011042323.1|  PREDICTED: vinorine synthase-like                  208   1e-56   
ref|XP_002315639.2|  transferase family protein                         208   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_008340164.1|  PREDICTED: vinorine synthase-like                  208   2e-56   
ref|XP_002514980.1|  Anthranilate N-benzoyltransferase protein, p...    208   2e-56   Ricinus communis
gb|KDO41287.1|  hypothetical protein CISIN_1g044243mg                   207   2e-56   
ref|XP_006487765.1|  PREDICTED: vinorine synthase-like                  207   2e-56   
ref|XP_006423966.1|  hypothetical protein CICLE_v10028504mg             207   4e-56   
ref|XP_002875299.1|  transferase family protein                         207   5e-56   
dbj|BAB01067.1|  acetyltranferase-like protein                          207   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189233.1|  HXXXD-type acyl-transferase-like protein              207   6e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KCW86595.1|  hypothetical protein EUGRSUZ_B03227                     207   6e-56   
gb|KDP36802.1|  hypothetical protein JCGZ_08093                         207   7e-56   
ref|XP_008222018.1|  PREDICTED: vinorine synthase-like                  206   7e-56   
ref|XP_010044505.1|  PREDICTED: vinorine synthase-like                  206   7e-56   
emb|CDP08574.1|  unnamed protein product                                206   8e-56   
ref|XP_010506970.1|  PREDICTED: vinorine synthase-like                  206   2e-55   
emb|CDP13291.1|  unnamed protein product                                205   2e-55   
ref|XP_011070326.1|  PREDICTED: vinorine synthase-like                  204   4e-55   
ref|XP_004239499.1|  PREDICTED: vinorine synthase                       204   4e-55   
emb|CDY39174.1|  BnaC09g21700D                                          205   4e-55   
emb|CDP10330.1|  unnamed protein product                                204   8e-55   
ref|XP_008222079.1|  PREDICTED: vinorine synthase-like                  202   1e-54   
gb|KDP26742.1|  hypothetical protein JCGZ_17900                         202   2e-54   
gb|KDP26741.1|  hypothetical protein JCGZ_17899                         202   2e-54   
ref|XP_002511244.1|  Anthranilate N-benzoyltransferase protein, p...    202   3e-54   Ricinus communis
ref|XP_007028226.1|  HXXXD-type acyl-transferase family protein, ...    202   4e-54   
ref|XP_010100293.1|  Vinorine synthase                                  201   5e-54   
ref|XP_006443122.1|  hypothetical protein CICLE_v10020052mg             201   7e-54   
gb|KDP35375.1|  hypothetical protein JCGZ_10359                         201   1e-53   
ref|XP_006427936.1|  hypothetical protein CICLE_v10027290mg             200   1e-53   
ref|XP_010514234.1|  PREDICTED: vinorine synthase-like                  199   3e-53   
ref|XP_006345618.1|  PREDICTED: vinorine synthase-like                  199   4e-53   
ref|XP_002517535.1|  Anthranilate N-benzoyltransferase protein, p...    199   4e-53   Ricinus communis
ref|XP_007134122.1|  hypothetical protein PHAVU_010G020900g             199   4e-53   
ref|XP_009361768.1|  PREDICTED: BAHD acyltransferase At5g47980-like     198   7e-53   
gb|KCW86594.1|  hypothetical protein EUGRSUZ_B03226                     197   7e-53   
ref|XP_004310025.1|  PREDICTED: vinorine synthase-like                  197   8e-53   
ref|XP_006482379.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    198   8e-53   
ref|XP_006348577.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    197   1e-52   
ref|XP_006341810.1|  PREDICTED: vinorine synthase-like                  197   1e-52   
ref|XP_009114100.1|  PREDICTED: vinorine synthase                       197   2e-52   
emb|CDY04190.1|  BnaA09g19680D                                          197   2e-52   
ref|XP_007039558.1|  Anthranilate N-benzoyltransferase protein, p...    197   2e-52   
ref|XP_009359304.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    196   3e-52   
ref|XP_006430561.1|  hypothetical protein CICLE_v10011733mg             196   3e-52   
ref|XP_006420178.1|  hypothetical protein CICLE_v10006986mg             196   4e-52   
ref|XP_008390114.1|  PREDICTED: vinorine synthase-like                  196   4e-52   
ref|XP_006582966.1|  PREDICTED: vinorine synthase-like                  196   4e-52   
ref|XP_006443123.1|  hypothetical protein CICLE_v10024067mg             196   4e-52   
ref|XP_010499177.1|  PREDICTED: vinorine synthase-like                  196   5e-52   
ref|XP_009361770.1|  PREDICTED: vinorine synthase-like                  196   5e-52   
ref|XP_002514976.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    196   6e-52   Ricinus communis
gb|KDO46443.1|  hypothetical protein CISIN_1g043811mg                   195   8e-52   
ref|XP_003616845.1|  Vinorine synthase                                  195   1e-51   
ref|XP_002510627.1|  Anthranilate N-benzoyltransferase protein, p...    195   1e-51   Ricinus communis
gb|KDP30964.1|  hypothetical protein JCGZ_11340                         194   1e-51   
emb|CDP08578.1|  unnamed protein product                                194   1e-51   
ref|XP_010460459.1|  PREDICTED: vinorine synthase-like                  194   1e-51   
ref|XP_010046662.1|  PREDICTED: vinorine synthase-like                  194   1e-51   
ref|XP_011071306.1|  PREDICTED: vinorine synthase-like                  194   2e-51   
gb|KDO36951.1|  hypothetical protein CISIN_1g045540mg                   194   2e-51   
gb|ACI45390.1|  salutaridinol 7-O-acetyltransferase                     195   2e-51   Papaver somniferum
ref|XP_008340165.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    194   2e-51   
gb|KDP30966.1|  hypothetical protein JCGZ_11342                         194   4e-51   
ref|XP_010907772.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    193   4e-51   
ref|XP_002514981.1|  Salutaridinol 7-O-acetyltransferase, putative      193   5e-51   Ricinus communis
ref|XP_008383117.1|  PREDICTED: vinorine synthase-like                  193   5e-51   
ref|XP_009790148.1|  PREDICTED: vinorine synthase-like                  192   7e-51   
ref|XP_008389789.1|  PREDICTED: vinorine synthase-like                  192   7e-51   
ref|XP_009359355.1|  PREDICTED: vinorine synthase-like                  192   1e-50   
ref|XP_006493396.1|  PREDICTED: vinorine synthase-like                  191   1e-50   
gb|KDP38750.1|  hypothetical protein JCGZ_04103                         192   1e-50   
emb|CDP10332.1|  unnamed protein product                                191   2e-50   
ref|XP_010044503.1|  PREDICTED: vinorine synthase-like                  191   2e-50   
ref|XP_010682956.1|  PREDICTED: BAHD acyltransferase At5g47980          192   2e-50   
ref|XP_010100286.1|  Deacetylvindoline O-acetyltransferase              191   3e-50   
ref|XP_006435345.1|  hypothetical protein CICLE_v10001106mg             191   3e-50   
gb|KGN64382.1|  hypothetical protein Csa_1G050210                       191   3e-50   
ref|XP_004310187.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    191   3e-50   
ref|XP_008372859.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   4e-50   
ref|XP_006479029.1|  PREDICTED: vinorine synthase-like                  191   4e-50   
ref|XP_010025365.1|  PREDICTED: vinorine synthase-like                  190   4e-50   
ref|XP_004504492.1|  PREDICTED: vinorine synthase-like                  190   4e-50   
sp|Q94FT4.1|SALAT_PAPSO  RecName: Full=Salutaridinol 7-O-acetyltr...    191   4e-50   Papaver somniferum
gb|KCW86592.1|  hypothetical protein EUGRSUZ_B03224                     190   4e-50   
ref|XP_003521961.1|  PREDICTED: vinorine synthase-like                  190   7e-50   
ref|XP_006342247.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    189   7e-50   
ref|XP_004238629.1|  PREDICTED: vinorine synthase-like                  189   7e-50   
ref|XP_009361854.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   9e-50   
ref|XP_009759141.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    189   1e-49   
ref|XP_006415801.1|  hypothetical protein EUTSA_v10007650mg             189   1e-49   
gb|KDP26743.1|  hypothetical protein JCGZ_17901                         189   2e-49   
ref|XP_004310028.1|  PREDICTED: vinorine synthase-like                  189   2e-49   
ref|XP_008226171.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   2e-49   
gb|ADD71922.1|  BAHD-type acyltransferase                               188   2e-49   Actaea racemosa
gb|EYU22560.1|  hypothetical protein MIMGU_mgv1a020007mg                188   2e-49   
ref|XP_004301806.1|  PREDICTED: vinorine synthase-like                  188   2e-49   
gb|KDP36822.1|  hypothetical protein JCGZ_08113                         193   2e-49   
ref|XP_010046626.1|  PREDICTED: vinorine synthase-like                  188   2e-49   
gb|KEH20541.1|  3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase         188   3e-49   
ref|XP_010051001.1|  PREDICTED: vinorine synthase-like                  188   3e-49   
ref|XP_009342768.1|  PREDICTED: vinorine synthase-like                  188   3e-49   
ref|XP_010682887.1|  PREDICTED: vinorine synthase-like                  187   4e-49   
gb|KDO82048.1|  hypothetical protein CISIN_1g012688mg                   188   4e-49   
ref|XP_008383113.1|  PREDICTED: vinorine synthase-like                  189   5e-49   
ref|XP_007134039.1|  hypothetical protein PHAVU_010G014300g             187   6e-49   
ref|XP_004143047.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    187   7e-49   
ref|XP_006484024.1|  PREDICTED: BAHD acyltransferase At5g47980-like     187   1e-48   
ref|XP_009371390.1|  PREDICTED: vinorine synthase-like                  187   1e-48   
ref|XP_010044501.1|  PREDICTED: vinorine synthase-like                  186   1e-48   
ref|XP_007134037.1|  hypothetical protein PHAVU_010G014100g             186   1e-48   
ref|XP_002314561.1|  transferase family protein                         186   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008226591.1|  PREDICTED: BAHD acyltransferase At5g47980-like     187   2e-48   
ref|XP_010027285.1|  PREDICTED: BAHD acyltransferase At5g47980-like     186   2e-48   
ref|XP_009361769.1|  PREDICTED: BAHD acyltransferase At5g47980-like     186   2e-48   
ref|XP_004135298.1|  PREDICTED: vinorine synthase-like                  186   2e-48   
gb|KEH20540.1|  HXXXD-type acyl-transferase family protein              186   2e-48   
gb|ACI45392.1|  salutaridinol 7-O-acetyltransferase                     186   2e-48   Papaver bracteatum [great scarlet poppy]
ref|XP_007037901.1|  Anthranilate N-benzoyltransferase protein, p...    185   3e-48   
ref|XP_002515007.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    185   4e-48   Ricinus communis
ref|XP_009773462.1|  PREDICTED: vinorine synthase-like                  184   4e-48   
ref|XP_010100291.1|  Salutaridinol 7-O-acetyltransferase                185   4e-48   
ref|XP_004240930.1|  PREDICTED: vinorine synthase-like                  185   4e-48   
gb|AFK43775.1|  unknown                                                 184   4e-48   
gb|AES72092.2|  anthranilate N-benzoyltransferase                       184   5e-48   
ref|XP_003601841.1|  Vinorine synthase                                  186   5e-48   
ref|XP_004140566.1|  PREDICTED: BAHD acyltransferase At5g47980-like     184   6e-48   
ref|XP_002271612.1|  PREDICTED: vinorine synthase-like                  184   7e-48   Vitis vinifera
ref|XP_009606783.1|  PREDICTED: vinorine synthase-like                  184   7e-48   
ref|XP_008797275.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    184   8e-48   
ref|XP_006473916.1|  PREDICTED: vinorine synthase-like                  185   9e-48   
ref|XP_006441394.1|  hypothetical protein CICLE_v10023627mg             183   9e-48   
ref|XP_006345840.1|  PREDICTED: BAHD acyltransferase At5g47980-like     184   9e-48   
ref|XP_002514983.1|  Anthranilate N-benzoyltransferase protein, p...    184   1e-47   Ricinus communis
ref|XP_008372855.1|  PREDICTED: BAHD acyltransferase At5g47980-like     184   1e-47   
ref|XP_002311734.1|  hypothetical protein POPTR_0008s18070g             184   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_003616843.1|  Salutaridinol 7-O-acetyltransferase                184   1e-47   
ref|XP_004310024.1|  PREDICTED: vinorine synthase-like                  184   1e-47   
ref|XP_006438135.1|  hypothetical protein CICLE_v10031490mg             184   1e-47   
ref|XP_009780612.1|  PREDICTED: vinorine synthase-like                  183   1e-47   
ref|XP_011101100.1|  PREDICTED: vinorine synthase-like                  184   2e-47   
ref|XP_011083978.1|  PREDICTED: vinorine synthase-like                  183   2e-47   
emb|CDP07885.1|  unnamed protein product                                183   2e-47   
ref|XP_010556178.1|  PREDICTED: vinorine synthase                       184   2e-47   
ref|XP_011021361.1|  PREDICTED: BAHD acyltransferase At5g47980-like     183   2e-47   
ref|XP_009602470.1|  PREDICTED: vinorine synthase-like                  182   3e-47   
ref|XP_011101142.1|  PREDICTED: vinorine synthase-like                  182   3e-47   
gb|KDO48724.1|  hypothetical protein CISIN_1g047399mg                   181   3e-47   
ref|XP_008372831.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   3e-47   
ref|XP_007158727.1|  hypothetical protein PHAVU_002G177000g             182   3e-47   
ref|XP_002315640.2|  hypothetical protein POPTR_0010s06380g             181   3e-47   Populus trichocarpa [western balsam poplar]
gb|KEH20539.1|  HXXXD-type acyl-transferase family protein              182   4e-47   
ref|XP_006432232.1|  hypothetical protein CICLE_v10001086mg             182   4e-47   
gb|KDO85073.1|  hypothetical protein CISIN_1g044625mg                   182   4e-47   
ref|XP_008372858.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   5e-47   
ref|XP_010528792.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   5e-47   
ref|XP_006465504.1|  PREDICTED: vinorine synthase-like                  182   6e-47   
ref|XP_008226064.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   6e-47   
ref|XP_006464646.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    182   6e-47   
ref|XP_006415694.1|  hypothetical protein EUTSA_v10007649mg             181   8e-47   
ref|XP_004295709.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   8e-47   
ref|XP_007029093.1|  HXXXD-type acyl-transferase family protein, ...    183   8e-47   
ref|XP_008446186.1|  PREDICTED: vinorine synthase-like                  181   8e-47   
ref|XP_008446094.1|  PREDICTED: vinorine synthase-like                  181   9e-47   
ref|NP_173852.4|  HXXXD-type acyl-transferase-like protein              181   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459937.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   9e-47   
ref|XP_008346587.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   1e-46   
gb|KDO85081.1|  hypothetical protein CISIN_1g015400mg                   180   1e-46   
ref|XP_010094574.1|  Salutaridinol 7-O-acetyltransferase                181   1e-46   
ref|XP_009780317.1|  PREDICTED: vinorine synthase-like                  181   1e-46   
ref|XP_002308878.2|  hypothetical protein POPTR_0006s03450g             180   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010025917.1|  PREDICTED: vinorine synthase-like                  180   2e-46   
ref|XP_008377211.1|  PREDICTED: vinorine synthase-like                  182   2e-46   
ref|XP_004310183.1|  PREDICTED: vinorine synthase-like                  180   2e-46   
emb|CDP14000.1|  unnamed protein product                                181   2e-46   
gb|KCW86588.1|  hypothetical protein EUGRSUZ_B03220                     179   2e-46   
ref|XP_011071305.1|  PREDICTED: vinorine synthase-like                  179   2e-46   
ref|XP_002514982.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    180   2e-46   Ricinus communis
ref|XP_011040773.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    180   2e-46   
gb|KDO46444.1|  hypothetical protein CISIN_1g037811mg                   180   2e-46   
gb|KHN36442.1|  Vinorine synthase                                       181   2e-46   
ref|XP_007044970.1|  HXXXD-type acyl-transferase family protein, ...    179   3e-46   
ref|XP_009763180.1|  PREDICTED: vinorine synthase-like                  179   3e-46   
gb|KDP45585.1|  hypothetical protein JCGZ_17192                         179   3e-46   
ref|XP_010061156.1|  PREDICTED: vinorine synthase-like                  179   4e-46   
gb|KCW68080.1|  hypothetical protein EUGRSUZ_F01765                     179   4e-46   
ref|XP_009588476.1|  PREDICTED: vinorine synthase-like                  179   4e-46   
ref|XP_004310026.1|  PREDICTED: vinorine synthase-like                  179   4e-46   
ref|XP_002314550.2|  hypothetical protein POPTR_0010s06640g             179   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011029622.1|  PREDICTED: BAHD acyltransferase At5g47980          179   4e-46   
gb|KDO53587.1|  hypothetical protein CISIN_1g040754mg                   179   5e-46   
ref|XP_004301008.1|  PREDICTED: vinorine synthase-like                  179   5e-46   
ref|XP_003537018.2|  PREDICTED: vinorine synthase-like                  181   5e-46   
ref|XP_004310177.1|  PREDICTED: vinorine synthase-like                  180   5e-46   
ref|XP_006429944.1|  hypothetical protein CICLE_v10011699mg             179   5e-46   
ref|XP_006443317.1|  hypothetical protein CICLE_v10020331mg             178   6e-46   
ref|XP_008226087.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   6e-46   
ref|XP_007018014.1|  HXXXD-type acyl-transferase family protein, ...    182   6e-46   
ref|XP_010092011.1|  BAHD acyltransferase                               179   6e-46   
ref|XP_008444410.1|  PREDICTED: vinorine synthase                       179   7e-46   
ref|XP_006598680.1|  PREDICTED: uncharacterized protein LOC100305...    179   8e-46   
ref|XP_002533732.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    178   9e-46   Ricinus communis
ref|XP_006432226.1|  hypothetical protein CICLE_v10001111mg             178   9e-46   
ref|XP_010425269.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   1e-45   
ref|XP_008226065.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   1e-45   
gb|AFK42496.1|  unknown                                                 178   1e-45   
ref|XP_008222017.1|  PREDICTED: vinorine synthase-like                  178   1e-45   
ref|XP_002514985.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    178   1e-45   Ricinus communis
gb|KDP36821.1|  hypothetical protein JCGZ_08112                         178   1e-45   
ref|XP_004301957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   1e-45   
ref|XP_010048659.1|  PREDICTED: vinorine synthase-like                  177   2e-45   
ref|XP_002284817.2|  PREDICTED: vinorine synthase-like                  177   2e-45   Vitis vinifera
ref|XP_006372866.1|  hypothetical protein POPTR_0017s05810g             177   2e-45   
ref|XP_004135508.1|  PREDICTED: vinorine synthase-like                  177   2e-45   
ref|XP_009606831.1|  PREDICTED: vinorine synthase-like                  177   2e-45   
ref|XP_008226164.1|  PREDICTED: vinorine synthase-like                  178   2e-45   
ref|XP_008222020.1|  PREDICTED: BAHD acyltransferase At5g47980-like     177   3e-45   
ref|XP_002530172.1|  Anthranilate N-benzoyltransferase protein, p...    177   3e-45   Ricinus communis
ref|XP_006414522.1|  hypothetical protein EUTSA_v10025210mg             177   4e-45   
gb|KDP36818.1|  hypothetical protein JCGZ_08109                         177   4e-45   
ref|XP_011085805.1|  PREDICTED: vinorine synthase-like                  176   4e-45   
ref|XP_006429945.1|  hypothetical protein CICLE_v10011714mg             176   5e-45   
ref|XP_008226094.1|  PREDICTED: BAHD acyltransferase At5g47980-like     176   5e-45   
ref|XP_004299139.1|  PREDICTED: vinorine synthase-like isoform 1        177   5e-45   
ref|XP_010044502.1|  PREDICTED: vinorine synthase-like                  176   5e-45   
ref|XP_004299140.1|  PREDICTED: vinorine synthase-like isoform 2        177   5e-45   
ref|XP_004242673.1|  PREDICTED: vinorine synthase-like                  176   5e-45   
ref|XP_008383041.1|  PREDICTED: BAHD acyltransferase At5g47980-like     176   5e-45   
ref|XP_003532711.2|  PREDICTED: vinorine synthase-like                  176   5e-45   
gb|KDO58317.1|  hypothetical protein CISIN_1g037128mg                   176   6e-45   
ref|XP_011037677.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    176   6e-45   
ref|XP_002529587.1|  Anthranilate N-benzoyltransferase protein, p...    176   7e-45   
ref|XP_002305585.1|  hypothetical protein POPTR_0004s01720g             176   7e-45   
sp|Q70PR7.2|VINSY_RAUSE  RecName: Full=Vinorine synthase                175   8e-45   
ref|XP_008446095.1|  PREDICTED: vinorine synthase-like                  175   9e-45   
ref|XP_008389788.1|  PREDICTED: vinorine synthase-like                  176   9e-45   
ref|XP_010064604.1|  PREDICTED: vinorine synthase-like                  175   1e-44   
ref|XP_004514780.1|  PREDICTED: vinorine synthase-like                  175   1e-44   
ref|NP_001238226.1|  uncharacterized protein LOC100305374               175   1e-44   
ref|XP_004159582.1|  PREDICTED: vinorine synthase-like                  174   1e-44   
ref|XP_004292913.1|  PREDICTED: vinorine synthase-like                  176   2e-44   
ref|XP_010040066.1|  PREDICTED: vinorine synthase-like                  175   2e-44   
ref|XP_008392421.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    175   2e-44   
ref|XP_011086241.1|  PREDICTED: vinorine synthase-like                  174   2e-44   
ref|XP_004295693.1|  PREDICTED: BAHD acyltransferase At5g47980-like     175   2e-44   
gb|KDO37672.1|  hypothetical protein CISIN_1g0394691mg                  171   2e-44   
ref|XP_011041559.1|  PREDICTED: BAHD acyltransferase At5g47980-like     174   2e-44   
ref|XP_011000149.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    174   2e-44   
ref|XP_006380275.1|  hypothetical protein POPTR_0007s00980g             173   2e-44   
ref|XP_008240679.1|  PREDICTED: vinorine synthase-like                  175   2e-44   
gb|KHN12420.1|  Vinorine synthase                                       175   2e-44   
gb|KDO52922.1|  hypothetical protein CISIN_1g036706mg                   175   2e-44   
gb|KCW81000.1|  hypothetical protein EUGRSUZ_C02376                     174   3e-44   
ref|XP_008358908.1|  PREDICTED: vinorine synthase-like                  174   3e-44   
ref|XP_007018005.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    174   3e-44   
ref|XP_010050993.1|  PREDICTED: vinorine synthase-like                  174   3e-44   
ref|XP_009147434.1|  PREDICTED: BAHD acyltransferase At5g47980-like     174   3e-44   
emb|CDY22927.1|  BnaA01g18650D                                          173   4e-44   
ref|XP_011091741.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    173   4e-44   
ref|XP_007018004.1|  Anthranilate N-benzoyltransferase protein, p...    173   4e-44   
gb|KCW68076.1|  hypothetical protein EUGRSUZ_F01760                     174   4e-44   
ref|XP_006427169.1|  hypothetical protein CICLE_v10027043mg             174   5e-44   
gb|KCW57660.1|  hypothetical protein EUGRSUZ_H00424                     173   5e-44   
ref|XP_008444409.1|  PREDICTED: vinorine synthase-like                  173   5e-44   
ref|XP_009371379.1|  PREDICTED: vinorine synthase-like                  174   6e-44   
ref|XP_006853006.1|  hypothetical protein AMTR_s00174p00025490          173   6e-44   
ref|XP_008240680.1|  PREDICTED: vinorine synthase-like                  173   7e-44   
ref|XP_002868208.1|  hypothetical protein ARALYDRAFT_915274             173   7e-44   
ref|XP_006292868.1|  hypothetical protein CARUB_v10019128mg             172   8e-44   
ref|XP_009355133.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   9e-44   
emb|CDP21452.1|  unnamed protein product                                172   9e-44   
ref|XP_010090836.1|  Vinorine synthase                                  173   1e-43   
ref|XP_011000222.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    173   1e-43   
ref|XP_010025364.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   1e-43   
ref|XP_008346326.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   1e-43   
ref|XP_011041557.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   1e-43   
ref|XP_008241213.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   2e-43   
gb|KCW81026.1|  hypothetical protein EUGRSUZ_C02399                     170   2e-43   
ref|XP_004485524.1|  PREDICTED: vinorine synthase-like                  172   2e-43   
gb|KDP36817.1|  hypothetical protein JCGZ_08108                         172   2e-43   
ref|XP_002321827.2|  hypothetical protein POPTR_0015s14850g             171   2e-43   
ref|XP_006435339.1|  hypothetical protein CICLE_v10003197mg             171   3e-43   
ref|XP_002300646.2|  hypothetical protein POPTR_0002s01180g             171   3e-43   
ref|XP_011041560.1|  PREDICTED: BAHD acyltransferase At5g47980-like     171   3e-43   
gb|KCW45515.1|  hypothetical protein EUGRSUZ_L00759                     171   3e-43   
ref|XP_011031655.1|  PREDICTED: vinorine synthase-like                  171   3e-43   
ref|XP_010514678.1|  PREDICTED: BAHD acyltransferase At5g47980-like     171   3e-43   
ref|XP_010050981.1|  PREDICTED: vinorine synthase-like                  171   3e-43   
gb|AFB74620.1|  acetyltransferase 1                                     171   3e-43   
gb|KFK44501.1|  hypothetical protein AALP_AA1G265200                    171   4e-43   
ref|XP_010466664.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    171   4e-43   
ref|XP_011091918.1|  PREDICTED: vinorine synthase-like                  171   4e-43   
ref|XP_002875533.1|  transferase family protein                         171   4e-43   
ref|NP_189647.1|  HXXXD-type acyl-transferase-like protein              171   4e-43   
ref|XP_008386397.1|  PREDICTED: BAHD acyltransferase At5g47980-like     170   5e-43   
ref|XP_006378283.1|  hypothetical protein POPTR_0010s06650g             171   5e-43   
gb|KDO40774.1|  hypothetical protein CISIN_1g037323mg                   171   5e-43   
ref|XP_007135112.1|  hypothetical protein PHAVU_010G102000g             171   6e-43   
ref|XP_006427943.1|  hypothetical protein CICLE_v10027036mg             171   6e-43   
ref|XP_004310027.1|  PREDICTED: vinorine synthase-like                  170   6e-43   
ref|XP_010025920.1|  PREDICTED: vinorine synthase-like                  170   6e-43   
ref|XP_010529016.1|  PREDICTED: BAHD acyltransferase At5g47980-like     170   7e-43   
ref|XP_006432229.1|  hypothetical protein CICLE_v10001082mg             170   1e-42   
ref|XP_006379530.1|  hypothetical protein POPTR_0008s03350g             169   1e-42   
ref|XP_004511244.1|  PREDICTED: vinorine synthase-like                  169   1e-42   
gb|ACI45395.1|  salutaridinol 7-O-acetyltransferase                     170   1e-42   
ref|XP_011034885.1|  PREDICTED: vinorine synthase-like                  169   1e-42   
ref|XP_008222036.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    169   1e-42   
ref|XP_010100296.1|  Vinorine synthase                                  169   1e-42   
ref|XP_009353048.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   1e-42   
ref|XP_002524038.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    169   1e-42   
ref|XP_008226093.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   1e-42   
ref|XP_011037156.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    169   1e-42   
ref|XP_006427933.1|  hypothetical protein CICLE_v10026950mg             170   2e-42   
ref|XP_009358370.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   2e-42   
ref|XP_009782260.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    169   2e-42   
ref|XP_004295691.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   2e-42   
emb|CDY27594.1|  BnaA09g28130D                                          168   2e-42   
ref|XP_008383040.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   2e-42   
ref|XP_008383035.1|  PREDICTED: vinorine synthase-like                  169   2e-42   
ref|XP_006469323.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   2e-42   
ref|XP_006432227.1|  hypothetical protein CICLE_v10001125mg             169   2e-42   
gb|AHL24755.1|  ferulate monolignol transferase                         168   3e-42   
gb|KCW86591.1|  hypothetical protein EUGRSUZ_B03223                     167   3e-42   
ref|XP_009359423.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    168   3e-42   
ref|XP_006464857.1|  PREDICTED: vinorine synthase-like                  169   3e-42   
emb|CBI37948.3|  unnamed protein product                                175   3e-42   
ref|XP_006422067.1|  hypothetical protein CICLE_v10004997mg             168   3e-42   
emb|CDP15031.1|  unnamed protein product                                168   3e-42   
gb|KCW62003.1|  hypothetical protein EUGRSUZ_H04681                     168   4e-42   
ref|XP_010100288.1|  Salutaridinol 7-O-acetyltransferase                168   4e-42   
ref|XP_010025363.1|  PREDICTED: BAHD acyltransferase At5g47980-like     168   4e-42   
ref|XP_011069600.1|  PREDICTED: vinorine synthase-like                  168   4e-42   
ref|XP_008390113.1|  PREDICTED: BAHD acyltransferase At5g47980          167   4e-42   
ref|XP_002511237.1|  Anthranilate N-benzoyltransferase protein, p...    167   4e-42   
gb|KDO40654.1|  hypothetical protein CISIN_1g035869mg                   167   4e-42   
ref|XP_010647391.1|  PREDICTED: vinorine synthase-like                  167   4e-42   
gb|AET80686.1|  spermidine hydroxycinnamoyl transferase                 167   5e-42   
ref|XP_010527675.1|  PREDICTED: BAHD acyltransferase At5g47980-like     167   6e-42   
ref|XP_010046625.1|  PREDICTED: vinorine synthase-like                  165   6e-42   
ref|XP_006414524.1|  hypothetical protein EUTSA_v10027507mg             167   6e-42   
gb|KDO50293.1|  hypothetical protein CISIN_1g012496mg                   167   6e-42   
ref|XP_006464983.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    167   6e-42   
gb|KGN52789.1|  hypothetical protein Csa_4G001560                       167   6e-42   
ref|XP_010531415.1|  PREDICTED: BAHD acyltransferase At5g47980-like     167   6e-42   
ref|XP_004138261.1|  PREDICTED: vinorine synthase-like                  167   7e-42   
emb|CDP15027.1|  unnamed protein product                                167   7e-42   
ref|NP_199606.1|  HXXXD-type acyl-transferase-like protein              167   8e-42   
ref|XP_009628325.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    167   8e-42   
ref|XP_009783396.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    167   8e-42   
ref|XP_009628337.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    166   1e-41   
gb|KDO42120.1|  hypothetical protein CISIN_1g036438mg                   166   1e-41   
ref|XP_009778572.1|  PREDICTED: vinorine synthase-like                  166   1e-41   
ref|XP_002534423.1|  Anthranilate N-benzoyltransferase protein, p...    166   1e-41   
ref|XP_002533378.1|  Anthranilate N-benzoyltransferase protein, p...    166   1e-41   
emb|CDX84944.1|  BnaC05g21110D                                          166   2e-41   
ref|XP_008226162.1|  PREDICTED: vinorine synthase-like                  167   2e-41   
gb|AFK47265.1|  unknown                                                 166   2e-41   
ref|XP_008377073.1|  PREDICTED: vinorine synthase-like                  167   2e-41   
ref|XP_011013913.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    166   2e-41   
ref|XP_009371382.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    166   2e-41   
ref|XP_010088399.1|  Salutaridinol 7-O-acetyltransferase                166   2e-41   
ref|XP_010068270.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    166   2e-41   
ref|XP_009113794.1|  PREDICTED: BAHD acyltransferase At5g47980          166   2e-41   
ref|XP_011031656.1|  PREDICTED: vinorine synthase-like                  166   2e-41   
ref|XP_006351849.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    165   3e-41   
ref|XP_008226169.1|  PREDICTED: vinorine synthase-like                  165   3e-41   
ref|XP_006423655.1|  hypothetical protein CICLE_v10028515mg             165   3e-41   
ref|XP_008385235.1|  PREDICTED: uncharacterized protein LOC103447811    171   3e-41   
ref|XP_009590647.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    165   3e-41   
gb|KCW68078.1|  hypothetical protein EUGRSUZ_F01763                     165   3e-41   
ref|XP_008437382.1|  PREDICTED: BAHD acyltransferase At5g47980-like     165   3e-41   
emb|CDP15032.1|  unnamed protein product                                165   3e-41   
ref|XP_008226088.1|  PREDICTED: BAHD acyltransferase At5g47980-like     165   4e-41   
ref|XP_010061158.1|  PREDICTED: vinorine synthase-like                  166   4e-41   
ref|XP_002322397.2|  hypothetical protein POPTR_0015s14800g             165   4e-41   
ref|XP_007212426.1|  hypothetical protein PRUPE_ppa016640mg             165   4e-41   
ref|XP_011011265.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    165   4e-41   
ref|XP_002863835.1|  transferase family protein                         164   5e-41   
gb|KDP36806.1|  hypothetical protein JCGZ_08097                         165   5e-41   
ref|XP_010068276.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    164   5e-41   
gb|KDO60771.1|  hypothetical protein CISIN_1g012483mg                   165   6e-41   
ref|XP_009770804.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    164   6e-41   
ref|XP_007227141.1|  hypothetical protein PRUPE_ppa026262mg             164   6e-41   
emb|CAN63243.1|  hypothetical protein VITISV_028808                     164   6e-41   
ref|XP_006448149.1|  hypothetical protein CICLE_v10015171mg             164   7e-41   
ref|XP_004172751.1|  PREDICTED: vinorine synthase-like                  164   8e-41   
ref|XP_004243890.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    164   8e-41   
ref|XP_010514622.1|  PREDICTED: BAHD acyltransferase At5g47980-like     164   9e-41   
ref|XP_009764463.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    164   9e-41   
ref|XP_010097637.1|  Salutaridinol 7-O-acetyltransferase                164   1e-40   
gb|ACI45393.1|  salutaridinol 7-O-acetyltransferase                     164   1e-40   
ref|XP_006370899.1|  hypothetical protein POPTR_0019s01540g             164   1e-40   
ref|XP_004143048.1|  PREDICTED: vinorine synthase-like                  164   1e-40   
ref|XP_010088398.1|  Salutaridinol 7-O-acetyltransferase                163   1e-40   
ref|XP_011042322.1|  PREDICTED: vinorine synthase-like                  163   1e-40   
ref|XP_009371383.1|  PREDICTED: BAHD acyltransferase At5g47980-like     163   2e-40   
ref|XP_011085818.1|  PREDICTED: vinorine synthase-like                  163   2e-40   
ref|XP_010068273.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    163   2e-40   
ref|XP_006432225.1|  hypothetical protein CICLE_v10003243mg             163   2e-40   
ref|XP_006432233.1|  hypothetical protein CICLE_v10004053mg             163   2e-40   
ref|XP_004294209.1|  PREDICTED: BAHD acyltransferase At5g47980-like     163   2e-40   
ref|XP_010425699.1|  PREDICTED: BAHD acyltransferase At5g47980-like     162   2e-40   
ref|XP_006343697.1|  PREDICTED: vinorine synthase-like                  163   2e-40   
ref|XP_004301469.1|  PREDICTED: vinorine synthase-like                  163   2e-40   
ref|XP_002317521.2|  hypothetical protein POPTR_0011s12510g             163   2e-40   
ref|XP_010425703.1|  PREDICTED: BAHD acyltransferase At5g47980-like     162   2e-40   
ref|XP_008445555.1|  PREDICTED: vinorine synthase-like                  163   2e-40   
ref|XP_010100292.1|  Vinorine synthase                                  162   3e-40   
ref|XP_006370897.1|  hypothetical protein POPTR_0019s01520g             162   3e-40   
emb|CDP12986.1|  unnamed protein product                                162   3e-40   
gb|KDP30483.1|  hypothetical protein JCGZ_16162                         162   3e-40   
ref|XP_006379532.1|  hypothetical protein POPTR_0008s03420g             163   3e-40   
ref|XP_010100290.1|  Salutaridinol 7-O-acetyltransferase                162   3e-40   
ref|XP_004292912.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    163   3e-40   
ref|XP_004298111.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    162   4e-40   
ref|XP_004243011.1|  PREDICTED: vinorine synthase-like                  162   4e-40   
gb|KDP30484.1|  hypothetical protein JCGZ_16163                         162   4e-40   
emb|CDY68964.1|  BnaC01g42060D                                          162   5e-40   
ref|XP_004292909.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    162   5e-40   
ref|XP_008226172.1|  PREDICTED: BAHD acyltransferase At5g47980-like     161   5e-40   
ref|XP_009352970.1|  PREDICTED: vinorine synthase-like                  161   5e-40   
ref|XP_006363183.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    161   6e-40   
ref|XP_010065678.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    161   6e-40   
gb|KDO37664.1|  hypothetical protein CISIN_1g045515mg                   162   7e-40   
ref|XP_009371380.1|  PREDICTED: BAHD acyltransferase At5g47980-like     161   7e-40   
gb|KDP26744.1|  hypothetical protein JCGZ_17902                         161   8e-40   
ref|XP_006427935.1|  hypothetical protein CICLE_v10027530mg             162   8e-40   
ref|XP_006415800.1|  hypothetical protein EUTSA_v10007667mg             161   8e-40   
ref|XP_006387729.1|  hypothetical protein POPTR_0640s00200g             161   8e-40   
ref|XP_009371381.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    162   8e-40   
ref|XP_003538872.1|  PREDICTED: vinorine synthase-like                  160   9e-40   
ref|XP_006387730.1|  hypothetical protein POPTR_0640s00210g             161   9e-40   
emb|CBI18889.3|  unnamed protein product                                163   9e-40   
ref|XP_010100294.1|  Vinorine synthase                                  161   1e-39   
ref|XP_002530173.1|  Salutaridinol 7-O-acetyltransferase, putative      160   1e-39   
ref|XP_006282607.1|  hypothetical protein CARUB_v10004825mg             160   1e-39   
ref|XP_008226085.1|  PREDICTED: BAHD acyltransferase At5g47980-like     161   1e-39   
gb|KFK33809.1|  hypothetical protein AALP_AA5G062900                    160   1e-39   
ref|XP_010050974.1|  PREDICTED: vinorine synthase-like                  160   1e-39   
gb|KDO58318.1|  hypothetical protein CISIN_1g037986mg                   160   1e-39   
ref|XP_007148464.1|  hypothetical protein PHAVU_006G211000g             160   1e-39   
gb|AET80687.1|  putative spermidine hydroxycinnamoyl transferase        160   1e-39   
ref|XP_006428006.1|  hypothetical protein CICLE_v10025515mg             161   1e-39   
gb|AFM77973.1|  AT3                                                     160   2e-39   
emb|CDP13085.1|  unnamed protein product                                160   2e-39   
ref|XP_008372178.1|  PREDICTED: BAHD acyltransferase At5g47980-like     160   2e-39   
ref|XP_002893451.1|  transferase family protein                         160   2e-39   
ref|XP_011031654.1|  PREDICTED: vinorine synthase-like                  160   2e-39   



>ref|XP_002323910.2| hypothetical protein POPTR_0017s04320g [Populus trichocarpa]
 gb|EEF04043.2| hypothetical protein POPTR_0017s04320g [Populus trichocarpa]
Length=430

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 166/444 (37%), Positives = 249/444 (56%), Gaps = 26/444 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLA-LNVRLPFVFFYVSGRACHHTDTIDEl  1566
             M++++ SKEI++PS+PTP  LK YK S +DQLA  +  +P + FY         ++ D L
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFSADVPIILFYSPTDEISSKNS-DYL  59

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKS +KTL+L YP AGR K+D  +++CND+G  +I A VA NMS +L+  ++ +++QL  
Sbjct  60    KKSFAKTLTLFYPFAGRIKDDS-SIDCNDDGATYIEAHVAGNMSMILQQPDMDQLEQLQ-  117

Query  1385  SAKFYE--PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             S K  E   +P GK ++A QVN F CGGIAI   + H I DAS+LA F++ W + + G  
Sbjct  118   SCKPDENVDEPSGKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWGAISCGIY  177

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
              NN +G V D SS+ FPP  D S +  L  +    I +   ++  KRFV     +A LR 
Sbjct  178   DNN-AGTVVDCSSV-FPP-QDLSGMSFLYNL----IPRSSFNISTKRFVFEGPKLAALRG  230

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGT  858
              L   G  + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +C+G 
Sbjct  231   KLC-NGPYLNRPTRFEAVSALIWGVVGEDSESKKVNRPATIAVDLRKRMDPPLPQHCIGN  289

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +V  A     EA      +    L  +I ++   +     R+VY +G +   +  R  E+
Sbjct  290   IVHLA-----EANWENKAMDCNGLAGKIHESISMINSDYVRQVYADGTFFSLMRQRMAEM  344

Query  677   VRNRDS--STLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVEVWM  513
               + +S    +  SS C+  +YEVDFGWGKP  V     L+ +WV+ LD  +G  +EV +
Sbjct  345   AEDPNSFRGVIGFSSWCKFRFYEVDFGWGKPIWVGTSLRLEPNWVMLLDTRDGEGMEVRI  404

Query  512   KLPKQVMHTLTQDRHFLAYVSAFP  441
              LP + M    Q+   LAY S  P
Sbjct  405   ALPNEEMVKFEQNPDILAYASFTP  428



>ref|XP_007030131.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY10633.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=444

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 170/453 (38%), Positives = 244/453 (54%), Gaps = 30/453 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHTDTIDE  1569
             M+V++ S+E ++P SPTP+ L+ +K S LDQL   + LP + FY         + +  D 
Sbjct  1     MEVQIISRETIKPFSPTPDHLRTHKLSLLDQLVPPIYLPMILFYSATDENDPRNYNISDY  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLSK L+  YP AGR K+D +TV+CND GV F+ A VA +MS +LE  EI +++QL 
Sbjct  61    LKKSLSKALTHFYPFAGRIKDD-LTVDCNDGGVTFVEAQVACDMSFVLEEPEI-EVRQLL  118

Query  1388  PSAKF-YEPQPVGKA----LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             P A F + PQ          +AVQVN F+CGG+AI   +SH I DASA A F++ WA+  
Sbjct  119   PCAPFEHSPQTQSSTDQVIPLAVQVNYFACGGMAISVCISHVIGDASAAAHFLKGWAALA  178

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMK--MGAEG-IEQEEKDMIVKRFVIPAN  1053
             RG  A+N  G + D SS LFPP  D S   + +   + A G +E  E   + KR +   +
Sbjct  179   RG--ADNIEGVIYDSSS-LFPP-RDLSIFRKYVGGLVDANGKVESPEDKFVTKRLMFNGS  234

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-------LSCMVNLRRR  894
              I  LR ++   G ++ RP+RVEA+TA+VW A+INAT     +       +S  +NLR+R
Sbjct  235   KITALRNEIG-DGLNLYRPTRVEAVTAVVWEALINATAENDGSGTSPILAVSNAMNLRKR  293

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             M PPLP  C+G +    +V     K    +     L + I ++ +   D   RK +  G 
Sbjct  294   MNPPLPQQCIGNVSFSKMVSSLNVK----IKNRSNLAKIINESIKETDDEYIRKTFTSGE  349

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP-RLVVNMLDNSWVLFLDAI  537
              L  +     +  +N        S  CR  +YEVDFGWGKP      +  N    F+D  
Sbjct  350   CLNLMEKLCEKFEKNSKLGMFIFSCWCRFPFYEVDFGWGKPVWFECPLRANRVGFFVDTS  409

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +G  +E W+ L K+ M  L ++   LAY +  P
Sbjct  410   DGEGIEAWITLRKEEMAKLEKEPGILAYATFKP  442



>ref|XP_007030134.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY10636.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=439

 Score =   242 bits (618),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 161/448 (36%), Positives = 247/448 (55%), Gaps = 25/448 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI-DEl  1566
             M+V++  +E ++PSSPTP+ L+ +K    D LA  + +P + FY S R    T++I D L
Sbjct  1     MEVQIIDRETIKPSSPTPDHLRTHKLCLFDLLASPIYIPTLLFY-SARDGSPTNSISDNL  59

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKSLSK L+  YPLAGR K+D +T++CND+G  FI A VA +MS +LE  +I  ++QL P
Sbjct  60    KKSLSKALTHFYPLAGRIKDD-LTIDCNDDGATFIEAQVARDMSFVLEEPDIEVLQQLLP  118

Query  1385  S---AKFYEPQP-VGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
                     + QP   + L+AVQVN F+CGG+AI   +SH +ADASA A F++ WA     
Sbjct  119   CDPLQHLPQTQPSTDQVLLAVQVNHFACGGMAICVCISHVVADASAAANFLKGWAEV--A  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
             C A+   G + D SS+   PL D S   ++M++          ++I KRF+   + IA L
Sbjct  177   CGADIIEGVIYDCSSLF--PLRDMSLFYRVMEILLHKTNSGSPEVITKRFLFDGSKIAAL  234

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLPP  873
             R ++     S   P+RVEA+TAL+W A++ AT     T      S +VNLR+RM PPLPP
Sbjct  235   RNEMGDELNSYH-PTRVEAVTALIWEALVAATAENVTTSPILEASNIVNLRKRMNPPLPP  293

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY-GEGGWLRAVI  696
              C+G +   ++V    +     +     L ++I ++ + + D   RK++  +      ++
Sbjct  294   QCIGNVCFVSMV----STPTENIENRTSLARKIHESIKEIDDDYIRKIFTSDAECFHNLM  349

Query  695   ARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAING-AV  525
              + +E ++   +  ++  SS CR  +YE +FGWGKP         N     LD  +G  +
Sbjct  350   EKIFEEMKKSSNIGMFRFSSWCRFPFYETNFGWGKPIWFGTAFAINRNGCLLDTSDGEGI  409

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E W+ L K+ M  L Q    LA+ +  P
Sbjct  410   EAWISLTKEEMAQLEQQPGILAHAAFKP  437



>ref|XP_009610450.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=434

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 166/451 (37%), Positives = 256/451 (57%), Gaps = 44/451 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG-RACHHTDTIDEl  1566
             MKVE+  K+ ++PSSPTP S ++YK S +DQL     +P V FY S  + CH     D L
Sbjct  3     MKVEITHKDTIKPSSPTPLSQRDYKLSLIDQLTPGPYVPIVLFYDSTTKFCH-----DLL  57

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQLT  1389
             KKSLSKTL+ MYPLAGR K+D  T+ECND+GV+F+ A+V+   +S+++ + +IG + QL 
Sbjct  58    KKSLSKTLNYMYPLAGRIKDD-FTIECNDKGVDFLEANVSNITLSNIVNDPKIGTLSQLL  116

Query  1388  PSAKF-YEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR--G  1218
             P        +P  + L+AVQV +F CGGI+IG  V H IADAS L   ++ WA+ N+  G
Sbjct  117   PCHPHARSKEPSDQVLLAVQVTKFPCGGISIGVCVWHLIADASTLVTLVKTWATMNQENG  176

Query  1217  CAANN-GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
               +N  G+G++ + + I FPP  D S    L  +     E+    + +KRF+   + +A 
Sbjct  177   QESNVIGNGYIVNVTGI-FPP-RDLSNNPLLTMVPIP--EELPFKISMKRFIFDNSKLAA  232

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINA-----TPTQTATLSCMVNLRRRMEPPLP  876
             L Q   I       P+R EAL+A +W+A+I+      +  +   L   +NLR+RM P LP
Sbjct  233   LIQSCPIC------PTRFEALSAFLWSAIISTWKDKKSEIKVCILMTSINLRKRMIPNLP  286

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW-----  711
              N +G L+   +   +  ++G  V+   +LV+R++++ R V+D   R+++ + G+     
Sbjct  287   TNSMGNLIYPTMAKWEVEEEG--VIDYKKLVERVQESIRMVEDSYIRRIHEKNGYIDYLN  344

Query  710   --LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVL-FLDA  540
               L   I RG E+            S C++ + E DFGWGKP  + N +        LD 
Sbjct  345   SILELCITRGNEV------GIAGCISWCKLPFDEADFGWGKPIWIANPMKFPCGFNLLDT  398

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             ++G  +EVWM LP++ M  L +++ FL+YVS
Sbjct  399   VDGKGIEVWMGLPEEEMQLLEKNKDFLSYVS  429



>ref|XP_002308780.1| hypothetical protein POPTR_0006s01190g [Populus trichocarpa]
 gb|EEE92303.1| hypothetical protein POPTR_0006s01190g [Populus trichocarpa]
Length=432

 Score =   239 bits (610),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 152/444 (34%), Positives = 233/444 (52%), Gaps = 24/444 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHTDTIDE  1569
             M+V++ SKEI++PSS TP+ L+ YK S LDQLA  + +P + FY   S   C ++D + E
Sbjct  1     MEVQIISKEILKPSSSTPQHLRTYKLSVLDQLAPPIYIPIILFYSPASEHLCKNSDHLKE  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
                         YP AGR K+D  +V+CND+G EFI A VA ++S +LE  +I + +QL 
Sbjct  61    SFSQTLTH---FYPFAGRIKDD-FSVDCNDDGAEFIEARVAGDISMVLEQADINQQQQLL  116

Query  1388  PSAKFYEPQPVG--KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             P + + +   +   +  +AVQVN F+CGG+AI   + HA+ADAS LA F+  WA+ +R  
Sbjct  117   PCSPYGKSSKLSTDQVTLAVQVNYFNCGGVAISICIWHAVADASTLATFVNCWAAISRD-  175

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               NN    V    + LFPP  D S+   L     E +  E   +++KRF+   + +A LR
Sbjct  176   -PNNVIDEVVFDCTTLFPP-QDLSSF-SLHSFVKEDVSSE---IVMKRFLFDGSKVAALR  229

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRMEPPLPPNC  867
              ++   G S+ RPSR  A++ L+  A++  T      Q    +  V+LRRR++PP+P   
Sbjct  230   DEVG-NGPSLDRPSRFIAVSTLILTAMMTVTRENEAMQINAATIAVDLRRRLKPPVPKQS  288

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G +    I    E++          L  ++ ++ R + D   RK +  GG+   +   G
Sbjct  289   IGNIFQVTIAKWPESESNELSYNG--LAGKLHESIRMMNDDFIRKFHAGGGYFNFLKRSG  346

Query  686   YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAING-AVEVWM  513
              E  +  + +    SS C   +YE DFGWGKP  +   L  N   +FLD  +G  +E W+
Sbjct  347   EEARKGSNVTVFGFSSWCNFPFYETDFGWGKPLWLSPALKLNRVAIFLDTKDGEGIEAWI  406

Query  512   KLPKQVMHTLTQDRHFLAYVSAFP  441
              L ++ M    QD   L Y S  P
Sbjct  407   GLSEEDMVKFEQDPGILTYASFSP  430



>ref|XP_011008627.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=432

 Score =   239 bits (609),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 154/444 (35%), Positives = 235/444 (53%), Gaps = 24/444 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHTDTIDE  1569
             M+V++ SKEI++PSS TP+ L+ YK S LDQLA  + +P + FY   S   C ++D + E
Sbjct  1     MEVQIISKEILKPSSSTPQHLRTYKLSVLDQLAPPLYIPIILFYSPASENLCKNSDHLKE  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
                         YP AGR K+D  +V+CND G EFI A VA ++S +LE  +I + +QL 
Sbjct  61    SFSQTLTH---FYPFAGRIKDD-FSVDCNDYGAEFIEARVAGDISMVLEQADINQQQQLL  116

Query  1388  PSAKFYEPQPVG--KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             P + + +   +   +  +AVQVN F+CGG+AI   + HA+ADAS LA F+  WA+ +R  
Sbjct  117   PCSPYGKSSKLSTDQVTLAVQVNYFNCGGVAISLCIWHAVADASTLATFVNCWAAISRD-  175

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               NN    V    + LFPP  D S+   L     E +  E   +++KRF+   + +A LR
Sbjct  176   -PNNVIDEVVFDCTTLFPP-QDLSSF-SLHNFVKEDVSSE---IVMKRFLFEGSKVAALR  229

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRMEPPLPPNC  867
              ++   G S+ RPSR  A++ L+  A++  T      Q    +  V+LRRR+EPP+P   
Sbjct  230   DEVG-NGPSLDRPSRFIAVSTLILTAMMTVTRENEAMQINAATIAVDLRRRLEPPMPKQS  288

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G +    I    E++     +T   L  ++ ++ R + D   RK++  GG+   +   G
Sbjct  289   IGNIFQVTIAKWPESE--SNELTYNGLAGKLHESIRMMNDDFIRKIHAGGGYFNFLKRAG  346

Query  686   YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING-AVEVWM  513
              E  +  + +    SS C   +YE DFGWGKP  +   L    V +FLD  +G  +E W+
Sbjct  347   EEARKGLNFTVFGFSSWCNFPFYETDFGWGKPLWLSPALKLKRVAIFLDTKDGEGIEAWI  406

Query  512   KLPKQVMHTLTQDRHFLAYVSAFP  441
              L ++ M    QD   L Y S  P
Sbjct  407   GLSEEDMVKFEQDPGILTYASFSP  430



>ref|XP_011001807.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   239 bits (609),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 168/444 (38%), Positives = 246/444 (55%), Gaps = 26/444 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLA-LNVRLPFVFFYVSGRACHHTDTIDEl  1566
             M++++ SKEI++PS+PTP  LK YK S +DQLA     +P + FY        + T D L
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFAADIPIILFYSPTDEIS-SKTSDYL  59

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKS +KTL+L YP AGR K D  +++CND+G  +I A VA NMS +L+  ++ +++QL  
Sbjct  60    KKSFAKTLTLFYPFAGRIK-DASSIDCNDDGASYIEAHVAGNMSMILQQPDMDQLEQLQ-  117

Query  1385  SAKFYE--PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             S K  E   +P GK ++A QVN F CGG+AI   + H I DAS++A F++ W++   G  
Sbjct  118   SCKPDENVDEPSGKGMLAAQVNYFDCGGMAISVRIRHRIGDASSVASFVKCWSAICCGI-  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
              +N +G V D SS LFPP  D S I  L       I +   ++  KRFV     +A LR 
Sbjct  177   YDNSAGTVVDCSS-LFPP-QDLSGISFLYN----PIPRSSFNISTKRFVFEGPKLAALRG  230

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGT  858
              L   G  + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +C+G 
Sbjct  231   KLC-NGPYLNRPTRFEAVSALIWGVVGEDSESKKVNKPATIAVDLRKRMDPPLPQHCIGN  289

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +V  A+     A     VV    L  +I ++   +     R+VY +G +   +  R  E 
Sbjct  290   IVHLAV-----ANWENKVVDYNGLAGKIHESISMINSDYVRQVYADGTFFSLMRQRMAEK  344

Query  677   VRNRDS--STLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEVWM  513
              ++ D+    +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +EV +
Sbjct  345   AQDPDNFRGVIGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRI  404

Query  512   KLPKQVMHTLTQDRHFLAYVSAFP  441
              LP + M    Q+   LAY S  P
Sbjct  405   ALPNEEMVKFEQNPDILAYASFIP  428



>ref|XP_006372816.1| hypothetical protein POPTR_0017s05330g [Populus trichocarpa]
 gb|ERP50613.1| hypothetical protein POPTR_0017s05330g [Populus trichocarpa]
Length=426

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 163/430 (38%), Positives = 243/430 (57%), Gaps = 27/430 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLA-LNVRLPFVFFYVSGRACHHTDTIDEl  1566
             M++++ SKEI++PS+PTP  LK YK S +DQLA     +P V FY         ++ D L
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFAADIPVVLFYSPTDEISSKNS-DYL  59

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKS +KTL+L YP AGR K+D  +++CND+G  +I A VA NMS +L+  ++ +++QL  
Sbjct  60    KKSFAKTLTLFYPFAGRIKDDS-SIDCNDDGATYIEAHVAGNMSMILQQTDMDQLEQLQ-  117

Query  1385  SAKFYE--PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             S K  E   +P GK ++A QVN F CGGIAI   + H I DAS+LA F++ W + + G  
Sbjct  118   SCKPDENVDEPSGKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWGAISCGIY  177

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
              NN +G V D SS LFPP  D S +  L  +    I +   ++  KRFV     +A LR 
Sbjct  178   DNN-AGTVVDCSS-LFPP-QDLSGMSFLYNL----IPRSSFNISTKRFVFEGPKLAALRG  230

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGT  858
              L   G  + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +C+G 
Sbjct  231   KLC-NGPYLNRPTRFEAVSALIWGVVGEDSESKKVNKPATFAVDLRKRMDPPLPQHCIGN  289

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +V  A+   +   D         L  +I ++   +     R+VY +G +  ++  R  E+
Sbjct  290   IVHLAVANWENKVDCNG------LAGKIHESISMINSDYVRQVYSDGTFFSSIRQRMAEM  343

Query  677   VRNRDS--STLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEVWM  513
               + ++  S +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +EV +
Sbjct  344   AEDPNNFRSVIGFSSWCKFRFYEVDFGWGKPVWVGTSLRLSPNWVMLLDTRDGEGMEVRI  403

Query  512   KLPKQVMHTL  483
              LP + M  L
Sbjct  404   ALPNEEMVKL  413



>ref|XP_007037900.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY22401.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=434

 Score =   236 bits (602),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 159/452 (35%), Positives = 238/452 (53%), Gaps = 36/452 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + MKV + S+E ++PSSPTP   + +K S  DQLA  + +P + FY +    + +   D 
Sbjct  1     MEMKVHIISRETIKPSSPTPHHQRTHKLSLFDQLAPPLYIPILLFYSATSETNPSKKSDL  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLSK L+  YP AGR KE   T++CND+G  ++ A V  +M  +L+   I  + QL 
Sbjct  61    LKDSLSKILTHFYPFAGRVKEG-CTIDCNDDGAAYVEAQVDSDMFLVLKEPGIDLLLQLL  119

Query  1388  PSAKFYE-PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             P     + P+P  + ++AVQVN F+CGG+AI   + H ++DASA A F++ WA      A
Sbjct  120   PCEPLEKLPEPSAQVILAVQVNYFACGGMAICVCLRHVVSDASAAAGFVKSWA------A  173

Query  1211  ANNGSGFVSD----HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
               +G   V D      + LFPP  D S + + ++     +  E   ++ KRF+   + IA
Sbjct  174   VASGVDMVLDAVIYDCTSLFPP-QDLSGLWKTIEKSQNALLAE---VVTKRFIFYGSKIA  229

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA-------TPTQTATLSCMVNLRRRMEP  885
              LR ++   G S+ RP+RVEAL++L+W A+I          P   AT +  VNLR+RM P
Sbjct  230   ALRNEIG-NGLSLYRPTRVEALSSLIWNAIIAGDTEEGEIVPMHVATTA--VNLRKRMNP  286

Query  884   PLPPNCLGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             PLP  C+G +  V  A +   + K   +      L ++I ++   + D   R+ +G G  
Sbjct  287   PLPQLCMGNISHVTMANLFMAKTKSRNS------LAEKIHESILKIDDKFVRQFFGSGAH  340

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAIN  534
             L  +     EL ++  +     SS CR  +YE DFGWGKP      L  N   +FLD  +
Sbjct  341   LNVMKNMAAELGKSSKARLFNFSSWCRFPFYETDFGWGKPVWFATALRLNKLAIFLDTRD  400

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G  +E W+ L K+ M  L +D   LAY S  P
Sbjct  401   GKGIEAWIGLTKEEMTKLERDPGILAYASFNP  432



>gb|KDP40899.1| hypothetical protein JCGZ_24898 [Jatropha curcas]
Length=432

 Score =   234 bits (596),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 159/442 (36%), Positives = 242/442 (55%), Gaps = 30/442 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V++ SKE ++PS PTP+ LK +K S +DQLA+   +P + FY        +    +LK
Sbjct  1     MEVQIISKEKIKPSCPTPDHLKTHKLSIIDQLAIQCYVPVIIFYSPSHNQDSSQISTQLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL+  YPLAG+A      ++CND+G  F+ A++  +MS +L   +I  ++ L PS
Sbjct  61    KSLSETLTHFYPLAGKAINGSF-IDCNDDGASFVEANIVGDMSMVLNQSKIELLRLLLPS  119

Query  1382  A---KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
                  F E     K +V+VQVN F+ GGI I   + H IADAS +A F+E+W +  R CA
Sbjct  120   KLNENFAE-----KEIVSVQVNYFTSGGIVISVCIKHLIADASTVASFVEVWGNIAR-CA  173

Query  1211  ANNGS-GFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              N+ S G + D +  LFPP+ +   IE L  +    + +     + KRF+     IA LR
Sbjct  174   TNSVSNGIIFDRTG-LFPPVNN--KIEGLSWVEGSLLPE----TVTKRFLFDGLKIAALR  226

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS-----CMVNLRRRMEPPLPPN  870
             + ++  G SV +P+R EA++AL+W A I+A       +       +VNLR+++ P LP  
Sbjct  227   EMIS-NGVSVDQPTRFEAVSALIWGASISAARESEENVDSHVAVTVVNLRKKLNPNLPQQ  285

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             C+G +   AI   + A +  T     ELV++IR +   + DG  RK + EG W   V   
Sbjct  286   CIGNICQVAI--AKSAIEKST--DYRELVRKIRKSIGVLDDGYVRKFHAEGKWFDFVKKL  341

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN-SWVLFLDAING-AVEVW  516
               E   N     L  SS CR  +Y VDFGWGKP  V  +++  + V+FLD I+G  +E W
Sbjct  342   VEEPGNNYKVKQLNFSSWCRFPFYGVDFGWGKPIWVSTVMEQENGVIFLDTIDGQGIEAW  401

Query  515   MKLPKQVMHTLTQDRHFLAYVS  450
             + L ++ M    ++   L + +
Sbjct  402   ISLSRENMDKFEKNPEILEFAT  423



>ref|XP_004294207.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=440

 Score =   232 bits (591),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 149/445 (33%), Positives = 238/445 (53%), Gaps = 23/445 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+E+  ++I++PSSPTP  L+N++ SF DQ+A+ +  P + F+ +  +    +  + L 
Sbjct  5     MKIEIIERQIIKPSSPTPHHLRNFELSFFDQMAITIYTPLLLFFPNTESTSKLEICEHLT  64

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SL+KTL+  YPLAGR K   + VECND+G EF+ A V+ ++S  LEN  +  ++Q  P 
Sbjct  65    ESLAKTLTHFYPLAGRIKGSTV-VECNDDGAEFVKAQVSCSLSDFLENPAVKILEQFLP-  122

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
             A+    +     L+ VQV+ F CGG+A+GF +SH IADAS L+ F+  WA        ++
Sbjct  123   AEILSKEAGSGPLLLVQVSLFECGGMALGFSISHKIADASTLSTFINCWAQTTNTSITDS  182

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                     S+ LFPPL  +S   Q        +  +    I +RFV     I+ L+    
Sbjct  183   EVTLPEFGSASLFPPLEKSSDSSQ----PPARVYSKNHINITRRFVFDGANISALQSK--  236

Query  1022  ITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLPPNCLGT  858
             +   SV +P+RVEA++AL+W   I A+ +++ +      S  VNLR+R+ PPLP NC G 
Sbjct  237   VASPSVPKPTRVEAISALIWKCAIEASTSKSGSQRPSVFSQDVNLRKRVVPPLPENCAGN  296

Query  857   LVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARKVYG-EGGWLRAVIARGY  684
             +V        E +DG +V   + +LV + R+            ++G +  W    I   Y
Sbjct  297   VVG-FFRSKVEVEDGTSVAIDLKDLVSKFREGIENYA-AITETIFGSDEAWQG--IKDKY  352

Query  683   ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-AVEVW  516
             + ++  D+   Y+ +S CR  +YE DFGWGKP  V   ++   + ++ LD  +G  +EVW
Sbjct  353   KNLKKSDAMGFYSCTSWCRFPFYEADFGWGKPNWVSIASVSIENIIVMLDKRDGNGIEVW  412

Query  515   MKLPKQVMHTLTQDRHFLAYVSAFP  441
             + +  + M     +   LAY S  P
Sbjct  413   LTMNHETMALFESNAELLAYASVNP  437



>ref|XP_002511243.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF51845.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=429

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 151/444 (34%), Positives = 238/444 (54%), Gaps = 28/444 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA--CHHTDTIDE  1569
             M+VE+ SKE +RPSS TP  L+ Y  S LDQ+A  V +P + FY    A   + ++    
Sbjct  1     MEVEIISKETIRPSSSTPPHLRTYNLSLLDQIAPPVYVPVILFYSPDAANDVNPSNKSHH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK++ SKTL+  YPLAGR ++D   ++C+D G  +   +VA +MS +++   I ++++L 
Sbjct  61    LKQAFSKTLTHFYPLAGRIQDDIFNIDCSDNGASYTEVNVAGDMSMVIQEPNIHQLEKLL  120

Query  1388  PSAKFYE--PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             P    YE  P+   + ++  QVN F CG IAI   + H I DA+  A F++ WA+   G 
Sbjct  121   PCNP-YEMLPEISSQEILKAQVNYFECGEIAISICIWHVIGDATTAASFIKSWAAIASGG  179

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                +    V    + +FPP    S + +         ++   D+++KRFV   + +A LR
Sbjct  180   GGYSDIDNVVFDCTSIFPPQKIHSFLWRNFMT-----DEMLSDILMKRFVFDGSKVAALR  234

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGTL  855
             +++   G S+  P+RVEA+ AL+W AV+ AT  +    + +++LR+R+EPPLP NC+G +
Sbjct  235   EEVG-KGPSLDHPTRVEAIGALIWKAVMAAT-GKDYVAATVIDLRKRVEPPLPKNCIGNI  292

Query  854   VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELV  675
                A      A D  +V+    L  +I ++ + + +   RK++  G +L  V     +L 
Sbjct  293   NQMAF-----AAD-CSVMDYNYLAGKIHESIKMINNEYVRKIHAGGEYLEHV----RDLA  342

Query  674   -RNRDS----STLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAING-AVEVWM  513
              +NR+S    +    SS CR  +YE DFGWGKP  V   L N     LD  +G  +E W+
Sbjct  343   DQNRESPGWLNQFSISSWCRFPFYEADFGWGKPIWVTTALINRCAFLLDTKDGQGIEAWI  402

Query  512   KLPKQVMHTLTQDRHFLAYVSAFP  441
              LPK+VM    Q+     Y S  P
Sbjct  403   GLPKEVMSKFEQNPDICTYASFTP  426



>ref|XP_006482086.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=426

 Score =   227 bits (579),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 159/449 (35%), Positives = 234/449 (52%), Gaps = 41/449 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M +++   EI++PSSPTP+    YK S +DQL  NV    +  Y S        T D LK
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLY-SNAGESTAKTSDHLK  59

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS TL+  YPLAG+ K D++ V+CND+GV FI A VA +M  LL+   I  ++QL P 
Sbjct  60    KSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVANDMRQLLKIPNIDVLEQLLP-  118

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
              K +E     ++ + +QVN F CGG+AIG    H + DA+  A F++ W    RG  A  
Sbjct  119   FKPHEGFDSDRSNLTLQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARG--AGE  176

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQLRQD  1029
                 + DH+S+   P  D S +       A+ +++E  + +   KRFV     IA  ++ 
Sbjct  177   IKDLIIDHASLF--PARDLSCL-------AKSVDEEFLKPESETKRFVFDGPTIASFQET  227

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCMVNLRRRMEPPLP  876
              T      +RP+R E ++A++  A+I AT         P +  T+   VNLR+RM PP P
Sbjct  228   FT---SFERRPTRFEVVSAVILGALITATRESDDESNVPERLDTI-ISVNLRQRMNPPFP  283

Query  875   PNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
              +C+G ++   +V    ++  D G       L + I ++ + V D  ARK YG+  +L  
Sbjct  284   EHCMGNIISGGLVYWPLEKKVDYGC------LAKEIHESIKKVDDQFARKFYGDAEFLNL  337

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFLDAING-A  528
                 G E V+ R+    + +S C+   YE DFGWGKP+   N M  N   +F D+ +G  
Sbjct  338   PRLAGAEDVKKRE---FWVTSWCKTPLYEADFGWGKPKWAGNSMRLNQITVFFDSSDGEG  394

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             VE W+ LPK+ M    +D   LAY S  P
Sbjct  395   VEAWVGLPKKDMARFEKDSGILAYTSPNP  423



>ref|XP_011041297.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   225 bits (573),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 159/434 (37%), Positives = 232/434 (53%), Gaps = 28/434 (6%)
 Frame = -3

Query  1709  RPSSPTPESLKNYKFSFLDQLA-LNVRLPFVFFYVSGRACHHTDTIDElkkslsktlsLM  1533
             +PS+PTP  LK YK S +DQLA     +P + FY         ++ D LKKS +KTL+L 
Sbjct  12    KPSAPTPRHLKTYKLSAVDQLAAFAADIPVILFYSPADEISSKNS-DYLKKSFAKTLTLF  70

Query  1532  YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL---TPSAKFYEPQ  1362
             YP AGR K+D  +++CND+G  +I A VA NMS +L+  ++ K++QL    P     E  
Sbjct  71    YPFAGRIKDDS-SIDCNDDGASYIEAHVAGNMSMILQQPDMDKLEQLQSCKPDENIDELS  129

Query  1361  PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSD  1182
               GK ++A QVN F CGGIAI   + H I DAS+LA F++ WA+ + G   NN    V  
Sbjct  130   --GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWAAISCGIYDNNAETVVD-  186

Query  1181  HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQ  1002
               S LFPP  D   +  L  +    I +   ++  KRFV     +A LR  L   G  + 
Sbjct  187   -CSSLFPP-QDFLGMSFLYNL----IPRSSLNISTKRFVFEGPKLAALRGKLC-NGPYLN  239

Query  1001  RPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQ  828
             RP+R EA++AL+W  V   + ++      +  V+LR+ M+PPLP +C+G +V  A+    
Sbjct  240   RPTRFEAVSALIWGVVGEDSESKKVNKLATIAVDLRKIMDPPLPQHCIGNIVHLAV----  295

Query  827   EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDS--ST  654
              A     VV    L  +I ++   +     R+VY +G +  ++  R  E+  + ++  S 
Sbjct  296   -ANWENKVVDCNGLAGKIHESISMINSDYVRQVYADGTFFSSMRQRMAEMAEDPNNFRSV  354

Query  653   LYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEVWMKLPKQVMHTL  483
             +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +EV + LP + M   
Sbjct  355   IGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRIALPNEEMVKF  414

Query  482   TQDRHFLAYVSAFP  441
              Q+   LAY S  P
Sbjct  415   EQNPDILAYASFTP  428



>ref|XP_008353036.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   225 bits (573),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 151/437 (35%), Positives = 233/437 (53%), Gaps = 27/437 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+EV  +  ++PS PTP  L  ++FSFLDQ+A ++ +P +FFY +          D++K
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNNNHVNDARTYSDKVK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SLS+ L+  YPLAGR  E+   ++CND+G  ++ A V   +S ++   +  ++ +L P 
Sbjct  61    QSLSEILTQYYPLAGRIIENAF-IDCNDQGAPYVQARVRSPLSDVISEADPNQLNKLLPC  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-CAAN  1206
                 E   VG  ++A+QV+ F CGG+AIG  +SH +ADA +   F+  WAS +RG C   
Sbjct  120   ----ELDKVGDLVLAIQVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGDCNIT  175

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
             N S  + D ++ LFPP + +          + GI +E+  ++ KRFV  A+ IA LR   
Sbjct  176   NISPPIFDLAT-LFPPRSISGF------KPSTGIAREK--IVTKRFVFSASTIASLRSKY  226

Query  1025  TITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLG  861
             T    +  +PSR+EAL+A +WA  I +T     P     +   VNLR RM+PPLP    G
Sbjct  227   TDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTVNLRTRMDPPLPEYHFG  286

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYE  681
              +     V+   + D G   T   +V ++R A + + DG+      EG  L   + +  E
Sbjct  287   NV--SRFVMSSPSFDEGE-DTCYGIVSQMRQAIKTI-DGDYIAKIKEGNELLEFLKQRME  342

Query  680   LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVEVWMK  510
                  + ++   +SLCR   YE DFGWGKP  V  V+    + V F+DA  +G +E W+ 
Sbjct  343   EFMKGEVASFSFTSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSGGIEAWVN  402

Query  509   LPKQVMHTLTQDRHFLA  459
             L ++ M     D   LA
Sbjct  403   LKEEDMAKFQHDEQLLA  419



>ref|XP_011037141.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   225 bits (573),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 160/434 (37%), Positives = 232/434 (53%), Gaps = 28/434 (6%)
 Frame = -3

Query  1709  RPSSPTPESLKNYKFSFLDQLA-LNVRLPFVFFYVSGRACHHTDTIDElkkslsktlsLM  1533
             +PS+PTP  LK YK S +DQLA     +P + FY         ++ D LKKS +KTL+L 
Sbjct  12    KPSAPTPRHLKTYKLSAVDQLAAFAADIPVILFYSPADEISSKNS-DYLKKSFAKTLTLF  70

Query  1532  YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL---TPSAKFYEPQ  1362
             YP AGR K D  +++CND+G  +I A VA NMS +L+  ++ +++QL    P     E  
Sbjct  71    YPFAGRIK-DASSIDCNDDGATYIEAHVAGNMSMILQQPDMDQLEQLQSCKPDENIDELS  129

Query  1361  PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSD  1182
               GK ++A QVN F CGGIAI   + H I DAS+LA F++ WA+ + G   NN    V  
Sbjct  130   --GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWAAISCGIYDNNAETVVD-  186

Query  1181  HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQ  1002
               S LFPP  D   +  L  +    I +   ++  KRFV     +A LR  L   G  + 
Sbjct  187   -CSSLFPP-QDFLGMSFLYNL----IPRSSLNISTKRFVFEGPKLAALRGKLC-NGPYLN  239

Query  1001  RPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQ  828
             RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +C+G +V  A     
Sbjct  240   RPTRFEAVSALIWGVVGEDSESKKVNKLATIAVDLRKRMDPPLPQHCIGNIVHLA-----  294

Query  827   EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDS--ST  654
             EA     VV    L  +I ++   +     R+VY +G +  ++  R  E+  + ++  S 
Sbjct  295   EANWENKVVDYNGLAGKIHESISMINSDYVRQVYADGTFFSSMRQRMAEMAEDPNNFRSV  354

Query  653   LYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEVWMKLPKQVMHTL  483
             +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +EV + LP + M   
Sbjct  355   IGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRIALPNEEMVKF  414

Query  482   TQDRHFLAYVSAFP  441
              Q+   LAY S  P
Sbjct  415   EQNPDILAYASFTP  428



>ref|XP_008368264.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/437 (35%), Positives = 233/437 (53%), Gaps = 27/437 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+EV  +  ++PS PTP  L  ++FSFLDQ+A ++ +P +FFY +          D++K
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNNNHVNDARTYSDKVK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SLS+ L+  YPLAGR  E+   ++CND+G  ++ A V   +S ++   +  ++ +L P 
Sbjct  61    QSLSEILTQYYPLAGRIIENAF-IDCNDQGAPYVQARVRSPLSDVISEABPNQLNKLLPC  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-CAAN  1206
                 E   VG  ++A+QV+ F CGG+AIG  +SH +ADA +   F+  WAS +RG C   
Sbjct  120   ----ELDKVGDLVLAIQVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGDCNIT  175

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
             N S  + D ++ LFPP + +          + GI +E+  ++ KRFV  A+ IA LR   
Sbjct  176   NISPPIFDLAT-LFPPRSISGF------KPSTGIAREK--IVTKRFVFSASTIASLRSKY  226

Query  1025  TITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLG  861
             T    +  +PSR+EAL+A +WA  I +T     P     +   VNLR RM+PPLP    G
Sbjct  227   TDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTVNLRTRMDPPLPEYHFG  286

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYE  681
              +     V+   + D G   T   +V ++R A + + DG+      EG  L   + +  E
Sbjct  287   NV--SRFVMSSPSFDEGE-DTCYGIVSQMRQAIKTI-DGDYIAKIKEGNELLEFLKQRME  342

Query  680   LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVEVWMK  510
                  + ++   +SLCR   YE DFGWGKP  V  V+    + V F+DA  +G +E W+ 
Sbjct  343   EFMKGEVASFSFTSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSGGIEAWVN  402

Query  509   LPKQVMHTLTQDRHFLA  459
             L ++ M     D   LA
Sbjct  403   LKEEDMAKFQHDEQLLA  419



>gb|KDO53588.1| hypothetical protein CISIN_1g048249mg [Citrus sinensis]
Length=426

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 157/449 (35%), Positives = 233/449 (52%), Gaps = 41/449 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M +++   EI++PSSPTP+    YK S +DQL  NV    +  Y S        T D LK
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLY-SNAGESTAKTSDHLK  59

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS TL+  YPLAG+ K D++ V+CND+GV FI A VA +M  LL+   I  ++QL P 
Sbjct  60    KSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVANDMRQLLKIPNIDVLEQLLP-  118

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
              K +E     ++ + +QVN F CGG+AIG    H + DA+  A F++ W    RG  A  
Sbjct  119   FKPHEGFDSDRSNLTLQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARG--AGE  176

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQLRQD  1029
                 + DH+S+   P  D S +       A+ +++E  + +   KRFV     IA  ++ 
Sbjct  177   IKDLIIDHASLF--PARDLSCL-------AKSVDEEFLKPESETKRFVFDGPTIASFQET  227

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCMVNLRRRMEPPLP  876
              T      +RP+R E ++A++  A+I AT         P +  T+   VNLR+RM PP P
Sbjct  228   FT---SFERRPTRFEVVSAVILGALITATRESDDESNVPERLDTI-ISVNLRQRMNPPFP  283

Query  875   PNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
              +C+G ++   +V    ++  D G       L + I ++ + V D  ARK YG+  +L  
Sbjct  284   EHCMGNIISGGLVYWPLEKKVDYGC------LAKEIHESIKKVDDQFARKFYGDAEFLNL  337

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFLDAING-A  528
                 G E V+ R+    + +S C+   YE DFGWG P+   N M  N   +F D+ +G  
Sbjct  338   PRLAGAEDVKKRE---FWVTSWCKTPLYEADFGWGNPKWAGNSMRLNQITVFFDSSDGEG  394

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             VE W+ LP++ M    +D   LAY S  P
Sbjct  395   VEAWVGLPRKDMARFEKDSGILAYTSPNP  423



>ref|XP_009342764.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=433

 Score =   223 bits (569),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 153/443 (35%), Positives = 232/443 (52%), Gaps = 35/443 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+EV  K  ++PS PTP  L+ ++FSFLDQ+A  + +P + FY +          D +K
Sbjct  1     MKIEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMIIFYNNDHGNDAITYSDRVK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SLSKTL+  YPLAGR  E+   V+CND+G  ++ A V   +S ++   E  ++ QL P 
Sbjct  61    QSLSKTLTQYYPLAGRVIENAY-VDCNDQGAPYVQARVRSPLSDVISQPEPNQLNQLLPC  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-CAAN  1206
                 E   VG  ++AVQVN F CGG+AIG  +SH +ADA +L  F+  WAS +RG C   
Sbjct  120   ----ELDNVGDLVLAVQVNVFDCGGMAIGVCISHKVADALSLIMFLNSWASISRGDCNIK  175

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAIAQL  1038
             N         S + PP+ D +       +     + GI +E+  ++ KRFV  A+ +A L
Sbjct  176   N---------STVNPPIFDLATHFPPRSISGFKPSTGITREK--IVTKRFVFSASTVASL  224

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPP  873
             R   T    + ++P+R+EAL+A +WA VI +T     P     +   VNLR RM PPLP 
Sbjct  225   RSKYTDNKNNERKPTRIEALSAFIWARVIASTQGKPNPNTLYKVLHAVNLRTRMHPPLPE  284

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
                G +      +   + D G  +    +V ++R+A + +      K+      L+ +  
Sbjct  285   YHFGNV--SRFAMSSPSFDEGEDM-CCGMVGQMREAIKTIDGDYIAKIKDGNAHLKFLKQ  341

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA---INGA  528
             R  E ++   +S  +T SLCR   YE DFGW KP  V   ++   + V+F+DA    +G 
Sbjct  342   RAEEFMKGEVASFSFT-SLCRFPLYETDFGWSKPVWVASASLTFKNLVVFMDAGPGSSGG  400

Query  527   VEVWMKLPKQVMHTLTQDRHFLA  459
             +EVW+ L ++ M     D   LA
Sbjct  401   IEVWVNLKEEDMAKFQDDEQLLA  423



>ref|XP_007044963.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00795.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=429

 Score =   222 bits (566),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 158/452 (35%), Positives = 235/452 (52%), Gaps = 43/452 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRA-CHHTDTIDE  1569
             MKVEV ++ I++PSSPTP  L+N  FSFLDQ+A  V +P VFFY + G     + +  + 
Sbjct  1     MKVEVVARGIIKPSSPTPGHLRNLHFSFLDQIATPVFMPMVFFYPIDGDVNVGNFNRTEW  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPLAGR K D   ++CNDEGV F+ + V   +S ++   E  ++ +L 
Sbjct  61    LKKSLSETLTRFYPLAGRVK-DNAFIDCNDEGVPFVQSRVKCQLSDVVRQPEPAQLNKLL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    YE   VG  ++A+Q N F CGG+AIG  +SH IADA +L  F+  WA+  RG   
Sbjct  120   P----YELDNVGDLILAIQANIFDCGGMAIGVCISHKIADALSLIMFLNNWAATARG---  172

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAIAQ  1041
                        S   PP  D + +     +     + GI +++  ++ +RFV  A+ IA 
Sbjct  173   ----------DSYTVPPRFDLATLFPARSISGFKPSTGIFKDK--IVTRRFVFSASMIAA  220

Query  1040  LRQDLTITGGS----VQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRME  888
             LR      G S     +RP+R+EAL+  +W+  +  T     P +  T+   VNLR RM+
Sbjct  221   LRAKYADDGASNGEFQRRPTRIEALSTFIWSRFMATTHGKPDPEKLYTVLHAVNLRTRMD  280

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPLP    G +   AI +     +         +V  +RDA R +     RK+    G L
Sbjct  281   PPLPEYYFGNISRFAIAIPSINSEE----ECFGIVSEVRDAIRKIDGDYVRKLQEGSGHL  336

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD-AI  537
               +  R  E +   D  +   +SLCR   YE DFGWG+P  V   ++   + V+F+D   
Sbjct  337   NFMKERA-ERITKGDVVSFSFTSLCRFPLYETDFGWGRPIWVGSASLTFKNLVVFMDTGS  395

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +G +E W+ + ++ M     D   LA+V + P
Sbjct  396   SGGIEAWINMKEEDMARFEGDEELLAFVCSAP  427



>ref|XP_006430560.1| hypothetical protein CICLE_v10011796mg [Citrus clementina]
 gb|ESR43800.1| hypothetical protein CICLE_v10011796mg [Citrus clementina]
Length=426

 Score =   222 bits (565),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 158/448 (35%), Positives = 233/448 (52%), Gaps = 39/448 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHT-DTIDEl  1566
             M +++   EI++PSSPTP+    YK S +DQL  NV    +  Y   +A   T  T D L
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLY--SKAGESTAKTSDHL  58

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKSLS TL+  YPLAG+ K D++ V+CND+GV FI A V  +   LL+   I  ++QL P
Sbjct  59    KKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVTNDRRQLLKIPNIDVLEQLLP  118

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               K +E     ++ + +QVN F CGG+AIG    H + DA+  A F++ W    RG  A 
Sbjct  119   -FKPHEGFDSDRSNLTIQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARG--AG  175

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
                  + DH+S+   P  D S + +   +  E ++ E +    KRFV     IA L++  
Sbjct  176   EIKDVIIDHASLF--PARDLSCLTK--SVDEEFLKPESE---TKRFVFDGATIASLQETF  228

Query  1025  TITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCMVNLRRRMEPPLPP  873
                    +RP+R E ++A++  A+I AT         P +  T+   VNLR+RM PP P 
Sbjct  229   ---ASFERRPTRFEVVSAVILGALITATRESDDESNVPERLDTI-ISVNLRQRMNPPFPE  284

Query  872   NCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             +C+G ++   +V    ++  D G       L + I ++ + V D  ARK YG+  +L   
Sbjct  285   HCMGNIISGGLVYWPLEKKVDYGC------LAKEIHESIKKVDDQFARKFYGDAEFLNLP  338

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFLDAING-AV  525
                G E V+ R+    + +S C+   YE DFGWGKP+   N M  N   +F D+ +G  V
Sbjct  339   RLAGAEDVKKRE---FWVTSWCKTPLYEADFGWGKPKWAGNSMRLNQITVFFDSSDGEGV  395

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E W+ LPK+ M    +D   LAY S  P
Sbjct  396   EAWVGLPKKDMARFEKDSGILAYTSPNP  423



>ref|XP_008389785.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=431

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 151/441 (34%), Positives = 233/441 (53%), Gaps = 33/441 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+EV  K  ++PS PTP  L+ ++FSFLDQ+A  + +P + FY +          D++K
Sbjct  1     MKIEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMILFYNNDHGNDAITYSDKVK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SLSKTL+  YPLAGR  E+   V CND+G  ++ A V   +S ++   +  ++ QL P 
Sbjct  61    QSLSKTLTQYYPLAGRVIENAY-VNCNDQGAPYVQARVRSPLSDVISQPDPNQLNQLLPC  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-CAAN  1206
                 +   VG  ++AVQVN F CGG+AI   +SH +ADA +L  F+  WAS +RG C   
Sbjct  120   ----KLDNVGDLVLAVQVNVFDCGGMAIXICISHKVADALSLIMFLNSWASISRGDCNIK  175

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAIAQL  1038
             N         S + PP+ D +       +     + GI +E+  ++ KRFV  A+ +A L
Sbjct  176   N---------STVSPPIFDLATHFPPRSISGFKPSTGITREK--IVTKRFVFSASTVASL  224

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPP  873
             R   T    + ++P+R+EAL+A +WA VI +T     P     +   VNLR RM+PPLP 
Sbjct  225   RSKYTDNKTNERKPTRIEALSAFIWARVIASTQGKPNPNTLYKVLHAVNLRTRMDPPLPE  284

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
                G +      +   + D G  +    +V ++R+A + +      K+      L+ +  
Sbjct  285   YHFGNV--SRFAMSSPSFDEGEDM-CYGMVGQMREAIKTIDGDYMAKIKDGNAHLKFLKQ  341

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVE  522
             R  E ++   +S  +T SLCR   YE DFGWGKP  V   ++   + V+F+DA  +G +E
Sbjct  342   RAEEFMKGEVASFSFT-SLCRFPLYETDFGWGKPVWVASASLTFKNLVVFMDAGSSGGIE  400

Query  521   VWMKLPKQVMHTLTQDRHFLA  459
             VW+ L ++ M     D   LA
Sbjct  401   VWVNLKEEDMAKFQDDEQLLA  421



>ref|XP_007044964.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00796.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=430

 Score =   221 bits (562),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 154/448 (34%), Positives = 229/448 (51%), Gaps = 40/448 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA---CHHTDT  1578
             + ++VEV SKEI++PSSPTP+ L++Y+ SFLDQ++  V  P V FY         + T  
Sbjct  1     MKLEVEVMSKEIIKPSSPTPDQLRHYQLSFLDQISPPVYNPLVLFYPMTECNILVNKTKI  60

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
              D LK+S+S  LS  YPLAGR K++R+ V+CNDEG+ F+ A V   +S +LEN    ++ 
Sbjct  61    TDHLKQSMSNALSYFYPLAGRIKDNRL-VDCNDEGIPFLEAQVKCKLSDILENPAPSELN  119

Query  1397  QLTPSA-KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +L P      E  P+G     +Q N F  GGI IG  +SH +ADA +   F+  WA+  R
Sbjct  120   KLLPFVLDDAEELPLG-----IQFNIFDSGGICIGVCISHKLADALSFFTFVNTWAAIAR  174

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G +      F    S+ LFPP   T   E    +  E I       + KRFV  A+ I +
Sbjct  175   GESYIVSPEFA---SAKLFPP-KSTLGFEPRTGISTERI-------VTKRFVFTASKIQE  223

Query  1040  LRQDLTITGGSVQR---PSRVEALTALVWAAVINATPTQTATLSCM------VNLRRRME  888
             ++   T +  S +    PSR+EAL+  +W+  + AT  +    +C       VNLR R++
Sbjct  224   IKAKYTKSTASAENQKGPSRIEALSTFIWSRFVAATKAKPIPDNCFYTIIHAVNLRPRLD  283

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPL  +  G     A+ +    +D         LV +IRD+ R +     R++     + 
Sbjct  284   PPLAEHSFGNFYRIAMTVPSSEED------CCSLVYQIRDSIRKLDMKYVRQLQDGQSYF  337

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
               +  R    +R    S  +T SLCR   Y+ DFGWGKP  V   N+   + V+F+D ++
Sbjct  338   DFMKERAESFIRGEIVSFSFT-SLCRFPIYKADFGWGKPIWVGSANLTFKNLVVFMDTVS  396

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYV  453
             G  +E W+ L ++ M     D   LAYV
Sbjct  397   GDGIEAWVSLKEEDMAMFGSDEVLLAYV  424



>ref|XP_002511241.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51843.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=435

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 157/449 (35%), Positives = 245/449 (55%), Gaps = 31/449 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+VE+ SKE V+P S TPE  + YK S LDQLA  V +P V FY +          D LK
Sbjct  1     MEVEIISKETVKPCSSTPEHQRTYKLSLLDQLAPPVYIPIVLFYSTTGENSSQKLSDHLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
              S S  L+  YPLAGR K D  +++CNDEG  ++ A+VA +MS +L+  EI ++++L P 
Sbjct  61    TSFSGVLTHFYPLAGRMK-DGFSIDCNDEGAPYVEANVAGDMSIVLQEPEIHQLQKLLPC  119

Query  1382  AKFYEPQPV-GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               +     +  + ++A QVN F CGG+AI   + HAIADASA A F+  WA+    C A+
Sbjct  120   NPYDISSDISSQVILAAQVNHFDCGGMAISICIWHAIADASAAASFITSWAAM--ACGAS  177

Query  1205  NGSGFVSDHSSILFPPLTDTS-AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             +  G   D +S LFPP    S ++   +K      E+   +++VKRF+  +  +A L++ 
Sbjct  178   DFQGVNVDCTS-LFPPQDMRSFSLRNFVK------EELSSNILVKRFLFDSLKLAALKEK  230

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATPT----------QTATLSCMVNLRRRMEPPL  879
             +  +G  +  P+RVEA+ AL+W AV+ A+              AT+S  V LR+R+ PPL
Sbjct  231   VG-SGPCLDCPTRVEAVAALIWGAVMAASTEEEEDESTREINVATIS--VGLRKRLIPPL  287

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P   +G +   A+  C + ++   ++    L  ++ ++   + +   RK++  GG+   +
Sbjct  288   PQLSIGNIYQVALANCSKNEN---MLDYNGLAGKLHESIGKMDNNFVRKIHAGGGYFHFL  344

Query  698   IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING-A  528
               +  EL R  + + ++  SS CR  +YE DFGWGKP  V   +    V +F+D+ +G  
Sbjct  345   KKKAEELGRRPNLTRVFGFSSWCRFPFYEADFGWGKPTWVGTAMKLYKVAIFIDSKDGQG  404

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +E W+ LPK+ M    Q+    AY S  P
Sbjct  405   IEAWVSLPKEDMAKFEQNPDICAYASFKP  433



>ref|XP_008222084.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   218 bits (555),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 152/447 (34%), Positives = 235/447 (53%), Gaps = 30/447 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG--RACHHTDTIDE  1569
             MK+E+  KE ++PSSPTP +LK++K S LDQL+L    P V FY +         +   +
Sbjct  5     MKIEIVKKETIKPSSPTPHNLKSFKLSLLDQLSLVAYGPLVLFYPNNVSEVTLTEERSHQ  64

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ L+  YPLAGR K D + +ECNDEG  ++ A V   +S+ L+   +  +K L 
Sbjct  65    LKKSLSEALTRFYPLAGRIK-DNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKLLL  123

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  K   P+     L+ VQ + F CGG+AIG  +SH +ADAS L+ F+++WA+   G   
Sbjct  124   P-IKVDSPEAATGCLLLVQASFFECGGLAIGVCMSHKLADASTLSTFIKVWAATALGL--  180

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
               G   V D S+    P  D SA     +  A  +E +    + KRFV     +  L+  
Sbjct  181   --GHTVVPDFSAATRYPPRDFSA-----QSPAAAVEMKIVKCVAKRFVFDGPKMRALKAK  233

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRMEPPLPPNCL  864
               +T GSVQRP+RVEA+T L+W   + A+      ++ + +S  VN+R+R+ P LP   +
Sbjct  234   --VTSGSVQRPTRVEAVTGLIWNCAMKASKLSSGISKLSMVSQSVNIRKRVVPRLPQTSI  291

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G LV     + +E+   G  + ++ELV R+R       +  ++++ G+  +  A+     
Sbjct  292   GNLVGYYTAMAEES---GIELNSMELVSRLRKGMVEFNEIHSKRLQGDIVF-EAICEYFM  347

Query  683   E---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAINGAVE  522
             E   ++R  D +    +SLC    YE+DFGWGKP  V    +++ N   L        V+
Sbjct  348   EIGNIMRRDDINLFICTSLCNFGIYEIDFGWGKPIWVSIPFDIIKNVACLIDTKEGDGVD  407

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              W+ L ++ M    +D   LA+ S  P
Sbjct  408   AWISLSEEDMALFERDPELLAFASLNP  434



>ref|XP_006430562.1| hypothetical protein CICLE_v10013397mg [Citrus clementina]
 gb|ESR43802.1| hypothetical protein CICLE_v10013397mg [Citrus clementina]
Length=431

 Score =   217 bits (552),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 152/457 (33%), Positives = 226/457 (49%), Gaps = 52/457 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA-CHHTDTIDEl  1566
             M++ + S E ++PSSPTP+ L+ ++ SF+DQL+    L  + FY +G +  H   ++ E 
Sbjct  1     MELRISSTENIKPSSPTPDHLRTHRLSFIDQLSPRAYLSMILFYSAGASPVHLKKSLSET  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQLT  1389
                        YP AG+ K D   V+C+D GV FI A +AE ++S +++  +   ++QL 
Sbjct  61    LTH-------FYPFAGQFK-DSPVVDCDDHGVTFIEAYLAEEDVSEVIQQAKANILEQLM  112

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  K +E   V   L+ VQVN F CGG+AIG    H IADA+  A F++ W    RG  A
Sbjct  113   P-CKPHESTRVEHNLI-VQVNYFGCGGMAIGICFHHKIADAATAANFLKTWGLHARGAGA  170

Query  1208  NNGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              + + F   V D +SI   P  D   +   + +G   +     D +VKRF I    IA L
Sbjct  171   GDTNDFKHVVYDSNSIF--PAQDLPDMSVNLGLGLFSL-----DSVVKRFTIEGEKIASL  223

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVNLRR  897
             R+ +      + RPSRVE +++++  A++ A             TP +  T    VNLR+
Sbjct  224   REKVVKAEPYLDRPSRVEVVSSVILGALLAAYGGLRDDDEEFTTTPPKNVTAIFAVNLRK  283

Query  896   RMEPPLPPNCLGTLVDEAIV---LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
             RM PPLP    G +   A +   + +E K     +    L  ++R + R V D   RK+Y
Sbjct  284   RMNPPLPEQSFGNISSAAFLNLPIDREKK-----INHSSLAGQLRQSIRMVDDQFVRKLY  338

Query  725   GEG---GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDNS  561
              EG     L+AV A+G      + +     SS C+M +YE DFGWGKP    V     ++
Sbjct  339   AEGEILNILKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTDA  394

Query  560   WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +L       A+E W+ L KQ M    Q    LAY S
Sbjct  395   AILVDSCQTDAIEAWVGLSKQDMARFEQHLGVLAYTS  431



>ref|XP_008360182.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=443

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 229/449 (51%), Gaps = 33/449 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTI  1575
             + ++V V SKEI+RPSSPTP  L++Y+FSFLDQ+A  V  P + FY      H   T+  
Sbjct  1     MKVQVVVISKEIIRPSSPTPGHLRHYQFSFLDQMAPQVYNPLLLFYEYNAKMHPNITEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIK  1398
             + LK SLS+ LSL YPLAGR K D   + CNDEG+ +I A V    +S +L N    ++ 
Sbjct  61    NHLKNSLSEALSLFYPLAGRIK-DNCFIHCNDEGIPYIEARVLNCTLSDVLSNPNPDELN  119

Query  1397  QLTPSA--KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +  P        P P G     VQ+N F CGG AIG  VSH IAD  +   F +IWA+  
Sbjct  120   KFMPFELDDITNPLPFG-----VQLNIFQCGGFAIGQCVSHKIADGLSYFTFSKIWAAIA  174

Query  1223  RGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             RG  AN +   FV   S+ LFPP    +  +     G  GI    KD + KRFV  A+ I
Sbjct  175   RGEQANIDPPQFV---SATLFPPKEFNTGFD-----GGVGI---TKDRVTKRFVFNASKI  223

Query  1046  AQLRQDLTITGGSVQ--RPSRVEALTALVWAAVINATPTQTATLSCM----VNLRRRMEP  885
               L+        S+Q   P+RVE L+A +W+  + AT   T     M    VNLR R  P
Sbjct  224   KTLQAKYEKDMKSLQLKHPTRVETLSAFIWSRYVAATKDCTVNKLYMVIHAVNLRPRFSP  283

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP +  G L   A+       +GG       ++  +R+A   + +   +++ G+G    
Sbjct  284   PLPQHSFGNLFRVAMTSPLRISNGGEEECDGVVIGEVREAISKIDNEYVKQLQGQGDEHL  343

Query  704   AVIARGYELVRNRDS-STLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAIN  534
              ++ +  +  +  D  + L  SS CR   YE DFGWGKP  V +  +   + VLF+D   
Sbjct  344   GLMKKAADSFKRGDMVAVLSFSSYCRFPLYENDFGWGKPAWVGSPALTYKNLVLFMDTKE  403

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E ++ L ++VM     D   L+YVS
Sbjct  404   GDGIEAYVSLEERVMVKFECDSELLSYVS  432



>ref|XP_010044504.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86593.1| hypothetical protein EUGRSUZ_B03225 [Eucalyptus grandis]
Length=441

 Score =   216 bits (550),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 155/449 (35%), Positives = 233/449 (52%), Gaps = 40/449 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             ++VEV S++ ++PSSPT + L++YK SFLDQ+ + V +P V F+         + +  +K
Sbjct  6     VEVEVVSRDTIKPSSPTLDHLRHYKLSFLDQIQVPVFMPLVLFFPRDDGMLLDEKLSRIK  65

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SL+K L+  YPLAGR + D + V+CNDEG  ++ A V   +S +LEN E   + +  P 
Sbjct  66    QSLAKALAKFYPLAGRVR-DNLYVDCNDEGALYVEARVRCKLSDILENPEPRVMNRFLPC  124

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                 E   V    VAVQVN F CGG+A+   +SH +ADA +   F+  WAS  RG     
Sbjct  125   ----ELDNVQDLPVAVQVNFFECGGLALSLLISHKVADALSFFTFLNAWASAARGDPGII  180

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                F    SS LFPP+ D S  +      + GI ++  ++  +RF+  A  IA LR+  T
Sbjct  181   DPCF---SSSELFPPI-DLSGFQT-----STGIVKD--NISTRRFIFDAATIASLREKFT  229

Query  1022  -------ITGGSVQRPSRVEALTALVWAAV------INATPTQTATLSCMVNLRRRMEPP  882
                    +     +RP+RVEAL++ +W+        I A   +  T+   VNLR R EPP
Sbjct  230   DLKKVADVADHPRRRPTRVEALSSFLWSRYMASTQPIEARGDKIYTVLHAVNLRTRTEPP  289

Query  881   LPPNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             +     G +   AI +     + DGG      ++V ++RDA + V     RK+    G L
Sbjct  290   ISERHFGNISRLAIAVPTVDASTDGG-----YKIVDQVRDAIKQVNAEYVRKLQEGQGHL  344

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
              ++  R   + R    S  +T SLCR   YE DFGWGKP  V   ++   + ++F+D  +
Sbjct  345   NSLKERSSRISRGEVVSFSFT-SLCRFPMYEADFGWGKPAWVGSASLTFKNLIVFMDTKS  403

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E W+ L +  M    QD+  LA VS
Sbjct  404   GDGIEAWVNLKEDDMAKFEQDKELLALVS  432



>ref|XP_009359305.1| PREDICTED: vinorine synthase [Pyrus x bretschneideri]
Length=435

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 237/448 (53%), Gaps = 27/448 (6%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + MK+E+ S++  +PSSPTP  LK+YK S LDQ+A    +P V FY        T  +D 
Sbjct  1     MQMKIEIVSEDQCKPSSPTPNHLKSYKLSLLDQIAPIFYVPVVLFYSDPENIDDTTIVDR  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPLAGR  E   +V+C D GV F  A     +S +L+  E+  ++QL 
Sbjct  61    LKKSLSETLTCFYPLAGRI-EGNASVDCEDGGVVFTKARAHIQLSEILKTPEMDLVQQLL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +        A +AVQ+N F CGG+ IG  +SH IAD + L+ F++ WA+ +RG + 
Sbjct  120   PLDPYNIRTDKAVAAMAVQLNCFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRGISE  179

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             N        +S+ +FPP       ++ + M +  I++E  +++ KRFV  A+++A+L+  
Sbjct  180   NITPSL---NSATMFPPR------DKEIFMPSNLIKRE--NIVTKRFVFDASSLAKLKVK  228

Query  1028  LTITGGSVQR-PSRVEALTALVWAAVINATPTQ------TATLSCMVNLRRRMEPPLPPN  870
              +    +  R P+RVEALTAL+  + +NA          +  +S +VNLR RM PPLP +
Sbjct  229   ASKGLCTDDRAPTRVEALTALICKSSMNAKNGTLGKGRPSMAISHVVNLRERMAPPLPEH  288

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV--I  696
               G +   A+      +    +    +LV R+R   R + D   RK+ GE G+  A   +
Sbjct  289   SFGNIWRFAVASIMNDESNPEL---HDLVVRLRKVIRKIDDDYVRKLQGEDGFTHACEPL  345

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPR--LVVNMLDNSWVLFLDAING-AV  525
                 E+V   +      SS  R + Y  DFGWGKP    + ++   + V+ L + +G  +
Sbjct  346   KETSEMVSEGEVEFFRVSSWIRFSLYNTDFGWGKPTWACIPSVPIKNVVILLSSSSGDGI  405

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E W+ L ++ M    +D   L +VS  P
Sbjct  406   EAWVTLDEEDMAKFERDHELLEFVSVAP  433



>gb|KDO45520.1| hypothetical protein CISIN_1g039563mg [Citrus sinensis]
Length=472

 Score =   216 bits (551),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 151/478 (32%), Positives = 232/478 (49%), Gaps = 48/478 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH---TDT  1578
             + M++ + SKEI++PSSPTP  LK +K S LDQLA ++ LP V FY S         T T
Sbjct  1     MNMQLRIISKEIIKPSSPTPHHLKTHKLSLLDQLAPDIYLPIVLFYDSSSRVDDKTSTAT  60

Query  1577  IDElkkslsktlsLM-------YPLAGRA-KEDRITVECNDEGVEFIVADVAENMSSLLE  1422
             I+       +  + +       YP AGR   +D   ++C+D GV  +   V  NM  +L 
Sbjct  61    INSTNNISRRLKNSLSKTLTHYYPFAGRVLLKDNYVIDCDDSGVPVVETLVGSNMFDVLN  120

Query  1421  NFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
               E+  ++QL P     +        VAVQ+N F CGG+A+GF   H +AD +A   F++
Sbjct  121   FPEMDTLEQLLPFNPNKKHLSTHDVTVAVQINYFHCGGVAVGFNFRHIVADGAAAIGFIK  180

Query  1241  IWASFNRGCAANNGSGFVSDHSSI-----LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
              WA  N     ++ +  VS   ++     +FPP  + S   + +        Q   + + 
Sbjct  181   NWAKLNYSNDDHDINIDVSTKYAVVDCTNIFPPNKEISGYSRSINEW-----QRSTECVT  235

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ----TATLS  918
             KRF    + IA LR+++ +   S+    RPSR EA+  L+W A++     +    T+T++
Sbjct  236   KRFRFNGSKIAALRREMIMEKASLNLQYRPSRFEAVCGLIWGALLAMDREKHIDSTSTIA  295

Query  917   CM-VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE  741
              + VNLR RM PPLP  C+G L   A+   +  + G        L + +R+  + V D  
Sbjct  296   TIPVNLRNRMNPPLPEGCIGNLF-HAVTCTENNEAGDGHYNKSTLARNVREFTKMVSDDF  354

Query  740   ARKVYGEGGWLRAVIARGY-----ELVRNRDSSTLYTSSL--------CRMAYYEVDFGW  600
              RKVY +GG    V    Y     EL+++  ++   T+S+          + YY +DFGW
Sbjct  355   VRKVYQDGG---VVFVNQYKEAVEELLKDGTNNNNTTNSVRMFGFSGPIGLQYYGIDFGW  411

Query  599   GKPRLVVNMLD-NSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             GKP  V  ++  N+  + LD  +G  VE W+ LP   M    QD   LAY S    P+
Sbjct  412   GKPLWVTTVMRLNNVAMLLDTCDGKGVEAWVGLPINDMSKFEQDLGILAYASFTSSPR  469



>ref|XP_008240535.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=444

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 161/452 (36%), Positives = 239/452 (53%), Gaps = 37/452 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTI  1575
             + ++VEV SKEI++PSSPTP+ L++Y+FSFLDQ+A     P + FY          T+  
Sbjct  3     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQGYNPLLLFYEHNAKTQPNITEIS  62

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIK  1398
             + LK SL + L+L YPLAGR K ++  + CNDEG+ F+ A V +  +S +L N   G++ 
Sbjct  63    NHLKNSLCEVLNLFYPLAGRIKNNQF-IHCNDEGIPFVEARVLDCTLSDVLSNPIPGELN  121

Query  1397  QLTPSAKFYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +  P    +E   +  +L + VQ+N F CGG AIG  +SH IAD  +   F +IWA+  R
Sbjct  122   KFMP----FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAAIAR  177

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G  AN N   FV   SS LFPP        +   +G +G     KD I KRFV  A+ I 
Sbjct  178   GDQANINPPEFV---SSTLFPP--------KEFNIGFDGSVGITKDRITKRFVFDASQIE  226

Query  1043  QLRQDLTITGGSV-QRPSRVEALTALVWAAVINATPTQTATLSCM------VNLRRRMEP  885
              LR+    +  ++ +RP+RVE L+  +W+  + A  T+ +TL+ +      VNLR R++P
Sbjct  227   NLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAA--TKDSTLNKLYRVIHAVNLRPRIDP  284

Query  884   PLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVE--LVQRIRDAFRAVKDGEARKVYGEGG  714
             PLP +  G L   AI    Q    GG         ++  IR+A   + +   +K+  EG 
Sbjct  285   PLPQSSFGNLFHVAITAPLQIPSSGGGDEECGHGVVIPVIREAIDNIDNEYVKKLQKEGD  344

Query  713   WLRAVIAR-GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD  543
                 V+ +  Y   R    + L  SS CR   Y+ DFGWG+P  V   +    + VLF+D
Sbjct  345   EYLGVMKKLAYSCKRGEMGTLLSFSSYCRFPLYDNDFGWGRPTWVGSPSRTYKNLVLFMD  404

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                 G +E ++ L ++VM     D   L+YV+
Sbjct  405   TKEGGGIEAYVSLEEEVMAKFECDSELLSYVA  436



>ref|XP_006380880.1| hypothetical protein POPTR_0006s01180g [Populus trichocarpa]
 gb|ERP58677.1| hypothetical protein POPTR_0006s01180g [Populus trichocarpa]
Length=403

 Score =   214 bits (545),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 149/440 (34%), Positives = 224/440 (51%), Gaps = 51/440 (12%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV++ SKEI++PSS TP+ L+ YK S LDQLA  +             C ++D + +  
Sbjct  1     MKVQIISKEILKPSSSTPQHLRTYKLSVLDQLASPIE----------DLCKNSDHLKDSF  50

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
                       YP AGR K+D  +V+CND+G EFI A VA ++S +LE  +I + +QL P 
Sbjct  51    SKTLTH---FYPFAGRIKDD-FSVDCNDDGAEFIEARVAGDISMVLEQADINQQQQLLPC  106

Query  1382  AKFYEPQPVG--KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             + + +   +   +  +AVQVN F+CGG+AI   + HA+ADAS LA F+  WA+ +R    
Sbjct  107   SPYVKSSKLSTDQVTLAVQVNYFNCGGVAISICIWHAVADASTLATFVNCWAAISRD--P  164

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             NN    V    + LFPP  D S    L     E +  E   +++KRF+   + +A LR +
Sbjct  165   NNVIDEVVFDCTTLFPP-QDLSGF-SLHSFVKEDVLSE---IVMKRFLFDGSKVAALRDE  219

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRMEPPLPPNCLG  861
             +   G S+ RP+R  A++AL+  A++  T      Q      +V+LRRR++PP       
Sbjct  220   VG-NGPSLDRPTRFIAVSALILGAMMAVTRENNAMQINAAFIVVDLRRRLKPP-------  271

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYE  681
                          +    V++   L  ++ ++ R + D   RK +  GG+   ++ R  E
Sbjct  272   ------------PESESNVLSYNGLAGKLHESIRMMNDDYIRKFHAGGGYFN-LLKRAGE  318

Query  680   LVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAING-AVEVWMK  510
               R   + TL+  SS C   +YE DFGWGKP  V   L  N   +FLD  +G  +E W+ 
Sbjct  319   EARKGSNLTLFGFSSWCNFPFYETDFGWGKPLWVSPALKFNRVAVFLDTKDGEGIEAWIG  378

Query  509   LPKQVMHTLTQDRHFLAYVS  450
             L K+ M    QD   L Y S
Sbjct  379   LSKEDMVKFEQDPGILTYAS  398



>ref|XP_008222021.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   215 bits (548),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 150/447 (34%), Positives = 232/447 (52%), Gaps = 30/447 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG--RACHHTDTIDE  1569
             MK+E+  KE ++PSSPTP +LK++K S LDQL+     P V FY +         +   +
Sbjct  5     MKIEIVKKETIKPSSPTPHNLKSFKLSLLDQLSPVAYGPLVLFYPNNVSEVTLTEERSHQ  64

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ L+  YPLAGR K D + +ECNDEG  ++ A V   +S+ L+   +  +K L 
Sbjct  65    LKKSLSEALTRFYPLAGRIK-DNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKLLL  123

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  K   P+     L+ VQ + F CGG+AIG  +SH +ADAS L+ F+++WA+   G   
Sbjct  124   P-IKVDSPEAATGCLLLVQASFFKCGGLAIGVCMSHKLADASTLSTFIKVWAATALGL--  180

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
               G   V D S+    P  D SA     +  A  +E +    + KRFV     +  L+  
Sbjct  181   --GHTVVPDFSAATRYPPRDFSA-----QSPAAAVEMKIVKCVTKRFVFDGPKMRALKAK  233

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRMEPPLPPNCL  864
               +T GSVQRP+RVEA+T L+W     A+      ++ + +S  VN+R+R+ P LP   +
Sbjct  234   --VTSGSVQRPTRVEAVTGLIWKCATKASKLSSGISKLSMVSQSVNIRKRVVPQLPQTSI  291

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G L      + +E+   G  + ++ELV R+R       +  ++++ G+  +  A+     
Sbjct  292   GNLAGYYTAMAEES---GIELNSMELVSRLRKGMVEFNENHSKRLQGDNVF-EAICEYFK  347

Query  683   E---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---NMLDNSWVLFLDAINGAVE  522
             E   ++R  D +    +SLC    YE+DFGWGKP  V     ++ N  +L        V+
Sbjct  348   EIGNIMRRDDINLFICTSLCNFGIYEIDFGWGKPIWVSIPGGVVKNVAILIDTKEGDGVD  407

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              W+ L ++ M    +D   LA+ S  P
Sbjct  408   AWISLSEEDMALFERDPELLAFASLNP  434



>ref|XP_006292162.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
 gb|EOA25060.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
Length=431

 Score =   214 bits (546),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 156/449 (35%), Positives = 234/449 (52%), Gaps = 38/449 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M V+V S++I++PSSPTP  LK +K S L+QL   +  P VFFY         + I +LK
Sbjct  1     MIVDVTSRDIIKPSSPTPNHLKTFKLSLLEQLGPTIFGPMVFFYSGNNRIKPAEQIQKLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP-  1386
             +SLS+TL+  +PLAGR K + ++++CND GV+FI A V   +SSLL+      ++QL P 
Sbjct  61    QSLSETLTHFHPLAGRLKGN-VSIDCNDSGVDFIEAQVDSPLSSLLQEPSSDSLQQLIPT  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCAA  1209
             SA   E +     L+  Q + F CG +A+G  +SH  ADA+++  FM+ WA+  +RG   
Sbjct  120   SADSIETR---TKLLLAQASFFECGSMAVGVCISHKFADATSIGLFMKTWAAISSRGSIE  176

Query  1208  NNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
               GS  V D + I FPP   ++TS    IE  +KM            + KRF+  +++I 
Sbjct  177   TVGSP-VFDTAKI-FPPGNFSETSPAPVIEPEIKMN---------QTVSKRFIFDSSSIQ  225

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+     +   V +P+RVEA++AL+W   + AT T + T     L+   +LR R+ PP 
Sbjct  226   SLQAK--ASSFEVNQPTRVEAVSALIWKTAVKATRTVSGTSKPSILANSASLRSRLSPPF  283

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N +G LV        +A++G        LV  IR A +  ++    K+ G       +
Sbjct  284   TENTIGNLVS---YFAAKAEEGINQTKLQTLVSEIRKAKQRFQENHVPKLVGNPNATEVI  340

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
              +   E   ++ + +      SS CR   YE+DFGWGKP  V   ++   S V  LD   
Sbjct  341   CSYQKEAGDMIASGEFDFYIISSACRFGLYEIDFGWGKPVWVGIPSIRQKSIVTLLDTRE  400

Query  533   -GAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              G +E W+ L +Q M    QDR  L +VS
Sbjct  401   AGGIEAWVNLNEQEMKLFEQDRELLQFVS  429



>ref|XP_008222087.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=442

 Score =   214 bits (545),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 157/452 (35%), Positives = 244/452 (54%), Gaps = 37/452 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRAC--HHTDTI  1575
             + ++VEV SKEI++PSSPTP+ L++Y+FSFLDQ+A  V  P + FY        + T+  
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHNAKTQPNSTEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIK  1398
             + LK SL + L+L YPLAGR K ++  + CNDEG+ F+ A V +  +S +L N   G++ 
Sbjct  61    NHLKNSLCEVLNLFYPLAGRIKNNQF-IHCNDEGIPFVEARVLDCTLSDVLSNPIPGELN  119

Query  1397  QLTPSAKFYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +  P    +E   +  +L + VQ+N F CGG AIG  +SH IAD  +   F +IWA+  R
Sbjct  120   KFMP----FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAAIAR  175

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G  AN N   FV   SS LFPP        +   +G +G     KD + KRFV  A+ I 
Sbjct  176   GDQANINPPKFV---SSTLFPP--------KEFNIGFDGSVGITKDRVTKRFVFAASQIE  224

Query  1043  QLRQDLTITGGSV-QRPSRVEALTALVWAAVINATPTQTATLSCM------VNLRRRMEP  885
              LR+    +  ++ +RP+RVE L+  +W+  +    T+ +TL+ +      VNLR R +P
Sbjct  225   NLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAV--TKDSTLNKLYRVIHAVNLRPRFDP  282

Query  884   PLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVE--LVQRIRDAFRAVKDGEARKVYGEGG  714
             PLP +  G L   AI    Q    GG+        ++  +R+A   + +   +K+  +G 
Sbjct  283   PLPQSFFGNLFRLAITAPLQIPSSGGSDEECGHGVVIPVVREAIDNIDNEYVKKLQKQGD  342

Query  713   WLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLD  543
                 V+ +  +  +  + +TL + SS CR   Y+ DFGWG+P  V +  +   + VLF+D
Sbjct  343   EHLGVMKKQADSFKRGEMATLLSFSSYCRFPLYDNDFGWGRPTWVGSPALTYKNLVLFMD  402

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                 G +E ++ L ++VM     D   L+YV+
Sbjct  403   TKEGGGIEAYVSLEEEVMAKFECDGELLSYVA  434



>ref|XP_008222013.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=435

 Score =   214 bits (545),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 149/442 (34%), Positives = 233/442 (53%), Gaps = 32/442 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS--GRACHHTDTI-D  1572
             M+++V  ++ ++PSSPTP  L+ ++ SFLDQ+A  + +P + FY +  GR  +H     D
Sbjct  2     MRIQVIERDCIKPSSPTPPHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNHVKIYSD  61

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
              +K+SLS+ L+  YPLAGR  +D   V+CND+G  ++ A V   +S ++   +  +  +L
Sbjct  62    RVKQSLSEILTQYYPLAGRVIDDAY-VDCNDQGAHYVQAQVNCTLSDVISQPDPNQHNKL  120

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG--  1218
              P    Y+   VG  ++AVQVN F CGG+AIG  +SH I DA ++  F+  WAS +RG  
Sbjct  121   LP----YDLDNVGDLVLAVQVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASVSRGDY  176

Query  1217  -CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                 N  S  + D ++ LFPP + +          + GI +E  +++ KRFV  A+ +A 
Sbjct  177   DIKNNTISPPLFDVAT-LFPPRSISGY------KPSTGITRE--NIVTKRFVFSASMVAS  227

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLP  876
             LR   T    +   P+R+EAL+  +WA  I +T     P +   +   VNLR RM+PPLP
Sbjct  228   LRSKYTENNSNEIYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAVNLRTRMDPPLP  287

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                +G +   AI    +    G+  T   LV ++RDA + +      K+      L  + 
Sbjct  288   EYHIGNVSRFAIA---KLSFDGSKDTCYRLVGQMRDALKTIDSDYLSKMRDGDTHLNFLK  344

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAV  525
              R  E ++    S  +T SLCR   Y  DFGWGKP  V   ++   + V+F+D    G +
Sbjct  345   ERVAEFMKGEVVSLNFT-SLCRFPLYGTDFGWGKPVWVGSASLPFKNLVVFMDTESGGGI  403

Query  524   EVWMKLPKQVMHTLTQDRHFLA  459
             E W+ L ++ M    +D   LA
Sbjct  404   EAWVNLKEEDMAKFQEDEQLLA  425



>ref|XP_008222012.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=434

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 145/444 (33%), Positives = 228/444 (51%), Gaps = 36/444 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---ID  1572
             M+++V  ++ ++PSSPTP  L+ ++ SFLDQ+A  + +P + FY +       D     D
Sbjct  1     MRIQVIERDCIKPSSPTPSHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNDVKIYSD  60

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
              +K+SLS+ L+  YPLAGR  +D   V+C D+G  ++ A V   +S ++   +  +  +L
Sbjct  61    RVKQSLSEILTQYYPLAGRVIDDAY-VDCIDQGAHYVQAQVNCTLSDVISQPDPNQHNKL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
              P    Y+   VG  ++AVQVN F CGG+AIG  +SH I DA ++  F+  WAS +RG C
Sbjct  120   LP----YDLDNVGDLVLAVQVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASISRGDC  175

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAI  1047
                N +         + PPL D + +     +     + GI +E  +++ KRFV  A+ +
Sbjct  176   DIKNNT---------ISPPLFDVATLFPPRSISGYKPSTGITRE--NIVTKRFVFSASMV  224

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPP  882
             A LR   T    + + P+R+EAL+  +WA  I +T     P +   +   VNLR RM+PP
Sbjct  225   ASLRSKYTENNSNERYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAVNLRTRMDPP  284

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP   +G +   AI         G+  T   LV ++RDA + +      K+      L  
Sbjct  285   LPEYHIGNVSRFAIATLSF---DGSKDTCYGLVGQMRDALKTIDSDYLSKMRDGDTHLNF  341

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-ING  531
             +     E ++    S  +T SLCR   YE DFGWGKP  V   ++   + V+F+D    G
Sbjct  342   LKQGAAEFMKGEVVSLNFT-SLCRFPLYETDFGWGKPVWVGSASLPFKNLVVFMDTESGG  400

Query  530   AVEVWMKLPKQVMHTLTQDRHFLA  459
              +E W+ L ++ M    +D   LA
Sbjct  401   GIEAWVNLKEEDMAKFQEDEQLLA  424



>ref|XP_009359286.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=432

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 148/440 (34%), Positives = 227/440 (52%), Gaps = 30/440 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+EV  +  ++PS PTP  L  ++FSFLDQ+A  + +P +FFY +          D +K
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATQIFMPMIFFYNNHHVNDARTYSDRVK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADV-AENMSSLLENFEIGKIKQLTP  1386
             +SLS+ L+  YP AGR  E+   ++CND+G  ++ A V +  +S ++   +  ++ +L P
Sbjct  61    QSLSEALTQYYPFAGRIVENAF-IDCNDQGAPYVQARVRSPPLSDVISEPDPNQLNKLLP  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-CAA  1209
                  E   VG  + A+QVN F CGG+AIG   SH +ADA +   F+  WAS +RG C  
Sbjct  120   C----ELDNVGDLVFAIQVNMFDCGGMAIGICFSHKVADALSFITFLNSWASISRGDCNI  175

Query  1208  NNG--SGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              N   S  + D ++ LFPP +        +      +E+  + ++ KRFV  A+ IA LR
Sbjct  176   KNSTVSRPIFDLAT-LFPPRS--------ISGFKPSVEKAREKIVTKRFVFSASTIASLR  226

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
                T    +  +PSR+EAL+A +WA  I +T     P     ++  VNLR RM+PPLP  
Sbjct  227   SRYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVAHAVNLRTRMDPPLPEY  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G +     V+   + D     T   +V+++R A + + DG+      EG      + +
Sbjct  287   HFGNV--SRFVMSSPSFDERE-DTCYGMVRQMRQAIKTI-DGDYVAKIKEGNEHVEFLKQ  342

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVEV  519
               E    R+ ++   SSLCR  YYE D GWGKP  V   +    + V F+DA  +G +E 
Sbjct  343   LAEESMKREVASFSFSSLCRFPYYETDLGWGKPVWVGSASFPFKNLVCFIDAGSSGGIEA  402

Query  518   WMKLPKQVMHTLTQDRHFLA  459
             W+ L ++ M     D   LA
Sbjct  403   WVNLKEEDMAKFQHDEQLLA  422



>ref|XP_006443121.1| hypothetical protein CICLE_v10023671mg [Citrus clementina]
 gb|ESR56361.1| hypothetical protein CICLE_v10023671mg [Citrus clementina]
Length=470

 Score =   214 bits (546),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 151/476 (32%), Positives = 230/476 (48%), Gaps = 48/476 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH---TDTID  1572
             M++ + SKEI++PSSPTP  LK +K S LDQLA ++ LP V FY S         T TI+
Sbjct  1     MQLRIISKEIIKPSSPTPHHLKTHKLSLLDQLAPDIYLPIVLFYDSSSRVDDKISTATIN  60

Query  1571  ElkkslsktlsLM-------YPLAGRA-KEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
               K    +    +       YP AGR   +D   ++C+D GV  +   V  NM  +L   
Sbjct  61    STKNISRRLKKSLSKTLTHYYPFAGRVLLKDNYVIDCDDSGVPVVETLVGSNMFDVLSFP  120

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             E+  ++QL P     +        VAVQ+N F CGG+A+GF   H +AD +A   F++ W
Sbjct  121   EMDTLEQLLPFNPNKKHLSTHDVTVAVQINYFHCGGVAVGFNFRHIVADGAAAIGFIKNW  180

Query  1235  ASFNRGCAANNGSGFVSDHSSI-----LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKR  1071
                N     ++ +  VS   ++     +FPP  + S   + +        Q   + + KR
Sbjct  181   GKLNYSNDDHDINIDVSTKYAVVDCTNIFPPNKEISGYSRSINEW-----QRSTECVTKR  235

Query  1070  FVIPANAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ----TATLSCM  912
             F    + IA LR+++ +   S+    RPSR EA+  L+W A++     +    T+T++ +
Sbjct  236   FRFNGSKIAALRREMIMEKASLNLQYRPSRFEAVCGLIWGALLAMDREKHIDSTSTIATI  295

Query  911   -VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
              VNLR RM PPLP  C+G L   A+   +  + G        L + +R+  + V D   R
Sbjct  296   PVNLRNRMNPPLPEGCIGNLF-HAVTCTENNEAGDGHYNKSTLARNVREFTKMVSDDFVR  354

Query  734   KVYGEGGWLRAVIARGY-----ELVRNRDSSTLYTSSL--------CRMAYYEVDFGWGK  594
             KVY +GG    V    Y     EL+++  ++   T+S+          + YY +DFGWGK
Sbjct  355   KVYQDGG---VVFVNQYKEAVEELLKDGTNNNNTTNSVRMFGFSGPIGLQYYGIDFGWGK  411

Query  593   PRLVVNMLD-NSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             P  V  ++  N+  + LD  +G  VE W+ LP   M    QD   LAY S    P+
Sbjct  412   PLWVTTVMRLNNVAMLLDTCDGKGVEAWVGLPINDMSKFEQDLGILAYASFTSSPR  467



>ref|XP_002267341.1| PREDICTED: vinorine synthase [Vitis vinifera]
 emb|CBI27536.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   213 bits (542),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 229/449 (51%), Gaps = 41/449 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTIDEl  1566
             ++VEV S + ++PSSPTP  L++++ SFLDQ+   + +P + FY + G      DTI+  
Sbjct  4     IEVEVISTDTIKPSSPTPAHLRHFQLSFLDQVLSPIFIPIILFYPMDGDV--KVDTIERS  61

Query  1565  kkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
                       +   YPLAGR K D + ++C D+GV +  A V   +S  + N +  ++ +
Sbjct  62    IWLKKTLSMTLVQFYPLAGRVK-DNLFIDCTDQGVPYFEAQVKCQLSEFICNPDPMQLSK  120

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P A       +   ++A+QVN F CGGIAIG  +SH +ADAS++  F+  WA+     
Sbjct  121   FVPHAL----DDIVDIVLAIQVNIFKCGGIAIGVCISHKVADASSVVTFVNGWAA-----  171

Query  1214  AANNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
              A   +  V     +  LFPP+ + S       M  E I       + KRFV  A+++A 
Sbjct  172   VARRDTHMVCPQFGLANLFPPI-NLSGFNPSTGMTKEKI-------LTKRFVFSASSVAA  223

Query  1040  LRQ---DLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEP  885
             LR+   D + T    +RP+R+EAL+AL+W+  +  T     P +  T+   VNLR RM+P
Sbjct  224   LREKYADQSTTEDLPRRPTRIEALSALIWSRFVAVTHGMADPKKIYTILHAVNLRTRMDP  283

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP N  G ++  AI   +   DG        LV ++R+A   + DG+  K   EG    
Sbjct  284   PLPENSFGNIIWFAIT--RPCIDGMKEGKRHALVNQMREAIEKI-DGDYIKKLPEGIKHL  340

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA--I  537
               +    E V   +  +   +S CR   YE DFGWGKP+ V   ++   + V+F+D+   
Sbjct  341   NFLKERAERVTKGEIESFRFTSFCRFPVYEADFGWGKPKWVGSGSLPFKNLVIFIDSSGT  400

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             NG +E W+ L ++ M     D   L++VS
Sbjct  401   NGGIEAWINLVEEDMDKFQGDEELLSFVS  429



>ref|XP_006438136.1| hypothetical protein CICLE_v10033777mg [Citrus clementina]
 gb|ESR51376.1| hypothetical protein CICLE_v10033777mg [Citrus clementina]
Length=430

 Score =   212 bits (540),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 227/449 (51%), Gaps = 36/449 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG---RACHHTDT  1578
             + ++VEV S E ++PSSPTP+ L +Y+ SFLDQ++  V  P V FY +       ++T+T
Sbjct  2     MKLEVEVISTETIKPSSPTPQHLGHYQLSFLDQISPPVYNPLVLFYTADDEINNNNNTET  61

Query  1577  IDElkkslsktlsL-MYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKI  1401
             +    K     +    YPLAGR  +D   +ECNDEG+ F  A V   +  LL+N    ++
Sbjct  62    LGNFIKQSLSEVFTCFYPLAGRIHKDNNFIECNDEGIPFKKARVKCQLLHLLQNPNPNEL  121

Query  1400  KQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +L P    ++     +  + +Q N F CGGI +G  +SH + DA +   F++ WA+  R
Sbjct  122   NKLLP----FDLAEAKELPIGIQFNIFDCGGIGLGICISHKVGDAQSFFTFVKSWAATAR  177

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G        FV   S+ LFPP  +    E      + GI +E  +++ KRFV  A  I +
Sbjct  178   GEKHTVRVEFV---SATLFPP-KNILGFEP-----STGITKE--NVVTKRFVFAAPKIEE  226

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINAT-PTQTA------TLSCMVNLRRRMEPP  882
             +R + T +      PSRVEAL+A +W+  + AT P+         T++  VNLR +MEPP
Sbjct  227   IRSNYTHSESCT--PSRVEALSAFIWSRFVAATKPSHKTSDHRFYTITHAVNLRTKMEPP  284

Query  881   LPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             LP    G L   A+ + C + +D       +  + ++RD+ R V     +K+      L 
Sbjct  285   LPDYSFGNLYRTAVTIPCLDNEDEERYNHII--ISQMRDSLRKVDKDYVKKLQQGDEHLG  342

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING  531
              +  R  +  R    S  +T SLCR   YE DFGWGKP      ++   + V F+D ++G
Sbjct  343   FIRDRAEKFARGEIVSFSFT-SLCRFPLYEADFGWGKPVWTASASLSFKNLVTFMDTVSG  401

Query  530   --AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                VE W+ L ++ M  L  D   L++ S
Sbjct  402   DHGVEAWINLKEEDMAKLEADEKLLSFAS  430



>ref|XP_006484023.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=480

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 147/451 (33%), Positives = 229/451 (51%), Gaps = 36/451 (8%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG---RACHHT  1584
             +++ ++VEV S E ++PSSPTP+ L +Y+ SFLDQ++  V  P V FY +       ++T
Sbjct  50    IKLQLEVEVISTETIKPSSPTPQHLGHYQLSFLDQISPPVYNPLVLFYTADDEINNNNNT  109

Query  1583  DTIDElkkslsktlsL-MYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIG  1407
             +T+    K     +    YPLAGR  +D   +ECNDEG+ F  A V   +  LL+N    
Sbjct  110   ETLGNFIKQSLSEVFTCFYPLAGRIHKDNNFIECNDEGIPFKKARVKCQLLHLLQNPNPN  169

Query  1406  KIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
             ++ +L P    ++     +  + +Q N F CGGI +G  +SH + DA +   F++ WA+ 
Sbjct  170   ELNKLLP----FDLAEAKELPIGIQFNIFDCGGIGLGICISHKVGDAQSFFTFVKSWAAT  225

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
              RG        FV   S+ LFPP  +    E      + GI +E  +++ KRFV  A  I
Sbjct  226   ARGEKHTVRVEFV---SATLFPP-KNILGFEP-----STGITKE--NVVTKRFVFAAPKI  274

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-PTQTA------TLSCMVNLRRRME  888
              ++R + T +      PSRVEAL+A +W+  + AT P+         T++  VNLR +ME
Sbjct  275   EEIRSNYTHSESCT--PSRVEALSAFIWSRFVAATKPSHKTSDHRFYTITHAVNLRTKME  332

Query  887   PPLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             PPLP    G L   A+ + C + +D       +  + ++RD+ R V     +K+      
Sbjct  333   PPLPDYSFGNLYRTAVTIPCLDNEDEERYNHII--ISQMRDSLRKVDKDYVKKLQQGDEH  390

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI  537
             L  +  R  +  R    S  +T SLCR   YE DFGWGKP      ++   + V F+D +
Sbjct  391   LGFIRDRAEKFARGEIVSFSFT-SLCRFPLYEADFGWGKPVWAASASLSFKNLVTFMDTV  449

Query  536   NG--AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +G   VE W+ L ++ M  L  D   L++ S
Sbjct  450   SGDHGVEAWINLKEEDMAKLEADEKLLSFAS  480



>ref|XP_008222015.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=442

 Score =   212 bits (540),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 156/452 (35%), Positives = 243/452 (54%), Gaps = 37/452 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRAC--HHTDTI  1575
             + ++VEV SKEI++PSSPTP+ L++Y+FSFLDQ+A  V  P + FY        + T+  
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHNAKTQPNSTEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIK  1398
             + LK SL + L+L YPLAGR K ++  + CNDEG+ F+ A V +  +S +L N   G++ 
Sbjct  61    NHLKNSLCEVLNLFYPLAGRIKNNQF-IHCNDEGIPFVEARVLDCTLSDVLSNPIPGELN  119

Query  1397  QLTPSAKFYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +  P    +E   +  +L + VQ+N F CGG AIG  +SH IAD  +   F +IWA+  R
Sbjct  120   KFMP----FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAAIAR  175

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G  AN N   FV   SS LFPP        +   +G +G     KD + KRFV  A+ I 
Sbjct  176   GDQANINPPKFV---SSTLFPP--------KEFNIGFDGSVGITKDRVTKRFVFAASQIE  224

Query  1043  QLRQDLTITGGSV-QRPSRVEALTALVWAAVINATPTQTATLSCM------VNLRRRMEP  885
              LR+    +  ++ +RP+RVE L+  +W+  +    T+ +TL+ +      VNLR R +P
Sbjct  225   NLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAV--TKDSTLNKLYRVIHAVNLRPRFDP  282

Query  884   PLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVE--LVQRIRDAFRAVKDGEARKVYGEGG  714
             PLP +  G L   AI    Q    GG+        ++  +R+A   + +   +K+  +G 
Sbjct  283   PLPQSFFGNLFRLAITAPLQIPSSGGSDEECGHGMVIPVVREAIDNIDNEYVKKLQKQGD  342

Query  713   WLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLD  543
                 V+ +  +  +  + + L + SS CR   Y+ DFGWG+P  V +  +   + VLF+D
Sbjct  343   EHLGVMKKQADSFKRGEMAKLLSFSSYCRFPLYDNDFGWGRPTWVGSPALTYKNIVLFMD  402

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                 G +E ++ L ++VM     D   L+YV+
Sbjct  403   TKEGGGIEAYVSLEEEVMAKFECDSELLSYVA  434



>ref|XP_011071304.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=433

 Score =   212 bits (539),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 155/445 (35%), Positives = 233/445 (52%), Gaps = 34/445 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++EV S E ++PSSPTPESL+ Y+ SFLDQ+A    +P V+FY +     + +  + 
Sbjct  1     MEIEIEVISNETIKPSSPTPESLRKYQLSFLDQIAPPTFMPLVYFYPADAKFSNPEKSNH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ LS  YPLAGR  +D + V+CN+EG  ++ A    ++S ++ N     + +  
Sbjct  61    LKKSLSQVLSRFYPLAGRLIDD-LYVDCNNEGAPYVEAVANCSLSQVVTNPIPKNMNKFL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  K  E Q +G   +AVQV  F CGG A+G  +SH IADA +       WA+  R    
Sbjct  120   PY-KVDEVQNLG---MAVQVTYFQCGGTAVGLLISHKIADALSFFLVANTWAAIARNGNY  175

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             ++  G   + + I FPP  D +  +      + GI +EE  ++ K F  PA+ I+ L++ 
Sbjct  176   DDVPGPKFEGAKI-FPP-RDAAGFKP-----STGIVKEE--LVTKIFTFPASRISALQE-  225

Query  1028  LTITGGSVQ----RPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLP  876
                +GG+ +    RPSRVEAL+A +W   I+AT     P +  T+   VNLR R++PPL 
Sbjct  226   -RYSGGAAELPQRRPSRVEALSAFLWTRFISATQMKADPNKIYTVLHAVNLRTRLDPPLS  284

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                 G +   AI +     DGG+     EL+Q++R+A RAV DGE      +G      +
Sbjct  285   EYHFGNISRLAIAMPSVGVDGGS-----ELLQKVREAIRAV-DGEYVAQLRQGDKHLNFL  338

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-AV  525
                       +  T   +SLCR   YE DFGWGKP       ++  + V F+D   G  +
Sbjct  339   KERMAQANKGELVTFNFTSLCRFPLYEADFGWGKPVWAGSAGLVYKNLVTFIDTATGNGI  398

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVS  450
             E W+ L K+ M     D     ++S
Sbjct  399   EAWINLRKEDMEKFEADLELQEFLS  423



>ref|XP_011071181.1| PREDICTED: vinorine synthase-like isoform X1 [Sesamum indicum]
 ref|XP_011071182.1| PREDICTED: vinorine synthase-like isoform X2 [Sesamum indicum]
Length=422

 Score =   211 bits (538),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 154/437 (35%), Positives = 231/437 (53%), Gaps = 34/437 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++EV S E ++PSSPTPESL+ Y+ SFLDQ+A  + +P V+FY +       +  + 
Sbjct  1     MEIEIEVVSNETIKPSSPTPESLRKYQLSFLDQIAPPIFMPLVYFYPADAKFSSPEKSNH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ LS  YPLAG+  +D + V+CNDEG  ++ A    ++S ++ N     + +  
Sbjct  61    LKKSLSQVLSRFYPLAGQLIDD-LYVDCNDEGAPYVEAVANCSLSQVVTNPIPKNMDKFL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  K  E Q +G   +AVQV  F CGG A+G  +SH IADA +L      WA+  R    
Sbjct  120   PY-KVDEVQNLG---MAVQVTYFQCGGTAVGVLISHKIADALSLFLVANTWAAVARNGNY  175

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             ++      + + I FPP  D +  +      + GI +E+  ++ K F  PA+ I+ L++ 
Sbjct  176   DDVPSPKFEGAKI-FPP-RDAAGFKP-----STGIVKEQ--LVTKIFTFPASKISALQE-  225

Query  1028  LTITGGSVQ----RPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLP  876
                +GG+ +    RPSRVEAL+A +W   I+AT     P +  T+   VNLR R++PPL 
Sbjct  226   -RYSGGTAELPQRRPSRVEALSAFIWTRFISATQMKADPNKIYTVHHAVNLRTRLDPPLS  284

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                 G +   AI +     DGG+     EL+Q++R+A RAV DGE      +G      +
Sbjct  285   EYHFGNISRLAIAMPSVGVDGGS-----ELLQKVREAIRAV-DGEYVAQLRQGDKHLNFL  338

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-AV  525
                       +  T   +SLCR   YE DFGWGKP  V    ++  + V F+D   G  +
Sbjct  339   KERMAQANKGELVTFNFTSLCRFPLYEADFGWGKPVWVGSAGLVYKNLVTFIDTAAGNGI  398

Query  524   EVWMKLPKQVMHTLTQD  474
             E W+ L K+ M     D
Sbjct  399   EAWINLKKEDMEKFEAD  415



>ref|XP_007037899.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY22400.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=444

 Score =   212 bits (540),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 150/445 (34%), Positives = 239/445 (54%), Gaps = 25/445 (6%)
 Frame = -3

Query  1751  QITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTID  1572
             ++ M++++ S+E ++PSSPTP  L+ +K S LDQL   V +P + FY S  A +      
Sbjct  15    KLEMEIQIISRETIKPSSPTPHHLRTHKLSLLDQLVPPVNIPVLLFY-SATAENPRKRSL  73

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             +LK+SLSKTL   Y  AGR  E   +++CND G  +I A VA +MS +L+  EI  + QL
Sbjct  74    QLKESLSKTLVHFYTFAGRLSES-FSIDCNDNGATYIEAQVAIDMSVVLKEPEIDLLLQL  132

Query  1391  TPSAKFYE-PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
              P        +P  + ++++QVN F+CGG+AI   V HA+ADASA+A F++ WA+    C
Sbjct  133   LPCDPHENLAEPSAQVVLSIQVNYFACGGMAICVCVHHAVADASAVATFLQSWAAV--AC  190

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              AN       D +S+   P  D S   ++++   + I +E  D++  RF+   + I  LR
Sbjct  191   GANLTDTETFDCTSLF--PRQDLSGFWEVLEENKDLIIRE--DVVTTRFLFDRSKIDVLR  246

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL----SCMVNLRRRMEPPLPPNC  867
              ++   G S+ RP+RVEA++AL+W A++ +      T+    +  VNLR+RM  P P  C
Sbjct  247   DEIG-NGSSLYRPTRVEAVSALIWNAMVASIAEYDKTIPIYVATSVNLRKRMNFPFPQKC  305

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +  +     ++ +   +    ++   L   + D+   V D   RK++  G +L   I +G
Sbjct  306   VANV--SQFIMTELPIEKTKNLS--NLAGNLHDSITKVDDEYVRKLHAGGAYLN--IMKG  359

Query  686   YELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAIN-GAVEVW  516
                ++    + +++ SS CR  +YE DFGWGKP      L  N    FLD  + G +E W
Sbjct  360   --AIKGFGKNWIFSFSSWCRFPFYETDFGWGKPIWFGTTLRLNRVAFFLDTNDGGGIEAW  417

Query  515   MKLPKQVMHTLTQDRHFLAYVSAFP  441
             + L ++ M  L QD   L Y +  P
Sbjct  418   ITLTQEEMVKLEQDTGILDYATFKP  442



>ref|XP_006395599.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
 gb|ESQ32885.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
Length=458

 Score =   211 bits (538),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/450 (34%), Positives = 236/450 (52%), Gaps = 34/450 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V++ S+++++PSSPTP  LKN+K S L+QL   +  P VFFY   +    T+ + +LK
Sbjct  17    MRVDLISRDMIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMVFFYSGNKGIKPTEQLQKLK  76

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KS S+TL+  YPLAGR K + I+++CND G +F+ A+V   +S+LL+      ++QL P+
Sbjct  77    KSFSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEAEVNTPLSNLLQEPSSDILQQLIPT  135

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCAAN  1206
             +   +       L+  Q + F CGG+AIG  +SH +ADA++++ FM+ WA+  +RG    
Sbjct  136   S--VDSIETRTKLLLAQASFFECGGMAIGVCISHKLADATSISLFMKSWAAISSRGSIKT  193

Query  1205  NGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQL  1038
                GF    +  +FPP   ++TS         A  +E E      + KRFV  +++I  L
Sbjct  194   --VGFPVFDTVKIFPPGNFSETSP--------APVVEPEIMMNQTLSKRFVFDSSSIQAL  243

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPT--QTATLSCMVN---LRRRMEPPLPP  873
             +     +   V +P+RVEA++AL+W A + AT T  +T+  S + N   LR R+ PP   
Sbjct  244   QAK--ASSFEVNQPTRVEAVSALIWKAAMKATRTVSRTSKPSILANSACLRSRVSPPFTE  301

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N +G LV        +A++G        LV  IR A +  +D    K+ G       +  
Sbjct  302   NSIGNLVS---YFAAKAEEGENQTKLRTLVFEIRKAKQRFRDNHVSKLVGNPDATEIICN  358

Query  692   RGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN-G  531
                E   ++ + D      SS CR   YE DFGWG P  V   ++   + V  LD    G
Sbjct  359   YQIEAGDMIASGDFDFYIFSSACRFGLYETDFGWGNPVWVGFPSVRQKNIVALLDTKEAG  418

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E W+ L +Q M    QDR  L++ S  P
Sbjct  419   GIEAWVNLNEQEMKLFEQDRELLSFASVNP  448



>ref|XP_008389833.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=443

 Score =   210 bits (535),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 158/449 (35%), Positives = 229/449 (51%), Gaps = 33/449 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTI  1575
             + ++VEV S E ++PSSPTP  L++Y+FSFLDQ+A  V  P + FY      H   T+  
Sbjct  1     MKVEVEVISNENIKPSSPTPGHLRHYQFSFLDQMAPQVYNPLLLFYEYNANIHPNITEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIK  1398
             + LK SLS+ LSL YPLAGR K++R  + CNDEG+ ++ A V    +S +L N   G++ 
Sbjct  61    NHLKNSLSEALSLFYPLAGRIKDNRF-IHCNDEGIPYVEARVLNCTLSDVLSNPNPGELN  119

Query  1397  QLTPSA--KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +  P        P P G     VQ+N F CGG AIG  +SH IAD  +   F +IWA+  
Sbjct  120   KFMPFELDDITNPLPFG-----VQLNIFRCGGFAIGQCISHKIADGLSYFTFSKIWAAIA  174

Query  1223  RGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             RG  AN +   FV   S+ LFPP    +  +     G  GI    KD + KRFV  A+ I
Sbjct  175   RGEQANIDPPQFV---SATLFPPKELNTGFD-----GGVGI---TKDRVTKRFVFNASKI  223

Query  1046  AQLRQDLTITGGSVQ--RPSRVEALTALVWAAVINATPTQTATLSCM----VNLRRRMEP  885
               L+        S+Q   P+RVE L+A +W+  + AT   T     M    VNLR R  P
Sbjct  224   ETLQAKYEKDMKSLQLKHPTRVETLSAFIWSRYVAATKDCTVNKLYMVIHAVNLRPRFSP  283

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP +  G L   ++        GG       ++  +R+A   + +   +++  +G    
Sbjct  284   PLPQHSFGNLFRFSMTSPLRISYGGQEECDGVVIGEVREAISKIDNEYVKQLQRQGEKHL  343

Query  704   AVIARGYELVRNRDS-STLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAIN  534
              ++ +  +  +  D  + L  SS CR   YE DFGWGKP  V +  +   + VLF+D   
Sbjct  344   GLMKKAADNFKRGDMVAVLSFSSYCRFPLYENDFGWGKPAWVGSPALTYKNLVLFMDTKE  403

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E ++ L ++VM     D   L+YVS
Sbjct  404   GDGIEAYVSLEERVMAKFECDSELLSYVS  432



>ref|XP_008226170.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=454

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 147/458 (32%), Positives = 242/458 (53%), Gaps = 39/458 (9%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG------RACHHTDT  1578
             KV++  ++ ++PSS TP  L+++K SF DQ A+ + +P + +Y +       R  HH   
Sbjct  6     KVQIIERQTIKPSSATPPHLRSFKLSFFDQTAIVIYIPILLYYPNTGSTSKVRTGHHDHV  65

Query  1577  I------DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
             +        L +SLSKTL+  YPLAGR  E +  VECND G EF+ A +  ++S +LE+ 
Sbjct  66    VAINERCQHLIESLSKTLTHFYPLAGRIIEGKAMVECNDAGAEFVKARINCSLSEILEHP  125

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             +   +K+  P     +    G+ L+ VQ+N F CGG+AIG  +SH IADAS L+ F++ W
Sbjct  126   DAQMLKEFLPIEYESKEASTGR-LLRVQINCFECGGMAIGLSISHRIADASTLSTFIKCW  184

Query  1235  ASFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A+   G   ++    V     ++ +FPP+  ++  +   +   E I+ E  + I KRFV 
Sbjct  185   ATIAFGSRDSDQVLLVLPKFGAAPVFPPIDFSNCTQPPAR---EVIKVE--NCITKRFVF  239

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCM-VNLR  900
              A+ IA L+ +   T   V +P+RVEA++AL+W   + A+      TQ  +  C  VNLR
Sbjct  240   DASKIAALQSES--TSSVVPKPTRVEAVSALIWKCAMEASSRSKLGTQRRSGFCQDVNLR  297

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +R+ PPLP N +G +V       +E       +    LV ++R+    +K+  A+K+  +
Sbjct  298   KRVVPPLPENLVGNVVGSFTSTAEEG-----TIDLKGLVAKLREGIEELKEKYAKKLVFD  352

Query  719   GGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVLF  549
                    I   +  ++N D   +Y+ +S CR  +YE DFGWGKP    V+++   + ++ 
Sbjct  353   SNEAWQGIKDKHSKLKNDDEMEIYSCTSWCRFPFYEADFGWGKPSWVSVISIAIKNIIVL  412

Query  548   LDA--INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +D    NG +E W+ + ++ M     +   L Y S  P
Sbjct  413   MDKGDCNG-IEAWLTMSQESMALFESNVELLRYASVNP  449



>ref|XP_008226167.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=450

 Score =   210 bits (534),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 148/463 (32%), Positives = 228/463 (49%), Gaps = 48/463 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI----  1575
             +KVE+  ++ V+PSSPTP  L+NYK S LDQ+A    +P + FY +       D +    
Sbjct  5     IKVEIIQRQTVKPSSPTPHHLRNYKLSILDQIAPQTYIPILLFYPNAADATSNDVMATNE  64

Query  1574  --DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKI  1401
                 L +SL+KTL+  YP AGR K D + +ECND+G EF+ A V  ++S + E+ +   +
Sbjct  65    RCQHLMQSLAKTLTHFYPSAGRIKGDAV-IECNDDGAEFVEARVKCSLSEIFEHPDAVML  123

Query  1400  KQLTPSAKFYEPQPVGKA-LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             ++  P     E +  G   L+ VQVN F CGG+AIGF +SH   DA+ L+ F+  W +  
Sbjct  124   RRFLPVEP--ESREAGTGTLLLVQVNLFECGGMAIGFSISHKFGDAATLSTFINCWTAAA  181

Query  1223  RGCAANNGSGFVSDHSSIL-FPPLTDTSAIEQLMKMGAE---GIEQEEKDMIVKRFVIPA  1056
             R            D S++L  P     S    L    +E    +E + +  I +RFV  A
Sbjct  182   R------------DQSNMLMLPKFGAASLFSPLNFSNSEPLPSVEVDNEKFITRRFVFDA  229

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----------LSCMV  909
             + IA L+    +T   V +P+RVEA +AL+W   I A+   ++             S  V
Sbjct  230   SKIAALQSK--VTSSVVPKPTRVEAASALIWKCKIEASSRSSSNTLGTSLIRPSVFSLSV  287

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             N+R+   P LP N +G +++ +      +++  TV+    LV +IR      K+  A  V
Sbjct  288   NMRKMAVPLLPENLVGNILEFSTTNYSHSEENSTVIDLKGLVAKIRGGLEETKERCAAVV  347

Query  728   YGEG--GWLRAVIARGY-ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LD  567
               +    W R    + Y  L++N D      SS CR  +YE DFGWGKP  V  +   ++
Sbjct  348   VFDSNEAWQR---TKWYMNLMKNDDMDKFICSSWCRFPFYEADFGWGKPSWVSYVAVAIN  404

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             N  VL     +  +E W+ L ++ M     ++  L Y S  P+
Sbjct  405   NITVLMNKRDDNGIEAWVTLSQENMALFESNKELLEYASLNPR  447



>ref|XP_010554168.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554169.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554170.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554172.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554173.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554174.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554175.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554176.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554177.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554178.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554179.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554180.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554181.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554182.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554183.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554184.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554185.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554186.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554187.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554188.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554189.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554190.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554191.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554192.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554193.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554194.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554195.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554196.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554198.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554199.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554200.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554201.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554202.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554203.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554204.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554205.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554206.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554207.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554208.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554209.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554210.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554211.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554212.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554213.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554214.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554215.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554216.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554217.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554218.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554219.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
Length=462

 Score =   210 bits (534),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 161/466 (35%), Positives = 241/466 (52%), Gaps = 38/466 (8%)
 Frame = -3

Query  1793  KLSQLLRATSSLSLQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFF  1614
             +L Q   A+ S S    M+V+  +++I+RPSSPTP+ L+++K S L+QL   +  P VFF
Sbjct  10    RLHQKCLASESKS---QMRVDTVARDIIRPSSPTPDHLRHFKLSLLEQLGPTIFGPMVFF  66

Query  1613  YVSGRACHHTDTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMS  1434
             Y S R     + + +LKKSLS+TLS  YPLAGR K + ++++CND GV+F+ A+   ++S
Sbjct  67    YSSSR-FRQAEQLQKLKKSLSETLSHFYPLAGRLKGN-VSIDCNDSGVDFLEAEADSSLS  124

Query  1433  SLLENFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALA  1254
               LE   +  ++QL P+ +   P+   K L+A Q + F CGGIA+G  +SH IADAS++ 
Sbjct  125   GFLEEPYLEGLQQLIPT-QVDSPEARTKLLLA-QASFFRCGGIALGVCLSHKIADASSIG  182

Query  1253  KFMEIWASFN-RGCAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE-EKD  1086
               M+ WA+ + RG       GF   +++ LFPP   +DT          A  +E E  K 
Sbjct  183   LIMKSWAAMSARGSMKT--VGFPVYNTANLFPPGNFSDTDP--------APVVEPEIMKK  232

Query  1085  MIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----L  921
              + KRFV  A+ I  L+         V +P+RVEA++AL+W   + AT T + T     +
Sbjct  233   TVSKRFVFGASDIQSLQA--KSASSEVSQPTRVEAVSALIWKCAMKATRTVSGTPKPSVI  290

Query  920   SCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE  741
             +   N+RR + PPLP   +G LV       +E            LV +IR A +  +D  
Sbjct  291   AHATNIRRLVSPPLPETSIGNLVSYFAARAEEENQ----TKLQNLVFQIRKAKQNFRDKH  346

Query  740   ARKVYGEGGWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---V  579
               K+ G       +     E   ++ + +      SS CR   YE DFGWGKP  V    
Sbjct  347   VPKLIGNPEAPDIICNHQKEAGDMIASGEYDFYIFSSACRFDLYETDFGWGKPTWVGVPS  406

Query  578   NMLDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                 N  VLF     G +EVW+ L ++ M    +D  F+ + S  P
Sbjct  407   VQQKNMMVLFDTKEPGGIEVWVNLHEEEMELFEKDSEFIEFASPNP  452



>ref|XP_011042323.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   208 bits (530),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 242/447 (54%), Gaps = 37/447 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR--ACHHTDTI  1575
             + +++EV S EI++PSSPTP+ L++Y+ SFLDQ++     P + FY +      ++ + +
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPMLLFYPADGDVKINNIEKL  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             +++K+SLS+ L+L +PLAGR K D + VECNDEG+ F  A+V   +  ++E+ E  ++ +
Sbjct  61    NQIKQSLSEVLNLYHPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVEDPEPSELNK  119

Query  1394  LTPSA-KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             L P A    E  P+G     +Q N F CGGI IG  +SH + DAS+L  F++ WA+  RG
Sbjct  120   LIPFALDDAEELPLG-----IQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATARG  174

Query  1217  CAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
              A + +   F+   S+ LFPP+ + S  +      + GI +E  D++ KRFV  +++I  
Sbjct  175   EADHISRPEFI---SATLFPPI-NISGFKP-----STGITKE--DVVTKRFVFRSSSIEL  223

Query  1040  LRQDLTITGGSVQR---PSRVEALTALVW-----AAVINATPTQTATLSCMVNLRRRMEP  885
             L++  +   GS++    PSRVEAL+  +W     A  + + P +  ++   VNLR RMEP
Sbjct  224   LKEKCSTASGSLENQRPPSRVEALSVFIWQRFTAATKVESRPERIYSMVHAVNLRPRMEP  283

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP    G     A  +   + D G       LV +IRD+   +     +K+      L 
Sbjct  284   PLPEYSFGNYYRIAFTI--PSIDTGE--ENYNLVSQIRDSIGKIDKEYVKKLQKGSQHLG  339

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING  531
              +  +    ++    S  +T SLCR   YE DFGW KP  V   ++   + V+F+D  +G
Sbjct  340   FIKEQAARFLKGEVVSLNFT-SLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDTASG  398

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYV  453
               +E  + L ++ M    +D   L Y+
Sbjct  399   DGIEALVHLKEEDMAKFQEDEELLQYI  425



>ref|XP_002315639.2| transferase family protein [Populus trichocarpa]
 gb|EEF01810.2| transferase family protein [Populus trichocarpa]
Length=430

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 242/450 (54%), Gaps = 43/450 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR--ACHHTDTI  1575
             + +++EV S EI++PSSPTP+ L +Y+ SFLDQ++     P + FY +      ++ +  
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLCHYQLSFLDQISPPTYNPLLLFYPADGDVKINNIEKP  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             ++LK+SLS+ L+L YPLAGR K D + VECNDEG+ F  A+V   +  ++EN E  ++ +
Sbjct  61    NQLKQSLSEVLNLYYPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVENPEPSELNK  119

Query  1394  LTPSA-KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             L P A    E  P+G     +Q N F CGGI IG  +SH + DAS+L  F++ WA+  RG
Sbjct  120   LIPFALDDAEELPLG-----IQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATARG  174

Query  1217  CAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
              A + +   F+   S+ LFPP+ + S  +      A GI +E  D++ KRFV  +++I  
Sbjct  175   EADHISRPDFI---SATLFPPI-NISGFKP-----ATGITKE--DVVTKRFVFRSSSIEL  223

Query  1040  LRQDLTITGGSVQR---PSRVEALTALVW-----AAVINATPTQTATLSCMVNLRRRMEP  885
             L++  +   GS++    PSRVEAL+  +W     A+ + + P +  ++   VNLR RMEP
Sbjct  224   LKEKCSPASGSLENQRPPSRVEALSVFIWQRFTAASKVESRPERIYSMVHAVNLRSRMEP  283

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVYGEGG  714
             PLP    G         C+ A    ++ T  E   L  +IRD+   V     +K+     
Sbjct  284   PLPEYSFGN-------YCRIAFTIPSIDTGEENYNLASQIRDSIGKVDKEYVKKLQKGNE  336

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA  540
              L  +  +    +R  +   L  +SLCR   YE DFGW KP  V   ++   + V+F+D 
Sbjct  337   HLGFMKEQAARFLRG-EVVPLNFTSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDT  395

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYV  453
              +G  +E  + L ++ M    +D   L Y+
Sbjct  396   ASGDGIEALVHLKEEDMAKFQEDEELLQYI  425



>ref|XP_008340164.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 234/451 (52%), Gaps = 33/451 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + MK+E+ S++  +PSSPTP+ LK YK S LDQ+A    +P V FY +      T  +D 
Sbjct  1     MQMKIEIVSEDQCKPSSPTPDHLKXYKLSLLDQIAPIFYVPVVLFYSASVNIDDTTIVDR  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPLAGR  E   +V+C D  V F  A     +S +L+  E+  ++QL 
Sbjct  61    LKKSLSETLTCFYPLAGRI-EGNASVDCEDGVVVFTKARAHIQLSEILKTPEMDLVQQLL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +        A +AVQ+N F CGG+ IG  +SH IAD + L+ F++ WA+ +RG + 
Sbjct  120   PLDPYNIRTDKXVAAMAVQLNXFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRGISE  179

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             N        +S+ +FPP       ++ + M    I++E  +++ KRFV  A+++A+L+  
Sbjct  180   NITPSL---NSATMFPPR------DKEIFMPTNLIKRE--NIVTKRFVFDASSLAKLKVK  228

Query  1028  LTITGGSVQR-PSRVEALTALVWAAVINATPTQTATL---------SCMVNLRRRMEPPL  879
              +    +  R P+RVEALTAL+  + +N   T+  TL         S +VNLR R  PPL
Sbjct  229   ASKGLCTDDRAPTRVEALTALICKSSMN---TKNGTLGKGRPSMAISHVVNLRERXAPPL  285

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P +  G +   A+      +    +    +   R+R   R + D   RK+ GE G+  A 
Sbjct  286   PEHSFGNIWRFAVASIMNDESNPEL---HDFXVRLRKVIRKIDDDYVRKLQGEDGFTHAC  342

Query  698   --IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPR--LVVNMLDNSWVLFLDAING  531
               +    ELV   +      SS  R + Y  DFGWGKP    + N+   + V+ L + +G
Sbjct  343   EPLKETSELVSEGEVEFFRFSSWIRFSLYNTDFGWGKPTWACIPNVPIKNVVILLSSSSG  402

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L ++ M    +D   L +VS  P
Sbjct  403   DGIEAWVTLDEEDMAKFERDHELLEFVSVAP  433



>ref|XP_002514980.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47534.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=450

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 161/478 (34%), Positives = 238/478 (50%), Gaps = 71/478 (15%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-------VSGRACHHTD  1581
             +V+V SKE+++PSSPTP  L++Y+ SFLDQ+A+ V +P V FY        +   C+H  
Sbjct  3     EVKVISKELIKPSSPTPHLLRHYQLSFLDQIAVPVFMPLVLFYPKETNNITNQERCNHA-  61

Query  1580  TIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKI  1401
                  KKSLSK L+  YPLAGR K + + ++CNDEG  F+ A+    +S +L++ +   +
Sbjct  62    -----KKSLSKALTQFYPLAGRVKHN-MYIDCNDEGAYFVEAEAKCTLSHILQHPDPNDL  115

Query  1400  KQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +  P     E   V       QV  F CGG+AI F +SH + DA +   F+  WA+  R
Sbjct  116   NKFLP----LELDDVNDLASVFQVTLFQCGGLAISFGMSHKVGDALSFFMFLNSWAAIAR  171

Query  1220  GCAA--NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             G +   N    F    SS+LFPP  D S  +        GI ++   ++ KRFV  A+ I
Sbjct  172   GDSTTINTVPCF---QSSLLFPP-KDLSGFQP-----RTGIVKDT--IVAKRFVFDASTI  220

Query  1046  AQLRQDLTITGGSVQ---RPSRVEALTALVWA---AVINATPTQTA----TLSCMVNLRR  897
             + LR   T  G + +   RP+RVEAL+A +W+   A + A          TL   +NLR 
Sbjct  221   SALRAMYTDDGDNNKYPRRPTRVEALSAFIWSRFMASVEANKVHDCDKIYTLLHAINLRP  280

Query  896   RMEPPLPPNCLGTLVDEAIVLC-------------------QEAKDGGTVVTAVELVQRI  774
             RM+PPL     G +   A+ +                    ++ K+ GT       V+++
Sbjct  281   RMDPPLQELYFGNISRIAVAIASMEDIDNICGPKDICGGTKEDFKNHGT-------VKKM  333

Query  773   RDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGK  594
             RDA R V     +K+    G L  +  R  ++++    S  +T SLCR   YE DFGWGK
Sbjct  334   RDAIRNVNVEYVKKLQESDGHLSFMKGRAEQVMKGEVVSFSFT-SLCRFPIYEADFGWGK  392

Query  593   PRLV--VNMLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
             P  V    +   + V+FLD   G  +E W+ L  + M     D+ FLA+VS F   K+
Sbjct  393   PVWVGSARLTFKNLVVFLDTKEGDGIEAWINLKVEDMVKFEADKEFLAHVSPFSNVKI  450



>gb|KDO41287.1| hypothetical protein CISIN_1g044243mg [Citrus sinensis]
Length=425

 Score =   207 bits (527),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 229/454 (50%), Gaps = 51/454 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---  1578
             + + VE  S+E+++PS+PTP  L++Y FS+LDQ A  + +  ++FY       H D    
Sbjct  1     MKISVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYVSLLYFY-------HLDDHKL  53

Query  1577  --------IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE  1422
                     I+ LK SLS  L+  YPLAGR K +   V+CNDEGV F  A V+  +S ++ 
Sbjct  54    VSNNNHLFINSLKSSLSNVLTKYYPLAGRVKNN--YVDCNDEGVVFSEAKVSCLLSEIIN  111

Query  1421  NFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
                  +  +L P  +  +   +    +A+QVN F+CG +AI   +SH IADAS+L  F +
Sbjct  112   ELP-SEFNKLRPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMISHKIADASSLITFTK  170

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG--IEQEEKDMIVKRF  1068
              WA+  RG + N    F    ++ LFPP  D          G+ G  ++   K +++K+F
Sbjct  171   NWAAAARGGSENVFPEFA---AARLFPP-KDAG--------GSSGVSVDPRPKKIVLKKF  218

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNL  903
             +     I  LR    +  G    P+RVEAL+A +W+ +     I  +P +   L  +VNL
Sbjct  219   LFEGPKITALRDKYGLDNGIY--PTRVEALSAFIWSRLAASTRIKISPERPYMLVHLVNL  276

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R+RMEPPLP +  G ++  A+ + +E  D         +V + RDA   V     + +  
Sbjct  277   RKRMEPPLPDDSFGNIIGAAVTVLEENDDDD------RMVNKFRDAICKVDKDYLKVMKL  330

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLF  549
             E   L  ++    E+V   +    + SSLC+   YE DFG GKP  V    +   + +  
Sbjct  331   EHSELTDLVITNGEIVDRGELGYCFFSSLCKFPVYEADFGLGKPMWVAWGRLPYKNIIHL  390

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +D  +G  +E W+ L ++VM     D+  LAYVS
Sbjct  391   IDTKSGDGIEAWVHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_006487765.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=425

 Score =   207 bits (527),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 230/454 (51%), Gaps = 51/454 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---  1578
             + + VE  S+E+++PS+PTP  L++Y FS+LDQ A  + +  ++FY       H D    
Sbjct  1     MKISVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYVSLLYFY-------HLDDHKL  53

Query  1577  --------IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE  1422
                     I+ LK SLS  L+  YPLAGR K +   V+CNDEGV F  A V+  +S +++
Sbjct  54    VSNNNHLFINSLKSSLSNVLTKYYPLAGRVKNN--YVDCNDEGVVFSEAKVSCLLSEIIK  111

Query  1421  NFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
                  +  +L P  +  +   +    +A+QVN F+CG +AI   + H IADA++L  F +
Sbjct  112   ELP-SEFNKLHPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMIFHKIADAASLITFTK  170

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG--IEQEEKDMIVKRF  1068
              WA+  RG + N    FV   ++ LFPP  D          G+ G  ++   K +++K+F
Sbjct  171   NWAAAARGGSENVFPEFV---AARLFPP-QDAG--------GSSGVCVDPRTKKIVLKKF  218

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNL  903
             +     I  LR    +  G    P+RVEAL+A +W+ +     I  +P +   L  +VNL
Sbjct  219   LFEGPKITALRDKYGLDNGIY--PTRVEALSAFIWSRLAASTRIKISPERPYMLVHLVNL  276

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             RRRMEPPLP +  G ++  A+ + +E  D         +V + RDA   V     + +  
Sbjct  277   RRRMEPPLPDDSFGNIIGAAVTVLEENDDDD------RMVNKFRDAICKVDKDYLKVMKL  330

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLF  549
             E   L  ++    E+V   +    + SSLC+   YE DFG GKP  V    +   + +  
Sbjct  331   EHSELTDLVITNGEIVDRGELGYCFFSSLCKFPVYEADFGLGKPMWVAWGRLPYKNIIHL  390

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +D  +G  +E W+ L ++VM     D+  LAYVS
Sbjct  391   IDTKSGDGIEAWIHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_006423966.1| hypothetical protein CICLE_v10028504mg [Citrus clementina]
 gb|ESR37206.1| hypothetical protein CICLE_v10028504mg [Citrus clementina]
Length=425

 Score =   207 bits (526),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 228/454 (50%), Gaps = 51/454 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---  1578
             + + VE  S+E+++PS+PTP  L++Y FS+LDQ A  + +  ++FY       H D    
Sbjct  1     MKITVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYMSLLYFY-------HLDDHKL  53

Query  1577  --------IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE  1422
                     I+ LK SLS  L+  YPLAGR K     V+CNDEGV F  A V+  +S ++ 
Sbjct  54    VSNNNHLFINSLKSSLSNVLTKYYPLAGRVKNS--YVDCNDEGVVFSEAKVSCLLSEIIN  111

Query  1421  NFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
                  +  +L P  +  +   +    +A+QVN F+CG +AI   +SH IADAS+L  F +
Sbjct  112   ELP-SEFNKLRPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMISHKIADASSLITFTK  170

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG--IEQEEKDMIVKRF  1068
              WA+  RG + N    F    ++ LFPP  D          G+ G  ++   K +++K+F
Sbjct  171   NWAAAARGGSENVFPEFA---AARLFPP-KDAG--------GSSGVSVDPRPKKIVLKKF  218

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNL  903
             +     I  LR    +  G    P+RVEAL+A +W+ +     I  +P +   L  +VNL
Sbjct  219   LFEGPKITALRDKYGLDNGIY--PTRVEALSAFIWSRLAASTRIKISPERPYMLVHLVNL  276

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R+RMEPPLP +  G ++  A+ + +E  D         +V + RDA   V     + +  
Sbjct  277   RKRMEPPLPDDSFGNIIGAAVTVLEENDDDD------RMVNKFRDAICKVDKDYLKVMKL  330

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLF  549
             E   L  ++    E+V   +    + SSLC+   YE DFG GKP  V    +   + +  
Sbjct  331   EHSELTDLVITNGEIVDRGELGYCFFSSLCKFPVYEADFGLGKPMWVAWGRLPYKNIIHL  390

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +D  +G  +E W+ L ++VM     D+  LAYVS
Sbjct  391   IDTKSGDGIEAWVHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_002875299.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51558.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   207 bits (526),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 148/449 (33%), Positives = 231/449 (51%), Gaps = 32/449 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V+V S++I++PSSPTP  LK ++ S L+QL   +  P VFFY         + + +LK
Sbjct  1     MRVDVISRDIIKPSSPTPNHLKKFQLSLLEQLGPTIFGPMVFFYSGNNRIKPAEQLQKLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL+  YPLAGR K + I+++CND G +F+ A+V   +SSLL+      ++QL P+
Sbjct  61    KSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEAEVNSPLSSLLQEPSSDSLQQLIPT  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
             +   +       L   Q + F CG +AIG  +SH +ADA+++  FM+ WA+ +   +   
Sbjct  120   S--VDSIETRTRLFLAQASFFECGSMAIGVCISHKLADATSIGLFMKSWAAISSQGSIKT  177

Query  1202  GSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQLR  1035
               GF    ++ +FPP   ++TS         A  +E E      + KRFV  +++I  L+
Sbjct  178   -VGFPVFDTAKIFPPGNFSETSP--------APVVEPEIMMNQTLSKRFVFDSSSIQALQ  228

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLPPN  870
                  +   V +P+RVEA++AL+W   + AT T + T     L+   +LR R+ PP   N
Sbjct  229   AK--ASSFEVNQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPFTKN  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              +G LV        +A++G        LV +IR A +  +D    K+ G       + + 
Sbjct  287   SIGNLVS---YFAAKAEEGTNQTKLQTLVSKIRKAKQWFRDNHIPKLVGNPNATEIICSY  343

Query  689   GYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN-GA  528
               E   ++ + D      SS CR   Y+ DFGWGKP  V    +   + V  LD    G 
Sbjct  344   QKEAGDMIASGDFDFYIFSSACRFGLYDTDFGWGKPVWVGIPTVRQKNIVTLLDTKEAGG  403

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +E W+ L +Q M+   QDR  L + S  P
Sbjct  404   IEAWVNLYEQEMNLFEQDRELLQFASLNP  432



>dbj|BAB01067.1| acetyltranferase-like protein [Arabidopsis thaliana]
Length=455

 Score =   207 bits (527),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 153/450 (34%), Positives = 236/450 (52%), Gaps = 34/450 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V+V S++I++PSSPTP  LK +K S L+QL   +  P VFFY +  +   T+ +  LK
Sbjct  14    MRVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSANNSIKPTEQLQMLK  73

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL+  YPLAGR K + I+++CND G +F+ A V   +S+LL       ++QL P+
Sbjct  74    KSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQLIPT  132

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCAAN  1206
             +   +       L+  Q + F CG ++IG  +SH +ADA+++  FM+ WA+  +RG    
Sbjct  133   S--VDSIETRTRLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGSIKT  190

Query  1205  NGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQL  1038
              G+  V D   I FPP   ++TS         A  +E E      + KRF+  +++I  L
Sbjct  191   IGAP-VFDTVKI-FPPGNFSETSP--------APVVEPEIMMNQTLSKRFIFDSSSIQAL  240

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLPP  873
             +     +   V +P+RVEA++AL+W + + AT T + T     L+  V+LR R+ PP   
Sbjct  241   QAK--ASSFEVNQPTRVEAVSALIWKSAMKATRTVSGTSKPSILANSVSLRSRVSPPFTK  298

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N +G LV        +A++G        LV +IR A +  +D    K+ G       + +
Sbjct  299   NSIGNLVS---YFAAKAEEGINQTKLQTLVSKIRKAKQRFRDIHIPKLVGNPNATEIICS  355

Query  692   RGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN-G  531
                E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD    G
Sbjct  356   YQKEAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGFPSVRQKNIVTLLDTKEAG  415

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E W+ L +Q M+   QDR  L + S  P
Sbjct  416   GIEAWVNLNEQEMNLFEQDRELLQFASLNP  445



>ref|NP_189233.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AEE77107.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=442

 Score =   207 bits (526),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 153/450 (34%), Positives = 236/450 (52%), Gaps = 34/450 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V+V S++I++PSSPTP  LK +K S L+QL   +  P VFFY +  +   T+ +  LK
Sbjct  1     MRVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSANNSIKPTEQLQMLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL+  YPLAGR K + I+++CND G +F+ A V   +S+LL       ++QL P+
Sbjct  61    KSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQLIPT  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCAAN  1206
             +   +       L+  Q + F CG ++IG  +SH +ADA+++  FM+ WA+  +RG    
Sbjct  120   S--VDSIETRTRLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGSIKT  177

Query  1205  NGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQL  1038
              G+  V D   I FPP   ++TS         A  +E E      + KRF+  +++I  L
Sbjct  178   IGAP-VFDTVKI-FPPGNFSETSP--------APVVEPEIMMNQTLSKRFIFDSSSIQAL  227

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLPP  873
             +     +   V +P+RVEA++AL+W + + AT T + T     L+  V+LR R+ PP   
Sbjct  228   QAK--ASSFEVNQPTRVEAVSALIWKSAMKATRTVSGTSKPSILANSVSLRSRVSPPFTK  285

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N +G LV        +A++G        LV +IR A +  +D    K+ G       + +
Sbjct  286   NSIGNLVS---YFAAKAEEGINQTKLQTLVSKIRKAKQRFRDIHIPKLVGNPNATEIICS  342

Query  692   RGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN-G  531
                E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD    G
Sbjct  343   YQKEAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGFPSVRQKNIVTLLDTKEAG  402

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E W+ L +Q M+   QDR  L + S  P
Sbjct  403   GIEAWVNLNEQEMNLFEQDRELLQFASLNP  432



>gb|KCW86595.1| hypothetical protein EUGRSUZ_B03227 [Eucalyptus grandis]
Length=443

 Score =   207 bits (526),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 236/453 (52%), Gaps = 45/453 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             ++VEV S + ++PSSPTP+ L++YK SFLDQ+ + V +P V F+         +    ++
Sbjct  4     VEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFFPRDDDVSLDEKRGRIR  63

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             ++L+K L+  YPLAGR + D + V+CNDEG  ++ A V   +S +LEN     + +  P 
Sbjct  64    QALAKALTQFYPLAGRVR-DNLYVDCNDEGALYVEARVRCELSDILENPVPRVLNRFLPR  122

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                 +   V    VAVQVN F CGG+A+   +SH +ADA +   F+  WA+  RG     
Sbjct  123   ----QIDDVQDLAVAVQVNFFECGGLALSLLISHKVADALSYFTFLNSWAATARGDTDII  178

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                F    SS LFPP+ + S  +      + GI ++  ++  +RFV  A  IA LR+ LT
Sbjct  179   DPCF---SSSELFPPI-NLSGFQT-----STGIVKD--NISTRRFVFDAATIASLREQLT  227

Query  1022  ----------ITGGSVQRPSRVEALTALVWAAVINAT-PTQTA-----TLSCMVNLRRRM  891
                              RP+RVEAL++ +W+  + +T P  T      T+   VNLR RM
Sbjct  228   DLNNAAAAATTVDHQRSRPTRVEALSSFLWSRYMASTQPIDTRGDKLYTVLHAVNLRTRM  287

Query  890   EPPLPPNCLGTLVDEAIVLCQEAK--DGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             EPP+  +  G +   AI +  +    DGG      ++V ++R+A + V DGE  K   +G
Sbjct  288   EPPMSGHHFGNISRLAITVPTKDAVVDGGH-----KIVHQVREAIKQV-DGEHIKKLRDG  341

Query  716   -GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFL  546
              G+L  +  R   + +    S  +T SLCR   YE DFGWGKP      ++   + V+F+
Sbjct  342   EGYLNWLKERSARISQGEVVSFSFT-SLCRFPIYEADFGWGKPTWAGSASLTFKNLVVFM  400

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D  +G  +E W+ L +  M    QD+  LA VS
Sbjct  401   DTKSGDGIEAWVHLKEDDMAKFEQDKELLALVS  433



>gb|KDP36802.1| hypothetical protein JCGZ_08093 [Jatropha curcas]
Length=450

 Score =   207 bits (526),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 226/461 (49%), Gaps = 46/461 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V++ SKE V+PSSPTP  LK +K S LDQ   +   P V FY   +  +H D   +LK
Sbjct  1     MEVQIISKENVKPSSPTPPHLKIFKLSLLDQFMPSPYAPIVLFYPMIKNTNHLDVSSKLK  60

Query  1562  kslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
                      +   YPLAG  K+D +++ECND+G  F+ A V   +   L   ++  I + 
Sbjct  61    LLKESLSQTLTCFYPLAGIIKDD-LSIECNDKGANFVEARVTCRLHEFLAQPDLMLINKF  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P         VG  +  +Q N F C GIAIG  +SH I D  AL+ F++ W   +RGC 
Sbjct  120   LPCQFVVNKSTVGAFVTNIQANIFDCDGIAIGICISHKILDGDALSTFLKGWTYASRGCN  179

Query  1211  ANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                   FV   +S LFP     L ++SA+    L++ G         + I +RFV  ++A
Sbjct  180   EAIYPKFV---ASFLFPANDLWLKNSSAVMWSSLLRKG---------NCITRRFVFDSSA  227

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEP  885
             I +L+     +G  +Q P+RVE ++A +W ++++A+       + + L+ +VNLRRRMEP
Sbjct  228   IEKLKAQANSSG--LQCPTRVETVSAFLWKSIMSASAKVNGFQKPSLLTHIVNLRRRMEP  285

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
              L  N LG  +   I   Q   +    ++  +LV ++++A   + +   +K+ GE     
Sbjct  286   SLSENSLGNFL--WIAAAQYTDEAKPKLS--DLVSKVKEAISRIDEEFVKKIKGEEE--N  339

Query  704   AVIARGYELVRNRDS-----STLYTSSLCRMAYYEVDFGWGKPRLVVNM------LDNSW  558
             +V++   + +   DS          SS C+  YY+ DFGWGKP  + +M        N  
Sbjct  340   SVLSESLKEIGEMDSYKNGRDCFGFSSWCKFGYYDADFGWGKPVWISSMGLEGSVFMNLI  399

Query  557   VLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +L        +E W+ L +Q M  L  ++  L   S  P P
Sbjct  400   ILVETRFGDGIEAWLTLDEQEMAILEGNQDLLKLASLNPSP  440



>ref|XP_008222018.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=436

 Score =   206 bits (525),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 158/455 (35%), Positives = 243/455 (53%), Gaps = 46/455 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS--GRACHHTDTI  1575
             + ++VEV SKEI++PSSPTP+ L+ Y  SFLDQ++  V  P V FY S      +  D  
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRTYHLSFLDQISPPVHNPLVIFYSSEPDTKFNIVDIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             ++LKKSLS  L+L YPLAGRA  +   ++CNDEG+ ++   V   +S +++N    ++ +
Sbjct  61    NQLKKSLSDVLTLFYPLAGRAHGNSF-IDCNDEGIPYLETRVNCQLSHVIQNPIPSELNK  119

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P    ++   V    + VQ+N F CGGIA+G  VSH IADA +L  F++ WA+  R  
Sbjct  120   FIP----FQVHEVADLSLGVQLNIFDCGGIALGACVSHKIADALSLFMFIKSWAAIARQQ  175

Query  1214  AAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
               +     FV   S+ LFPP  + S +         GI ++  +++ KRF+  A+ I  L
Sbjct  176   DEHIVCPQFV---SATLFPP-RNISGLNP-----RTGITKQ--NVVTKRFIFDASKIEAL  224

Query  1037  RQDLTITGGS------VQRPSRVEALTALVWAAVINAT-------PTQTATLSCMVNLRR  897
             +   +I   S       + PSRVEAL+AL+W+ V+ +T       P +   +   VNLR 
Sbjct  225   KAKYSIDNYSQSLESYQKPPSRVEALSALIWSRVVASTQVKSEPAPERLYAIVHAVNLRT  284

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVY  726
             R +PPLP +  G L   A+ +        ++ T  E   LV+++RD  R +      K+ 
Sbjct  285   RTDPPLPEHSFGNLYRIAMTI-------PSLQTGEECYGLVRQVRDQVRQIDKHFVSKL-  336

Query  725   GEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVL  552
              +G      I +  E     +  TL  +SLCR   YE DFGWGKP  V +  +  N+ V+
Sbjct  337   QQGSEHLDFIKQSSENFFKGEMVTLSFTSLCRFPLYEADFGWGKPTWVGSPPLTFNNLVV  396

Query  551   FLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             F+DA + G +E ++ + ++ +  L  D  FLA+VS
Sbjct  397   FMDAKSGGGIEAYINMKEEDLAKLEGDNEFLAFVS  431



>ref|XP_010044505.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=445

 Score =   206 bits (525),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 236/453 (52%), Gaps = 45/453 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             ++VEV S + ++PSSPTP+ L++YK SFLDQ+ + V +P V F+         +    ++
Sbjct  6     VEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFFPRDDDVSLDEKRGRIR  65

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             ++L+K L+  YPLAGR + D + V+CNDEG  ++ A V   +S +LEN     + +  P 
Sbjct  66    QALAKALTQFYPLAGRVR-DNLYVDCNDEGALYVEARVRCELSDILENPVPRVLNRFLPR  124

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                 +   V    VAVQVN F CGG+A+   +SH +ADA +   F+  WA+  RG     
Sbjct  125   ----QIDDVQDLAVAVQVNFFECGGLALSLLISHKVADALSYFTFLNSWAATARGDTDII  180

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                F    SS LFPP+ + S  +      + GI ++  ++  +RFV  A  IA LR+ LT
Sbjct  181   DPCF---SSSELFPPI-NLSGFQT-----STGIVKD--NISTRRFVFDAATIASLREQLT  229

Query  1022  ----------ITGGSVQRPSRVEALTALVWAAVINAT-PTQTA-----TLSCMVNLRRRM  891
                              RP+RVEAL++ +W+  + +T P  T      T+   VNLR RM
Sbjct  230   DLNNAAAAATTVDHQRSRPTRVEALSSFLWSRYMASTQPIDTRGDKLYTVLHAVNLRTRM  289

Query  890   EPPLPPNCLGTLVDEAIVLCQEAK--DGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             EPP+  +  G +   AI +  +    DGG      ++V ++R+A + V DGE  K   +G
Sbjct  290   EPPMSGHHFGNISRLAITVPTKDAVVDGGH-----KIVHQVREAIKQV-DGEHIKKLRDG  343

Query  716   -GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFL  546
              G+L  +  R   + +    S  +T SLCR   YE DFGWGKP      ++   + V+F+
Sbjct  344   EGYLNWLKERSARISQGEVVSFSFT-SLCRFPIYEADFGWGKPTWAGSASLTFKNLVVFM  402

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D  +G  +E W+ L +  M    QD+  LA VS
Sbjct  403   DTKSGDGIEAWVHLKEDDMAKFEQDKELLALVS  435



>emb|CDP08574.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   206 bits (524),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 144/442 (33%), Positives = 217/442 (49%), Gaps = 37/442 (8%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkks  1557
             +E+ SKE+++PSSPTP  L+N+  SFLDQLA  + +P +FFY   +   + D     +  
Sbjct  5     LEILSKEMIKPSSPTPYHLRNFTLSFLDQLAPPIYIPLIFFYQPSQLQTYKDHAQISQLL  64

Query  1556  lsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ---  1395
                  + +   YPL GR   D   ++ ND G  F+ A V  N+  ++E   + ++KQ   
Sbjct  65    KQSLSNALTKFYPLGGRICSDDFAIDANDAGALFVEAQVHSNLLQVIEKPSMDEMKQYLP  124

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P+   +        L+AVQ+N F CGG+AIG  +SH IAD ++L  FM  WA+  RG 
Sbjct  125   LQPNGSGHGITEANTILLAVQINIFDCGGLAIGVQMSHKIADGTSLVAFMNAWAANCRGD  184

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAE---GIEQEEKDMIVKRFVIPANAIA  1044
             A  + S    D +S LFPP       + ++  G +   GI +E+  +  KRFV     +A
Sbjct  185   AEIHQSSL--DLAS-LFPP-------KDVLNSGFKPTVGITKEK--ITTKRFVFDREKLA  232

Query  1043  QLRQDLTITGGS-VQRPSRVEALTALVWAAVINATPTQTATLS-------CMVNLRRRME  888
             +L+Q L  + GS V+ P+RVEA++A  W   I AT  +  + S         VNLR RM 
Sbjct  233   KLKQALASSPGSQVKDPTRVEAVSAFFWRHFIEATKAKMDSKSKKMVAAVHAVNLRPRMN  292

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             P LP +  G L   A+ +     + G    A +L    R+A R +     + +     +L
Sbjct  293   PALPDHAFGNLWRHALAIPVAEGEKGYQNLAGDL----RNAIRNINSNYVKTLQIGDEYL  348

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAI  537
              A + +  ELV   D      SS CR   YEVD+GWGKP  V        N  +L   + 
Sbjct  349   HA-LKKTMELVSKGDIEFCNFSSWCRFPVYEVDYGWGKPTWVCTTTLPFKNVVILMSTSC  407

Query  536   NGAVEVWMKLPKQVMHTLTQDR  471
                +E W+ + ++ M +   D 
Sbjct  408   GEGIEAWVNMLEEDMASFESDH  429



>ref|XP_010506970.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 237/452 (52%), Gaps = 35/452 (8%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV-SGRACHHTDTIDE  1569
             +M V+V S++I++PSSPTP  LK +K S L+QL   +  P VFFY  +      T+ + +
Sbjct  16    SMIVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSGNNNRIKPTEQLQK  75

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPLAGR K + ++++CN+ G +F+ A+V   +SSLL+      ++QL 
Sbjct  76    LKKSLSETLTHFYPLAGRLKGN-VSIDCNNSGADFLEAEVNSPLSSLLQEPSSDNLQQLI  134

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCA  1212
             P++   +       L+  Q + F CG +AIG  +SH  ADA+++  FM+ WA+  +RG  
Sbjct  135   PTS--VDSIETRTKLLLAQASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRGSI  192

Query  1211  ANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIA  1044
                GS  V D   I FPP   ++TS         A  IE E      + KRFV  +++I 
Sbjct  193   KTVGSP-VFDTVKI-FPPGNFSETSP--------APVIEPEIMMNQTLSKRFVFDSSSIQ  242

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+     +   V++P+RVEA++AL+W   + AT T + T     L+   +LR R+ PP 
Sbjct  243   SLQAK--ASSFEVKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPF  300

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N +G LV        +A++G        LV ++R+A +  ++    K+ G       +
Sbjct  301   TENSVGNLVS---YFAAKAEEGVNQTKLQTLVSKLRNAKQRFRENHVPKLVGNPNATEII  357

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
              +   E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD   
Sbjct  358   CSYQREAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGIPSVRQKNIVTLLDTKE  417

Query  533   -GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +Q M    QDR  L +VS  P
Sbjct  418   AGGIEAWVNLNEQEMKLFEQDRELLHFVSLNP  449



>emb|CDP13291.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 150/455 (33%), Positives = 231/455 (51%), Gaps = 41/455 (9%)
 Frame = -3

Query  1742  MKVEVR--SKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR-----ACHHT  1584
             MKV+V+  S+  ++PSSPTP+ L++Y  SFLDQ+   V +P V FY S +     +    
Sbjct  1     MKVDVQVISRYTIKPSSPTPDHLQHYPLSFLDQINPPVFMPLVLFYPSEQNHLITSTPGP  60

Query  1583  DTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGK  1404
             D +++LKKSLS+ L+  YPLAGR   +   V+CNDEG+ ++ A  +  +S  L+N   G+
Sbjct  61    DKLNQLKKSLSEALTRFYPLAGRLIGNTY-VDCNDEGIPYVEARASCGLSDFLDNPIPGE  119

Query  1403  IKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             + +  P     + + +G   + +QV  F CGG+A+G  +SH IADA++L  F+  WA+ +
Sbjct  120   LNKFLP-CDLDDVKDIG---MVIQVTLFECGGVAVGVAISHKIADATSLFLFVTSWATIS  175

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             R  + +  S      S+ +FPP  D +     + M    ++++E  ++ KR V  A  IA
Sbjct  176   RRDSHDTRSPIY--ESAAIFPP-RDVAGYNHALGM----VKKDE--IVTKRLVFTATKIA  226

Query  1043  QLRQDLTITGGSVQ-------RPSRVEALTALVWAAVINATPTQTAT------LSCMVNL  903
              LR+  T    +         RP+R+EAL+A +W   + AT            L+  VNL
Sbjct  227   SLREKYTTNSNTATGDEYHQIRPTRIEALSAFIWTRFLTATTGHKVNRDKMYMLNHAVNL  286

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R RM PPL     G L   AI +     D         +V ++RDA R V   +      
Sbjct  287   RPRMHPPLSECYFGNLSRPAITIPSFDNDE----QGYGIVNQVRDAIRNVGGDQYVTKLR  342

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
             EG      I    +LV   +  +   +SLCR   YE DFGWGKP  +   ++   + V+F
Sbjct  343   EGDKHLNFIRERAKLVNKGEVVSFSFTSLCRFPSYEADFGWGKPVWIGSASLTFKNLVVF  402

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             LD  +G  +E W+ +  + M  L  D+  L YVS 
Sbjct  403   LDTRSGDGIEAWINMKLEDMAKLEADKELLKYVST  437



>ref|XP_011070326.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=437

 Score =   204 bits (520),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 149/450 (33%), Positives = 231/450 (51%), Gaps = 37/450 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++EV SKE ++PSSPTPESL  Y+ SF+DQ+A  + +P V+FY +     +    D 
Sbjct  1     MEIEIEVVSKETIKPSSPTPESLGKYQLSFIDQIAPPIFMPLVYFYQADARFSNPGKSDH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK+SLSK LS  YPLAGR  +D + ++CND+G  ++ A    ++S ++ N     + +  
Sbjct  61    LKQSLSKVLSRFYPLAGRVVDD-LYIDCNDKGAPYVEAVANCSLSQVITNPVPMNMNKFL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    Y+   V    +AVQV  F CGG A+G  +SH IADA +       WA+  R    
Sbjct  120   P----YKLDDVQNLGMAVQVTHFQCGGTAVGLVISHKIADALSFFLLANTWAAVARNGNY  175

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             ++  G   + + I FPP  + +  +      + GI +E+  ++ K F  PA+ I+ LR+ 
Sbjct  176   DDVPGPKFEGAKI-FPP-RNAAGFKP-----STGIVKEQ--LVTKIFTFPASKISTLRE-  225

Query  1028  LTITGGSVQ----RPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLP  876
                +GG+ +    RP+RVEAL+A +W   I+AT     P +  T+   VNLR R++PPL 
Sbjct  226   -RYSGGATEFLHRRPTRVEALSAFIWTRFISATGMKADPNKIYTVLHAVNLRTRLDPPLS  284

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                 G +   AI +     D G       L+Q++R+A R+V +GE      +G      +
Sbjct  285   EYHFGNISRLAIAMPSVGADDGCA-----LLQKVREAIRSV-NGEYVAQLRQGDKHLNFL  338

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AV  525
                       +  T   +SLCR   Y  DFGWGKP  V +  +   + V F+D   G  +
Sbjct  339   KERMAQANKSELHTFNFTSLCRFPLYGADFGWGKPVWVASAGLTYKNLVTFMDTATGEGI  398

Query  524   EVWMKLPKQVMHTLTQD---RHFLAYVSAF  444
             E W+ L ++ M     D   + FL+ V  F
Sbjct  399   EAWINLTQEDMEKFEADLELQEFLSKVKTF  428



>ref|XP_004239499.1| PREDICTED: vinorine synthase [Solanum lycopersicum]
Length=431

 Score =   204 bits (519),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 146/449 (33%), Positives = 223/449 (50%), Gaps = 35/449 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++E+ SK +++PS+PTP  L NYK S+LDQ+  N+ +P VFFY +      T   ++
Sbjct  1     MKIEIEIISKLVIKPSTPTPHELHNYKLSYLDQITPNILMPLVFFYQANNNFTKTHISNQ  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLS TL+  YPL GR       V CNDEGV ++ A    N+S  L +    ++ +L 
Sbjct  61    LKTSLSHTLTKFYPLCGRLDVANTHVNCNDEGVPYVEAIAKCNLSDFLLDPLPNELNKLI  120

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P     +   V +  + VQ N F CGG+AIG  +SH IADA +    +  W +  RG   
Sbjct  121   PC----DLHDVKEFCLLVQANFFQCGGMAIGIAISHKIADALSTFMIINTWGAIARGSID  176

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
                  F    SSILFPP   T     +M         E+ +++ KRFV  A+ ++ LR  
Sbjct  177   IPCPRF---DSSILFPPRDVTKFKSSVM--------IEKDNIVTKRFVFSASKVSALRDK  225

Query  1028  LTITGGSVQR-PSRVEALTALVWA---AVINATPTQTATLSCM--VNLRRRMEPPLPPNC  867
              T  G    R PSR+EAL+A +W    A I+A   +T     +  VNLR R +PPLP + 
Sbjct  226   YTEKGTENTRPPSRIEALSAFIWTRLMASIHAERDETKIYGMVHTVNLRTRSDPPLPDSL  285

Query  866   LGTLVDEAI-VLCQEAKDGGTVVTA--VELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
              G ++   + V   ++ D  +       ELV+++R++   V       +  +     + I
Sbjct  286   FGNVMQVVVTVPATDSNDNNSTNKEQDFELVKKVRESINNVNSEFVSGLRKKDQKHLSFI  345

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP------RLVVNMLDNSWVLFLDAIN  534
                    R  +      +SLCR+  Y+ DFGWGKP      RLV+  +    + FLD  +
Sbjct  346   KEKANEQRKGELVVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDV----IGFLDTKS  401

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E W+ L ++ M     D+  L++ S
Sbjct  402   GNGIEAWVNLREEDMAIFEADKELLSWCS  430



>emb|CDY39174.1| BnaC09g21700D [Brassica napus]
Length=459

 Score =   205 bits (521),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 151/453 (33%), Positives = 230/453 (51%), Gaps = 36/453 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             +T +VEV S++I++PSSPTP  LKN+K S L+QL   +  P +FFY +      T+ +  
Sbjct  16    LTRRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANNRIKQTEQLQN  75

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPLAGR   + I++ CND G +F+ A V   +S+LL+      ++QL 
Sbjct  76    LKKSLSETLTHFYPLAGRLNGN-ISINCNDSGADFLEAQVNSPLSNLLQEPSSEVLEQLI  134

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCA  1212
             P++   +       L+  Q   F CGG+AIG  VSH +ADA+++  FM+ W++  +RG  
Sbjct  135   PTS--VDSTEARTKLLLAQATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAISSRGTI  192

Query  1211  ANNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
                GS  V D   I FPP   ++TS    +E  +KM            + KRFV  + +I
Sbjct  193   KTVGSP-VFDTLKI-FPPGNFSETSPAPVVEPEIKMN---------QTLSKRFVFDSWSI  241

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPP  882
               L+     +   V +P+RVEA++A +W   + AT T + T     L+   +LR R+ PP
Sbjct  242   EALQAK--ASSFEVSQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVSPP  299

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
                N +G LV       +E +    + T V  ++R +  FR   D    K+ G G     
Sbjct  300   FTKNSIGNLVSYFAAKAEEGEKQRKLQTLVAEIRRAKQRFR---DDHIPKLVGNGDATEV  356

Query  701   VIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAI  537
             +     E   ++ +        +S CR   YE+DFGWGKP      ++   + V  LD  
Sbjct  357   ICNHQKEAGDMIASGGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALLDTK  416

Query  536   -NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               G +E W+ L +Q M    +DR  L + S  P
Sbjct  417   EGGGIEAWVNLNEQEMKLFEEDRELLDFASVNP  449



>emb|CDP10330.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   204 bits (518),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 148/453 (33%), Positives = 225/453 (50%), Gaps = 32/453 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+VE+ S+EI++PS PTP+ LK +K SFLDQ++    + F+ FY         + +    
Sbjct  1     MEVEIISQEIIKPSIPTPDHLKIFKRSFLDQISGRFLVRFISFYPRKETNLKINQVTHQL  60

Query  1562  kslsktlsLM-YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K        + YPLAG  K+D  ++ECND+G  F+ A V  N++ LL   +  +  +L  
Sbjct  61    KISLSQTLTLYYPLAGVYKDDS-SIECNDKGALFVTAHVRCNINELLNLPKFQQFHKLGT  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
             S+KF E  P     V VQ N FSCGG+AI    SH + D   ++ F++ WA+ +RG   +
Sbjct  120   SSKFLEDGPFQ---VFVQFNTFSCGGVAIFTCFSHMVIDMPTISVFLKCWAAISRGSQDD  176

Query  1205  NGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                G  +    S +LFPP     ++     +  +G   ++   I KRFV  A AI+    
Sbjct  177   QSPGHPYPRYESQVLFPP---KDSVPLGFSVVVKGSLLKDGRSIRKRFVFSAPAIS----  229

Query  1031  DLTITGGS--VQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPPLPP  873
             DL + G S  V  P+ VE +++ +W   + A        Q + +    +LRRRM PPLP 
Sbjct  230   DLKVKGTSKRVPDPTSVEVVSSFIWKHAMAAAKVVKGFQQPSVIFHAADLRRRMVPPLPE  289

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAV  699
                G +     ++ +  K     V    LV+ +R A    KD    K+   GG+  +   
Sbjct  290   YFAGNI--GCPIVAEYDKIDDLEVKFGRLVKILRLAKEKNKDEFVPKLLSSGGFDMMIKF  347

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLV----VNMLDNSWVLFLDA  540
             +    E   N+D +T   SS C++   EVDFGWGKP    LV    V  +  ++V+ +D 
Sbjct  348   LEDWGEKCSNKDLNTYQFSSWCKIGLNEVDFGWGKPIWTSLVGGTEVESMYKNFVVLVDG  407

Query  539   INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G +E W+ L ++ M  L  DR FLAY S  P
Sbjct  408   SDGGIEAWLILEQKEMAILENDREFLAYASPNP  440



>ref|XP_008222079.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=438

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 233/449 (52%), Gaps = 31/449 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTI  1575
             + ++VEV SKEI++PSSPTP+ L++Y+FSFLDQ+A  V  P + FY          T+  
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHKAKTQFNITEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIK  1398
             + LK SLS+ L+L YPLAGR K ++  + CNDEG+ F  A V +  +S +L N   G++ 
Sbjct  61    NHLKNSLSEVLTLFYPLAGRIKHNQF-IHCNDEGIPFFEARVLDCTLSDVLNNPIPGELN  119

Query  1397  QLTPSAKFYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +  P    +E   +  +  + VQ+N F CGG AIG  +SH IAD  +   F +IWA+  R
Sbjct  120   KFMP----FELDDITNSFPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAAIAR  175

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G  AN N   F+   SS LFPP     A +     G  GI    KD + KRFV  ++ I 
Sbjct  176   GDKANINPPEFI---SSTLFPPKEFNIAYD-----GGVGI---TKDRVTKRFVFDSSQIE  224

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT----LSCMVNLRRRMEPPLP  876
              LR          +R +RVE L+  +W+  + AT   T      +   VNLR R +PPLP
Sbjct  225   NLRARYEHNMHLKKRLTRVETLSTFLWSRFVAATKDCTMNKLYRVIHAVNLRPRFDPPLP  284

Query  875   PNCLGTLVDEAIV--LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
              +  G L   ++   L   +  G        ++Q +R+A   + +   +K+  +G     
Sbjct  285   QSSFGNLFRFSMTAPLRIPSSGGDEECGHDVVIQAVREAVGKIDNEYVKKLQKQGDEHFG  344

Query  701   VIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAI-N  534
             V+ +  +  +  +  TL + SS CR   Y+ DFG G+P  V +  +   + VLF+D    
Sbjct  345   VMKKQADSFKRGEMGTLLSFSSYCRFPLYDNDFGLGRPTWVGSPALTYKNLVLFMDTKEG  404

Query  533   GAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             G +E ++ L ++VM     D   L+YV++
Sbjct  405   GGIEAYVSLEEEVMAKFECDSELLSYVAS  433



>gb|KDP26742.1| hypothetical protein JCGZ_17900 [Jatropha curcas]
Length=438

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 150/455 (33%), Positives = 223/455 (49%), Gaps = 39/455 (9%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI  1575
             + +  K+ V + E +RPSSPTP  LK  K S +DQ         V FY      H    I
Sbjct  1     MAMAKKIRVINTETIRPSSPTPSDLKTLKLSLMDQFVPATYTSLVLFYSLNNNTHTNTEI  60

Query  1574  DElkkslsktlsL--MYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKI  1401
              +  K+          +PLAGR K D  ++ECNDEG EFI A +  ++S +LE  +   +
Sbjct  61    LQKLKTSLSETLTHHFFPLAGRIK-DNSSIECNDEGAEFIEARINCSLSDILEKPDTEFL  119

Query  1400  KQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             KQL P+A    P+     L+ VQ N F CGG+A+G  VSH IADA+ L  F+  WA+   
Sbjct  120   KQLLPAA-IESPEAATGNLLLVQANFFDCGGLALGVCVSHKIADAATLTIFINCWAAMAS  178

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                    S F    S  LFPP+ D S     +++ A      +++ I KRFV   + IA 
Sbjct  179   RSNKVVDSPFFMGAS--LFPPI-DISIPNASLELVA------QQNCITKRFVFTESKIAA  229

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA----TLSCM-VNLRRRMEPPLP  876
             L+  +  T   V  P+RVEA++ L+W AVI    ++      ++ CM VNLR R  P LP
Sbjct  230   LKAKVAST--RVPEPTRVEAVSGLIWKAVITTVRSKLGVSRKSVLCMAVNLRSRFVPKLP  287

Query  875   P----NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
                  NC+G++V    +         +V+ AVELV +IR       +   +++  EGG L
Sbjct  288   ENYAGNCVGSIVPRLDI-------ASSVIDAVELVGKIRKEMEEFGENYVKRLQ-EGGSL  339

Query  707   R--AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLD  543
                    +  ++  ++D      SS C+   Y  DFGWGKP  +   +  + N  VL +D
Sbjct  340   AICGFTKQFGDMAMSKDIDFYVCSSWCKYDLYGADFGWGKPIWLCTAITTIRNVAVL-VD  398

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +G  +EVW+ L ++ M  L  ++  L + +  P
Sbjct  399   TRDGLGIEVWLTLTEEEMALLESNQELLQFAALNP  433



>gb|KDP26741.1| hypothetical protein JCGZ_17899 [Jatropha curcas]
Length=432

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 149/449 (33%), Positives = 230/449 (51%), Gaps = 34/449 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG--RACHHTDTI  1575
             + ++ E+ SKEI++PSSPTP+ L++YK SFLDQ++  V  P + FY +      +  +  
Sbjct  1     MKLECELISKEIIKPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFYETDGETKFNSVEKY  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             ++LK+SLS+ L   YPLAGR K++   V+CNDEG+  + A V+  +S ++++    +IK+
Sbjct  61    NQLKQSLSQALIHFYPLAGRIKDNHF-VDCNDEGIPCLQAKVSGKLSDVVQSPVPTEIKK  119

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P    +E     +  + VQ N F CGGI IG  +SH I DA ++  F++IWA+  RG 
Sbjct  120   LLP----FELDQDQELPLGVQFNIFECGGICIGLCLSHNIGDALSIVLFVKIWAAITRGE  175

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    FV   S+ LFPP  D S     +    E +       + +RFV  +++I  LR
Sbjct  176   EEITRPEFV---SAKLFPP-KDFSGFNPRIGFAKENV-------LTERFVFKSSSIESLR  224

Query  1034  QDLTITGG--SVQRPSRVEALTALVWAAVINATPTQTATLS-------CMVNLRRRMEPP  882
                  +    S + PSRVEAL+A +W   + A   QT   S         VNLR RM PP
Sbjct  225   AKYAASTSLKSQRPPSRVEALSAFIWTRFMAAIKQQTEEPSEKIYMMLHAVNLRTRMNPP  284

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP N  G     A+       + G      ++V ++RD+   + D E  K   E G    
Sbjct  285   LPENSFGNFYRVAMTF-PSPTNNGEESNYDDIVIQMRDSISKI-DTEYVKKLQEAGNDEH  342

Query  701   V--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
             +  I +  +     +  +L  +SLCR   YE DFGW KP  V   ++   + V+F+D  +
Sbjct  343   MDFIKQMAQFFMRGEMVSLNFTSLCRFPLYETDFGWRKPIWVGSPSLTFKNLVVFMDTPS  402

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E  + L ++ M    +D+  L +VS
Sbjct  403   GDGIEALIHLNQEDMQKFKEDQELLQFVS  431



>ref|XP_002511244.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51846.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=445

 Score =   202 bits (513),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 224/449 (50%), Gaps = 34/449 (8%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA---CHHTDTI  1575
             ++ V V S+E ++PSSPTP++LK +K S LDQL+    +P + +Y S        + + +
Sbjct  3     SVNVLVTSRETIKPSSPTPQTLKCFKLSLLDQLSPAAYVPMIIYYASNSELDEVKNQERL  62

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             D LKKSLS+TL+  YPLAGR KE+ + +ECND+GV+F  A V   +S +L   E   + Q
Sbjct  63    DLLKKSLSRTLTQFYPLAGRVKEN-LFIECNDQGVDFFEARVNCPLSEILRRPEADVLNQ  121

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P           +  VA+QVN F+CGGIAIG  +SH + D      FM  WAS  RG 
Sbjct  122   FLPHEYHVPAASSMEFQVAIQVNTFTCGGIAIGTSISHKLVDGITFTCFMNNWASIARGS  181

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               ++   FV  H    FPP  D S +  ++ +        +   I KRF+   + +A LR
Sbjct  182   DEHSPPVFVGPH---FFPP-KDLSGLFPVLDI-------PQAKNITKRFLFDLSKVASLR  230

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSC---------MVNLRRRMEPP  882
             + +   G     PSRVE ++AL+W   ++A+     +  C          VNLR RM PP
Sbjct  231   ERV-FGGSGSNAPSRVEIVSALIWKYAMDASSRAKPSSGCNKSPSFLTQTVNLRARMNPP  289

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--L  708
             LP +  G  +    ++   A      +   ELV +++++F+       +K+ GE G   L
Sbjct  290   LPDSAAGNFI---WLIIAPAPSDFKKIELHELVYQVQNSFKNFNSEFVKKIQGEAGLLVL  346

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLFLDAI  537
                + +  ELV +R+      +SL +   YE DFGWG P  V +      N  VL     
Sbjct  347   GETLDQIGELV-SRNVDIYRFTSLRKFQLYEADFGWGVPAWVSSAGLAFKNVVVLIETRD  405

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                +E W+ L ++VM     ++  L++ S
Sbjct  406   ADRIEAWITLEEEVMAIFEHNQELLSFDS  434



>ref|XP_007028226.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY08728.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=442

 Score =   202 bits (513),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 138/448 (31%), Positives = 226/448 (50%), Gaps = 32/448 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRL-PFVFFYVSGRACHHTDTIDEl  1566
             MKVEV S++ ++PS PTP  L+ +  S LDQ    +     VFFY S      + +    
Sbjct  4     MKVEVTSRKTIKPSIPTPHHLRTFNLSLLDQDVPAIHYGSVVFFYPSDNTARSSISQKSQ  63

Query  1565  kkslsktlsLM--YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
                 S +  L+  YPLAG+ K D +T+ECND+G  FI A     ++  L + + G +K+L
Sbjct  64    SLKNSLSRILLHFYPLAGQVK-DAVTIECNDQGACFIEARTGCQLNDFLTHPDPGFLKEL  122

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              PS      +     ++ VQ+  F+CGG A+   VSH  ADAS+L  F++ W + +    
Sbjct  123   VPSTDPKAIRSTLACILLVQLTSFTCGGTAVAVCVSHKFADASSLCTFIQSWTAMSS---  179

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                      ++  ++ P L   S +  + K+         ++   KRFV   + IA L+ 
Sbjct  180   --------REYGRVVVPKLVGASLLPPIHKLITSTPPPTTRNCATKRFVFHKSQIANLKA  231

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPT------QTATLSCMVNLRRRMEPPLPPN  870
              +  T G  QRP+ VE + A+V      A+ +      Q+A L+ +VNLR+RM PPLP N
Sbjct  232   KVAATMGKQQRPANVEIVLAIVLRCASAASQSKYGSSRQSALLN-VVNLRKRMVPPLPGN  290

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              +G L+    VL QE+      V   ++V +++DAF  V + + + +  + G      +R
Sbjct  291   TIGNLIWTYPVLFQESD-----VQLHQIVAKMKDAFTNVCNDKLKTIKSKKGHTEVQESR  345

Query  689   GY--ELVRNR--DSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAINGAV  525
                 +L+  +  D++T   ++LC    +E+DFGWGKP  V +  +  + ++ LD+  G +
Sbjct  346   KQIAQLLNGKLVDTNTYTCTNLCSYPLHEMDFGWGKPLWVTSPSNFKNLIVLLDSKWGDI  405

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E W+ L +  M T  +D+  LA  S+ P
Sbjct  406   EAWVTLDELEMATFERDQELLAVASSNP  433



>ref|XP_010100293.1| Vinorine synthase [Morus notabilis]
 gb|EXB82427.1| Vinorine synthase [Morus notabilis]
Length=438

 Score =   201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 232/454 (51%), Gaps = 40/454 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV--SGRACHH----  1587
             + +++E+ SKE ++PSSPTP+ L++Y+ SFLDQL+  V  P++ FY+  +    HH    
Sbjct  1     MEVEIELISKEFIKPSSPTPDHLRHYQLSFLDQLSPKVYNPWLLFYLLNNDDHVHHSEFN  60

Query  1586  --TDTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFE  1413
               T+    LKKSLS+ LSL YPLAGR K+    ++CNDEGV F  A V   +S +++N  
Sbjct  61    NITNISYHLKKSLSQVLSLYYPLAGRVKDGLNIIDCNDEGVPFFEARVKGKLSDVIDNPN  120

Query  1412  IGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             I ++ +  P    ++   V +  + +Q+N F CGGIAIG   SH ++DA +   F++ W 
Sbjct  121   INELDRFLP----FKLDDVTELALGLQINVFECGGIAIGVCNSHQLSDALSNITFIKTWV  176

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
             +  R         F+   S  LFPP       + L+ +    I    K+++ KRFV  A 
Sbjct  177   ATARREPDIVRPEFI---SGKLFPP-------KNLVGLNP-SIGITRKNIMTKRFVFKAA  225

Query  1052  AIAQLR--QDLTITGGSVQRPSRVEALTALVWAAVINAT--------PTQTATLSCMVNL  903
              I  LR   D    G   +RPSRVEAL+A +W+  + AT          +T  +   VNL
Sbjct  226   TIEALRAKYDENSLGEDRRRPSRVEALSAFIWSRFVAATNGDQSGHDDQKTYIVLHAVNL  285

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R R EPPL  N  G     AI +    K G  +      V+++R+  R +     RK+  
Sbjct  286   RPRFEPPLGENHFGNYFRVAITV-PSLKTGEDLCHG--FVRQVREEIRKIDKEFVRKLQE  342

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLF  549
                 L  +  R    V+  +  T   +SLCR   YE DFGWGKP  V +   N  +  +F
Sbjct  343   GNEHLELLKDRSEGFVKG-EVITFAFTSLCRFPVYEADFGWGKPTWVGSAALNFHNVTVF  401

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +DA NG  +E ++ L  + +  L  D+ F A VS
Sbjct  402   MDAKNGDGIEAYLSLKDEDLAKLEVDKEFQACVS  435



>ref|XP_006443122.1| hypothetical protein CICLE_v10020052mg [Citrus clementina]
 ref|XP_006478865.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR56362.1| hypothetical protein CICLE_v10020052mg [Citrus clementina]
Length=464

 Score =   201 bits (512),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 233/477 (49%), Gaps = 56/477 (12%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS-GRACHHTD--TID  1572
             M++++ SK I++PSSPTP  LK +K S LDQLA N     + FY    R    T   TI+
Sbjct  1     MQLDIISKNIIKPSSPTPLHLKTHKLSLLDQLAPNNYTSLLLFYDGPSRFDDKTSARTIN  60

Query  1571  ElkkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAEN--MSSLLENFEIG  1407
             +  +  S     +   YP AG+  +D   V+C+D GV F+   V  +  MS +L+N E  
Sbjct  61    DYHRLKSSLSKTLTLYYPFAGKVLKDNYVVDCDDSGVPFVETRVPSSISMSEVLKNPETN  120

Query  1406  KIKQL---TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              ++QL    P+ K+          +A+Q+N F+CGG+AIGF   H +ADA+A   F++ W
Sbjct  121   TLQQLLPFNPNKKYL--SSTDDVNMAIQINHFACGGMAIGFNFRHIVADATASIGFIKNW  178

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIE--QEEKDMIVKRFVI  1062
             A  N   ++++ S     H  +     TDT    + +   A  I   Q   + + KRFV 
Sbjct  179   AKLN---SSDDNSIINYKHVVV---DCTDTFPRNKEIPSYARRINEWQRAPECVTKRFVF  232

Query  1061  PANAIAQLRQDLTITG----GSVQRPSRVEALTALVWAAVI------NATPTQTATLSCM  912
               + +A L++++ +           PSR EA+  L+W A+I      N   T T  +S  
Sbjct  233   DGSKVAALKREMIVKNEASLNHQYSPSRFEAVCGLIWGALIAMDREKNIDSTST-IVSIP  291

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLC---QEAKDGGTVVTAVELVQRIRDAFRAVKDGE  741
             VNLR RM P LP +C+G L     V C    EA DG    +   L + + ++ + V D  
Sbjct  292   VNLRNRMNPLLPEDCIGNLFHS--VTCAANNEAGDGHRDKST--LARNVHESKKMVGDDF  347

Query  740   ARKVYGEGGWLRAVIARGY-----ELVR---NRDSST----LYTSSLCRMAYYEVDFGWG  597
              RKVY +GG    V    Y     EL++   N D++        S    + YYE+DFGWG
Sbjct  348   VRKVYQDGG---VVFVNQYKEAVKELLKDGPNNDTTNSVRLFGFSGPIGLQYYEIDFGWG  404

Query  596   KPRLVVN-MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             KP  V + M  ++  + LD  +G  VE W+ LP   M  L QD   L Y S  P P+
Sbjct  405   KPVWVTSAMRMHNTAMLLDTRDGKGVEAWVGLPINDMPKLEQDPGILTYASFTPSPR  461



>gb|KDP35375.1| hypothetical protein JCGZ_10359 [Jatropha curcas]
Length=440

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 153/462 (33%), Positives = 225/462 (49%), Gaps = 52/462 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-----VSGRACHHT  1584
             + M VE  S E ++PSSPTP  L+N+K   LD+LA    +P +  Y      +     + 
Sbjct  1     MAMMVEKISSETIKPSSPTPNDLRNFKICLLDELAPPSYVPILLLYSPSADFNNGVADYF  60

Query  1583  DTIDElkkslsktlsL-MYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIG  1407
             D I E  K          YPL G+  E  ++VECND+G  F+ A V   +S +++N E  
Sbjct  61    DAISEKLKKSLSETLTRFYPLCGKL-EGNLSVECNDDGALFVKAKVNIAVSEIVKNLETD  119

Query  1406  KIKQLTPSAKFYEPQPVGK------ALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFM  1245
              + QL P    Y+ +P G        +  VQVN F CGG+ IG  VSH I D +A+A F+
Sbjct  120   LLYQLFPFNP-YKVRPDGARENGEAMITGVQVNLFECGGVGIGVCVSHKIVDGAAMAAFL  178

Query  1244  EIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
               WA+   G   N  S  +  H   LFPP      I+Q     ++ I  E+  +I KRF 
Sbjct  179   NAWAATATGI-DNTISPRLDAHK--LFPP-KGIDIIKQ-----SDMIRNEK--VITKRFE  227

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCM  912
               A ++A L++ +   G S    +RVEA+TAL+W + + A          P+  AT   +
Sbjct  228   FDAKSLANLKEKIK-NGNS----TRVEAVTALIWKSAMKAVRLNSGKDKLPSSIAT--HL  280

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLC-QEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
             +N+R RM+PPLP   LG L   ++  C  E KD    V   ELV  +R + R V +    
Sbjct  281   INIRDRMDPPLPGYSLGNLWRLSLAPCVDEKKD----VELQELVSLLRKSIRRVDNDYVN  336

Query  734   KVYGEGGWLRAV--IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM---  573
             ++ G+GG L+A+  +    +L    +   +YT SS  R   YE+DFGWGKPR V  +   
Sbjct  337   ELQGDGGLLKALEPLKELRQLALGGEGVEVYTFSSWARFPLYEIDFGWGKPRRVCTITVP  396

Query  572   LDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             + N  +L        +E W+ L ++ M         L +VS 
Sbjct  397   VRNCVILMGTRSGDGIEAWVTLTEKDMAKFESSEELLQFVSG  438



>ref|XP_006427936.1| hypothetical protein CICLE_v10027290mg [Citrus clementina]
 gb|ESR41176.1| hypothetical protein CICLE_v10027290mg [Citrus clementina]
Length=439

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 151/450 (34%), Positives = 233/450 (52%), Gaps = 38/450 (8%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkks  1557
             V++ S E ++PSSPTP+ L+ Y+ S LDQ+  N+ +PFVFFY + +        D LK+S
Sbjct  4     VQIISTEAIKPSSPTPKHLRTYELSMLDQMFSNLYMPFVFFYSANKHQDFRKNSDFLKQS  63

Query  1556  lsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP-SA  1380
             L+KTL+  YPLAGR   D  +VECND GV FI A V  +MS  L+   +G ++QL P S 
Sbjct  64    LAKTLTHYYPLAGRFV-DSFSVECNDHGVTFIEAQVGCDMSKFLQPPNMGVMQQLIPPSP  122

Query  1379  KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNG  1200
             +    +   +AL+AVQVN FS G +AIG  + H +AD SA++ FM++WA  NRG   N  
Sbjct  123   QSLRLEASERALLAVQVNYFSTGDVAIGICIWHGLADGSAISNFMKLWAEINRGVNENIC  182

Query  1199  SGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT-  1023
             +  V D +S LFPP   +S  +Q +K       Q    ++ KR       I  L++ +  
Sbjct  183   NNVVLDCTS-LFPP--HSSLKDQHIK------PQLTSKVVFKRLFFDGKKIVALKEKVNK  233

Query  1022  -ITGGSVQ---RPSRVEALTALVWAAVINATPTQ---------TATLSCMVNLRRRMEPP  882
              I  GS     + SR   +++L+W A I     +         +  +   +NLR +M PP
Sbjct  234   EIMVGSFDHELQASRFMVVSSLIWGAFIAVAQERKRAINNKLYSHAMYYTMNLRSKMNPP  293

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             + P C+G +     V  +    G   + A  LV+++  A R V +      Y   G+++ 
Sbjct  294   MIPQCMGNIF--RFVRAEWPLVGDDDIEATSLVKKVIKAKRNVSNVMNNIEY--LGFMKD  349

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSWVLFLDAING  531
              +   +E     DS +L  +S+  + YYE DFGWGKP    +    L N+ +L   +   
Sbjct  350   -MNEAWE-----DSRSLTLTSVVGLRYYEADFGWGKPVWLSIGSVSLPNAALLSDTSDGK  403

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              VE W+ L ++ M    ++   +A+ S+ P
Sbjct  404   GVEAWVVLYEEDMDKFEKNPSIMAHASSNP  433



>ref|XP_010514234.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   199 bits (507),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 152/452 (34%), Positives = 233/452 (52%), Gaps = 35/452 (8%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV-SGRACHHTDTIDE  1569
             +M V+V S++I++PSSPTP  LK +K S L+QL   +  P V+FY  +      T+ + +
Sbjct  16    SMIVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVYFYSGNNNRIKPTEQLQK  75

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPLAGR K + ++++CND G +F+ A+V   +SSLL+      +++L 
Sbjct  76    LKKSLSETLTHFYPLAGRLKGN-VSIDCNDSGADFLEAEVNSPLSSLLQEPSSDNLQRLI  134

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGCA  1212
             P++   +       L+  Q + F CG +AIG  +SH  ADA+++  FM+ WA+  +RG  
Sbjct  135   PTS--VDSIETRTKLLLAQASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRGSI  192

Query  1211  ANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIA  1044
                GS  V D   I FPP   ++TS         A  IE E      +  RFV  +++I 
Sbjct  193   KTVGSP-VFDTVKI-FPPGNFSETSP--------APVIEPEIMMNQTLSNRFVFDSSSIQ  242

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+ +   +   V++P+RVEA++AL+W   + AT T + T     L+   +LR R+ PP 
Sbjct  243   SLQAN--ASSFEVKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPF  300

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N +G LV        +A++G        LV  +R   +  +D    K+ G       +
Sbjct  301   TENSVGNLVS---YFAAKAEEGVNQTKLQTLVSELRKEKQRFRDNHVPKLVGNPSATEII  357

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
              +   E   ++ + D      SS CR   YE DFGWGKP  V    +   + V  LD   
Sbjct  358   CSYQREAGHMIASGDFDFYIFSSACRFGLYETDFGWGKPAWVGIPCVRQKNIVTLLDTKE  417

Query  533   -GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +Q M  L QD   L +VS  P
Sbjct  418   AGGIEAWVNLNEQEMKLLEQDSELLHFVSLNP  449



>ref|XP_006345618.1| PREDICTED: vinorine synthase-like [Solanum tuberosum]
Length=425

 Score =   199 bits (505),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 150/446 (34%), Positives = 239/446 (54%), Gaps = 40/446 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +KVE+ SKE ++P SP+ +S K++K S LDQ A N    FV FY    +    + ID 
Sbjct  1     MDIKVEIISKETIKPFSPSSKSHKSHKLSLLDQKAPNCYTTFVLFYNKNSSSDLENVIDS  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLSKTLS + PLAGR K D ITVECND+GV+   A+V E+MS++L N +I  +++L 
Sbjct  61    LKVSLSKTLSYLNPLAGRVK-DGITVECNDQGVDLTRANVHEDMSNVLMNLKIQVLRKLL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P             L+A+Q+N F+CGGIAIG  +SH I D S++A F++ WAS ++  A 
Sbjct  120   PMNPLTRSD--DNVLLALQINCFACGGIAIGVCISHLITDGSSIATFLKTWASISQSRAE  177

Query  1208  NNG----SGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             N+          D +SI FPP      +         G +Q +  M  +RFV   + I  
Sbjct  178   NDNITISDKLFMDCTSI-FPP----KKVHSFSVFQFGGKDQLQPKMAARRFVFDESNI--  230

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVI-------NATPTQTATLSCMVNLRRRMEPP  882
                 L +   + +  S+VEA+ A VW +VI       N    +   +   ++LRRR++PP
Sbjct  231   ----LALNTKAERSTSQVEAVLAFVWESVIAAMQKRSNNNGIKNYVIRIPIDLRRRIQPP  286

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP   +G ++   +    E  +G   +    LV++I+D+         + V   G  ++ 
Sbjct  287   LPQQTMGNII-HMVEANWEVSEGP--LDYKLLVKKIQDSI--------KNVTKHGYDVKN  335

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVLFLDAING-A  528
             +  R   L  N++   L ++S C+  +Y++DFGWG+P+   V  +  + V+ +D  +G  
Sbjct  336   MDDRVRTL--NKEERILGSTSFCKFPFYDIDFGWGRPKWASVGSIAPNLVVLMDTSDGKG  393

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +EVW+ L ++ M  L +++ F  +VS
Sbjct  394   IEVWLGLVEEDMAILEKNQEFFKFVS  419



>ref|XP_002517535.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF44699.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=446

 Score =   199 bits (506),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 151/458 (33%), Positives = 231/458 (50%), Gaps = 40/458 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH---TDTID  1572
             MKVE+ S+E+++PSSPTP  LK++K   LD+LA     P +  Y S    +    +   D
Sbjct  1     MKVEIISREMIKPSSPTPIHLKDFKICLLDELAPPSYAPILLLYSSTDFVNENCFSAVAD  60

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             +LKKSLS+TL   YP +G+ KE+  +++CNDEG  F+ A V   +S +++N E   + QL
Sbjct  61    KLKKSLSQTLVHFYPFSGKLKENLNSIDCNDEGALFLEAKVNVALSKIVKNPETNMLCQL  120

Query  1391  TPSAKFYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
              P    ++P         +    VQVN F CGG+ IG  VSH IAD + +A F+  WAS 
Sbjct  121   FP----FDPYDAAVDGEIRVTTGVQVNVFECGGVGIGVCVSHKIADGATMASFISSWASS  176

Query  1226  NRGCAANNGSGFVSD---HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                  +++     S     S+++FPP         +MK     I  E+  ++ KRF    
Sbjct  177   ATATGSDDDHQAFSSPRLDSAMIFPPKG-----MDMMKHCNMVIRNEK--IVTKRFEFDW  229

Query  1055  NAIAQLRQDLTITGGSVQ-RPSRVEALTALVW--AAVINATPTQTATLSC-----MVNLR  900
               +A L+ ++   G S +  P+RVEA+TAL+W  A  +  + ++  T+ C     +VN+R
Sbjct  230   KKLANLKANIDANGVSEKINPTRVEAVTALIWRSAMEVKRSMSEQDTIPCSIATHLVNIR  289

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              RM PPLP + +G L   A+    E K     V   ELV  IR++ R + +    ++ GE
Sbjct  290   ERMRPPLPGHSIGNLWRLAVAPYLEFKKD---VKLQELVDLIRESIRRIDNDYVTELQGE  346

Query  719   GGWLRAVIA----RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSW  558
              G+ + +      R   L+          SSL R  +YE+DFG GKP  V  + M   + 
Sbjct  347   DGFEKGIEPLKELRELALLGGEGVEVYTFSSLARFPFYEIDFGLGKPVKVCTITMPIRNC  406

Query  557   VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             V  +D   G  +E W+ L +  M      +  L +VSA
Sbjct  407   VTLIDTRFGDGIEAWVTLTENDMAKFECSQELLQFVSA  444



>ref|XP_007134122.1| hypothetical protein PHAVU_010G020900g [Phaseolus vulgaris]
 gb|ESW06116.1| hypothetical protein PHAVU_010G020900g [Phaseolus vulgaris]
Length=441

 Score =   199 bits (505),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 232/453 (51%), Gaps = 41/453 (9%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY----VSGRACHHTDTID  1572
             K E+ S E ++PSSPTP  L N+K SFLDQLA +  +P + FY    V   A   T   +
Sbjct  4     KNEIISNERIKPSSPTPNHLHNFKLSFLDQLAPSFYVPILLFYSASDVRTFATDLTALSE  63

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             +LK SLSK L+L YP  GR + +  T++CND+GV FI + +   +S++L+N +   + QL
Sbjct  64    KLKTSLSKLLTLYYPFCGRLRGNS-TIDCNDQGVIFIHSKLPIPLSNILKNPKPHNLHQL  122

Query  1391  TPSAKFYEPQPVGK---ALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              P A  Y  QP  +    ++AVQ+++F CGGIA+G   SH I DAS  A F+  WA+ +R
Sbjct  123   LPCAP-YNLQPQQRDTLGIMAVQLSQFKCGGIALGVCFSHKIIDASTAASFLSAWAATSR  181

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G   ++ +    + +S+LFPP      +   M  G  G      + + KRF+   + I++
Sbjct  182   GHGNSSFAPPPMEETSLLFPPRN----VFVDMTSGMFG----HANTVTKRFIFSGSNISR  233

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT---------ATLSCMVNLRRRME  888
             LRQ++   G     PSRVEA+TAL+W + + A    +         +++  +VN+R RM 
Sbjct  234   LRQNI---GCPSFNPSRVEAVTALLWKSSLEAAKEGSDSGEENVAASSVCHIVNIRSRMV  290

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             P L  + +G +   A+    E + G   V   +L +R+R+  R V     RK+  +  ++
Sbjct  291   PALSKDSIGNIWQYAVSSLVEVEGG---VGLRDLAERVRETIRKVDGDYIRKLQSDVEFV  347

Query  707   RAVIARGYELVRNRDSSTLYT----SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLF  549
               V  +G E  R   +   +     +S     +YEVDFGWGKP     +   + N  VL 
Sbjct  348   EVV--KGLEEARTMAAEKGHRFCAFTSWVGFGFYEVDFGWGKPTYATTIGMPIKNLGVLI  405

Query  548   LDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                    +E W+ L  + M  L  +   L + S
Sbjct  406   STKDGEGIEAWLTLTTREMAQLEHNAQLLDFAS  438



>ref|XP_009361768.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=451

 Score =   198 bits (504),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 142/460 (31%), Positives = 233/460 (51%), Gaps = 44/460 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--------VSGRACHH  1587
             +KVE+  ++ ++PS+ TP  L++YK SFLDQ+A  +  P + FY        VS R  HH
Sbjct  5     IKVEIIERQTIKPSTSTPHHLRSYKLSFLDQMAFVIYTPLLLFYPIASTTSNVSTR--HH  62

Query  1586  TDTIDE----lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
               +IDE    L +SL+KTL+  YPLAGR  +    VECND G  FI A ++  +S +LEN
Sbjct  63    AMSIDERCRHLIESLAKTLTHFYPLAGRIVKGNSIVECNDGGAAFIKARISCCLSDILEN  122

Query  1418  FEIGKIKQLTPSAKFYEPQPVGKA-LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
              +   +K+  P     E +  G   L+ VQVN F CGG+AIG  +SH IADAS L  F+ 
Sbjct  123   PDGQILKRFLPIE--IESKEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFIN  180

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGI----EQEEKDMIVK  1074
              WA+   G          SD   +L  P    +++ + ++  +       E  ++  + +
Sbjct  181   CWATIALGS---------SDSDQVLNLPEFGAASVFKPIEFSSSSQPPAREVVKEKCVTQ  231

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMV  909
             R+V  A+ I+ L+ +  +    V +P+RVEA++AL+W     A+ +       +     V
Sbjct  232   RYVFDASKISTLQSE--VASSFVAKPTRVEAVSALIWKCATEASRSNLRKQGPSFFRQDV  289

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             NLR+R+ PPLP N  G +V        +A +  +V+   +LV ++R+    +K+  A K+
Sbjct  290   NLRKRVVPPLPENLAGNVVGS---FTSKADEESSVINLKDLVAKLREGIEGLKEKYAAKL  346

Query  728   YGEGGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRL--VVNMLDNSW  558
               +       I       +  D+  +Y+ +S CR  +YE DFGWG+P    V ++   + 
Sbjct  347   VFDSDEAWQEIKDEQNKPKTHDNMEIYSCTSWCRFPFYEADFGWGRPSWASVASIAIKNI  406

Query  557   VLFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             ++ +D  +   +E W+ + ++       +   L Y S  P
Sbjct  407   IVLMDKRDCSGIEAWVTMSEEGKALFESNVELLGYASVNP  446



>gb|KCW86594.1| hypothetical protein EUGRSUZ_B03226 [Eucalyptus grandis]
Length=412

 Score =   197 bits (501),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 142/446 (32%), Positives = 220/446 (49%), Gaps = 61/446 (14%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             ++VEV S +IV+PSSPTP+ L++YK SFLDQ+ + V +P++ F+         +    ++
Sbjct  6     VEVEVISSDIVKPSSPTPDHLRHYKLSFLDQIQVPVFMPWILFFPRDDHLSLDEKCSNIR  65

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SL++ L+  YPLAGR + D + ++CNDEG  ++ A V   +S +LEN     + +  P 
Sbjct  66    RSLAEALTRFYPLAGRVR-DNLYIDCNDEGALYVEARVRCKLSDILENPVPRVLNRFLPR  124

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                 E   V    VAVQVN F CGG+A+   +SH +ADA ++  F+  WA+  RG A   
Sbjct  125   ----ELDDVQDLAVAVQVNFFECGGLALALLISHKVADALSIFTFLNAWAATARGDAD--  178

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                        +  P  D+                        RFV  A AI  LR+   
Sbjct  179   -----------IIDPCFDS------------------------RFVFDATAIFSLREQFA  203

Query  1022  ITGGSVQ------RPSRVEALTALVWAAVINATPTQTA------TLSCMVNLRRRMEPPL  879
                 +        RP+RVEAL++ +W+  + +T    A      T+   VNLR RMEPP+
Sbjct  204   NLNSAAAADPQCCRPTRVEALSSFLWSRYMASTQPVDARGDKLYTVLHAVNLRTRMEPPI  263

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               +  G +   A+ +    KD GT     E+V ++R+A + V      K+    G+L  +
Sbjct  264   SGHHFGNISRVAVAV--PTKDAGT-DGGYEIVHQVREAIKQVDRQYIEKLQDGEGYLNWL  320

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-A  528
               R   + +    S  +T S+CR   YE DFGWGKP  V   ++   + ++F+D  +G  
Sbjct  321   KERSARISQGEVVSFSFT-SMCRFPIYEADFGWGKPAWVGSASLTFKNLIVFVDTKSGDG  379

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +E W+ L +  M    QD+  LA VS
Sbjct  380   IEAWVHLKEDDMAKFEQDKELLALVS  405



>ref|XP_004310025.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=428

 Score =   197 bits (502),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 148/440 (34%), Positives = 230/440 (52%), Gaps = 34/440 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTID--E  1569
             MKVEV  ++ ++PSSPTP  L+ ++ SFLDQ+A  + +P + FY +    +    +    
Sbjct  1     MKVEVIERDCIKPSSPTPNHLRKHELSFLDQVAPPIFMPMLLFYPATSYGNDETPLSASR  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             +K+SLS+TL+  YPLAGR   D   V CNDEG  F+ A V   +S ++   +  ++ +L 
Sbjct  61    VKQSLSETLTQFYPLAGRII-DNAFVNCNDEGTPFVEARVKCLLSDVVSQPDPNQLNKLL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P     + + V   ++AVQVN F CGG+AIG  +SH +ADA +L  F+  WAS +RG   
Sbjct  120   PC----DLECVVDFVLAVQVNIFDCGGMAIGVCISHKVADALSLVMFLNSWASISRGDNC  175

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             N  +       +  FPP + +       K G  GI +++  ++ KRFV  A+ +A LR  
Sbjct  176   NYRAPIFD--LATFFPPRSISG-----FKPGV-GIARDK--IVTKRFVFSASNVASLRTK  225

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINAT---PTQTATLSCM--VNLRRRMEPPLPPNCL  864
              T T  + +RP+R+EAL+A VW+  + +T   P        +  VNLR RMEP LP +  
Sbjct  226   YT-TSETERRPTRIEALSAFVWSRFLASTQGKPNSDIVYKVLHAVNLRTRMEPALPEHHF  284

Query  863   GTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             G +     A    +E ++          V ++RDA ++V     RK+      +  +  R
Sbjct  285   GNVSRFATATTSFEEGEE-----ECYGFVGQMRDAIKSVDGEYMRKILEGTAHVDYLKQR  339

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVEV  519
               E ++    S  +T SLCR   YE DFGWGKP  V   ++   + V F+D+  +G +E 
Sbjct  340   AEEFLKGEVVSFSFT-SLCRFPLYETDFGWGKPIWVGSASLTFKNLVCFMDSGSSGGIEA  398

Query  518   WMKLPKQVMHTLTQDRHFLA  459
             W+ L ++ M    +D    A
Sbjct  399   WVNLKEEDMAKFQEDEQLRA  418



>ref|XP_006482379.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=441

 Score =   198 bits (503),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 151/457 (33%), Positives = 220/457 (48%), Gaps = 46/457 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++ + S E ++PSSPTP+  + +K SF+DQL        + FY +G +       + LK
Sbjct  1     MELRISSTENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASS------ERLK  54

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQLTP  1386
             KSLS+TL+  YP AG+ K++   V+C+D GV FI A     +MS +++  +   ++QL P
Sbjct  55    KSLSETLTHFYPFAGQFKDNHF-VDCDDHGVTFIEAHFHRGDMSEVIQQAKTNILEQLIP  113

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               K +E   V   L+ VQVN F CGG+AIG    H +ADA+  A F++ W    RG  A 
Sbjct  114   -CKPHESTRVEHNLI-VQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARGAGAG  171

Query  1205  NGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAE-GIEQEEKDMIVKRFVIPANAIAQL  1038
             + + F   + D +SI FP        + L  M    G+     D +VKRF      IA L
Sbjct  172   DTNDFKHAIYDSNSI-FPA-------QDLPDMSVNLGLVLFSLDSVVKRFTFEGEKIASL  223

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVNLRR  897
             R+ +      + RPSRVE +++++  A++ A              P    T    VNLR+
Sbjct  224   REKIVQAEPGLGRPSRVEVVSSVILGALLAAYRGSRDGDEEFTTAPLTHVTAIIAVNLRK  283

Query  896   RMEPPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             RM PPLP    G +   A   +      D    +    L  ++  + R V D   RK+Y 
Sbjct  284   RMNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRKLYV  343

Query  722   EGGWL---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDNSW  558
             EG  L   +AV A+G      + +     SS C+M +YE DFGWGKP    V      + 
Sbjct  344   EGEILNIRKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTEAA  399

Query  557   VLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             VL        +E W+ L KQ M    Q    LAY S+
Sbjct  400   VLVDGCQTDGIEAWVGLSKQDMARFEQHPGILAYTSS  436



>ref|XP_006348577.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Solanum 
tuberosum]
Length=438

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 144/449 (32%), Positives = 233/449 (52%), Gaps = 34/449 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKE-IVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTID  1572
             + +++EV SKE +++P SPTP  L++Y  S+LDQ+  ++ +P V+FY +     +T+  D
Sbjct  1     MKIEIEVISKETLIKPCSPTPIELRHYSLSYLDQIIPSIFMPLVYFYPASDLISNTERSD  60

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             ++K SLS+ L+  YPLAGR   D + V+CNDEGV ++   V  N++ ++ N    ++ + 
Sbjct  61    KIKLSLSQALTKFYPLAGRVV-DNLYVDCNDEGVPYVEVIVKCNLTDIISNPIPNELNKF  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    YE   V    + VQVN F CGG+AIG  +SH +ADA++   F+ +WAS  R C 
Sbjct  120   IP----YELDDVKDLGLVVQVNFFECGGMAIGIGISHKLADAASCFMFINMWASIAR-CD  174

Query  1211  ANNGSGFV-SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              ++   F  S  SS LFPP  D S +  +       +E  +++++ K+FV   + I  LR
Sbjct  175   YDDTCHFSPSFDSSTLFPP-KDASLVRDVC------LEIRKENIVTKKFVFSNSDILTLR  227

Query  1034  QDLTI--TGGSV-----QRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRM  891
                T     GSV     Q PSR+ AL+A +W+  +    ++  T     ++  VNLR R 
Sbjct  228   DKYTDQRMKGSVFERIGQHPSRILALSAFLWSRYMATVHSERDTDKIYAVTHTVNLRGRT  287

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV-YGEGG  714
             +PPL     G ++  A+V+     D G+     E + ++R++ + + +    +    +  
Sbjct  288   DPPLHEFLFGNIMRSALVI--PFFDKGSENEVFEFMNKVRESIQEINNNFVSQFKKNDQQ  345

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDA  540
              L  +  R  E  R      L  SSLC+   YE DFGWGKP  V +  +   + + F+D 
Sbjct  346   HLNFLQERANE-KRKGHMELLCFSSLCKFPLYEADFGWGKPIWVGSGRLATKNIIGFMDT  404

Query  539   -INGAVEVWMKLPKQVMHTLTQDRHFLAY  456
              +   VE W+ L    M     D+  LA+
Sbjct  405   KLGDGVEAWVNLEADDMAKFEADKKLLAF  433



>ref|XP_006341810.1| PREDICTED: vinorine synthase-like [Solanum tuberosum]
Length=430

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 217/448 (48%), Gaps = 34/448 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++E+ SK I++PSS TP  L NYK S+LDQ+  N+ +P VFFY       +T T ++
Sbjct  1     MKIEIEIISKLIIKPSSSTPHELHNYKLSYLDQITPNILMPLVFFYPVNNNFTNTHTSNQ  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLS TL+  YPL GR       V CNDEGV ++ A    ++S  L +    ++ +  
Sbjct  61    LKTSLSHTLTKFYPLGGRLDVANSHVNCNDEGVPYVEAIAKCSLSEFLLDPLPNELNKFI  120

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P     +   V    + VQ N F CGG+AIG  +SH I DA +   F+  W +  RG   
Sbjct  121   PC----DLHDVKDFCLLVQANFFQCGGMAIGIAISHKITDALSTFMFINTWGAIARGSID  176

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
                  F    SSILFPP   T     +M         E+ +++ KRFV  A+ ++ LR  
Sbjct  177   VPCPRF---DSSILFPPRDITKFKSSVM--------IEKDNIVTKRFVFSASKVSALRDK  225

Query  1028  LTITGG-SVQRPSRVEALTALVWA---AVINATPTQTATLSCM--VNLRRRMEPPLPPNC  867
              T  G  S + PSR+EAL+A +W    A ++A   +T     +  VNLR R  PPLP + 
Sbjct  226   YTEKGSESTKPPSRIEALSAFLWTRLMASVHAERDETKIYGMVHTVNLRTRSNPPLPESL  285

Query  866   LGTLVDEAIVLCQEAKDGGTVVTA--VELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
              G ++   I +     +          ELV+++R++   V       +        + I 
Sbjct  286   FGNVMQVVITVPATNNNNNRTNEEQDFELVKKVRESINNVNSEFVSGLRKNDKKHLSFIK  345

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP------RLVVNMLDNSWVLFLDAING  531
                   R  +      +SLCR+  Y+ DFGWGKP      RLV+  +    + FLD  +G
Sbjct  346   EKANEQRKGELVVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDV----IGFLDTKSG  401

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +E W+ L ++ M     D+  L++ S
Sbjct  402   NGIEAWVNLKEEDMAIFEVDKELLSWCS  429



>ref|XP_009114100.1| PREDICTED: vinorine synthase [Brassica rapa]
Length=459

 Score =   197 bits (502),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 144/452 (32%), Positives = 226/452 (50%), Gaps = 34/452 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             +T +VEV S++I++PSSPTP  LKN+K S L+QL   +  P +FFY +      T+ +  
Sbjct  16    LTTRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANYRIKQTEQLLN  75

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPL+GR   +  ++ CND G +F+ A V   +S+LL+      ++QL 
Sbjct  76    LKKSLSETLTHFYPLSGRLNGN-TSINCNDSGADFLEAQVNSPLSNLLQEPSSEMLEQLI  134

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P++   +       L+  Q   F CGG+AIG  VSH +ADA+++  FM+ W++     + 
Sbjct  135   PTS--VDSIEARTKLLLAQATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAITSQGSI  192

Query  1208  NNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                   V D   I FPP   ++TS    +E  +KM            + KRFV  +++I 
Sbjct  193   KTVGSPVFDTLKI-FPPGNFSETSPAPVVEPEIKMN---------QTLSKRFVFDSSSIE  242

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+     +   V +P+RVEA++A +W   + AT T + T     L+   +LR R+ PP 
Sbjct  243   ALQAK--ASSFEVTQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVSPPF  300

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N +G LV       +E +    + T V  ++R +  FR   D    K+ G G     +
Sbjct  301   TKNSIGNLVSYFAAKAEEGEKQRKLQTLVAEIRRAKQRFR---DDHIPKLVGNGDATEVI  357

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAI-  537
                  E   ++ +        +S CR   YE+DFGWGKP      ++   + V  +D   
Sbjct  358   CNYQKEAGNMIASGGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALVDTKE  417

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +Q M    +DR  L + S  P
Sbjct  418   GGGIEAWVNLNEQEMKLFEEDRELLDFASVNP  449



>emb|CDY04190.1| BnaA09g19680D [Brassica napus]
Length=459

 Score =   197 bits (502),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 145/452 (32%), Positives = 227/452 (50%), Gaps = 34/452 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             +T +VEV S++I++PSSPTP  LKN+K S L+QL   +  P +FFY +      T+ +  
Sbjct  16    LTTRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANYRIKQTEQLLN  75

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+TL+  YPL+GR   +  ++ CND G +F+ A V   +S+LL+      ++QL 
Sbjct  76    LKKSLSETLTHFYPLSGRLNGN-TSINCNDSGADFLEAQVNSPLSNLLQEPSSEMLEQLI  134

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P++   +       L+  Q   F CGG+AIG  VSH +ADA+++  FM+ W++     + 
Sbjct  135   PTS--VDSIEARTKLLLAQATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAITSQGSI  192

Query  1208  NNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                   V D   I FPP   ++TS    +E  +KM            + KRFV  +++I 
Sbjct  193   KTVGSPVFDTLKI-FPPGNFSETSPAPVVEPDIKMN---------QTLSKRFVFDSSSIE  242

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT--QTATLSCMVN---LRRRMEPPL  879
              L+     +   V +P+RVEA++A +W   + AT T  +T+  S + N   LR R+ PP 
Sbjct  243   ALQAK--ASSFEVTQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVSPPF  300

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N +G LV       +E +    + T V  ++R +  FR   D    K+ G G     +
Sbjct  301   TKNSIGNLVSYFAAKAEEGEKQRKLQTLVAEIRRAKQRFR---DEHIPKLVGNGDATEVI  357

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAI-  537
                  E   ++ +        +S CR   YE+DFGWGKP      ++   + V  +D   
Sbjct  358   CNHQKEAGDMIASGGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALVDTKE  417

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +Q M    +DR  L + S  P
Sbjct  418   GGGIEAWVNLNEQEMKLFEEDRELLDFASVNP  449



>ref|XP_007039558.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY24059.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=444

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 144/458 (31%), Positives = 217/458 (47%), Gaps = 35/458 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHT-DTID  1572
             I +K E+ S++ ++PS+PTP  LK +K S LDQL+  V     FFY S        D   
Sbjct  2     IEIKSEIVSRQTIKPSTPTPSDLKTFKLSLLDQLSPAVHGNMTFFYPSSNTMDSIGDDFS  61

Query  1571  Elkk----slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGK  1404
             E  +    S+SKTLSL YPL GR  +D  T++CNDEG  F  A V   +S  L   E   
Sbjct  62    EKSQLLQESISKTLSLFYPLGGRL-QDAATIDCNDEGAFFAEAKVNIQLSEFLNQPEFNL  120

Query  1403  IKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +    P+      +    A+  VQ+  F+CGG+AI   ++H +AD SAL   ++ W +  
Sbjct  121   MDHFLPTTDTKTMELSNGAMFIVQLTSFTCGGVAISLSLTHKLADVSALLTLLQSWTAVC  180

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             RG +       + +       P  + SA+   + + AE         +++RFV  A+ IA
Sbjct  181   RGLSDPVTPDLIGEK---FLAPRDELSAMSASLNIAAE-------KFVLRRFVFSASKIA  230

Query  1043  QLRQ--DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEP  885
             +L+   D          PSRVE + AL+W   +     +T +     L   VNLR+RM P
Sbjct  231   ELKAKVDQEFQNEMQSHPSRVEVVLALLWKCAVACKKQKTGSFGPTALFQAVNLRKRMSP  290

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP   +G  +   +VL  E KD    +   ELV ++R +F    + +A    GE   L 
Sbjct  291   PLPETAIGNFIWPFMVLAHEEKD----LKLPELVIQMRKSFIEFNNTKANMFRGEAAPLA  346

Query  704   ---AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLFLDA  540
                A+  RG     NR+ +    SS C+   Y+ DFGWGKP   + +N L ++ +   D 
Sbjct  347   IMGALKERGEFFRNNREMTVYKCSSWCKFPLYDTDFGWGKPLWHVSINKLVSNTIALADT  406

Query  539   IN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              +   +E  + L ++ M    Q+   L Y  A P P +
Sbjct  407   RSRDGIEALLTLDEEEMALFEQNEELLKY--ATPNPSI  442



>ref|XP_009359304.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Pyrus 
x bretschneideri]
Length=437

 Score =   196 bits (499),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 156/456 (34%), Positives = 234/456 (51%), Gaps = 45/456 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-----VSGRACHHT  1584
             +TM+VE+ S+EI++PS+PTP  L+ +  SF++Q      LP V+FY      S    H +
Sbjct  1     MTMEVELISREIIKPSTPTPPHLRTHNLSFIEQNTPRTYLPVVYFYHKESSASPNGDHES  60

Query  1583  DTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIG  1407
             + + +   SLS+ LS  YP AGR + DR +V+CNDEGV F+ A V    +S +LE+ E  
Sbjct  61    NQLKK---SLSEILSKYYPFAGRIR-DRASVDCNDEGVAFVEARVRNVKLSEILEHPEDT  116

Query  1406  KIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
              +  L      +        + AVQV+ F CGG+AIG  +SH +AD S +A F+  WA+ 
Sbjct  117   WLALLFTDNLQWNDDSSLSVIFAVQVSFFDCGGMAIGICMSHKVADTSTVANFINDWAAR  176

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             N+         F+   +   FP        +  M +  E +  E+ D + KRFV  A  I
Sbjct  177   NKCDQYVPSPLFIGADT---FP--------QGDMPLFPETV-LEKGDCVTKRFVFDALKI  224

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-PTQTATLS-----CMVNLRRRMEP  885
             A L+    I    VQ P+RVE +TAL+++  I+A   T  ++L+       VNLR R+ P
Sbjct  225   ASLK---AIVADKVQNPTRVEVVTALIYSCAISALRSTSQSSLNPTVFIHTVNLRTRVVP  281

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP N +G+++  A  L   A+D  +V+   +LV +++ +     D  A+K  GE  W  
Sbjct  282   PLPKNSVGSMI-WAFTL-STAED--SVMELHDLVTQMKQSMTRFCDSYAQKFRGEDQW-P  336

Query  704   AVIARGYELVRNRDS----STLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFL  546
             A+     + +R   S     T   SS CR   YE DFGWGKP  V      L N+ +  +
Sbjct  337   AIFKECTQALRKEFSIANLVTYRCSSWCRFPVYEADFGWGKPIWVTIASCPLKNA-IFLI  395

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             D  NG  +E ++ L KQ +    +D   LA+ S  P
Sbjct  396   DTRNGEGIEAYVNLEKQQLDVFERDAQLLAFASLNP  431



>ref|XP_006430561.1| hypothetical protein CICLE_v10011733mg [Citrus clementina]
 gb|ESR43801.1| hypothetical protein CICLE_v10011733mg [Citrus clementina]
Length=441

 Score =   196 bits (499),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 148/456 (32%), Positives = 219/456 (48%), Gaps = 44/456 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++   S E ++PSSPTP+  + +K SF+DQL        + FY +G +       + LK
Sbjct  1     MELRFSSIENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASS------ERLK  54

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQLTP  1386
             KSLS+TL+  YP AG+ K++   V+C+D GV FI A     +MS +++  +   ++QL P
Sbjct  55    KSLSETLTHFYPFAGQFKDNHF-VDCDDHGVTFIEAHFDRGDMSEVIQQAKTNILEQLIP  113

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               K +E   V   L+ VQVN F CGG+AIG    H +ADA+  A F++ W    RG  A 
Sbjct  114   -CKPHESTRVEHNLI-VQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARGAGAG  171

Query  1205  NGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
             + + F   + D +SI   P  D   +   + +G   +     D +VKRF      IA LR
Sbjct  172   DTNDFKHAIYDSNSIF--PAQDLPDMSVNLGLGLFSL-----DSVVKRFTFEGEKIASLR  224

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVNLRRR  894
             + +      + RPSRVE +++++  A++ A              P    T    VNLR+R
Sbjct  225   EKIVQAEPGLGRPSRVEVVSSVILGALLAAYGGSRDDDEEFTTAPLTHVTAIIAVNLRKR  284

Query  893   MEPPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             M PPLP    G +   A   +      D    +    L  ++  + R V D   RK+Y E
Sbjct  285   MNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRKLYVE  344

Query  719   GGWL---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDNSWV  555
             G  L   +AV A+G      + +     SS C+M +YE DFGWGKP    V      + V
Sbjct  345   GEILNIRKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTEAAV  400

Query  554   LFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             L        +E W+ L KQ M    Q    LA+ S+
Sbjct  401   LVDSCQTDGIEAWVGLSKQDMARFEQHPGILAHTSS  436



>ref|XP_006420178.1| hypothetical protein CICLE_v10006986mg [Citrus clementina]
 gb|ESR33418.1| hypothetical protein CICLE_v10006986mg [Citrus clementina]
Length=428

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 154/447 (34%), Positives = 225/447 (50%), Gaps = 44/447 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTIDEl  1566
             M VEV SKE ++PS+PTP+ L+ YKFSF DQ++ +  +P ++FY ++     +     +L
Sbjct  1     MDVEVISKETIKPSTPTPKHLQIYKFSFTDQISPSFYIPLIYFYNLNDHKLGNNIISGDL  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKSLSK L+  YPLAG   +D   V+CND+GV F+ A V  N+S ++      K+ +  P
Sbjct  61    KKSLSKVLTHYYPLAGCLNDD--YVDCNDKGVLFLEAKVKCNLSQIIGEPNPRKLNKFLP  118

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW-ASFNRGCAA  1209
                      V   ++A+QVN F CG IAIG  VSH IADAS    F++ W A+ + G   
Sbjct  119   DH-------VKNFILAIQVNFFDCGNIAIGACVSHKIADASTFITFIKNWAAAASFGGGG  171

Query  1208  NNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              + S  +     S+ LFPP     +    +          EK+++ K FV   + IA L+
Sbjct  172   GDDSVKICPELLSATLFPPRDVGESCRVSLPA--------EKNIVCKSFVFRGSRIAALK  223

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
             +     GG    P+RVEAL+A +W+    +T     P + + L   VNLR+RM+PP P +
Sbjct  224   E--KYAGGI--HPTRVEALSAFIWSRFAASTEIKIGPERVSMLVHAVNLRKRMDPPQPDD  279

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK----VYGEGGWLRA  702
               G +      +  E  D G       LV+  RDA   +    A+K    V+   G L +
Sbjct  280   SFGNISGPTATIISE--DIGE--ECYGLVKMFRDAIGRINKDYAKKLQEGVFEHFGLLGS  335

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---NMLDNSWVLFLDAING  531
             +   G++    R+    Y +SLCR   YE DFGWGKP  V        N  VL       
Sbjct  336   INDDGFD---RREVVNFYYTSLCRFPLYEADFGWGKPIWVAWGGWPYRNIAVLMDTKCGN  392

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +E W+ L ++ M     D+ FL+YVS
Sbjct  393   GIEAWIHLKEEDMVKFEADKEFLSYVS  419



>ref|XP_008390114.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 146/453 (32%), Positives = 233/453 (51%), Gaps = 37/453 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + MK+E+ S++  +PSSP P+ LK+YK S L+Q+A    +P + FY +      T  +D+
Sbjct  1     MQMKIEIVSEDQCKPSSPIPDHLKSYKLSLLEQIAPMFYVPVILFYSAPENIDDTTIVDK  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             L  SLS+TL+  YPLAGR  E   +V+C D  V F  A     +S +L+  E+  ++QL 
Sbjct  61    LNNSLSETLTGFYPLAGRI-EGNASVDCEDGAVXFARARANIQLSEILKIPEMDLVQQLL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +        A +A+Q+N F CGG+ I   +SH IAD + L+ F++ WA+ +RG   
Sbjct  120   PLDPYNIRMDKAVAAMAIQLNFFDCGGMGIVICLSHKIADGATLSSFLDAWATRSRGVFE  179

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR--  1035
             N        +S+ +FPP       ++ + M +  I++E+   + KRFV  A+++A+L+  
Sbjct  180   NITPSL---NSANIFPPR------DKQIFMPSNLIKREK--FVTKRFVFDASSLAKLKVK  228

Query  1034  --QDLTITGGSVQRPSRVEALTALVWAAVINAT------PTQTATLSCMVNLRRRMEPPL  879
               + L   G   + P+RVEALTAL+  + +NA          +  +S +  LR RM PPL
Sbjct  229   ASKGLCTDG---RAPTRVEALTALICKSSMNAKIGTLGRGRPSMAISHVGYLRERMAPPL  285

Query  878   PPNCLGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P +  G +  V  A ++  E+K         + V ++R   R + D   RK+ GE G+  
Sbjct  286   PEHSFGNIWRVAVASIMKDESKP-----ELHDFVVQLRKVIRKIDDDCVRKLQGEDGFSH  340

Query  704   AV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPR--LVVNMLDNSWVLFLDAI  537
             A   +    ELV   +      SS  R + Y  DFGWGKP    + N+   + V+ L + 
Sbjct  341   ACEPLKETSELVSEGEVEFFRFSSWIRFSLYNTDFGWGKPTWACISNVPIKNVVILLSSS  400

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +G  +E W+ L ++ M     D   L +VS  P
Sbjct  401   SGDGIEAWVTLDEEDMAKFESDHELLEFVSVAP  433



>ref|XP_006582966.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN39388.1| Vinorine synthase [Glycine soja]
Length=424

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 141/441 (32%), Positives = 218/441 (49%), Gaps = 30/441 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + ++VEV SKE+++PSSPT + L++Y  SFLDQ++  V  P V FY          TI E
Sbjct  1     MKLEVEVISKEMIKPSSPTQDHLRHYPLSFLDQVSPMVYNPMVLFYSCYGITQTQFTISE  60

Query  1568  lkkslsk-tlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
               K      L+  YPLAGR   +   ++CNDEG+ ++ A V   +  ++     G++  L
Sbjct  61    KLKKSLSDVLTHFYPLAGRVNGNSTFIDCNDEGIPYLEAKVKCKVVDVIHKPVPGELNHL  120

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRG-  1218
              P    +    +      VQ+N F CGGIAIG  +SH IAD  +   F+  WA+F +RG 
Sbjct  121   VP----FLLDDITNITFGVQLNVFDCGGIAIGACLSHQIADGLSFFMFLNSWAAFASRGE  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              A      F+   S+ LFPP  + S  +        GI +E  ++I K FV   + +  L
Sbjct  177   QAVLPNPQFI---SAKLFPP-KNISGFDP-----RSGIIKE--NIICKMFVFDGSVVESL  225

Query  1037  RQDLTITGGSVQR-PSRVEALTALVWAAVINAT-PTQTATLSCMVNLRRRMEPPLPPNCL  864
             R     T    ++ P+RVEAL+A +W+  +  T P +T  +   VNLR +MEPPLPP+  
Sbjct  226   RARYAATSFENEKHPTRVEALSAFIWSRYVAVTGPQRTYAVVHAVNLRPKMEPPLPPDSF  285

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G     ++ +        ++ T   LV++ RD  + +     RK+      L  +    Y
Sbjct  286   GNYYRISLTI-------PSLNTEEHLVKQARDQIKKIDKDYVRKLQYGNDHLDFLKDSSY  338

Query  683   ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAIN-GAVEVWM  513
              ++   +      +SLCR   Y+ DFGWG+P  V +  +   + V+F+D  N G +E ++
Sbjct  339   RVLLKGELVPFNITSLCRFPLYDADFGWGEPTWVGSPALTFKNLVVFIDTKNGGGIEAYV  398

Query  512   KLPKQVMHTLTQDRHFLAYVS  450
              L  + M     D   LA VS
Sbjct  399   SLKVEDMTKFEADEELLACVS  419



>ref|XP_006443123.1| hypothetical protein CICLE_v10024067mg [Citrus clementina]
 ref|XP_006478989.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR56363.1| hypothetical protein CICLE_v10024067mg [Citrus clementina]
Length=447

 Score =   196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 225/463 (49%), Gaps = 52/463 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS-GRACHHTDT----  1578
             M++ + SK+I++PSSPTP  LK +K S LDQLA ++    +FFY    R    T+T    
Sbjct  1     MQLRIISKKIIKPSSPTPLHLKTHKLSLLDQLAPDIYTSLLFFYNGPSRVYDETNTSTNN  60

Query  1577  -IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIV--ADVAENMSSLLENFEIG  1407
                 LK SLSKTL+L YP AG+  +D   V+C+D G+ F+      + +MS +L+N E+ 
Sbjct  61    VYHRLKSSLSKTLTLYYPFAGKLLQDNYVVDCDDSGIPFVETRGPSSISMSEVLKNPEMN  120

Query  1406  KIKQL---TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              ++QL    P+ K+     V     AVQ+N F CGG+AIG    H +AD +A   F++ W
Sbjct  121   TLQQLLPFNPNKKYLSTDDVN---AAVQINHFDCGGVAIGLNFRHIVADGAASVGFIQNW  177

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEK--DMIVKRFVI  1062
             A  +   ++++ S     H+ +     TDT    Q +   A  I +  +  + + KRFV 
Sbjct  178   AKLH---SSDDNSIINYKHAVV---DCTDTFPSNQEISSYARRIIEWHRAPECVTKRFVF  231

Query  1061  PANAIAQLRQDLTITGGSVQ----RPSRVEALTALVWAAVINATPTQTATLSCM----VN  906
                 +A LR ++     S+     RP+R EA++ L+W A+I     +    +C+    VN
Sbjct  232   DGGKVAALRGEIIKKDASLSLNQYRPTRFEAVSGLIWDALIAMDREENVGSTCIASVPVN  291

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
             LR RM PPLP +C+G L     V C   K            + I    + V D   RKVY
Sbjct  292   LRNRMNPPLPEDCIGNLYHA--VTCTTNKTSA---------RNINQFTKMVNDDFVRKVY  340

Query  725   GEGGWLRAVIARGY-----ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKP--RLVVNML  570
              +GG    V    Y     E+++  +   L+  + +  + +YE DFGWGKP        L
Sbjct  341   QDGG---IVFVNQYKEAVEEILKGDNGVRLFGFTGVIGLPFYEPDFGWGKPVWSTTAMSL  397

Query  569   DNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +N  VL        VE W+ LP   M    QD   L Y S  P
Sbjct  398   NNIAVLLGTRDGKGVEAWVGLPINDMPKFEQDPGILTYASFIP  440



>ref|XP_010499177.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=444

 Score =   196 bits (498),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 147/461 (32%), Positives = 232/461 (50%), Gaps = 32/461 (7%)
 Frame = -3

Query  1790  LSQLLRATSSLSLQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY  1611
             +S ++   S    ++ +K+ V S+E+V+PSS     L  +  SFLDQLA  + +PF+FFY
Sbjct  1     MSLIIPIISGFKTRMELKITVTSQELVKPSSLNLNHLPCHHLSFLDQLAPPIFMPFLFFY  60

Query  1610  VSGRACHHTDTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSS  1431
              +     + +  D +K SLS+ L+L  PLAGR K     V CND G  F+ A    NMS 
Sbjct  61    HNKTNLSNNERSDHIKNSLSEILNLFNPLAGRMKNSGDVVVCNDMGASFVEAKADSNMSQ  120

Query  1430  LLENFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAK  1251
             +LEN    ++ +L P    +E   V   L+ VQ+  F CGG+A+G  +SH + DA +   
Sbjct  121   ILENPNPNELNKLHP----FEFHEVSDVLLTVQLTFFQCGGLALGIGLSHKLCDALSGLI  176

Query  1250  FMEIWASFNRGCAANNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
             F++ WA+  RG      +G V+    +  +FPP      IE L    A GI +E  +++ 
Sbjct  177   FIKSWAALARG-----DTGIVTPSFDLAKMFPPCD----IENLNM--ATGITKE--NIVT  223

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCM  912
             KRFV   +++  LR+    +G    R +RVEAL+  +W+  + +T       +  TL   
Sbjct  224   KRFVFLKSSVESLRE--RFSGNKEIRATRVEALSVFIWSRFMASTNQDDKTGKIYTLIHP  281

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             VNLRR+ +P +P N  G ++  ++ + +   +         LV+++R+  R +     +K
Sbjct  282   VNLRRQADPFIPDNMFGNIMRFSVTVPKMTINEDDEAEP-SLVEQMREEIRKIDAVYVKK  340

Query  731   VYGEG-GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNS  561
             +  +  G L  +  +    V     S  +T SLC+   YE DFGWGKP  V +  M   +
Sbjct  341   LQEDSRGHLEFLNKQASGFVNGEIVSFSFT-SLCKFPVYEADFGWGKPLWVASARMSYKN  399

Query  560   WVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              V F+D   G  +E W+ L +  M     D   L YVS+ P
Sbjct  400   LVAFIDTKEGDGIEAWINLDQNDMSRFEADEELLRYVSSNP  440



>ref|XP_009361770.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=447

 Score =   196 bits (498),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 147/460 (32%), Positives = 234/460 (51%), Gaps = 44/460 (10%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHT----  1584
             +++VE+   + V+PSSPTP+ L+N+K   LD     V + F+ FY  V+     HT    
Sbjct  5     SIEVEIVDTQTVKPSSPTPQDLRNFKLYLLDLFMPGVDIKFLLFYPNVASTTTTHTAKAI  64

Query  1583  -DTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIG  1407
              D    L +SL+KTL+  Y  AGR K + + VECND+G + + A V  ++S + E  +  
Sbjct  65    NDKYQHLIESLAKTLTHYYHFAGRIKSN-VAVECNDDGAQVVKAHVKCSLSDIFERPDPE  123

Query  1406  KIKQLTPS-AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              +++L P+ A+  E +   +AL+ VQVN F CGG+A+G  VSH IAD S +  F+  WA+
Sbjct  124   MLRRLLPTGAESTEAEAGPRALLYVQVNLFECGGMAVGLGVSHKIADISTVCTFIHCWAA  183

Query  1229  FNRGCAANNG--SGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                   +NN     F    SS  FPPL D    E            E++  + +R+V   
Sbjct  184   --TALQSNNVILPQFGGVASS--FPPL-DFPLWES---------PSEKEKPVTRRYVFDN  229

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINA-----------TPTQTATLSCMV  909
             + I+ L+ +   +   V +P+RVEA++AL+W   I A           +P + +TL   V
Sbjct  230   SKISVLQSE--TSSSLVPKPTRVEAISALIWKCAIEASSKSSPNTLCSSPIRPSTLRVAV  287

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             NLR+ + PP P N  G     AI   +E+     V+   +LV +IR     +K+  A KV
Sbjct  288   NLRKMVTPPFPDNMAGNFSLSAIPKAEEST--SNVLDLKDLVVKIRAGIEEMKEA-ATKV  344

Query  728   YGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWV  555
             +     ++ +       +++++  T Y SS CR  +YE DFGWGKP  V   +++ N+  
Sbjct  345   FDPNEAMQVLTEYLTIPLKDQEIETYYCSSWCRFPFYETDFGWGKPSWVSVPSLVVNNMF  404

Query  554   LFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
               +D  +   +E W+ L ++ M     +   LAY S  P+
Sbjct  405   HLVDKRDCKGIEAWLTLSEEKMALFESNMELLAYASLNPR  444



>ref|XP_002514976.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47530.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=435

 Score =   196 bits (497),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 144/445 (32%), Positives = 222/445 (50%), Gaps = 31/445 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             ++VE  S+E+++PSSPTP+ L++++ SFLDQ+ + V +PFV FY       +    ++LK
Sbjct  3     VEVEFISQELIKPSSPTPDHLRHFQLSFLDQIQVPVWMPFVLFYSKEPNTSNLARCNQLK  62

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLSKTL++ YPLAGR   +  ++ CNDEGV F+ A     +S +L N       +L P 
Sbjct  63    KSLSKTLTIFYPLAGRV-NNNTSIHCNDEGVLFVEAQANCQLSDILRNANPSDNNKLIPL  121

Query  1382  AKFYEPQPVGKALVA-VQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
                  P   GK L A +QV  F+CGG+AI   +SH + DA +   F+  WA+  RG    
Sbjct  122   -----PLDDGKGLAAFLQVTFFTCGGLAISLAMSHKLGDALSKLIFLNCWAAITRGDTDP  176

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
             N  G     S+ LFPP        +++     G    + +++ KRFV  ++ ++ LR   
Sbjct  177   NIIGVSPSGSATLFPP--------KILSGFDAGAAIVKDNIVTKRFVFDSSTVSGLRAKY  228

Query  1025  TITGGSVQRPSRVEALTALVWAAVINA-----TPTQTATLSCMVNLRRRMEPPLPPNCLG  861
                 G     SRVEAL A +W+  + A     T  +   +   VNLR RMEPPL     G
Sbjct  229   KHKNGC--SVSRVEALAAFIWSRFMAATQADRTDNKLYMVLHAVNLRPRMEPPLSNLYFG  286

Query  860   TLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
              +   A  +    AKD         +V R+ +A R+V     + +    G L  +     
Sbjct  287   NITRIATTMADMNAKDD----ECYGIVSRMNNAIRSVNADFVKSLQKSDGHLNFLKEEAG  342

Query  683   ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVEVWM  513
             ++ +       +T SLC+   YE+DFGWGKP  V +  ++  +  LF D   G  +E W+
Sbjct  343   KITKGELIHFAFT-SLCKFPVYEIDFGWGKPVWVGSACLVFKNLALFFDTKEGNGIEAWI  401

Query  512   KLPKQVMHTLTQDRHFLAYVSAFPK  438
              L ++ M     D    A++++ P 
Sbjct  402   NLKEEDMAKFELDEELRAHITSTPN  426



>gb|KDO46443.1| hypothetical protein CISIN_1g043811mg [Citrus sinensis]
Length=448

 Score =   195 bits (496),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 224/463 (48%), Gaps = 51/463 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS-GRACHHTDT----  1578
             M++ + SK+I++PSSPTP  LK +K S LDQLA ++    +FFY    R    T+T    
Sbjct  1     MQLRIISKKIIKPSSPTPLHLKTHKLSLLDQLAPDIYTSLLFFYNGPSRVYDETNTSTNN  60

Query  1577  -IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIV--ADVAENMSSLLENFEIG  1407
                 L+ SLSKTL+L YP AG+  +D   V+C+D G+ F+      + +MS +L+N E+ 
Sbjct  61    VYHRLQSSLSKTLNLYYPFAGKLLQDNYVVDCDDSGIPFVETRGPSSISMSEVLKNPEMN  120

Query  1406  KIKQL---TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              ++QL    P+ K+        A  AVQ+N F CGG+AIG    H +AD +A   F++ W
Sbjct  121   TLQQLLPFNPNKKYLSSTDDVNA--AVQINHFDCGGVAIGLNFRHIVADGAASVGFIQNW  178

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIE--QEEKDMIVKRFVI  1062
             A  +   ++++ S     H+ +     TDT    Q +   A  I   Q   + + KRFV 
Sbjct  179   AKLH---SSDDNSIINYKHTVV---DCTDTFPPNQEISSYARRINEWQRAPECVTKRFVF  232

Query  1061  PANAIAQLRQDLTITGGSVQ----RPSRVEALTALVWAAVINATPTQTATLSCM----VN  906
                 +A LR ++     S+     RP+R EA++ L+W A+I     +    +C+    VN
Sbjct  233   DGGKVAALRGEIIKKDASLSLNQYRPTRFEAVSGLIWDALIAMDREENVGSTCIASVPVN  292

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
             LR RM PPLP +C+G L     V C   K            + I    + V D   RKVY
Sbjct  293   LRNRMNPPLPEDCIGNLYHA--VTCTANKTSA---------RNINQFTKMVSDDFVRKVY  341

Query  725   GEGGWLRAVIARGY-----ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKP--RLVVNML  570
              +GG    V    Y     E+++  +   L+  + +  + +YE DFGWGKP        L
Sbjct  342   QDGG---IVFVNQYKEAVEEIMKGDNGVRLFGFTGVIGLPFYEPDFGWGKPVWSTTAMSL  398

Query  569   DNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +N  VL        VE W+ LP   M    QD   L Y S  P
Sbjct  399   NNIAVLLGTRDGKGVEAWVGLPINDMPKFEQDPGILTYASFIP  441



>ref|XP_003616845.1| Vinorine synthase [Medicago truncatula]
 gb|AES99803.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=440

 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 140/451 (31%), Positives = 226/451 (50%), Gaps = 40/451 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+E ++PSSPTP  LK Y  SF+D +      P ++FY   ++      I +L+
Sbjct  1     MEIELLSRETIKPSSPTPSHLKLYPLSFIDNIIFRNYAPLLYFYNPNKSIDQNSKISQLR  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+ LS  YP AGR K DRIT+ECND+GV F+V  +   +S +L+N     +  L P 
Sbjct  61    KSLSQLLSKYYPFAGRIK-DRITIECNDQGVLFLVTKIKNKLSEILQNPTEKLLNPLFPD  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++      + +A+Q+N F+CGG+ I   ++H I DAS + KFM  WA  N+    + 
Sbjct  120   ELQWKEMDWRASFIAIQINWFTCGGMVISICMTHKIGDASTIFKFMNDWAIINQKIEEDK  179

Query  1202  GSGFVS-----DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 VS     D  + +FP        ++ + +  E + ++E +++ KRFV     I  L
Sbjct  180   KELLVSPLSLLDAGATIFP--------QRDLPIFPEMVIKKENNVVFKRFVFQPAMIKSL  231

Query  1037  RQDLTITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPPNCL  864
             +    +T  S+  P++V+ +TA ++  A  I     QTA  S +V+LRRRM PPL  +C+
Sbjct  232   KA--MVTSSSMHSPTQVQVVTAWIYKHAVSIMGLNFQTAMFSMIVDLRRRMVPPLSEHCV  289

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY------GEGGWLRA  702
             G +   + +L  + +     +   +LV +I++        E   VY       E   +  
Sbjct  290   GNIFWFSSMLANKKE-----MELEDLVCQIKEGL-----SECCNVYPKLFREKENNNISE  339

Query  701   VIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM-LDNSWVLFL-DAING  531
              + +  E     ++  L+T SS CR   YE DFGWGKP  +    L +  ++FL D  +G
Sbjct  340   CLKQVTEPY--SENKNLFTFSSWCRFPMYEADFGWGKPIWITTTGLSSRNIIFLMDTRDG  397

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E  + +    M     +   L Y S  P
Sbjct  398   DGIEAIVNMEDNYMAKFEHEFELLQYASFNP  428



>ref|XP_002510627.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF52814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=440

 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 222/456 (49%), Gaps = 38/456 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+E ++PSSPTP  LK YK S LDQL  +  +P +FFY        +  + +LK
Sbjct  1     MEIEIMSRENIKPSSPTPSHLKTYKLSLLDQLMPSAHVPIIFFYGPINQTDMSIRLPKLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SLS+ L+  YP AG+ K+D + ++CNDEGV +  A V+  +S +L   +   I +L P 
Sbjct  61    QSLSEALTSFYPFAGKVKDD-LYIDCNDEGVSYTQAKVSCCLSDILGKPDSETIFKLLPG  119

Query  1382  -AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
              + F E    G  +  +QVN F CGG+AIG   SH I D      F++ WA+  RG    
Sbjct  120   DSYFMESSGNGIPVAMIQVNVFKCGGVAIGTKTSHKIIDGPTSTAFLKAWAAIARGSGET  179

Query  1205  NGSGFVSDHSSILFP-----PLTDTSAI-EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                 F++     LFP     P     AI   L+K G           I KRFV  A+++A
Sbjct  180   VEPCFIAPS---LFPQNDCLPKDTMLAIWPSLIKFGKG---------ITKRFVFDASSVA  227

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+     +   V RP+RVEA++A +W   + A+  +        LS +VNLR +    L
Sbjct  228   ILKAR-AASSLLVHRPTRVEAVSAFIWQCNMLASKAKHGCQRPSFLSLIVNLRGKKGTQL  286

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA-  702
             P N +G L+   I  C       T      LV  +R++   +     +K+ GE G+ +  
Sbjct  287   PSNSVGNLLWMTIAQCSAE----TERELHPLVGLLRESISKIDGDFVQKLSGEEGFSKVC  342

Query  701   -VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV------NMLDNSWVLFLD  543
               +    E+  N  +  L  +SLC +  YE DFGWG+P  V        +  N   L   
Sbjct  343   ECLQEFGEVYSNAGADYLTFTSLCNVGIYETDFGWGRPIWVTPGGITGPVFQNLVFLNET  402

Query  542   AINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             ++   +E W+ L +Q M  L +D   L++ +  P P
Sbjct  403   SVGDGIEAWLTLDEQDMIILERDTEILSFSALDPSP  438



>gb|KDP30964.1| hypothetical protein JCGZ_11340 [Jatropha curcas]
Length=423

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 149/439 (34%), Positives = 241/439 (55%), Gaps = 23/439 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V++ SKEI++PSS  P++ K Y  S LDQLA  V +P + FY       +  + D LK
Sbjct  1     MEVQIISKEIIKPSSSAPQNRKTYNLSLLDQLAPPVYIPIILFYSPAFENGYKIS-DHLK  59

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSS-LLENFEIGKIKQLTP  1386
             KS S+TL+  YPLAGR   D  +++CND+G  ++ A V  +MS+ L++  EI K+++L P
Sbjct  60    KSFSETLTHFYPLAGRIN-DEFSIDCNDDGAPYVEARVNGDMSTVLIQEPEIHKLEKLLP  118

Query  1385  SAKFYEPQPVG-KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
                   P  +  + ++A Q+N F CGGIAI   + HAIADASA+A F+  WA+   G + 
Sbjct  119   C----NPHDLSSQVILAAQINHFDCGGIAISVCIWHAIADASAMASFITSWATIASG-SN  173

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
              + +G + D +S LFPP  D         +  E + +    ++VKRF+  +  I+ LR++
Sbjct  174   FDINGVIFDSTS-LFPP-QDMRGFSLHKFLSKELLSK----IVVKRFLFDSCNISALREE  227

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGTLVD  849
             +   G  + RP+ VEA+ A++WAAV+ A   +    +  V LR+R+ P +P   +G +  
Sbjct  228   VG-NGPCLDRPTMVEAVAAIIWAAVM-AGNEEEHVAAISVGLRKRIIPLIPELSIGNIFQ  285

Query  848   EAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRN  669
              AI  C + ++   V+    L   + ++   + +   RK++  G +   +  +  EL +N
Sbjct  286   VAIANCSKNEN---VLDYNGLAGNLHESIERMNNEYVRKIHAGGRYFEFMKKKSEELGKN  342

Query  668   RDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING-AVEVWMKLPKQ  498
              +   ++  SS CR  +YE DFGWGKP  V   L    V +F+D  +G  +E W+ LPK+
Sbjct  343   PNLMKVFGFSSWCRFPFYEADFGWGKPIWVGTALKLYKVAIFIDTKDGQGIEAWIALPKE  402

Query  497   VMHTLTQDRHFLAYVSAFP  441
              M    ++    +Y S  P
Sbjct  403   EMLKFEKNPGICSYASFKP  421



>emb|CDP08578.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/436 (31%), Positives = 210/436 (48%), Gaps = 27/436 (6%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR--ACHHTDTIDElk  1563
             +E+ SKE+++PSSPTP  L+++K SFLDQ+A  V +P +FFY + +       D I +L 
Sbjct  5     LEILSKEMIKPSSPTPHHLRDHKLSFLDQIAPPVFIPLIFFYQTNQLETFQDRDQISQLL  64

Query  1562  kslskt-lsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K      L+  YPLAGR      +++CND+G   I A V  N+  ++E   + ++KQ  P
Sbjct  65    KQSLSNILTQFYPLAGRICSKNFSIDCNDDGALCIEAQVHSNLLQVIEKPVMEELKQYLP  124

Query  1385  ---SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
                ++K          L+A+Q+N F CGGIAIG  +SH IAD ++L  FM  WA   + C
Sbjct  125   LELNSKGPGLTEAKTILLAIQINFFDCGGIAIGVQLSHKIADGTSLVTFMNAWA---KSC  181

Query  1214  AANNGSGFVSDHSSILFPPLTDTS-AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
             +  +     S   + LFPP   +S   +    M  E I       + KRFV     +A+L
Sbjct  182   SEVSEIVPSSFELASLFPPRDMSSFGFKPTTGMTKEKI-------VTKRFVFDKEKLAKL  234

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGT  858
             +Q        V+ P+RVEA++A +W   I+A+  +       VN+R RM P L  +  G 
Sbjct  235   KQ--AAASSLVKDPTRVEAVSAFIWRHFIDASKAKVVAAVHAVNMRPRMNPALEDHAFGN  292

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +    + +     + G       LV  +R A R +     +K+     +L+ ++ +  E 
Sbjct  293   IWTHTVAIPMLEGEKGY----ENLVGDLRKAIRNINSNYVKKLQNGDEYLK-ILKKSVEF  347

Query  677   VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAVEVWMKL  507
                 D      SS CR   YEVDFGWGKP  V        N  +L   +    +E W+ +
Sbjct  348   ASKGDVELCNFSSWCRFPVYEVDFGWGKPTWVSTTAFPFKNVVILMSTSCGEGIEAWLNM  407

Query  506   PKQVMHTLTQDRHFLA  459
              +  + +   +   L+
Sbjct  408   HEDDVPSFQSNHRHLS  423



>ref|XP_010460459.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=433

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 145/444 (33%), Positives = 227/444 (51%), Gaps = 32/444 (7%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkk  1560
             K+ V S+E+V+PSS     L  +  SFLDQLA  + +PF+FFY +       +  D++K 
Sbjct  4     KITVTSQELVKPSSLNLNHLPCHHLSFLDQLAPPIFMPFLFFYHNKTNLSTNERSDQIKS  63

Query  1559  slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPSA  1380
             SLS+ L+L YPLAGR +     V CND GV F+ A    NMS +LEN    ++ +L P  
Sbjct  64    SLSEILNLFYPLAGRIRNSGDVVLCNDMGVSFVEAKADFNMSQILENPNSNELNKLHP--  121

Query  1379  KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNG  1200
               +E   V   L+ VQ+  F CGG+A+G  +SH + DA +   F++ WA   RG      
Sbjct  122   --FEFHEVSDVLLTVQLTFFQCGGLALGIGLSHKLCDALSGLIFIKSWADLARG-----D  174

Query  1199  SGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
             +G V+    +  +FPP      IE L    A GI +E  +++ KRFV   +++  LR+  
Sbjct  175   TGIVTPSFDLAKMFPPCD----IENLNM--ATGITKE--NIVTKRFVFLKSSVESLRE--  224

Query  1025  TITGGSVQRPSRVEALTALVWAAVINAT--PTQTATLSCM---VNLRRRMEPPLPPNCLG  861
               +G    + +RVEAL+  +W+  + +T    +T  +  M   VNLRR+ +P +P N  G
Sbjct  225   RFSGNKEIQATRVEALSVFIWSRFMASTNQDDKTGKIYTMIHPVNLRRQADPVIPDNMFG  284

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG-GWLRAVIARGY  684
              ++  ++ + +   +         LV+++R+  R +     +K+  +  G L  +  +  
Sbjct  285   NIMRFSVTIPKMTINEDDEAQP-SLVEQMREEIRKIDAVYVKKLQEDSRGHLEFLNKQAS  343

Query  683   ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVEVWM  513
               V     S  +T SLC+   YE DFGWGKP  V +  M   + V F+D   G ++E W+
Sbjct  344   GFVNGEIVSFSFT-SLCKFPVYEADFGWGKPLWVASARMSYKNLVAFIDTKEGDSIEAWI  402

Query  512   KLPKQVMHTLTQDRHFLAYVSAFP  441
              L +  M     D   L YVS+ P
Sbjct  403   NLDQNDMSRFEADEELLQYVSSNP  426



>ref|XP_010046662.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86861.1| hypothetical protein EUGRSUZ_B03452 [Eucalyptus grandis]
Length=436

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 150/457 (33%), Positives = 226/457 (49%), Gaps = 40/457 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS---GRACHHTDTID  1572
             MK++V SKE + PSS TP  ++ Y+FS LDQLA    +P V FY +    +   H +  +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFFVPVVLFYSAPDPDQDFDHVNIYE  60

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             +LK SLS+ LS  YPLAGR K D   V+     V F+   V   ++ LL N E+  ++QL
Sbjct  61    KLKTSLSECLSCFYPLAGRIKGDEHAVDLGQRAV-FVRTRVNARLAKLLANPELKLVQQL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    Y  Q     + A+Q+N F+ GGI IG  +SH IAD + L+ F+  W + +RG  
Sbjct  120   LPLDP-YNIQCQNALVTAIQLNLFNRGGIGIGVCISHKIADRATLSTFLSSWGAISRG--  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAI----EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                        +S L  P  DT+ I    E  + +    I++E+  ++ KRF   + ++A
Sbjct  177   -----------ASKLVAPYQDTTTIFPPREFRVPLPNNLIKKEK--IVTKRFEFDSASLA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA------TPTQTATLSCMVNLRRRMEPP  882
              LR      G + + P+ +EA+TAL+  A +NA          +  +S +VNLR RM PP
Sbjct  224   ALRTKAG-DGSTSKSPTLIEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPP  282

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP +  G +   A    +E +D   +     L   +R A R + +   RK+ GE G+L A
Sbjct  283   LPDHSFGNIWRFATATIKEEEDDAELHV---LADHLRTAIRKIDNDYVRKLQGEDGFLWA  339

Query  701   V--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAI  537
                +   +EL+   D  +   SS  R  +YE DFGWGKP         + N+ +L     
Sbjct  340   CESMREVHELMYKGDVESYRFSSWVRFPFYETDFGWGKPVWACISSVPIKNAVILMSSWS  399

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVS-AFPKPKL  429
                +E W+ L +Q M     D   L +VS  +  PK+
Sbjct  400   GNGLEAWVTLDEQEMAKFQSDPLLLQFVSLPYKSPKI  436



>ref|XP_011071306.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=439

 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 234/451 (52%), Gaps = 42/451 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++EV SKEI++PSSPTPESL+ ++ SFLDQ+A    +P ++FY +     +    + 
Sbjct  1     MEIEIEVISKEIIKPSSPTPESLRKHQLSFLDQIAPPAFMPVLYFYQADAKFSNLKKSNN  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ LS  YPLAGR  +D + V+CNDEG  ++ A     +S ++ N  +  + +  
Sbjct  61    LKKSLSQVLSRFYPLAGRLVDD-LYVDCNDEGAPYVEAVANCTLSQIITNPVMKNMDKFL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +   + V    +AVQV  F CGG A+G  +SH IAD S+       WA+  R    
Sbjct  120   P---YKVDEYVQNLCMAVQVTYFQCGGTAVGLVISHKIADGSSFVPVANTWAAVARNGNY  176

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             ++      + + I FPP   T          + GI +E   +I K F  PA+ I+ L++ 
Sbjct  177   DDVPAPKFEGAKI-FPPQDATG----FKPPSSTGIVKEA--VITKIFTFPASKISALQER  229

Query  1028  LTITGGS-VQR-PSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
              +      +QR PSRVEAL+A +W   ++AT     P +  T+   VNLR R+ PPL   
Sbjct  230   YSSGAAEFLQRPPSRVEALSAFIWTRFVSATEMKANPNKIYTVRHTVNLRPRLNPPLSDY  289

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG----WLRA  702
               G +   A+ +     + G     VE++Q++++A RAV +GE      +GG    +L+ 
Sbjct  290   HFGNIFWVAVAMPSVGANCG-----VEVMQKVKEAIRAV-NGENVAQLLQGGETLNFLKE  343

Query  701   VIA---RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLFLDA  540
              +A   RG ELVR         +SL +   Y+ DFGWGKP  VV    +LD + V+ +D 
Sbjct  344   KMAYANRG-ELVR------FTFTSLHKFPLYKADFGWGKPVWVVTLAGLLDKNLVVLVDT  396

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               G  +E  + L K+ M     D     ++S
Sbjct  397   ATGDGIEARINLSKEDMEKFEADLELQEFLS  427



>gb|KDO36951.1| hypothetical protein CISIN_1g045540mg [Citrus sinensis]
Length=428

 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 153/447 (34%), Positives = 225/447 (50%), Gaps = 44/447 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTIDEl  1566
             M VEV SKE ++PS+PTP+  + YKFSF DQ++ +  +P ++FY ++     +     +L
Sbjct  1     MDVEVISKETIKPSTPTPKHRQIYKFSFTDQISPSFYIPLIYFYNLNDHKLGNNIISGDL  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKSLSK L+  YPLAG   +D   V+CND+GV F+ A V  N+S ++      K+ +  P
Sbjct  61    KKSLSKVLTHYYPLAGCLNDD--YVDCNDKGVLFLEAKVKCNLSQIIGEPNPRKLNKFLP  118

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW-ASFNRGCAA  1209
                      V   ++A+QVN F+CG IAIG  VSH IADAS    F++ W A+ + G   
Sbjct  119   DH-------VKNFILAIQVNFFNCGNIAIGACVSHKIADASTFITFIKNWAAAASFGGGG  171

Query  1208  NNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              + S  +     S+ LFPP     +    +          EK+++ K FV   + IA L+
Sbjct  172   GDDSVKICPELLSATLFPPRDVGESCRVSLPA--------EKNIVCKSFVFRGSRIAALK  223

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
             +     GG    P+RVEAL+A +W+    +T     P + + L   VNLR+RM+PP P +
Sbjct  224   E--KYAGGI--HPTRVEALSAFIWSRFAASTEIKIGPERVSMLVHAVNLRKRMDPPQPDD  279

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK----VYGEGGWLRA  702
               G +      +  E  D G       LV+  RDA   +    A+K    V+   G L +
Sbjct  280   SFGNISGPTATIISE--DIGEECYG--LVKMFRDAIGKINKDYAKKLQEGVFEHFGLLGS  335

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---NMLDNSWVLFLDAING  531
             +   G++    R+    Y +SLCR   YE DFGWGKP  V        N  VL       
Sbjct  336   INDDGFD---RREVVNFYYTSLCRFPLYEADFGWGKPIWVAWGGWPYRNIAVLMDTKCGN  392

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +E W+ L ++ M     D+ FL+YVS
Sbjct  393   GIEAWIHLKEEDMVKFEADKEFLSYVS  419



>gb|ACI45390.1| salutaridinol 7-O-acetyltransferase [Papaver somniferum]
 gb|ACI45391.1| salutaridinol 7-O-acetyltransferase [Papaver somniferum]
Length=474

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 152/450 (34%), Positives = 222/450 (49%), Gaps = 49/450 (11%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQ-LALNVRLPFVFFY------VSGRACHHTDT  1578
             VEV SKE ++P++PTP  LKN+  S LDQ   L   +P + FY       +G + HH D 
Sbjct  9     VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPATAANSTGSSNHHDD-  67

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
             +D LK SLSKTL   YP+AGR   D I V+C+D+G+ F    +   M   +   ++  + 
Sbjct  68    LDLLKSSLSKTLVHFYPMAGRMI-DNILVDCHDQGINFYKVKIRGKMCEFMSQPDV-PLS  125

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL PS       P  +ALV VQVN F CGG AI   VSH IADA+ ++ F+  WAS  + 
Sbjct  126   QLLPSEVVSASVP-KEALVIVQVNMFDCGGTAICSSVSHKIADAATMSTFIRSWASTTKT  184

Query  1217  CAANNGSGFVSDH-------SSILFPP---LTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
               +   +  V+D        S+ LFPP   LT  S + ++    +   + E+   + KRF
Sbjct  185   SRSGGSTAAVTDQKLIPSFDSASLFPPSERLTSPSGMSEI-PFSSTPEDTEDDKTVSKRF  243

Query  1067  VIPANAIAQLRQDLTI---TGGSVQRPSRVEALTALVWAAVINATPTQ-TATLSCMVNLR  900
             V     I  +R+ L +        +RP+RVE +T+L+W +V+ +TP      +   VNLR
Sbjct  244   VFDFAKITSVREKLQVLMHDNYKSRRPTRVEVVTSLIWKSVMKSTPAGFLPVVHHAVNLR  303

Query  899   RRMEPPLPPNCLGTL-------VDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVK  750
             ++M+PPL     G L       +         A +     T+ E   ++  + D F A  
Sbjct  304   KKMDPPLQDVSFGNLSVTVSAFLPATTTTTTNAVNKTINSTSSESQVVLHELHD-FIAQM  362

Query  749   DGEARKVYGEGGWLRAVI---ARGYEL----VRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
               E  KV G+ G L  VI   A G++     + + +    + SS CRM  YE+DFGWGKP
Sbjct  363   RSEIDKVKGDKGSLEKVIQNFASGHDASIKKINDVEVINFWISSWCRMGLYEIDFGWGKP  422

Query  590   RLVV---NMLDNSWVLFLD--AINGAVEVW  516
               V    N+  N    F++       +EVW
Sbjct  423   IWVTVDPNIKPNKNCFFMNDTKCGEGIEVW  452



>ref|XP_008340165.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Malus 
domestica]
Length=437

 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 145/449 (32%), Positives = 233/449 (52%), Gaps = 36/449 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHT--DTIDE  1569
             M+V+  S+E+++PS+PTP  L+ +K S LDQ+     +P V+FY    + + +  D  ++
Sbjct  4     MEVQNISREVIKPSTPTPPHLRTHKLSILDQINPRSYVPVVYFYPKEASDYWSVADKSNQ  63

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQL  1392
             LKKSLS+TLS  YP AGR + DR +++CNDEGV F+   +    +S +LEN +   +  L
Sbjct  64    LKKSLSETLSKYYPFAGRIR-DRFSIDCNDEGVAFVETQIRNFKLSDILENPKDEDLALL  122

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
                   +   P    +V VQV+ F CGG+A+G  +SH IADAS +  F+  WA+  R   
Sbjct  123   ISEDVAWNEDPDVSVIVDVQVSFFECGGMALGIGMSHKIADASTIINFVNDWAAVARDQY  182

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
               +   FV+++   +FP        +  + +  E +  E+ D + KRFV  A  IA L+ 
Sbjct  183   VPSPE-FVAEN---IFP--------QGDLPLFPEAVP-EKSDCVAKRFVFDATKIAALK-  228

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINA------TPTQTATLSCMVNLRRRMEPPLPPN  870
                +    VQ P+RVE + A +++  I+A      + +    L+  VNLR RM PP+P N
Sbjct  229   --ALVADKVQNPTRVEVVAAFIYSCTISALRLTSGSSSNPTVLTQSVNLRTRMVPPVPQN  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAVI  696
              +G +V   I     A+D  +V+   +LV +++       D  A+K  G+  W  +    
Sbjct  287   SVGCMV--WIYTVSTAED--SVIELHDLVAQLKQNMTRFCDSYAQKFRGKDQWPVIFQXC  342

Query  695   ARGYELVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING-A  528
              +   +  +R +  +Y  +S CR   YEVDFGWGKP  +   +       + +D  NG  
Sbjct  343   LQESMVEFSRPNLVMYKCTSWCRFPMYEVDFGWGKPIWITVPSCTTKDCFILIDTKNGEG  402

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +E ++ L KQ +    +D   LA+ S  P
Sbjct  403   IEAYVNLEKQQLDVFERDEELLAFASLNP  431



>gb|KDP30966.1| hypothetical protein JCGZ_11342 [Jatropha curcas]
Length=454

 Score =   194 bits (492),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 147/453 (32%), Positives = 227/453 (50%), Gaps = 36/453 (8%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHTDTID  1572
             ++ V + S+E ++PSSPTP++LK +K S LDQLA    +P + +Y   +     + + I+
Sbjct  3     SVNVLIVSRETIKPSSPTPQNLKCFKLSLLDQLAPAAYVPMILYYAPTADSIVKNQERIN  62

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
              LKKSLS+TL+  YPLAGR K++ + +ECND+G++FI A +  ++S +L   E   + + 
Sbjct  63    LLKKSLSQTLTKFYPLAGRVKQN-LFIECNDQGIDFIEAKLNCSLSDILRRPEAHILDRF  121

Query  1391  TPSAKFYEPQPVGK--ALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              P    +         + + +QVN FSCGG+AIG  +SH + D      F+  WA+  RG
Sbjct  122   LPQEYHFHVSSSSTKCSQMGIQVNSFSCGGMAIGTSISHKLVDGITFTSFINTWAAMARG  181

Query  1217  CAANNGSG-FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                N  S  FV  H   +FPP      I  L+ +    ++  +     KRFV   + I  
Sbjct  182   SNDNLLSPIFVGPH---IFPP----KDIYGLLPV----LDIPKAKNTTKRFVFDLSKIGL  230

Query  1040  LRQDL----------TITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCM-VNLRRR  894
             LR+ L               +   PSRVE ++AL+W   I+A+ T+  + S   VNLR R
Sbjct  231   LRERLFGNGNSSVNNKNNNNNNNLPSRVEIVSALIWKCAIDASRTKKPSFSTQTVNLRAR  290

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             M+PPLP +  G L+  AI       DG + +   +LV ++R+A +       +K+ GE G
Sbjct  291   MDPPLPESAAGNLLWLAI--APAPSDGSSKIEIQDLVYQVRNALKKFDTDYVKKLQGENG  348

Query  713   W--LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLF  549
                L   + +  EL         +T SL +   YE DFGWGKP  + +      N  VL 
Sbjct  349   SLVLEETLKQITELALKHVDIYRFT-SLRKFQLYEGDFGWGKPVWISSAGLTFKNVVVLI  407

Query  548   LDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                    VE W+ L +Q M     ++  L++ S
Sbjct  408   ESRAGDRVEAWVTLDQQEMAVFECNQEILSFDS  440



>ref|XP_010907772.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Elaeis guineensis]
Length=426

 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 150/448 (33%), Positives = 224/448 (50%), Gaps = 39/448 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             + V++ SKE ++PSSPTP++L +   S LDQ+A  +    + FY    + +   T+ +LK
Sbjct  2     LAVQIISKETIKPSSPTPQNLHSLPLSLLDQIAPQIYSHILLFY----SKNPPQTLIQLK  57

Query  1562  kslsktlsLMYPLAGRAK----EDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
              SLSKTL+  YPL GR K    ++ + VECND+GVEFI A     + S+L    I +  +
Sbjct  58    SSLSKTLTHFYPLGGRIKASKDDNTLYVECNDDGVEFIHAQTNAELDSVLLQPPIDQFNE  117

Query  1394  LTP--SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             L P  ++ F      G  L+AVQ+  F   G  +GF +SH IAD +++A F+  WA   R
Sbjct  118   LLPIKASNFR----YGDPLLAVQLTWFKPHGFVLGFSISHLIADGASMAMFLNRWADVAR  173

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G   +    F    S   FPP        Q     A   E  +   I+KRFV+   AIA+
Sbjct  174   GLELHPAPRF---DSMAAFPPRP------QFTTNQAPKQESGQPAAIIKRFVMSPRAIAR  224

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVI----NATPTQTATLSCMVNLRRRMEPPLPP  873
             LR       G V  P+R+EAL+ALV   ++     A   + A  +  VNLRRR+ PPL  
Sbjct  225   LRGGGGYDNGRVHAPTRIEALSALVLRCLVRARGEAARGKRAVAAHSVNLRRRLSPPLSD  284

Query  872   NCLGTL-VDEAIV--LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
                G L +  A V  L  +  D G+    +E  + +R+  R V +   R+   E    R 
Sbjct  285   ESFGNLWISVAAVGKLVGDGCDDGSGQGVLE--EALRNGVREVDEEYVRRKAEE----RW  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAING  531
             +   G + V   DS     SS CRM +Y+ DFGWG+P  V   ++ + +  +L       
Sbjct  339   LGRDGMDGVVEGDSEVWIFSSWCRMPWYKTDFGWGEPEWVGCGISDMKDVCILIDTKDGD  398

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
              +EVW+ L  + M  + +D  FL ++S+
Sbjct  399   GMEVWLWLRAEEMERVERDPEFLDFISS  426



>ref|XP_002514981.1| Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis]
 gb|EEF47535.1| Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis]
Length=430

 Score =   193 bits (490),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 144/438 (33%), Positives = 226/438 (52%), Gaps = 38/438 (9%)
 Frame = -3

Query  1709  RPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRA-CHHTDTIDElkkslsktlsL  1536
             +PSSPTP+ L++YK SFLDQ++  V  P + FY   GR   ++    D+LK+SLS+ L+ 
Sbjct  14    KPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFYPTDGRVKSNNAQKYDQLKQSLSQVLTY  73

Query  1535  MYPLAGRAKEDRITVECNDEGVEFIVAD-VAENMSSLLENFEIGKIKQLTPSAKFYEPQP  1359
              YPLAGR K++ + V+CNDEGV F+ A  +A  +S  + N    + ++L P  +  EPQ 
Sbjct  74    YYPLAGRIKDNNL-VDCNDEGVPFLQAQAIACRLSDAVNNPMPTEFRKLLP-FELDEPQE  131

Query  1358  VGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN-NGSGFVSD  1182
                    +Q+N F CGGI I F +SH IADA +   F++ WA+  RG   +     F+  
Sbjct  132   FA---FGIQLNIFDCGGICIAFCLSHKIADALSTLVFLKTWAAITRGETDDIVCPEFI--  186

Query  1181  HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQ  1002
              S+ LFPP  + S         A GI +E  +++ KRFV   ++I  L +  + +  S++
Sbjct  187   -SATLFPP-KNLSGFNP-----AIGITKE--NVVTKRFVFRLSSIESLIEKYSTSTTSIE  237

Query  1001  R-----PSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLGTLV  852
                   PSR+EAL+  +W+  + AT     P +   +   VNLR RM P LP +  G   
Sbjct  238   NQQQKSPSRIEALSVFIWSRFMAATKVESEPGRVYLMLHAVNLRTRMNPQLPEHSFGNYY  297

Query  851   DEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVR  672
               AI +        T   +  LV+R+RD+   +     +K+      L  +  R     R
Sbjct  298   RVAITI----PSSDTEEESYNLVRRMRDSISKIDKDYVKKLQDGNEHLHFIKERAESFTR  353

Query  671   NRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVLFLDAING-AVEVWMKLPK  501
               + +TL  +SLCR   YE DFGW KP      ++   + V+F+D ++G  +E  + L +
Sbjct  354   G-EMATLNFTSLCRFPLYEADFGWSKPIWAGAPSLTFKNLVVFMDTVSGDGIEALIHLKE  412

Query  500   QVMHTLTQDRHFLAYVSA  447
             + M    +D+  L + + 
Sbjct  413   EDMAKFQEDQELLQFATG  430



>ref|XP_008383117.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=451

 Score =   193 bits (491),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 149/471 (32%), Positives = 231/471 (49%), Gaps = 70/471 (15%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-------VSGRACHH  1587
             +++VE   K+ V+PSS TP  L+N+K S LDQ +    +PF+ FY        S  + H 
Sbjct  5     SVEVETVEKQTVKPSSQTPHVLRNFKLSLLDQFSPVAYIPFLLFYPNVVSTTTSNVSTHS  64

Query  1586  TDTIDElkkslsktlsLM----YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
                I+E  + L K+LS +    YPLAGR K + + V CND+G EF+ A V  ++S +LE+
Sbjct  65    VKAINERYQHLIKSLSEILTHYYPLAGRIKGNVVIV-CNDDGAEFVKAHVKCSLSEILEH  123

Query  1418  FEIGKIKQLTPSAKFYEPQP---VGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
              +   +++L P     EP+    V   L+AVQVN F CGG+AIG  +SH IADAS +  F
Sbjct  124   PDAEMLRRLLP----IEPESTEAVTGKLLAVQVNLFECGGMAIGLTISHKIADASTVCTF  179

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+       +N         + LFPPL  + +    M      I  +EK    +R+
Sbjct  180   INSWAA---TAHKSNKVMLPQFGVASLFPPLDFSDSEPPSM------IYVKEK-CTTRRY  229

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----------L  921
             V   + I+ L+    ++   V +P+RVEA++AL+W   I A+P  ++             
Sbjct  230   VFDDSKISVLQSK--VSSSLVPKPTRVEAISALIWKCAIEASPKSSSNTLGSSPVRPSIF  287

Query  920   SCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDG  744
                VNLR+R+ PPLP N  G L+   ++   +A++  T V  + +LV +IR     +K+ 
Sbjct  288   HQAVNLRKRVTPPLPDNLAGNLL---VLSTSKAEESTTSVFDLKDLVAKIRAGIEEMKEC  344

Query  743   EARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN  564
              A K+      ++ +      L+++++  T   +S CR  +Y  DFGWG P         
Sbjct  345   -ATKLVDPNEAMQVLTEYRTNLMKDQEIETYSCTSWCRFPFYGADFGWGMP---------  394

Query  563   SWVLFLDA-------------INGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             SWV F                 NG +E W+ L ++ M         LAY S
Sbjct  395   SWVSFAGCSVKNLFGFMDKRDCNG-IETWLTLSEESMALFESKPKLLAYAS  444



>ref|XP_009790148.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=438

 Score =   192 bits (489),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 224/454 (49%), Gaps = 41/454 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+  + SK+ V+PS PTP  LKN+K  FLDQ+   VR+  + FY +     + + +    
Sbjct  1     METIILSKQKVKPSKPTPPHLKNHKLCFLDQVQPPVRIKTILFYENTTPAQNQNNLKN--  58

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
              +LS+TL+L YPLAG  KE    V+CND GV ++ A     +S  LEN ++ ++K+L   
Sbjct  59    -ALSETLTLFYPLAGELKEGSTFVDCNDTGVVYVEAQAKTCLSYFLENPDLSQLKKLMID  117

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
              + +         V+ QV RF CGG+AIG  + H ++DA+ ++ F+  WA+  R      
Sbjct  118   VECH--------FVSFQVTRFECGGMAIGASMFHLVSDANTMSAFLNTWANIARERIMPL  169

Query  1202  GS-GFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
              S  F S  SS+LFPP       ++L         +E    + +RFV  + AIA ++   
Sbjct  170   ASLDFTS--SSLLFPP--QNHLPQELSAFLKTLFFKEGDQFLQRRFVFDSKAIAAIK---  222

Query  1025  TITGGS---VQRPSRVEALTALVWAAVINATPT--QTATLSCM----VNLRRRMEPPLPP  873
              + GGS   V +P+RVEALTAL+W  ++ A+     +++ SCM    VNLR R+ PPL P
Sbjct  223   -LKGGSSSTVPKPTRVEALTALIWKHMMLASKAVKGSSSPSCMLNHAVNLRPRLHPPL-P  280

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N  G +V  A     E++     +    LV  +R+ F    +GE  K          ++ 
Sbjct  281   NASGNVVWFATTF-YESEITSDNIDLSHLVGLVREVFETFSNGENLKELEGDASFTYLVN  339

Query  692   RGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI-------  537
                + + +      Y  +S CR    EVDFGWGKP  V  +LD +  L    I       
Sbjct  340   LATDTINSFGKVDNYMFTSWCRFGLDEVDFGWGKPIWVAPLLDPTCSLGHVQIVILVESG  399

Query  536   --NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +  +E W+   K+ +  L  D  FL Y S  P
Sbjct  400   RSSDGIEAWILRNKEEILELENDEEFLQYASPNP  433



>ref|XP_008389789.1| PREDICTED: vinorine synthase-like [Malus domestica]
 ref|XP_008367046.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   192 bits (489),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 152/459 (33%), Positives = 239/459 (52%), Gaps = 55/459 (12%)
 Frame = -3

Query  1742  MKVEVR--SKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI--  1575
             MKVEV   SKEI+RPSSPTP+ L+ Y+ SFLDQ++  V  P V FY S       D +  
Sbjct  1     MKVEVVVISKEIIRPSSPTPDHLRTYQLSFLDQISPPVYNPLVIFYSSSEPETKFDIVEI  60

Query  1574  -DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
              ++LKKSLS  L+  YPLAGRA +  + ++CND+G+ ++   V   +S +++N    ++ 
Sbjct  61    SNQLKKSLSNALTQFYPLAGRA-QGNLFIDCNDQGIPYLETRVKCQLSDVIQNPIPVELN  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +  P    ++   V      VQ+N F CGGIA+G  +SH IADA +   F++ WA+  R 
Sbjct  120   KFIP----FQLDEVVDISFGVQLNIFECGGIALGLCISHKIADALSFFNFIKTWAATARQ  175

Query  1217  CAANNGSGFVSDH-------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
                       SDH       S+ LFPP   +    ++      GI +E  +++ + FV  
Sbjct  176   ---------QSDHLVCPQFVSAKLFPPKNISGYSPRV------GITKE--NIVTRMFVFE  218

Query  1058  ANAIAQLRQ-----DLTITGGSVQR-PSRVEALTALVWAAVINAT-------PTQTATLS  918
             A+ I  L+      D + +  + Q+ PSRVEAL+A +W+  + AT       P +   + 
Sbjct  219   ASKIETLKSKYGAGDHSKSLENHQKPPSRVEALSAFIWSRFMAATQVKSDIAPKRIYAIV  278

Query  917   CMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEA  738
               VNLR R++PPLP +  G L   A+ +   + D G       L+ ++RD  + + D   
Sbjct  279   HAVNLRTRIDPPLPEHSFGNLYRIAMTI--PSLDIGE--ECYGLLSQVRDQVKKI-DKHY  333

Query  737   RKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDN  564
              +   +G      I +  + V   +  TL  +SLCR   YE DFGWG P  V +  +  N
Sbjct  334   VENLQKGSEHLDFIKQTSDNVFKGEMVTLNFTSLCRFPLYEADFGWGNPTWVGSPALTFN  393

Query  563   SWVLFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             + V+F+DA + G +E ++ + ++ +  +  D  FLA+VS
Sbjct  394   NLVVFIDAKSGGGIEAYINMKEEDLAKIEGDGEFLAFVS  432



>ref|XP_009359355.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=455

 Score =   192 bits (489),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 221/461 (48%), Gaps = 42/461 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDEl-  1566
             ++VEV S + ++PSSPTP+ L+ +  SFLDQL   + +P V F+   +  H TD   E  
Sbjct  4     LEVEVVSSKTIKPSSPTPDHLRRHNLSFLDQLQPPIFMPMVLFF--PKDPHTTDDPTERC  61

Query  1565  ---kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
                K +LSKTL+  YPLAGR +  +  V+CNDEG  ++ A    N++ +++N        
Sbjct  62    TKIKTALSKTLTKFYPLAGRIRGIQY-VDCNDEGAYYVEAKANSNITDIIQNPCPSDFNM  120

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-  1218
               P A         +  + +QV  F+CGG++IG  +SH + DA ++  F+   A+  RG 
Sbjct  121   FIPCAL----DAASELPICLQVTFFACGGMSIGMGMSHKVGDALSIFIFLNSLAATTRGE  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 +   F+SD     FP    + + +    M    I         KRFV  A+A++ L
Sbjct  177   PDYGHAPEFISDK---YFPQQDLSGSYQHSSGMIKHNIS-------TKRFVFDASAVSAL  226

Query  1037  RQDLT-ITGGSVQRPSRVEALTALVWAAVINATPTQTA-----------TLSCMVNLRRR  894
             R   T +     +RP+RVEAL+A VW   I A  +Q             T+S  VNLR R
Sbjct  227   RARSTDVENEHARRPTRVEALSAFVWRRYIAACTSQQQNDHADDVPAMYTVSHAVNLRTR  286

Query  893   MEPPLPPNCLGTLVDEAIV---LCQEAKDGG-TVVTAVELVQRIRDAFRAVKDGEARKVY  726
             M+PPLP    G +   AI    +  E KDG  +  +   +V  +R A + V     +K+ 
Sbjct  287   MDPPLPEYTFGNVTRTAISVPPILMEPKDGSLSDPSLYSVVGHVRQALKQVDREYVKKLQ  346

Query  725   GEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVL  552
                G++  +  R  ++ R    S  +T SLCR   Y+ DFGWGKP           + V 
Sbjct  347   EGEGYVSFLKERSSQVKRGEVVSFSFT-SLCRFPIYDADFGWGKPAYAGSARFTFKNLVS  405

Query  551   FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             F D  +G  VE W+ L ++ M     D   L YVS  P  K
Sbjct  406   FFDTTSGDGVEAWINLKEEDMEKFEADEEVLKYVSPNPSSK  446



>ref|XP_006493396.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=425

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 223/459 (49%), Gaps = 61/459 (13%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---  1578
             + + VE  S+E+++PS+PTP  L++Y+FS LDQ+   V +  ++FY       H D    
Sbjct  1     MKIDVETISEEMIKPSTPTPSQLRHYQFSHLDQIGPPVYISLLYFY-------HLDDHKL  53

Query  1577  -------IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
                     + LK SLS  L+  YPLAGR K +   V+CNDEGV F  A V+ ++S ++  
Sbjct  54    VSNNHLFSNSLKSSLSNVLTKYYPLAGRIKNNY--VDCNDEGVVFSEAKVSCHLSEIVNE  111

Query  1418  FEIG-KIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
              E   + K+L P  +  +   V    +A+QVN F+CG +AI   +SH IAD S+L  F +
Sbjct  112   PEFSSEFKKLLPFDQEKDVVSVDGLAIAIQVNIFNCGNVAIAVMISHRIADGSSLITFTK  171

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
              WA+  RG   N    FV   ++ LF P     +            +   K +++K+F+ 
Sbjct  172   NWAAVARGEGENILPEFV---AAKLFAPKDAGGS-------SGTSFDPRPKKVVLKKFLF  221

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRR  897
               + I  LR    +   ++  P+RVEAL+A +W+ +     I  +P +   L   VNLR+
Sbjct  222   EGSKITTLRDKYGLD--NLIYPTRVEALSAFLWSRLAASTRIKVSPERPCMLVHAVNLRK  279

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAV-KDGEARKVYGE  720
             RMEP LP +  G L   A+ + +E  D         +V + RDA   + KD    K    
Sbjct  280   RMEPQLPADSFGNLFAFAVTILEENHDN-------RMVNKFRDAIGKIDKDYLKAKNVEH  332

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSW------  558
                +   I  G E     +      SSLC+   YE DFG GKP  V      +W      
Sbjct  333   SELIDLAITNG-ERFDKVELGYCIISSLCKFPVYEADFGLGKPIWV------AWGCFPYK  385

Query  557   --VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               + F+D  +G  +EVW+ L ++VM     D+  LAYVS
Sbjct  386   NVIHFMDTKSGDGIEVWVHLEEEVMAIFENDQELLAYVS  424



>gb|KDP38750.1| hypothetical protein JCGZ_04103 [Jatropha curcas]
Length=449

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 148/453 (33%), Positives = 234/453 (52%), Gaps = 43/453 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI----  1575
             +KVE+ ++E ++PSSPTP +L+    S LDQL+  +  P + FY     C   + I    
Sbjct  5     VKVEIITRETIKPSSPTPRNLRYKNLSLLDQLSFAMSTPMLLFY--PFRCDKNNNIVHVI  62

Query  1574  ----DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIG  1407
                   LK SLSKTL+L YPLAG  K +   +ECND GVE+I A V  +M  L +N E  
Sbjct  63    KEQSQNLKTSLSKTLTLFYPLAGELKNNSF-IECNDYGVEYIEAQVDCSMMELFQNPENY  121

Query  1406  KIKQLTPSAKFYEPQPVGKALVAV-QVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              ++ L P     +  PV K   A+  VN F+CGG+AIG  +SH IADA++L  F+  WAS
Sbjct  122   LLENLFP----IDLNPVDKFTGAIIHVNFFNCGGLAIGVSLSHKIADAASLGTFLLAWAS  177

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                   A+     + +     F   T   + E  + + +      +   I KRF + +  
Sbjct  178   M-----ASLSMEILPETKCPHFVSNTVIPSAENSLILPSPPPSLTQTKCITKRFTLSSCK  232

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT------ATLSCMVNLRRRME  888
             I  L+     +  ++Q P+RVE +TAL+W  +I+A+  ++      + L+  VNLRRR+ 
Sbjct  233   IDMLKAKAATS--TLQTPTRVEVVTALIWKCLISASQAKSKGKHKKSVLAQAVNLRRRLV  290

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             P LP N +G L  + +V+ ++ +         +LV  +R+    V D   ++V     + 
Sbjct  291   PHLPQNYIGNLSGKFLVMAEKER-----AELKDLVAHLREGIEKVSDNVWKRVDEILDF-  344

Query  707   RAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLFLDAI  537
                 A+ +  + +R+   LY+ +SLC   +Y+VDFGWGKP   +V N++  ++V+ LD  
Sbjct  345   ----AKEFAELHSREDLDLYSFTSLCGFPFYDVDFGWGKPIWTVVTNLVLKNYVVMLDMK  400

Query  536   N-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +   VEVWM L ++ M     +   L + S  P
Sbjct  401   DRKGVEVWMSLSEEDMPLFEANGELLEFASVNP  433



>emb|CDP10332.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 140/451 (31%), Positives = 229/451 (51%), Gaps = 29/451 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI-DEl  1566
             M+VE+ S+EI++PS PTP+ LK +K SF+DQ+     + F+ FY    +    + + ++L
Sbjct  1     MEVEIISQEIIKPSLPTPDHLKIFKRSFIDQITGGYLVRFISFYPRKESKLKINEVTNQL  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K SLS+TL+  YPLAG  K+D  T+ECND+G  F+ A V  NM+ L+   +  +  +L  
Sbjct  61    KTSLSQTLTRYYPLAGIYKDDS-TIECNDKGALFVTAHVHCNMNELINQPKFQQFHKLGT  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
             S++FY     G   V+VQ N FSCGG+AI     H I D + ++ F++ WA+   G   +
Sbjct  120   SSRFYGD---GSFQVSVQFNTFSCGGVAIFTCFYHMIMDITTISVFLKCWAAMASGSQDH  176

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
               + F  ++ S +  P+ D+        +  + +   E     KRFV  + AI++L+   
Sbjct  177   ESAFFYPEYRSAVLFPVKDSVPFG--FSVIIKSLSLNEGRSTRKRFVFSSAAISELK---  231

Query  1025  TITGGS--VQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPPLPPNC  867
              + G S  V  P+ VE +++ +W   + A        + + L    ++RRRM PPLP   
Sbjct  232   -VKGSSDRVPDPTSVEVVSSFIWKHAMTAAKVVQGVQEPSVLVHAADMRRRMVPPLPEYS  290

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAVIA  693
              G ++  ++++ +        V    LV+ +R A    K+    K+    G+  +   + 
Sbjct  291   AGNII--SMIIAEYDGIDECEVKFGRLVELLRVAKEENKNEFVPKIQSSKGYDVMMKFLE  348

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLV----VNMLDNSWVLFLDAIN  534
                E    +  +T   +  C+M   EVDFGWGKP    LV    V  +  ++V+ LD  +
Sbjct  349   EWGEKCSRKGLNTYQFTCWCKMGLNEVDFGWGKPVWTSLVGGTEVESMYKNFVVLLDGSD  408

Query  533   GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G +E W+ L +Q    L  D+ FLAY S  P
Sbjct  409   GGIEAWLILEQQETAILENDQEFLAYASLNP  439



>ref|XP_010044503.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=434

 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 144/445 (32%), Positives = 224/445 (50%), Gaps = 34/445 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTID-  1572
             + + VE+ S+E V+PSSPTP+ L++Y+ SFLDQ++  V  PFV FY         +  D 
Sbjct  1     MEIAVEITSRETVKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEDDQFNIDDI  60

Query  1571  --ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
               +LK SLS  L+  YPLAGR K + +++EC+D GV +  A V   +S + EN +  ++ 
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDVGVPYSEAIVKCQVSDVTENPDPQELG  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L P    +      +  + VQ N+F CGGIA+G  +SH I+DA +L  F+++WA+  RG
Sbjct  120   KLLP----FVLDVSDETTLGVQFNKFDCGGIAVGICMSHKISDALSLLTFIKMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F S     LFPP  + S  E        GI ++  +++ KRF+   N I  L
Sbjct  176   EEIVTPPQFASAE---LFPP-KNISGFEP-----RTGITRD--NIVSKRFIFKTNKIETL  224

Query  1037  --RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPL  879
               R    +  G  + PSRVEAL+  +W+       + + P++   +   VNLR + +PPL
Sbjct  225   KARYSKEMDLGQNRPPSRVEALSTFIWSRFAWSTRVYSEPSKKCIILHAVNLRTKFDPPL  284

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P +  G     A+   Q   D G       L  ++R+  R +  G   K+  +G      
Sbjct  285   PQHSFGNFYRVAVTSLQ--LDSGKECYG--LAAKMRETVRGIDKGYVEKLR-DGKEHLDF  339

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-A  528
             I R  E+    +   +  +SLCR   YE DFGW  P  V +  +   + V+F+D  +G  
Sbjct  340   IKRSAEVYLKGELLAMNFTSLCRFPMYESDFGWDNPTWVGSPALTFQNLVVFMDTKSGDG  399

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYV  453
             VE ++ L  + M  L  D  F+ +V
Sbjct  400   VEAYISLRVEDMAALESDEEFMEFV  424



>ref|XP_010682956.1| PREDICTED: BAHD acyltransferase At5g47980 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 144/454 (32%), Positives = 220/454 (48%), Gaps = 35/454 (8%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY----VSGRACHH  1587
             L   MKV   +++ ++PSS T   L+N+KFS LDQLA ++  P VFFY    +S      
Sbjct  6     LATLMKVARVARDYIKPSSITAPHLRNFKFSLLDQLAPSLYAPMVFFYPMQDISNIKDDT  65

Query  1586  TDTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAEN-MSSLLENFEI  1410
             +  ++ LK+SLS  L+  YP AGR K D ++++CND GVEF  A V    ++  L     
Sbjct  66    SYRVNHLKRSLSPFLNRFYPFAGRIK-DHVSIDCNDAGVEFFEAKVINTRLNDFLRLPNA  124

Query  1409  GKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
               +KQ  P     E       LV VQ N F CGG+A+G   SH I D    + FM+ W+S
Sbjct  125   NALKQFLPVD--IESNKSMDHLVHVQTNTFECGGMALGICWSHKITDGGTASTFMKGWSS  182

Query  1229  FNRGCAANNGSGFVSDH-SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
                G     G   V ++ +S LFPP+ D+S  +  +K+       ++     +RFV   +
Sbjct  183   MASGL----GDEVVPEYVASSLFPPM-DSSITQHALKL-------DKDRTTTRRFVFDGS  230

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCM---VNLRRRME  888
              I +L+    +    V +P+RVEA+++L+W     A+   + +  LS M   +N+RRR  
Sbjct  231   KIVKLKD--KVASKEVPKPTRVEAVSSLLWQCATKASRANSGSQALSVMSQSMNIRRRTL  288

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW-  711
             PPLP   +G LV   I   +E  D   ++   +LV + R       +  A+K+ G   + 
Sbjct  289   PPLPDTSIGNLVGYYIAKMEENSD--HIMHLEDLVTKQRQGKTEAINNYAKKLQGNDAYV  346

Query  710   -LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSWVLFLD  543
              ++ +      L+R  D +     S C    Y+ DFGWGKP    LV     N++ L   
Sbjct  347   VIQELFKEAGSLLRRDDVAFFKCLSTCGDGLYDADFGWGKPAWQSLVSLGYKNTFALSET  406

Query  542   AINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                G +E W+ L +  M     D   L + S+ P
Sbjct  407   KEGGGIEAWVTLNEDDMAIFEHDFDLLQFASSNP  440



>ref|XP_010100286.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
 gb|EXB82420.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
Length=439

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 150/452 (33%), Positives = 226/452 (50%), Gaps = 40/452 (9%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkk-  1560
             +E+  +E ++PSSPTP+  + +   + DQ++    +P + FY  G      + + E    
Sbjct  4     IEIIKRETIKPSSPTPQHNRIHNLCWFDQISTPFFIPILLFYRHGLFNTSINAVSETSSL  63

Query  1559  ---slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
                SLSKTLS  YP AGR + DR ++ CNDEGV+F+VA V +++SSLL N +   +  L 
Sbjct  64    LINSLSKTLSKYYPFAGRIR-DRESILCNDEGVDFLVAKVKQDLSSLLHNPKAEILHLLF  122

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    +    V   L+AVQVN F CGG+AIG  +SH ++DA+ L  F+  WAS  R    
Sbjct  123   PDNLQWRNTDVS-FLLAVQVNYFDCGGLAIGVCMSHKLSDAATLVSFINCWASTARNAGR  181

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQ-LMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             +           + FP L   S   +  + +  E +   + +   +RFV  A  I  L+ 
Sbjct  182   D-----------VSFPVLNVASLFPRGDLPLFPEAVHW-KGNYASRRFVFEAEKINSLK-  228

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINAT-------PTQTATLSCMVNLRRRMEPPLPP  873
                +    V+ P+RVEA+TAL++ + I A+        T +  L   VN+R RM P LP 
Sbjct  229   --AVISEKVENPTRVEAVTALLYKSAIKASRAVVSNAKTSSHLLVQQVNMRTRMVPELPE  286

Query  872   NCLGTLVDEAIVLCQ--EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               +G+L     VL    E  D    V    LV R+R+AF  +    A K  GE  +L  +
Sbjct  287   TSVGSLSWFFPVLWGSIEMDDQSFFVG---LVSRMREAFTKLCSSFADKFGGEDWFLEML  343

Query  698   -IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD--AI  537
              I + Y+ + +R    +Y  SS CR   YE DFGWGKP  V  V  +D + ++ +D    
Sbjct  344   EILKEYKGLLSRSDQVVYRFSSWCRFPVYEADFGWGKPVWVTSVGTVDKNVIILMDHGKN  403

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E ++ L +  M     D+  LA+ S  P
Sbjct  404   GGGIEAFVTLEEDEMFVFECDQELLAFASCNP  435



>ref|XP_006435345.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
 ref|XP_006473775.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
 gb|ESR48585.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
Length=455

 Score =   191 bits (486),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 156/467 (33%), Positives = 227/467 (49%), Gaps = 54/467 (12%)
 Frame = -3

Query  1742  MKVEVR--SKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             MK+EV+  SKE ++PSSPTP  LK +KFS LDQ   +   P + FY +   C     I +
Sbjct  1     MKIEVQIISKEDIKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFYPND--CMTLAEIPK  58

Query  1568  lkk----slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKI  1401
                    SLS+TL+  YPLAG+ K+D +++ECND+G  F+ A V   +   L   ++  +
Sbjct  59    RLALLKRSLSETLTRFYPLAGKIKDD-LSIECNDDGAYFVEAQVNCRLDEFLTKPDLLLL  117

Query  1400  KQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +  P     E   V   L  +QVN F CGGIAIG  +SH + D +AL+ F+  W++  R
Sbjct  118   HRFLPCELMKELTAV-TYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSATAR  176

Query  1220  GCAANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             GC       F +     LFP     L DTS +    L K G           I KRFV  
Sbjct  177   GCEEVIYPNFAAPS---LFPANDLWLRDTSMVMWGSLFKKGK---------CITKRFVFD  224

Query  1058  ANAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ-------TATLSCMV  909
             A+AIA L+  +  T   ++    P+RVEA++A +W  ++ A+  +          L+ +V
Sbjct  225   ASAIAALK--VVATSSKIKCPTPPTRVEAVSAFIWKCIMAASKEKHGYQTRRPCVLTHLV  282

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARK  732
             NLRRRM PPL  NC G L+  A   C             +LV  ++DA   + DGE  +K
Sbjct  283   NLRRRMTPPLSDNCTGNLLWMAAAKCMTPDKP----ELHDLVGELKDAISKL-DGEFVKK  337

Query  731   VYGEGG--WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM-LDNS  561
             +  + G   +   + +  EL    +   +  SS C   +YE+DFG GKP  V +  L  S
Sbjct  338   LSSDEGNSLMCESLKQIGELCSKDEVDHVGFSSWCNFGFYEIDFGRGKPVWVSSYGLSGS  397

Query  560   WVLFLDAI-----NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
              V+ L  +        +E WM L +Q M  L     ++ + S  P P
Sbjct  398   PVMNLVILVETRYGDGIEAWMTLDEQDMSNLECSSEYIKFASMDPSP  444



>gb|KGN64382.1| hypothetical protein Csa_1G050210 [Cucumis sativus]
Length=431

 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 145/450 (32%), Positives = 219/450 (49%), Gaps = 41/450 (9%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDEl  1566
             + K+++ S EI++PSSPTP + +++K SFLDQ A     P +FFY  G   +H D    L
Sbjct  7     SFKIDIISTEIIKPSSPTPSTHQHHKLSFLDQFAPGSYTPLLFFYPGG--GNHRDRCRRL  64

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN-FEIGKIKQLT  1389
             K+SL++TLS  YPLAG   E  + VECNDEGV F  A V+  +S ++EN  ++    +L 
Sbjct  65    KESLAETLSRFYPLAGTLVEAYL-VECNDEGVAFSEARVSGRLSEVMENPNDVVTYHRLL  123

Query  1388  PSAKFYEPQPV--GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             P    + P  V   + ++ VQ N F CGG  I   ++H I D ++   F + WAS  RG 
Sbjct  124   P----FHPDAVLERECILGVQYNVFECGGAVIALCITHKIVDGTSTTMFTKAWASTCRG-  178

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                       D+   + P    T     +   G        + ++ +RFV   + IA L+
Sbjct  179   ----------DNEYPIVPNFDATDLFPAMEIRGGNKRHPRMQKIVTRRFVFNKSNIAALK  228

Query  1034  QDLTITGGSVQR--PSRVEALTALVWAAVI----NATPTQTATLSCM--VNLRRRMEPPL  879
             +  +     + +  PSRVE+++  +W   I      TPT+    + +  VNLR RM PPL
Sbjct  229   KQASSAALFLNQRPPSRVESVSGFLWKRFIALYHKKTPTKAKRFAVIQAVNLRNRMNPPL  288

Query  878   PPNCLGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PPN  G +     A V   E +D  +      LV ++R+A R + D   + +      LR
Sbjct  289   PPNSFGNIWWFATADVPIDEEQDFPS------LVGKVREAIREIDDEYTKTLQDTEKSLR  342

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING  531
             A +  G E V + +      +S C    YE DFGWGKP  V        + VLF++  +G
Sbjct  343   AKMKMG-ERVYSGEVEMACFTSWCNFPVYETDFGWGKPTWVCTPGRPYKNVVLFVNTSDG  401

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAF  444
               +E W+ L +  M     D   L++ S F
Sbjct  402   EGIEAWVNLEESDMALFENDCELLSFTSLF  431



>ref|XP_004310187.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 154/459 (34%), Positives = 233/459 (51%), Gaps = 51/459 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-----VSGRACHHTDT  1578
             M+VE+ S+E ++PS+PT    + Y  SFL+QL      P V+FY      S    +  D 
Sbjct  1     MEVEIVSRETIKPSTPTLPHYRTYNLSFLEQLNPRTYTPIVYFYPKEASASDHYPNFCDK  60

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
              D+LKKSLS+TL++ YP +GR K DR++++CNDEGV FI A +   +S +LE  +  ++ 
Sbjct  61    SDQLKKSLSETLAIYYPFSGRIK-DRVSIDCNDEGVIFIEARIKVQLSQILEQPKDEELD  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              L      +        ++AVQV+ F CGG+AIG  +SH +AD S +  F+  WA+  R 
Sbjct  120   LLFTDKLQWNDDSNLTVILAVQVSFFDCGGMAIGICMSHKVADTSTMINFINDWAAMTRD  179

Query  1217  CAANN--GSGFVSDHSSILFP----PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
               A+      F+++    +FP    PL   S IE+              D I KR+V  A
Sbjct  180   HKADQYVSPKFIAE---TVFPRGEIPLPPESVIEK-------------GDCISKRYVFDA  223

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSC-------MVNLRR  897
             + IA L+    +    VQ P+RVE +TA +    I+A  + + +LS         VN+R 
Sbjct  224   SKIAALK---ALVCDKVQNPTRVEVVTAFIHRCAISALKSNSGSLSNPNTLLIQTVNMRA  280

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RM PPLP + +G++V    V   E +   +V+   ELV ++++   A   G   + +G+ 
Sbjct  281   RMVPPLPKSSVGSMVWYYAVSTAEEE---SVIELHELVTQMKERM-AQFCGTYLEKFGK-  335

Query  716   GWLRAVIARGYELVRNRDSSTLYT---SSLCRMAYYEVDFGWGKPRLVV---NMLDNSWV  555
              W    +    E  ++     L     SS CR   YE DFGWGKP  V     +L N+ +
Sbjct  336   EWPSIFLECMEESRKSFHIQNLVVYRCSSWCRFPIYEADFGWGKPIWVTIASCVLKNT-I  394

Query  554   LFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +DA NG  +EV++ L KQ M    +D   LA+ S  P
Sbjct  395   FLIDARNGEGIEVYVNLEKQHMDMFERDPELLAFASLNP  433



>ref|XP_008372859.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=450

 Score =   191 bits (484),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 234/457 (51%), Gaps = 39/457 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--------VSGRACHH  1587
             +KVE+  ++ ++PS+ TP  L++Y+ SFLDQ+A+ +  P + FY        VS R  HH
Sbjct  5     IKVEIIERQTIKPSTSTPHHLRSYELSFLDQMAIVIYTPLLLFYPITSTTSKVSTR--HH  62

Query  1586  TDTIDEl----kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
               +IDE      +SL+KTL+  YPLAGR  +  I VEC D+G  FI A ++  +S +LEN
Sbjct  63    AMSIDEKCRHLIESLAKTLTHFYPLAGRIVKGNI-VECTDDGAAFITARISCCLSDILEN  121

Query  1418  FEIGKIKQLTPSAKFYEPQPVGKA-LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
              +   +K+  P     E +  G   L+ VQVN F CGG+AIG  +SH IADAS L  F+ 
Sbjct  122   PDGQILKRFLPIE--IESKEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFIN  179

Query  1241  IWASFNRGCAANNGSGFVSDH-SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
              WA+   G + ++    + +  ++ +F P+  +S+ +   +      E  ++  I +R+V
Sbjct  180   CWATIALGSSDSDQVLNLPEFGAASVFKPIEFSSSSQPPAR------EVVKEKCITQRYV  233

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLR  900
               A  I+ L+ +  +    V +P+RVEA++AL+W     A+ +       +     VNLR
Sbjct  234   FDAPKISTLQSE--VASSVVAKPTRVEAVSALIWKCATEASRSNLRKQGPSFFRQDVNLR  291

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +R+  PLP N  G +V         A +  +V+   +LV ++R+    +K+  A K+  +
Sbjct  292   KRVVXPLPENLAGNVVGS---FTSRADEESSVINLKDLVAKLREGIEGLKEKYAAKLVFD  348

Query  719   GGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVLF  549
                    I       +  D+  +Y+ +S CR   YE DFGWG+P    V ++   + ++ 
Sbjct  349   SDEAWQEIKDKQNKPKTHDNMEIYSCTSWCRFPLYEADFGWGRPSWVSVASIAIKNIIVL  408

Query  548   LDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +D  +   +E W+ + ++       +   L Y S  P
Sbjct  409   MDKRDCSGIEAWVTMSEESKALFESNVELLGYASVNP  445



>ref|XP_006479029.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=442

 Score =   191 bits (484),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 144/449 (32%), Positives = 230/449 (51%), Gaps = 31/449 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH----TDTI  1575
             M++   S EI++PSSPTP+ LK +K S LDQ+A +   P + FY   + C +      T 
Sbjct  1     MEINNVSSEIIKPSSPTPQHLKTHKLSVLDQVAGDSLFPIILFY--PQTCSNNTSLNKTT  58

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVAD-VAENMSSLLENFEIGKIK  1398
             D LK+SLS+TL+L +P AGR K D  +++C+D G  FI A   A +MS +++   +  ++
Sbjct  59    DLLKRSLSRTLTLYHPFAGRLK-DEFSIDCDDTGATFIEARAAASDMSEIVKQPTVDMLE  117

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL P  K  E   V   L A       CGG+A+    SH IAD +  A F++ W +F  G
Sbjct  118   QLMP-YKLNEKPSVAVNLAAKVTYFEHCGGMALCVCFSHVIADITTAANFIKTWVTFASG  176

Query  1217  CAANNGSGFVSDHS----SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                ++    V  H+    S +FPP   +S    ++   AE + +   +++ KRF+   + 
Sbjct  177   SDTSSEDDDVIKHAVFGCSSIFPPQKFSSFSRNVI---AENLSK-SAEILTKRFIFEGDK  232

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVIN----ATPTQTATL--SCMVNLRRRME  888
             IA L++ +     S   P+RVEA++A++   +++    A     + L  S  VNLR R+ 
Sbjct  233   IAALKEKMGSESSSGYHPTRVEAVSAIILGGIMSVEKEADDFNHSHLVASIAVNLRNRVN  292

Query  887   PPLPPNCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             PP+P   +G +V   I  L  E K     +    L + +  +   + D   RK + +GG+
Sbjct  293   PPIPEQSIGNIVQAGIAKLPIEKK----TIDYRNLAETLHKSIEKINDEYLRKFHADGGF  348

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAIN  534
             L + +    E + +++      S+ CR   YE DFGWGKP  V  ++ +  V + LD+ +
Sbjct  349   L-SNMNDVLEGLFDKNCRWFTISAWCRRPLYEADFGWGKPVWVSTVMKHKDVAVLLDSSD  407

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E W+ LPK+ M    QD   L Y S
Sbjct  408   GKGIEAWVALPKKDMAKFEQDSGILRYAS  436



>ref|XP_010025365.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW62008.1| hypothetical protein EUGRSUZ_H04687 [Eucalyptus grandis]
Length=436

 Score =   190 bits (483),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 146/459 (32%), Positives = 233/459 (51%), Gaps = 47/459 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M V V   E ++PSSPTP +L+ +  SFLDQ++  + +P + F+       + + + +L+
Sbjct  1     MNVIVEHTETIKPSSPTPPNLRRHGLSFLDQISPPIFMPLLLFFPKDDLLTNEEKLSKLR  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             +SL++TL+  YPLAGR++ D + VECND+GV F VA     +S +LE+ +  K+ +L P 
Sbjct  61    RSLAETLTRFYPLAGRSR-DNLYVECNDDGVPFAVARATCQLSEVLESPDPEKLDRLLP-  118

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
              K Y+   +G    AVQV+ F CGG+ +   +SH +ADA +   F+  WA+  RG    +
Sbjct  119   FKLYD---LGDLTTAVQVSFFECGGLCLALCLSHKLADALSFFSFLNSWAAITRG----D  171

Query  1202  GSGFVSD--HSSILFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
             G   +S    SS LFPP  L   +    L+K G          ++ KRFV  A +I  LR
Sbjct  172   GGHIISPIFESSSLFPPVNLVGYAPSTGLLKEG----------LVTKRFVFDARSITTLR  221

Query  1034  Q-----DLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS---------CMVNLRR  897
                   ++    G  +RP+RVEAL+A +W   + +T  +   +S           VNLR 
Sbjct  222   DKYSTAEIAEAEGQRRRPTRVEALSAFLWRRYMESTQKKGDRISENDKIYTVLHAVNLRP  281

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RM+PPL     G +    I L +   D    +    +V ++R+A + V     +K+    
Sbjct  282   RMDPPLSDRHFGNI--SRIALTRPTVDTDEHM----IVNQVREAIKEVDTSYVKKLKEGE  335

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLD  543
             G L  +  R  ++ +       +T SLCR    E DFGWGKP  V +      + ++FLD
Sbjct  336   GHLNFLKERSSQITKGEIVPFSFT-SLCRFPTNEADFGWGKPAWVGSSAFPFRNLIVFLD  394

Query  542   AIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
               + G +E +  L  + M    +D+  L++ S+   PK+
Sbjct  395   TRDGGGIEAYANLKPEDMALFEKDKELLSFASSSASPKV  433



>ref|XP_004504492.1| PREDICTED: vinorine synthase-like [Cicer arietinum]
Length=438

 Score =   190 bits (483),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/395 (33%), Positives = 208/395 (53%), Gaps = 29/395 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+EI++PSSPTP  LKN+  SF+D +     +P +FFY   + C  T  I  LK
Sbjct  1     MEMEIISREIIKPSSPTPPHLKNFPLSFIDHITFRNYVPLLFFYDDTKVCDQTSKISHLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
              SLS+ LS+ YP AGR K D++++ECND+GV F+VA++   +S++L+N     +  L P 
Sbjct  61    NSLSQILSIYYPFAGRFK-DQVSIECNDQGVSFLVANIGTKLSTILQNPNQNLLNPLFPD  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++     ++++A+Q+N F+CG I I     H I DAS    F+  WA  NR    + 
Sbjct  120   ELQWKTANWSESILAIQINCFACGRIVISVCACHKIIDASTAFNFVNDWAEINREKQKSK  179

Query  1202  GSGFVSDHSSI-----LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 +  ++++     +FP  T     E       E ++ E   ++ KRFV  A+ I  L
Sbjct  180   SILSILPYNALYAGGTIFPRATFPIFPE------VEFVKHEA--IVCKRFVFEASKIKLL  231

Query  1037  RQDLTITGGS-VQRPSRVEALTALVWAAVINATPT--QTATLSCMVNLRRRMEPPLPPNC  867
             +  +  +  + V+ P+RVE +TAL++   ++A     +T +L   V+LRRRM PPL    
Sbjct  232   KGMMVNSHSNPVKNPTRVEVVTALIYKCAVSALGLNFKTTSLRMAVDLRRRMVPPLLDKS  291

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G LV    V+  E  D         +V +IR+      +   +K  G+   L  ++   
Sbjct  292   VGNLVWFLFVINPELHD---------VVCKIREGLCEFCEIYPKKFGGKEKDLSFILECL  342

Query  686   YELVRNRDS---STLYTSSLCRMAYYEVDFGWGKP  591
              ++  N ++   S +  +S CR   YE DFGWGKP
Sbjct  343   KQVTTNSNAENQSLIIYASWCRFPMYEADFGWGKP  377



>sp|Q94FT4.1|SALAT_PAPSO RecName: Full=Salutaridinol 7-O-acetyltransferase; Short=salAT 
[Papaver somniferum]
 gb|AAK73661.1|AF339913_1 salutaridinol 7-O-acetyltransferase [Papaver somniferum]
Length=474

 Score =   191 bits (485),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 151/450 (34%), Positives = 221/450 (49%), Gaps = 49/450 (11%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQ-LALNVRLPFVFFY------VSGRACHHTDT  1578
             VEV SKE ++P++PTP  LKN+  S LDQ   L   +P + FY       +G + HH D 
Sbjct  9     VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPATAANSTGSSNHHDD-  67

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
             +D LK SLSKTL   YP+AGR   D I V+C+D+G+ F    +   M   +   ++  + 
Sbjct  68    LDLLKSSLSKTLVHFYPMAGRMI-DNILVDCHDQGINFYKVKIRGKMCEFMSQPDV-PLS  125

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL PS       P  +ALV VQVN F CGG AI   VSH IADA+ ++ F+  WAS  + 
Sbjct  126   QLLPSEVVSASVP-KEALVIVQVNMFDCGGTAICSSVSHKIADAATMSTFIRSWASTTKT  184

Query  1217  CAANNGSGFVSDH-------SSILFPP---LTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
               +   +  V+D        S+ LFPP   LT  S + ++    +   + E+   + KRF
Sbjct  185   SRSGGSTAAVTDQKLIPSFDSASLFPPSERLTSPSGMSEI-PFSSTPEDTEDDKTVSKRF  243

Query  1067  VIPANAIAQLRQDLTI---TGGSVQRPSRVEALTALVWAAVINATPTQ-TATLSCMVNLR  900
             V     I  +R+ L +        +R +RVE +T+L+W +V+ +TP      +   VNLR
Sbjct  244   VFDFAKITSVREKLQVLMHDNYKSRRQTRVEVVTSLIWKSVMKSTPAGFLPVVHHAVNLR  303

Query  899   RRMEPPLPPNCLGTL-------VDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVK  750
             ++M+PPL     G L       +         A +     T+ E   ++  + D F A  
Sbjct  304   KKMDPPLQDVSFGNLSVTVSAFLPATTTTTTNAVNKTINSTSSESQVVLHELHD-FIAQM  362

Query  749   DGEARKVYGEGGWLRAVI---ARGYEL----VRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
               E  KV G+ G L  VI   A G++     + + +    + SS CRM  YE+DFGWGKP
Sbjct  363   RSEIDKVKGDKGSLEKVIQNFASGHDASIKKINDVEVINFWISSWCRMGLYEIDFGWGKP  422

Query  590   RLVV---NMLDNSWVLFLD--AINGAVEVW  516
               V    N+  N    F++       +EVW
Sbjct  423   IWVTVDPNIKPNKNCFFMNDTKCGEGIEVW  452



>gb|KCW86592.1| hypothetical protein EUGRSUZ_B03224, partial [Eucalyptus grandis]
Length=423

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 223/444 (50%), Gaps = 34/444 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTID-  1572
             + + VE+ S+E V+PSSPTP+ L++Y+ SFLDQ++  V  PFV FY         +  D 
Sbjct  1     MEIAVEITSRETVKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEDDQFNIDDI  60

Query  1571  --ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
               +LK SLS  L+  YPLAGR K + +++EC+D GV +  A V   +S + EN +  ++ 
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDVGVPYSEAIVKCQVSDVTENPDPQELG  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L P    +      +  + VQ N+F CGGIA+G  +SH I+DA +L  F+++WA+  RG
Sbjct  120   KLLP----FVLDVSDETTLGVQFNKFDCGGIAVGICMSHKISDALSLLTFIKMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F S     LFPP  + S  E        GI ++  +++ KRF+   N I  L
Sbjct  176   EEIVTPPQFASAE---LFPP-KNISGFEP-----RTGITRD--NIVSKRFIFKTNKIETL  224

Query  1037  --RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPL  879
               R    +  G  + PSRVEAL+  +W+       + + P++   +   VNLR + +PPL
Sbjct  225   KARYSKEMDLGQNRPPSRVEALSTFIWSRFAWSTRVYSEPSKKCIILHAVNLRTKFDPPL  284

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P +  G     A+   Q   D G       L  ++R+  R +  G   K+  +G      
Sbjct  285   PQHSFGNFYRVAVTSLQ--LDSGKECYG--LAAKMRETVRGIDKGYVEKLR-DGKEHLDF  339

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-A  528
             I R  E+    +   +  +SLCR   YE DFGW  P  V +  +   + V+F+D  +G  
Sbjct  340   IKRSAEVYLKGELLAMNFTSLCRFPMYESDFGWDNPTWVGSPALTFQNLVVFMDTKSGDG  399

Query  527   VEVWMKLPKQVMHTLTQDRHFLAY  456
             VE ++ L  + M  L  D  F+ +
Sbjct  400   VEAYISLRVEDMAALESDEEFMEF  423



>ref|XP_003521961.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN35623.1| Vinorine synthase [Glycine soja]
Length=433

 Score =   190 bits (482),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 136/447 (30%), Positives = 222/447 (50%), Gaps = 31/447 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +KVE+ SK+ ++PSSPTP  L+++K S LDQLA    +P + FY    +     TI  
Sbjct  1     MAVKVEIVSKDTIKPSSPTPNHLQHFKLSLLDQLAPPFYVPILLFY--SFSDDDFKTISH  58

Query  1568  lkkslsktlsLMY-PLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
               K+    +  +Y P  G  + +   VECNDEG+ +  + V+  +S++++N  + +I +L
Sbjct  59    KLKASLSQVLTLYHPFCGTLRGNS-AVECNDEGILYTESRVSVELSNVVKNPHLHEINEL  117

Query  1391  TPSAKFYEPQPV--GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              P   +   +    G+ ++AVQ+N+F CGG+A+G   SH IADAS  A F+  WA+ +R 
Sbjct  118   FPFDPYNPARETLEGRNMMAVQLNQFKCGGVALGVCFSHKIADASTAASFLSAWAATSRK  177

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                N       +  ++LFPP      IE  M  G  G    +KD++ KRFV   + I++L
Sbjct  178   EDNNKVVPPQMEEGALLFPPRN----IEMDMTRGMVG----DKDIVTKRFVFNDSNISKL  229

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-------TLSCMVNLRRRMEPPL  879
             RQ +   G     P+RVEA+TAL+W + + A   ++A        +S  VN+R R+    
Sbjct  230   RQKM---GCFNFNPTRVEAVTALIWKSSLEAAKERSAEGRFPASMISHAVNIRHRIMASS  286

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               + +G L  +A+    E ++    +   +L +R+R   R V      K+ G   +    
Sbjct  287   KHHSIGNLWQQAVSQLVEVEEE---MGLCDLAERVRKTTREVDGNYVAKLQGLEFYKVIE  343

Query  698   IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING  531
               +   ++ +      Y+ SS  R  +YEVDFGWGKP  V  +   + N  +L       
Sbjct  344   SLKEARIMASEKGVPCYSFSSWVRFGFYEVDFGWGKPTYVRTIGVPIKNVVILMGTKDGD  403

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +E W+ L    M    Q+   L + S
Sbjct  404   GLEAWVTLTTSNMVQFEQNPELLEFAS  430



>ref|XP_006342247.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   189 bits (481),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 131/451 (29%), Positives = 228/451 (51%), Gaps = 39/451 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV+V S+E ++PSSPTP  LK +    LDQL      P V FY +       +    LK
Sbjct  2     MKVQVISRENIQPSSPTPNHLKKFNLCLLDQLIPAPYAPIVLFYPNLNDVKLREKSSLLK  61

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSL++TLS  YPLAGR K D ++++CND+GV ++  +V  ++   L    +  I Q  P 
Sbjct  62    KSLAQTLSSFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCHLIDYLNEPNLESIGQFLPC  120

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++   VG  +  +Q+N F CGGIAIG  ++H + D + L+ F++ W           
Sbjct  121   QPPFKVLGVGDYVTNIQINVFECGGIAIGLCIAHKVLDGAGLSTFLKNW-----------  169

Query  1202  GSGFVS--DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
              SG V+  +  +  F P  D    +  M M +   ++   + + KRFV   + I  L++ 
Sbjct  170   -SGLVTCPNLMANYFFPCDDLWLRDTSMTMWSSMFKK--GNFVTKRFVFNDSVIDNLKR-  225

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGTLVD  849
                T   ++ P++VE +++ +W  +I +     + L+ +VNLR+R  P LP N LG L  
Sbjct  226   -MSTSAHIKYPTKVEVVSSFIWKCLIASNKKSNSLLTHIVNLRKRAAPALPENILGNL--  282

Query  848   EAIVLCQEAKDGGTVVTAV---ELVQRIRDAFRAVKDGEARKVYGEGG--WLRAVIARGY  684
                +    AK+  T  + V   +LV ++R +   + D   +++ G+ G   +R  +    
Sbjct  283   ---IWLSSAKNNNTAKSDVVLSDLVNQVRRSILRIDDCFVKRLRGDEGCSLMRKSLKEIG  339

Query  683   ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI--------NGA  528
             +   ++ ++    SS C+  +Y++DFG+GKP + V+ + +    F++ I        +  
Sbjct  340   DFC-SKGANHYGFSSWCKFGFYDIDFGFGKP-IWVSSISSKCSFFMNLIILMESSRCDNG  397

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +E W+ L ++ M+ L  ++  L + S  P P
Sbjct  398   IEAWVTLDEEEMNMLVSNQELLVFASIDPSP  428



>ref|XP_004238629.1| PREDICTED: vinorine synthase-like [Solanum lycopersicum]
Length=435

 Score =   189 bits (481),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 136/455 (30%), Positives = 228/455 (50%), Gaps = 47/455 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV+V S+E ++PSSPTP+ LK +    LDQL      P V FY +       +    LK
Sbjct  2     MKVQVISRENIQPSSPTPKHLKKFNLCLLDQLIPAPYAPIVLFYPNLNDVKLREKSSLLK  61

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSL++TLS  YPLAGR + D ++++CND+GV ++  +V  ++   L    +  I Q  P 
Sbjct  62    KSLAQTLSSFYPLAGRFR-DELSIDCNDQGVNYVTTNVNCHLIDYLNKPNLESISQFLPC  120

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++   VG  +  +Q+N F CGGIAIG  ++H + D + L+ F++ W           
Sbjct  121   QPPFKVLGVGDYVTNIQINVFECGGIAIGLCIAHKVLDGAGLSTFLKNW-----------  169

Query  1202  GSGFVSD---HSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
              SG V+     ++  FP     L DTS I    + K G         + + KR V   +A
Sbjct  170   -SGLVTCPNLMANYFFPSDDLWLRDTSMIMWSSMFKKG---------NFVTKRLVFNDSA  219

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPN  870
             I  L++    T   ++ P++VE +++ +W  +I +     + L+ +VNLR+R  P LP N
Sbjct  220   IDNLKR--MSTSAHIKYPTKVEVVSSFIWKCLIASNKKSNSLLTHIVNLRKRATPALPEN  277

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG-EGGWLRAVIA  693
              LG L+  +      AK     V   +LV ++R +   + DG  +++ G EG  L     
Sbjct  278   ILGNLIWLSSAKNNNAK---RYVELADLVNQVRKSILKIDDGYVKRLRGDEGCSLMRKSL  334

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI--------  537
             +  E   ++ ++    SS C+  +Y++DFG+GKP + V+ + +    F++ I        
Sbjct  335   KEIEDFCSKGANHYGFSSWCKFGFYDIDFGFGKP-IWVSSISSKCSFFMNLIILMESNRC  393

Query  536   NGAVEVWMKL-PKQVMHTLTQDRHFLAYVSAFPKP  435
             +  +E W+ L  ++ M+ L  ++  L + S  P P
Sbjct  394   DNGIEAWVTLDEEEEMNMLVDNQELLVFASVDPSP  428



>ref|XP_009361854.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=440

 Score =   189 bits (481),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 136/454 (30%), Positives = 213/454 (47%), Gaps = 42/454 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV+V +KE ++PSSPTP  L+N + SF DQ    + +P + FY +       D  +   
Sbjct  5     MKVQVLNKETIKPSSPTPPDLRNLRLSFFDQFEPEIFIPLLLFYRNKPCAAVADDQERSN  64

Query  1562  kslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
                +     +   YP AG  + +  ++ CND GV F+ A V   MS + +  + G ++QL
Sbjct  65    FLKTSLSEALTHFYPFAGEFQRND-SICCNDHGVAFLQAQVNCYMSMVFDKPDDGILEQL  123

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P+ K          L+ +Q N F CGG+AIG   +H ++DA  ++KF+E WA+   G A
Sbjct  124   VPTDK-ESTLSNTDYLLLIQANFFECGGLAIGVSFAHKVSDAFTISKFIERWAAIALGSA  182

Query  1211  ANNGSGFVSDHSSI----------LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             +       +DH ++          LFPPL   ++ +  + +  EG        I +RFV 
Sbjct  183   ST-----TTDHHAVLPGEFGVSASLFPPLDIFNSPDFAVTLSTEG-------SITRRFVF  230

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRR  897
              A+ IA L+        S   P+RVE ++AL+W   I A+ +     + + L  +VN+R+
Sbjct  231   DASKIATLKSK---AANSTPNPTRVEVVSALIWKCAIQASRSKLGIIKPSMLCPIVNMRK  287

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             R    L  N LG  V    V+  E++     +    LV ++R       +     V G  
Sbjct  288   RSRQALAENILGNCVWSFAVMTVESE-----IEHESLVAKLRKGIEEHTEKYPNGVSGND  342

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVLFLDA  540
                 A  + G +L+ + D      SS CR ++YE DFGWGKP  V V  L  + +L +D 
Sbjct  343   IIEAAKESGGSKLLDSDDLDIYTCSSWCRFSFYEADFGWGKPSWVSVRSLYKNTILLMDM  402

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E  + L +  M         LAY S  P
Sbjct  403   RDGDGIEASLTLKEDDMALFENSEELLAYASPNP  436



>ref|XP_009759141.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Nicotiana 
sylvestris]
 gb|AHM22936.1| vinorine synthase [Nicotiana tabacum]
Length=435

 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 137/453 (30%), Positives = 234/453 (52%), Gaps = 46/453 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK+E   +E ++PSSPTP   +N+K SF+D++  +  +P + FY        ++    LK
Sbjct  1     MKIEKLCEEHIKPSSPTPLKHRNHKISFIDEIIPHSSIPLILFYNKNETIPQSEICSHLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
              SLS+ L+  YPLAGR    + +++CND+GV +    V  ++  +++N +  ++ QLTP 
Sbjct  61    TSLSQILTQFYPLAGRM-SSQYSIDCNDQGVYYAEVQVNVSLLDIIKNPKSNELVQLTPY  119

Query  1382  ------AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
                   + F E       L+A+QVN F+CGGIAI   +SH I DAS+L  F++ W + + 
Sbjct  120   NSDGTISNFQE-------LLAIQVNLFTCGGIAISISISHKIGDASSLCTFIKNWCNTSE  172

Query  1220  GCAAN----NGSGFVSDHSSILFPP---LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
                +N    N S F+S  S   FPP   + ++ + E+ +      I+   + ++VKRF+ 
Sbjct  173   ELRSNKKVINDSIFISLSS--FFPPREIVHNSMSSEKCV-----AIQPVVEKLVVKRFIF  225

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPP  882
              A+ I +++  +  +G + +R +RVE +TAL+W   + A    +  +   VN+R+++ PP
Sbjct  226   TASNIVKMKTKVINSGYNKERVTRVEVITALLWKCFMAAKGCNSIAI-LPVNIRKKIVPP  284

Query  881   LPPNCLGT--LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG--  714
             LP N  G   LV  AI        G        LV +I++    +    A K+ GE G  
Sbjct  285   LPENSFGNFFLVSSAI--------GNVENEWFSLVGKIKNVIERIDGNYAEKIRGENGFE  336

Query  713   WLRAVIARGYELV-RNRDSSTLYTSSLCRMAYYEVDFGWGKPRL-VVNMLD-NSWVLFLD  543
             ++++   +  EL+ +  D   L   S C      V+FGWG+  L +V +L     ++ LD
Sbjct  337   FVKSNFNQVGELLSQGDDIKVLRIGSWCNFPINGVNFGWGESILAIVAILGIKDHIVLLD  396

Query  542   AI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             ++  +G +E W+ +  Q M    QD+    + S
Sbjct  397   SLKYSGGIEAWVVMSDQEMELFEQDKELQDFTS  429



>ref|XP_006415801.1| hypothetical protein EUTSA_v10007650mg [Eutrema salsugineum]
 gb|ESQ34154.1| hypothetical protein EUTSA_v10007650mg [Eutrema salsugineum]
Length=441

 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 146/452 (32%), Positives = 225/452 (50%), Gaps = 40/452 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++ V S+E+++PSS +   L  +  SFLDQ+A +  +PF+FFY + R     +  D 
Sbjct  1     MELEITVTSQELIKPSSLSINHLPYHYLSFLDQIAPSFFMPFLFFYHNKRNLSDRERADH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             +K SLSK L+L YPLAGR K     V CND GV F+ A    NMS +LEN    ++    
Sbjct  61    IKSSLSKILNLFYPLAGRIKNSGNVVLCNDVGVSFVEAKAGCNMSQILENPNPYELDMFL  120

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  KF E   VG   + +Q+  F CGG+A+G  + H + DA +   F+  WA+F RG   
Sbjct  121   P-FKFDE---VGDVPLKIQLTFFECGGLALGIGLCHKLCDAMSGLIFIRSWAAFARGHTD  176

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
                +   S   + +FPP       E+L    A  I  E  +M+ +RFV   +++  LR  
Sbjct  177   EIVTP--SFDMAKMFPP----RGTEELNM--ATSITNE--NMVTRRFVFSKSSVESLRA-  225

Query  1028  LTITGGSVQRPSRVEALTALVWA---AVIN--ATPTQTATLSCMVNLRRRMEPPLPPNCL  864
                +G    R +RVEAL+A +W+   A IN      +  TL   VNLRR+ +P +P +  
Sbjct  226   -RFSGNKKFRATRVEALSAFLWSRFVATINRDGKTEKIYTLKHTVNLRRKADPFIPDHMF  284

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G +   ++ + +   +     +   LV++IR+  R +     +K+  +        +R +
Sbjct  285   GNIRSFSVTVPKMIINEDDDESKPSLVEQIREDIRKIDAKHVKKIQED--------SRAH  336

Query  683   ELVRNRDSS--------TLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN  534
                +NR  S         L  +SLC    YE DFGWGKP  + +   N  + V+F+D   
Sbjct  337   LEFQNRQVSGFVKGEIVPLSFTSLCNFPVYEADFGWGKPLWLGSTRRNRKNQVVFIDTKE  396

Query  533   -GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +  M  L  D   L YVS+ P
Sbjct  397   GGGIEAWINLDQNDMSMLESDGELLRYVSSNP  428



>gb|KDP26743.1| hypothetical protein JCGZ_17901 [Jatropha curcas]
Length=438

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 139/445 (31%), Positives = 227/445 (51%), Gaps = 32/445 (7%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDEl  1566
             +++ E+ S+E+V+PSSPTP+  K +   F +Q++  + +PFVFFY        +     L
Sbjct  4     SLQAEIISREMVKPSSPTPKHQKIHALCFFEQISSTIYVPFVFFYAKDTCPDRSHISYLL  63

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K SLS+TLS  YPLAGR K D +TV+CNDEG+EF    +  ++S + +N     IK L P
Sbjct  64    KGSLSETLSKYYPLAGRLK-DSVTVDCNDEGIEFFETRINCDLSYIFKNPNAETIKILIP  122

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
             +   Y+  P   +LV VQVN F CGG+ +   +SH IAD + L  F+  WA+  R    N
Sbjct  123   NDLEYK-DPFLSSLVIVQVNFFDCGGMGLTVCISHKIADMATLYSFINNWAAIAR----N  177

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEK-DMIVKRFVIPANAIAQLRQD  1029
             +G  ++S        PL +  ++   + +     E  EK   I +R +     IA L+  
Sbjct  178   SGKEYIS--------PLFNLGSLYPPIDLPVMSYEVPEKVKCISRRIIFDFPKIAILK--  227

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCM-----VNLRRRMEPPLPPNCL  864
              +I    +Q P+RVE +TAL++ + I+A  T + +L        ++LR  + PP+P N +
Sbjct  228   -SIIAKEIQDPTRVEVVTALIYKSAISAAKTVSRSLKPTILHQAIHLRSWVSPPVPENAM  286

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G L     +      D   +    +LV++ R      ++   +K+  E  +  + I    
Sbjct  287   GCLTG---IFPVPIMDESEIHQLAQLVRQTRQGKIRFREESKKKLVLEEFY--SFILECS  341

Query  683   ELVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVN-MLD-NSWVLFLDAING-AVEVW  516
             + VR   +  +Y  SSLC  ++Y  DFGWGKP  V + +LD  + ++ +D   G  +E +
Sbjct  342   KGVRESQNKNIYMCSSLCGFSFYVADFGWGKPTWVTHSILDARNIIMLIDTREGNGIEAY  401

Query  515   MKLPKQVMHTLTQDRHFLAYVSAFP  441
             + L +  M     ++  LA+    P
Sbjct  402   VSLEENEMAVFESNKELLAFAKINP  426



>ref|XP_004310028.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=442

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 151/453 (33%), Positives = 224/453 (49%), Gaps = 48/453 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + + VEV S+E V PSSPTP  L++++ SFLDQLA +  +PF++FY       HT     
Sbjct  1     MKIDVEVISQETVTPSSPTPHHLRHHQLSFLDQLAPHAYVPFLYFYSLPNTHSHTQISTH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQL  1392
             LKKSLSK L+  YPLAGR K + + VECND GV F  A V   ++S ++ N  + ++  L
Sbjct  61    LKKSLSKALTQYYPLAGRVKLN-LFVECNDFGVPFYEARVKSLSLSDVITNPSLPELNNL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++   +    + VQ+N F CGG+AIG   SH +AD  +   F++ WAS     A
Sbjct  120   LP----FKLDELKDIALGVQLNLFRCGGVAIGLCASHRVADGLSYFTFVKNWAS----AA  171

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQLR  1035
               N S      ++ +FPP             G  G+   +++ IV K FV     I  LR
Sbjct  172   CGNESVSPDFSAASIFPPKNMD---------GYNGVLIPKRNEIVTKGFVFDGLKIEALR  222

Query  1034  QDLT--ITGGSVQRPSRVEALTALVWAAVINATPTQTATLS-------CMVNLRRRMEPP  882
                   I   + + PSRVEAL+A +W   + A   +  + S        +++LR R +PP
Sbjct  223   SKYAEGIRLKTKKIPSRVEALSAFLWNKFMAAAAKEEGSSSRKLYAVVYIMDLRSRFDPP  282

Query  881   LPPNCLGTLVDEAI---VLCQEAKDGGTVVTAVELVQRIRDAF-RAVKDGEARKVYGEGG  714
             LP +  G     A     L    + GG V   +E +++I + + R  +DG    +     
Sbjct  283   LPQHSFGNYYRAATATPTLVNGEERGGLVRQVIEEIEKIDNKYMRKFQDGYKEHL----D  338

Query  713   WLRAVIARGY--ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFL  546
             ++R  + R    ELV      TL  SSLCR   YE DFGWGKP  V   +M  N+ ++F+
Sbjct  339   FMRRRMERAAKGELV------TLTFSSLCRFPLYEADFGWGKPEWVSMASMKINNQIVFM  392

Query  545   DA-INGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D  +   +E +    ++ M     D  FL  +S
Sbjct  393   DTKLGDGIESYFSFKEEDMAKFELDSEFLQLIS  425



>ref|XP_008226171.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=443

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 148/465 (32%), Positives = 225/465 (48%), Gaps = 60/465 (13%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHT-----DT  1578
             +KV+V  +E +RPSSPTP  L++   S  DQL   V +P + FY S  + HH+     + 
Sbjct  5     IKVDVSREETIRPSSPTPHHLRSSNLSVFDQLTPQVYVPLLLFYPSNNSDHHSPASAAER  64

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
                LK+SLS+TLS  YP AG  + + +++ CND G  F+ A V   MS +LE  ++G  K
Sbjct  65    SKLLKRSLSETLSHFYPFAGTIQSNDVSICCNDHGATFVEARVNCLMSKILEKPDLGIQK  124

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL P+   +  Q     L+ VQ N F CGG+AIG  +SH I DA  L KF+  WA+   G
Sbjct  125   QLHPNELEFMAQSGTCHLLLVQANFFECGGVAIGLNISHKIIDAYTLCKFINSWAAIALG  184

Query  1217  CAANNGSGFVSDH---------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
              A        +DH         ++ LFPPL         +      I+  +++ I +R+V
Sbjct  185   SAN-------TDHVVPPVEFGAAASLFPPL-------DFLNSPQPSIDFVKENCITRRYV  230

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT----ATLSC-MVNLR  900
               A+ IA L+        +V  P+RVE ++AL+W  V+ A+ + +     ++ C  VN+R
Sbjct  231   FDASKIAALKS--KAVSAAVPNPTRVEVVSALIWKCVMEASRSNSDFVRPSVWCQFVNMR  288

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             + +      N  G L+  ++   +E +    V +   LV ++R         E +  YG 
Sbjct  289   KILPQAPAENLSGNLLGYSVAKTEEREVEHDVKS---LVSKLRKGLE-----EFKVKYGN  340

Query  719   GGWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--------VVNM  573
             G     V  R  E   LV   D  T  ++S CR  +YE DFGWGKP          + NM
Sbjct  341   GISREDVFQRCIELSKLVGKVDIDTYCSTSWCRFPFYEADFGWGKPSWMSIPSTVEIKNM  400

Query  572   LDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +       +D  +G  +EV + L  + M  +  ++  LAY S  P
Sbjct  401   IS-----LVDVSDGIGIEVRLTLKDEDMAIIKSNQEMLAYASLNP  440



>gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa]
Length=424

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 145/440 (33%), Positives = 213/440 (48%), Gaps = 36/440 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA--CHHTDTIDE  1569
             M+V V S+EI++PSSPTP  LK   FS  DQ + +     +F+   G       T+T D 
Sbjct  1     MEVVVSSREIIKPSSPTPNHLKKLNFSLNDQYSTHYVSVLLFYSAQGDVDRFKQTNTSDR  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ L+  YPLAGR   +   ++CND+G+E++ A V   +S LL   +  ++ QL 
Sbjct  61    LKKSLSEILTQFYPLAGRIINNE-CIDCNDDGLEYLEARVPCPLSQLLGCPKADELNQLI  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P           + L AVQV+ F CGGIAIG  +SH   DAS+L  F+  WA+  +G   
Sbjct  120   P---------FSQKLSAVQVSLFDCGGIAIGVTISHTAGDASSLTAFINSWAATAKGANE  170

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQLRQ  1032
                  F  D+   LFPP  D   +      G   ++  +    V KRF+  ++ +A L+ 
Sbjct  171   IVPPKFGFDY---LFPP-RDVPTV----SFGGGAVDYTQLPRFVGKRFIFDSSKLAALKS  222

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVIN---ATPTQTATLSCMVNLRRRMEPPLPPNCLG  861
                     V+RP+RVE +TA ++   +N   +  ++ + LS  +NLR RM PPLPP+  G
Sbjct  223   ----ACADVERPTRVEVVTAFIYKCFLNTIRSRSSKPSVLSMPINLRGRMNPPLPPHSFG  278

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR----AVIA  693
              L   AI L  +            LV+++R+  R V  G   K+  +   L         
Sbjct  279   NL---AIRLTSQPWPAEKEPELNCLVKQLRETIRKVNGGFVEKLQADNAELLFEHWKDWK  335

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAING-AVEVW  516
             +G EL    D + L     CR  +YE DFGWGKP     +     V  +D  +G  VE W
Sbjct  336   KGIELSLTGDLNVLMVLICCRFPFYEADFGWGKPAWATRVNLYPSVSLVDTKDGEGVEAW  395

Query  515   MKLPKQVMHTLTQDRHFLAY  456
             + L +  M     +   L +
Sbjct  396   VTLAEGDMTRFCSEPDLLDF  415



>gb|EYU22560.1| hypothetical protein MIMGU_mgv1a020007mg [Erythranthe guttata]
Length=430

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 148/427 (35%), Positives = 211/427 (49%), Gaps = 24/427 (6%)
 Frame = -3

Query  1706  PSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkkslsktlsLMYP  1527
             PSSPTP+SL+ Y  SFLDQ+A    +P V+FY       ++   D LKKSLS+ LS  +P
Sbjct  13    PSSPTPKSLEKYHLSFLDQIAPPTFMPLVYFYSPHTKYTNSQKSDHLKKSLSEALSTFHP  72

Query  1526  LAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPSAKFYEPQPVGKA  1347
             LAGR       V+C D+G  F  A V  ++S  + N     + +  P    YE   +   
Sbjct  73    LAGRLVAGDAYVDCRDQGAPFFEAQVNCDLSQAITNPIPRNMNKFLP----YELNDLQNL  128

Query  1346  LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSDHSSIL  1167
              VAVQ   F CGG+A+G  VSH IADA +   F   WA+  R  +A          ++++
Sbjct  129   GVAVQATYFRCGGVAVGVLVSHKIADALSFFLFANAWAAAARNESAAAAPPVF--EAALI  186

Query  1166  FPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQ-RPSR  990
             FPP  D +      K G   +++ E D   K F  PA+ I+ LR+  +    + + RP+R
Sbjct  187   FPP-RDVAG----YKPGTGIVKEGELD--TKIFTFPASKISDLRERYSAAAAAGERRPTR  239

Query  989   VEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQE  825
             VEAL+A +W   I+AT     P +  T+   VNLR R+EPPL  N  G +   AI +   
Sbjct  240   VEALSAFIWTRFISATEMKPEPNKIYTVLHAVNLRNRLEPPLSDNHFGNISRLAIAV-PA  298

Query  824   AKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSSTLYT  645
               DGG++    EL+Q++R+A  AV +GE      EG      +          +  T   
Sbjct  299   VDDGGSIDGGYELMQKVREAIGAV-NGEYVARLREGDKHLNFLKERMAQANKSELVTFNF  357

Query  644   SSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQD  474
             +SLCR   YE DFGWGKP  V +  M   + V  +D   G  +E W+ L K+ M     D
Sbjct  358   TSLCRFPLYEADFGWGKPVRVGSAVMSYKNLVTLMDTATGNGIEAWINLKKEDMVKFEAD  417

Query  473   RHFLAYV  453
                  ++
Sbjct  418   LELQEFI  424



>ref|XP_004301806.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=423

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 145/446 (33%), Positives = 221/446 (50%), Gaps = 40/446 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTI  1575
             +  + EV SK I++P+SPTP+ L++Y+FSFLDQ++  V  P + FY          T+  
Sbjct  1     MKFEAEVISKHIIKPASPTPDHLRHYQFSFLDQISPPVYSPLLLFYEFNAKIQPNITEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             + LK SL+K LSL YPLAGR K+++  V+CND GV ++   V   +S +L N   G++ +
Sbjct  61    NHLKTSLAKVLSLYYPLAGRFKDNQY-VDCNDNGVPYLEVQVNCKLSDVLNNPIPGELNK  119

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P   F       K  + VQ+N F CGG AI   ++H +AD  +   F + WA+  RG 
Sbjct  120   LMP---FELDDVANKYPLGVQLNIFQCGGFAIAQCLTHKLADGLSYFTFSKTWAATARGE  176

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    F+   S+ LFPP   +         G +      ++ + KRFV  A+ I +LR
Sbjct  177   PKIEHPQFI---SATLFPPRNLS---------GFDARTGITRNKVSKRFVFSASDIEELR  224

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
             +       +  RPSRVEAL++ + +  + AT     P +   +   VNLR R EPPLP +
Sbjct  225   E--VQANKASARPSRVEALSSFILSRFVEATKDIGSPDKFYRVVHAVNLRSRFEPPLPHH  282

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV--I  696
               G L   A+        G       E    IR+    + +   RK+      L ++  I
Sbjct  283   SFGNLYRVAMTAPLRISSG-------EPFHGIREEISKIDNAYVRKLQKGDEHLSSIKTI  335

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAIN-GAV  525
             A+ +      +  T+  SS CR   Y+ DFGWG+P  V +  +   + V F+D    G +
Sbjct  336   AKSFA---KGEQVTISFSSYCRFPLYDNDFGWGRPTWVGSPALTFKNLVNFMDTREGGGI  392

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSA  447
             E ++ L ++VM     D   LAYVS+
Sbjct  393   EAYISLEEEVMTKFESDVELLAYVSS  418



>gb|KDP36822.1| hypothetical protein JCGZ_08113 [Jatropha curcas]
Length=696

 Score =   193 bits (490),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 148/462 (32%), Positives = 230/462 (50%), Gaps = 47/462 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++EV S+E ++P S TP  L+ YK S LDQL  +  +P +FFY           +  LK
Sbjct  1     MEIEVFSRESIKPPSLTPSHLRTYKLSLLDQLMPSAHVPIIFFYRPIDQPVIPARLQRLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
              SLS+ L+  YP AG+ K+D + ++CND+GV +  A V+  +S +L + +   I +L P 
Sbjct  61    HSLSQALTSFYPFAGKIKDD-LYIDCNDDGVSYTEAKVSSFLSDILGHPDTKTIFKLLPD  119

Query  1382  AKFY---EPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
               +      +  G  +  +QVN F CGGIAIG   SH I D      F++ WA+  RG  
Sbjct  120   DSYLLETYNEGNGIPVAMIQVNVFKCGGIAIGTKTSHKIIDGPTSTSFLKAWAAIARGSG  179

Query  1211  A-------NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
                        S F  +HS    P  T  +    L+K G           ++KRFV  ++
Sbjct  180   ELVVQPSFTAPSLFPQNHS---LPKDTLLAVWPSLVKFGKG---------VMKRFVFDSS  227

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRME  888
             AIA L+   + +   VQRP+RVEA++A +W   + A+  +  +     LS  VNLR +  
Sbjct  228   AIATLKARAS-SSSFVQRPTRVEAVSAFIWQCTMVASEKRNGSYKPSVLSHTVNLRGKKT  286

Query  887   PPLPPNCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
               LP + +G L+  +I   C EA+    V     LV  +R++   +     +K+ GE G+
Sbjct  287   VHLPESSVGNLLWMSIAKCCTEAERELHV-----LVGLLRESILKIDSNFVQKLSGEEGF  341

Query  710   LRA--VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP------RLVVNMLDNSWV  555
              +    +    E+  N  +  L  SSLC++  YE DFGWGKP       ++  +  N  +
Sbjct  342   YKVCECLQEFSEVYSNAGADYLTFSSLCKVGIYETDFGWGKPIWVSPGGVIGPVFQN--L  399

Query  554   LFLDAING--AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +FL+  +G   +EVW+ L +Q M  L  + H L++ S  P P
Sbjct  400   VFLNETSGGDGIEVWLTLDEQDMAILELETHILSFSSLDPSP  441


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 117/258 (45%), Gaps = 22/258 (9%)
 Frame = -3

Query  1466  FIVADVAENMSSLLENFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFV  1287
             +I A     +S  L   ++  +++L P        P G  +  +Q   F+CGG  IG + 
Sbjct  448   YIEATSNITLSQYLAKPDLALLRKLLPDIICEYELPSGSHIALIQETTFACGGFTIGIYA  507

Query  1286  SHAIADASALAKFMEIWASFNRGCAANNGSGFVSDHSSILFPPLTD-TSAIEQLMKMGAE  1110
             SH   D ++L  F++ WA+    C +     +++     +FPP T   S +     M A 
Sbjct  508   SHMFCDGASLFLFLKDWAA--TTCKSPTKHPYLAAEG--IFPPYTAFPSGVSFFTTMYAP  563

Query  1109  GIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT  930
              +++ +  +   R V   +AI  L+   ++       P+RVE +TA +   +I +   +T
Sbjct  564   FVKKGKYTL--NRIVFNESAITNLKAKASLNN---INPTRVEVVTAFLSKCLIASFKNKT  618

Query  929   A-----TLSCMVNLRRRMEPPLPPNCLGTLVDEA-IVLCQEAKDGGTVVTAVELVQRIRD  768
                    +   VNLRR+ +PPLP + LG ++  A  V   + K+       +ELV  +R+
Sbjct  619   GIDKPLAICHAVNLRRKADPPLPESLLGNIISFAGAVFTTKEKE------LIELVSELRE  672

Query  767   AFRAVKDGEARKVYGEGG  714
               + V +   +K+   GG
Sbjct  673   EMKKVDNDFLKKIKSGGG  690



>ref|XP_010046626.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86590.1| hypothetical protein EUGRSUZ_B03222 [Eucalyptus grandis]
Length=434

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 145/446 (33%), Positives = 218/446 (49%), Gaps = 36/446 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV---SGRACHHTDT  1578
             + + VE+ S+E ++PSSPTP+ L++Y+ SFLDQ++  V  PFV FY     G   +  D 
Sbjct  1     MEIAVEITSRETIKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEGDQSNIDDL  60

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
               +LK SLS  L+  YPLAGR + + +++EC+D GV +  A V   +S   EN +  +++
Sbjct  61    SSKLKASLSIILTHFYPLAGRLRGN-VSIECDDAGVPYSEAIVKCQVSEFTENPDPRELR  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              L P    +      +  + VQ NRF CGGIAIG  +SH I+DA +L  F+ +WA+  RG
Sbjct  120   NLVP----FVLDASDETTLGVQFNRFDCGGIAIGICMSHKISDALSLLTFINMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQ  1041
                     F S     LFPP            +G E      +D IV KRFV   + I  
Sbjct  176   EEILAPPQFPSAE---LFPPKN---------ILGFEPSTGIIRDNIVSKRFVFKTDKIEN  223

Query  1040  L--RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPP  882
             L  R    +     + PSR+EAL+  +W+       + + P++   +   VNLR + +PP
Sbjct  224   LKARYSKEMDLDRNRPPSRIEALSTFIWSRFAWSTRVYSEPSKKCIVLHAVNLRTKFDPP  283

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP    G     A+   Q   D G       LV ++R+  R +  G   K+  +G     
Sbjct  284   LPQYSFGNFYRVAVTSLQ--LDSGKECYG--LVAKMRETLRGIDKGYVEKLR-DGKEHLD  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-  531
              I R  E+        +  +SLCR   YE  FGWG P  V +  +   + V+F+D  +G 
Sbjct  339   FIKRSAEVYLKGQLLAMNFTSLCRFPVYESSFGWGNPTWVGSPALTFQNLVVFMDTKSGD  398

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYV  453
              VE ++ L  + M  L  D  F+ +V
Sbjct  399   GVETYISLRVEDMAALESDEEFMEFV  424



>gb|KEH20541.1| 3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase [Medicago truncatula]
Length=436

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 141/448 (31%), Positives = 228/448 (51%), Gaps = 29/448 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+E ++PSSPTP  L+N+  SF+D ++    +P +FFY   + C  T  I  LK
Sbjct  1     MEMEIISREFIKPSSPTPSHLRNFPISFIDHISFRNYVPLLFFYDDTKVCDQTSKISHLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVA-ENMSSLLENFEIGKIKQLTP  1386
              SLS+ LS+ YP AGR K D++++ECND+G  F+VA++A   +S++L+N     +  L P
Sbjct  61    NSLSQILSIYYPFAGRFK-DQLSIECNDQGASFLVANIAGTKLSTILKNPTENLLNPLFP  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
                 ++      +++ +Q+N F+CGGI I     H I DA+    FM  WA  N    +N
Sbjct  120   DELQWKNMDCNGSILVIQINCFACGGIIISVCACHKIVDAATAFNFMNDWAKLNSEGESN  179

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
             + S  +S   ++L+    DT   +  +    E     +K ++ KRFV  A+ +  L+  +
Sbjct  180   SKST-LSLPYNLLYA--GDTIFSQGSLPNFPECEFVIDKTIVSKRFVFEASKVKLLKSMM  236

Query  1025  TITGGS-VQRPSRVEALTALVWAAVINATPT--QTATLSCMVNLRRRMEPPLPPNCLGTL  855
               +  + V+ P+RVE +TA+++  V++A     +T +L   V+LRRRM PPL    +G +
Sbjct  237   VNSDSNEVKNPTRVEVVTAMIYKCVVSALELNFKTTSLRMAVDLRRRMVPPLSDKSVGNI  296

Query  854   VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELV  675
             V    ++  E  D         LV +IR       +   +K  G+   L + I    + V
Sbjct  297   VWFLFLINPELHD---------LVFKIRQGLHEFCEVYPKKFGGKEKDL-SFIFECLKQV  346

Query  674   RNRDSSTLYTSSL------CRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING-AV  525
                 S + Y  SL      C+   YE DFGWGKP  V      + N+ VL +D  NG  +
Sbjct  347   TTPVSESDYNQSLIVYASWCKFPMYEADFGWGKPIWVTTSTCPVKNAIVL-MDTRNGDGI  405

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E  + + +  M    ++   L Y S  P
Sbjct  406   EAIVNMKESDMVRFEREVELLQYASLNP  433



>ref|XP_010051001.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81034.1| hypothetical protein EUGRSUZ_C02410 [Eucalyptus grandis]
Length=440

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 221/463 (48%), Gaps = 50/463 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI--  1575
             +  K+EV S E ++PSSPTP  L+N+ F  LDQLA +  +P V FY++       D+   
Sbjct  1     MATKIEVVSTETIKPSSPTPPHLRNFNFCLLDQLAPSFYVPVVLFYLAPDQKAAPDSALV  60

Query  1574  -DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
                LK SL++ LSL YPL GR K +   ++CNDEG  ++ A     +S +L N +I +++
Sbjct  61    SGYLKTSLAQALSLFYPLGGRVKGN-AGIDCNDEGALYMEAKARFELSKVLSNPDIDQLQ  119

Query  1397  QLTPSAKFYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             Q  P    + P  V      + +V VQ N F CGG+ IG  +SH IAD ++++ F+  W+
Sbjct  120   QFLP----FSPSRVSTNINEQVIVGVQANFFDCGGMGIGICISHKIADGASVSAFLNAWS  175

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAE---GIEQEEKDMIVKRFVI  1062
                    ANNG     D  + L  P    S + Q   +  +   G+   EK +  KRF  
Sbjct  176   EI-----ANNG----VDGEASLITPFLKASELFQPKDINYQIPSGVISREK-LSTKRFCF  225

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----------PTQTATLSCM  912
                ++A+LR      GG+   P+RVEA+TAL+W + + A           P  +A +   
Sbjct  226   NGESLARLRAGF---GGA--NPTRVEAVTALIWKSALAAARKRPEWKEKYPPSSAVIHA-  279

Query  911   VNLRRRMEP-PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
             VN+R R+ P PLP   LG LV   +    E   G  +    +    +R++ RA+      
Sbjct  280   VNIRSRIRPQPLPETTLGNLVQAVVAPLMEPNKGDEL---QDFAGTLRNSIRAIDSEYLS  336

Query  734   KVYGEGGWLRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM--LD  567
              + GE G  +A   +    +L  +        SS  R  +YE DFGWG+P  V  +  + 
Sbjct  337   ALQGENGLAKACENLMATRKLAASSAIELYRFSSWARFPFYEADFGWGRPAWVCTIAPIK  396

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             N  +L        +E W+ L +  M     +   L +VS  P+
Sbjct  397   NLVILMGTRCGDGIEAWITLAEHDMIEFEHNDELLQFVSPNPR  439



>ref|XP_009342768.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=444

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 146/449 (33%), Positives = 221/449 (49%), Gaps = 35/449 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTIDE  1569
             ++VEV S E ++PSSPTP+ L+ +K SFLDQ+   + +P V F+          T+   +
Sbjct  4     LEVEVVSTETIKPSSPTPDHLRRHKLSFLDQIQPPIFMPMVLFFPKDPHTPEVPTERCTK  63

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             +K +LS+TL+  YPLAGR +  +  V+CNDEG  ++ A    N+  +++N       +  
Sbjct  64    IKTALSETLTNFYPLAGRVRGTQY-VDCNDEGAYYVEAKANSNIIDIIQNPNPIDFNKFI  122

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P A         +  + +QV  F+CGG++IG  +SH + DA +   F+   A+  RG   
Sbjct  123   PCAL----DAASELPICLQVTFFACGGMSIGMGMSHKVGDALSYFMFLNSLAATTRGEPD  178

Query  1208  N-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR-  1035
               +   FVSD     + P  D S   Q     + GI +   ++  KRFV  A A++ LR 
Sbjct  179   YVHAPEFVSDK----YFPQQDLSGSYQ----HSSGIIKH--NISTKRFVFDAPAVSALRA  228

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-------TLSCMVNLRRRMEPPLP  876
             Q   +     +RP+RVEAL+A +W   I A  T+ A       T+S  VNLR RM+PPLP
Sbjct  229   QSTDVENEQARRPTRVEALSAFIWRRYIAAC-TRRADDVPAMYTVSHAVNLRTRMDPPLP  287

Query  875   PNCLGTLVDEAIVLCQ---EAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARKVYGEGGWL  708
                 G +    I +     E K+G +   ++  +V  +R+A + V D E  K   EG   
Sbjct  288   EYTFGNVTRTTISVPPIQVEPKEGSSSDPSLYSVVSHVREALKQV-DREYIKKLQEGEAF  346

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
              + +      V+  D  +   +SLCR   Y+ DFGWGKP      +    + V F D  +
Sbjct  347   LSFLKERSSQVKRGDVVSFSFTSLCRFPIYDADFGWGKPVYAGSASFTFKNLVSFFDTTS  406

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                VE W+ L K+ M     D   L YVS
Sbjct  407   ADGVEAWINLKKEDMEKFEADEEVLKYVS  435



>ref|XP_010682887.1| PREDICTED: vinorine synthase-like [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 139/445 (31%), Positives = 227/445 (51%), Gaps = 32/445 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACH-HTDTIDEl  1566
             M+VE+ SKE ++PS PTP   K Y+ S LDQL+ ++ +P + FY +        D   +L
Sbjct  1     MEVEIISKEAIKPSKPTPSHCKLYRLSSLDQLSPSIYVPILLFYEAPTTPQKRADLSSQL  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K SLS+TL+  YP AGR K D   ++C+DEG  FI A    N+  +L   ++  +  L P
Sbjct  61    KSSLSETLTYYYPFAGRIK-DGSYIDCDDEGSLFIEAQAKNNLVDILTFPKLEALDVLFP  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               K ++      +++AVQ++ F CGG++IG  +SH IADA  +  F+  WAS  R    +
Sbjct  120   DEKQWK-SSRNSSVLAVQLSYFDCGGLSIGICISHKIADACTIFTFLNDWASQARKSGES  178

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
                 F   +++ +FPP  D   I +L        E  + +++ +R+V     I++L+  +
Sbjct  179   ICPLF---NTTSIFPP-NDEFVIPEL--------EFVKSNVVTRRYVFHPTKISELKATI  226

Query  1025  TITGGSVQRPSRVEALTALVWAAVINATP------TQTATLSCMVNLRRRMEPPLPPNCL  864
                  S+  P+RVE +T+L++ ++I AT        ++  L+  VN+R RM PPL  N +
Sbjct  227   VSNSNSLHNPTRVEVVTSLIFNSIIQATKIRSFGLVKSYVLAQTVNMRSRMVPPLVRNSM  286

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G +V    V+ ++ +D    ++   L  ++R+    + D  A+ V G+  WL    A   
Sbjct  287   GNIVWYFPVMIKDNED----ISLERLATQMREGLVKLCDF-AKNVEGK-DWLLMAAASEN  340

Query  683   ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING-AVEVW  516
                 +  +     SS C+   Y+VDFGWG P  V        N+ +  +D  +G  +E W
Sbjct  341   NGSEHSMNDAYKISSWCKYPVYQVDFGWGNPMWVSTAEYPYKNN-IFLIDCKDGEGIEAW  399

Query  515   MKLPKQVMHTLTQDRHFLAYVSAFP  441
             + L + VM  L  D  FL + S  P
Sbjct  400   VTLDEDVMFILQGDEEFLKFASLNP  424



>gb|KDO82048.1| hypothetical protein CISIN_1g012688mg [Citrus sinensis]
Length=458

 Score =   188 bits (477),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 224/466 (48%), Gaps = 49/466 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV----SGRACHHTDTI  1575
             MKVE+ SKE ++PSSPTP  LK+YK S LDQ+A       + FY       R  HH  ++
Sbjct  9     MKVEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHHHHISV  68

Query  1574  DElkkslsktlsLM-------YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
              +  K   +    +       YPLAGR K D IT++C+D G  ++ A V   +  LL+  
Sbjct  69    YKANKLSLQLKQSLSETLTRFYPLAGRVK-DNITIDCSDHGAVYVEAQVNCLLQDLLKQP  127

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
                 + QL P     E +P    L+ VQ + F+CGG+AIG  +SH IADA+ +  F+  W
Sbjct  128   NGDSVIQLVPIQLAEESKP--GLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSW  185

Query  1235  ASFNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A    G AA +     + S ++S LFPP  D +A   L       +  +EK    KRFV 
Sbjct  186   A----GAAAGDHRRVYYPSYNASSLFPP-RDVTATAMLFLNPPFNMAMKEK-CFTKRFVF  239

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
                 IA L   L+         +R EA+TAL+W   +NA+ + +     + LS  V++R+
Sbjct  240   YGPKIAALEAALSAPS------TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRK  293

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
                PPLP N +G LV        E+      +    LV+ +R+  +       +K+  E 
Sbjct  294   ITVPPLPDNSVGNLVGYYASQKDESD-----IQLQGLVRELREGIQDFSKSYLQKLQRED  348

Query  716   GWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS-----  561
               L A+     +   ++ + D      +SLC ++ Y++DFGWG P  V N+  N+     
Sbjct  349   A-LEAITESCKDAIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAPNHKN  407

Query  560   WVLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              V  +D+   +G++E W+ L +  M    +D   L Y + F  P +
Sbjct  408   LVGLIDSSTGDGSIEAWVTLSEADMALFERDPDLLCYAATFDYPSV  453



>ref|XP_008383113.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=506

 Score =   189 bits (480),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 141/444 (32%), Positives = 207/444 (47%), Gaps = 32/444 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFV-FFYVSGRACHHTDTIDEl  1566
             +KVEV SKEI++PSSPTP  L +Y+FSFLDQ+   V    V FF  +G      + I + 
Sbjct  4     IKVEVISKEIIKPSSPTPNHLSHYQFSFLDQINPPVYTSLVLFFEFNGERQPTINEISQH  63

Query  1565  kkslsktlsLM-YPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQL  1392
              K     +  + YPLAGRA+ +   V CNDEGV ++ A V    +S +L N    ++ +L
Sbjct  64    LKKSLAYVLTLYYPLAGRARLENHFVNCNDEGVPYLEAQVKNCQLSEVLNNPIPEELNKL  123

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P   F      G+ ++ VQ+N F CGG AIG   SH IAD  ++  F + WA+  RG  
Sbjct  124   VP---FELDDVAGEFILGVQLNMFECGGFAIGLCTSHKIADGLSMLMFTKTWAAIARG--  178

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                G     + + I  P     S        G +      +  + KRFV  A+ I +LR+
Sbjct  179   ---GHDHDDNQAKIERPEFVSASLFPPKEITGYDAHVGITRKKVTKRFVFDASTIEELRK  235

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATP--------TQTATLSCMVNLRRRMEPPLP  876
               T    +  RPSR+E L+A +W  ++ A           +   L   VNLR RM+PPLP
Sbjct  236   KYTGLESNKIRPSRIEILSAFIWRRIVEAAKGGDHIDVENKLHMLIHAVNLRPRMDPPLP  295

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVT---AVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
              +  G +    I +        T +       +V+ IR+A   + D E  K   EG    
Sbjct  296   RSSFGNIC--LISMTGPFTSSNTSLDNDPCYGMVRHIREAMSKI-DNEYVKRLQEGDEHL  352

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING  531
             + + +  +        T   +SLCR   Y+ DFGWG+P  V    +   + ++FLD    
Sbjct  353   SSVKKLADSFTREHLVTYNFTSLCRYPLYDNDFGWGRPTWVGLPALTFKNLIVFLDTKEA  412

Query  530   -----AVEVWMKLPKQVMHTLTQD  474
                   +E ++ L KQVM     D
Sbjct  413   GGGGRGIEAYVSLEKQVMAKFETD  436



>ref|XP_007134039.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris]
 gb|ESW06033.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris]
Length=432

 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 227/448 (51%), Gaps = 35/448 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +KVE+ SKE V+ SSP P  LK++K S LDQLA    +P + FY +  A   T     
Sbjct  1     MEVKVEIVSKERVKASSPPPNKLKHFKLSLLDQLAPPFYVPVLLFYSASDATDITTISHN  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLS+ L+L YP  G  + D  TVECN EGV F  + +  ++S++L+N  + +I QL 
Sbjct  61    LKASLSQLLTLYYPFCGTLR-DNSTVECNHEGVLFTHSTLPIHLSTILKNPHLHRINQLF  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +   +      + VQ+N+FSCGG+A+    SH IADAS+ A F+  WA+ +R    
Sbjct  120   PLDPYNPARDTLLETMVVQLNQFSCGGVALAVCFSHKIADASSAASFLTAWAATSRK-EE  178

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             N       +  +++FPP      IE  +  G  G     KD++ KRF+     I++L+Q 
Sbjct  179   NILIAPQMEEGALVFPP----RKIEMDITRGMVG----HKDIVTKRFMFNRTNISRLKQK  230

Query  1028  LTITGGSVQ-RPSRVEALTALVWAAVINATPTQT-------ATLSCMVNLRRRMEPPLPP  873
             +    GS++  P+ VEA+TAL+W + + A    +       + +S  VN+R RM   L  
Sbjct  231   V----GSLEFFPTSVEAVTALIWKSSLEAAKASSEEGKFPASMVSHAVNIRSRMASTLGK  286

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             + +G L  +A+    E +     V   +L +R+R+  R V      K+ G+  +    + 
Sbjct  287   HSMGNLWQQAVSPLVEVEGE---VGLRDLGERVRETIRKVDGNYVSKLQGDEFY---EVI  340

Query  692   RGYELVRNRDSST---LYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING  531
              G +  R   S      Y+ SS  R   YE DFGWGKP  V  + +   + V F+    G
Sbjct  341   EGLKEARRMASEKGVPCYSFSSWVRFGLYETDFGWGKPSYVSRIGVPIKNVVSFMPTKGG  400

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +E W+ L K  M    Q++  L +VS
Sbjct  401   DGIEAWISLTKPHMLHFEQNQELLQFVS  428



>ref|XP_004143047.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Cucumis 
sativus]
 gb|KGN62352.1| hypothetical protein Csa_2G350350 [Cucumis sativus]
Length=447

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 153/462 (33%), Positives = 232/462 (50%), Gaps = 43/462 (9%)
 Frame = -3

Query  1760  LSLQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV-----SGRA  1596
             +SLQ    +++ S +I++PSSPTP +L  +  S  DQLA +  +P +FF+      SG  
Sbjct  4     MSLQ---HLQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLLFFFSHHGPSSGTY  60

Query  1595  CHHTDTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADV-AENMSSLLEN  1419
               HT T++ L++SLS TLS  YPLAGR K D+++++CNDEGV F+ A +    +S +LEN
Sbjct  61    YDHT-TVELLRQSLSTTLSRYYPLAGRIK-DKVSIDCNDEGVTFVEARLEGVTVSKILEN  118

Query  1418  FEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
                  +++L      ++   +G +L+ VQ+  F CGG++IG  +SH + D + L KF++ 
Sbjct  119   PRSEIVEKLFVDGLQWKDSKMG-SLLKVQITLFECGGLSIGVLLSHKLGDLATLVKFIQD  177

Query  1238  WASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             W    R    NNG     D   I+ P                 G   EE +   KRFV  
Sbjct  178   WGVITR----NNG---FCDEEEIINPLFFSGDLFPHGDLPAMSGAVIEEGNFTCKRFVFE  230

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-------LSCMVNLR  900
              + I  L+  ++     VQ PSRVE ++AL++ A+I+A+ T   +       L   +NLR
Sbjct  231   GSKIESLKNRIS---EKVQNPSRVEVVSALIYKAIISASRTNNNSQNHPATLLLQTLNLR  287

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +R+ PPLP   +G+LV    V     ++   VV   ELV  +R       +  A+K Y  
Sbjct  288   KRVAPPLPDTLVGSLVSFFPVGVDGERE---VVELHELVGTMRKEMGEFCEKYAKK-YRT  343

Query  719   GGWLRAVIARGYE----LVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVN---MLDN  564
               WL  +  R  E    L +N ++  +Y  SS C    YEVDFGWG    +      + N
Sbjct  344   KEWLELIKKRLNESREILSKNGNNQLVYRCSSGCNFPIYEVDFGWGAADWITMPAFKMKN  403

Query  563   SWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             + V+ LDA NG  +E  + L    M     +   LA+ S  P
Sbjct  404   T-VMMLDAKNGRGIEALVSLQDGEMAAFQDNEELLAFASLNP  444



>ref|XP_006484024.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=450

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 223/466 (48%), Gaps = 49/466 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV----SGRACHHTDTI  1575
             MKVE+ SKE ++PSSPTP  LK+YK S LDQ+A       + FY       R  HH  ++
Sbjct  1     MKVEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHHHHISV  60

Query  1574  DElkkslsktlsLM-------YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
              +  K   +    +       YPLAGR K D IT++C+D G  ++ A V   +  LL+  
Sbjct  61    YKANKLSLQLKQSLSETLTRFYPLAGRVK-DNITIDCSDHGAVYVEAQVNCLLQDLLKQP  119

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
                 + QL P     E +P    L+ VQ + F+CGG+AIG  +SH IADA+ +  F+  W
Sbjct  120   NGDSVIQLVPIQLAEESKP--GLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSW  177

Query  1235  ASFNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A    G AA +     + S ++S LFPP  D +A   L       +  +EK    KRFV 
Sbjct  178   A----GAAAGDHRRVYYPSYNASSLFPP-RDVTATAMLFLNPPFNMAMKEK-CFTKRFVF  231

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
                 IA L   L+         +R EA+TAL+W   +NA+ + +     + LS  V++R+
Sbjct  232   YGPKIAALEAALSAPS------TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRK  285

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
                PPLP N +G LV        E+      +    LV+ +R   +       +K+  E 
Sbjct  286   ITVPPLPDNSVGNLVGYYASQKDESD-----IQLQGLVRELRKGIQDFSKSYLQKLQRED  340

Query  716   GWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS-----  561
               L A+     +   ++ + D      +SLC ++ Y++DFGWG P  V N+  N+     
Sbjct  341   A-LEAITESCKDAIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAANHKN  399

Query  560   WVLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              V  +D+   +G++E W+ L +  M    +D   L Y + F  P +
Sbjct  400   LVGLIDSSTGDGSIEAWVTLSEADMALFERDPDLLCYAATFDYPSV  445



>ref|XP_009371390.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=450

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 140/453 (31%), Positives = 221/453 (49%), Gaps = 44/453 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKVEV  KE +RPSSPTP  LK    S  DQL  ++ +PF+ FY +    H +   +  K
Sbjct  5     MKVEVIHKEAIRPSSPTPHYLKTTNLSVFDQLIPDIYVPFLLFYPNNNTDHRSLAAERSK  64

Query  1562  kslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
                +    ++   YP AG+   +  ++ CND GV F+ A V   +S +L+  +IG +KQL
Sbjct  65    ILKTSLSEILTHFYPFAGKFHYND-SICCNDHGVAFLEAQVNCPISKILDKADIGMVKQL  123

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-----  1227
              P A     Q V   L+ VQ N F CGG+AIG  ++H +ADAS ++ F++ WA       
Sbjct  124   LP-ADMASRQAVTGYLLLVQANFFECGGMAIGVSIAHKVADASTISTFIKRWAEIALDST  182

Query  1226  ---NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                N  C A   + F    S  LFPP       + ++      +E  ++  I + ++  A
Sbjct  183   SRPNTDCEAVLPAEFGVAAS--LFPP-------QDILNAPQPTLEFPKEKYITRTYLFDA  233

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS----C-MVNLRRRM  891
             + IA L+        +V +P+R+E ++AL+W   + A+ ++  ++     C  VN+R  +
Sbjct  234   SKIAALKS--KSASATVPKPTRIEVVSALIWKCAMEASKSKFGSIRPSAWCHAVNMRNVL  291

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVYGE  720
               P   N LG LV + I     A+ G + V  ++   LV ++R      K   A  V G+
Sbjct  292   VRPSAENLLGNLVGKFI-----ARAGESEVVDLDLQSLVGKLRKGIEEFKVKYANNVTGD  346

Query  719   GGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFL  546
                      + Y  +   D   +YT SS CR  +Y  DFGWGKP  V   L+  + ++ +
Sbjct  347   A----CESLKEYGDLLQMDDIEIYTCSSWCRFPFYAADFGWGKPSWVNQSLEGKNLIVLM  402

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D  +G  VEV +   ++ M  +  ++  LAY S
Sbjct  403   DVRDGDGVEVSLTFNEEDMAIIESNKKLLAYAS  435



>ref|XP_010044501.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86587.1| hypothetical protein EUGRSUZ_B03219 [Eucalyptus grandis]
Length=434

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 145/446 (33%), Positives = 216/446 (48%), Gaps = 36/446 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV---SGRACHHTDT  1578
             + + VE+ S+E ++PSS TP+ L++Y+ SFLDQ++  V  PFV FY     G   +  D 
Sbjct  1     MEIAVEITSRETIKPSSLTPDHLRHYRLSFLDQISPPVYNPFVLFYTPKKEGGQSNIDDI  60

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
               +LK SLS  L+  YPLAGR K + +++EC+D GV +  A V   +S   EN +  +++
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDAGVPYSEAIVKCQVSEFTENPDPRELR  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              L P    +      +    VQ NRF CGGIAIG  +SH IADA +L  F+ +WA+  RG
Sbjct  120   NLVP----FVLDASDETTFGVQFNRFDCGGIAIGICMSHKIADALSLLTFINMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQ  1041
                     F S     LFPP            +G E      +D IV KRF+   + I  
Sbjct  176   EEIVAPPQFPSAE---LFPPKN---------ILGFEPSTGIIRDNIVSKRFIFKTDKIEN  223

Query  1040  L--RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPP  882
             L  R    +     + PSR+EAL+  +W+       + + P++   +   VNLR + +PP
Sbjct  224   LKARYSKEMDLDRNRPPSRIEALSTFIWSRFAWSTRVYSEPSKKCIVLHAVNLRTKFDPP  283

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP    G     A+   Q   D G       LV ++R+  R +  G   K+  +G     
Sbjct  284   LPQYSFGNFYRVAVTSLQ--LDSGKECYG--LVAKMRETLRGIDKGYVEKLR-DGKEHLD  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-  531
              I R  E+        +  +SLCR   YE DFGWG P    +  +   + V+F+D  +G 
Sbjct  339   FIKRSAEVYLKGQLLAMNFTSLCRFPVYESDFGWGNPTWAGSPALTFQNLVVFMDTKSGD  398

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYV  453
              VE ++ L  + M  L  D  F+ +V
Sbjct  399   GVETYISLRVEDMAALESDEEFMEFV  424



>ref|XP_007134037.1| hypothetical protein PHAVU_010G014100g [Phaseolus vulgaris]
 gb|ESW06031.1| hypothetical protein PHAVU_010G014100g [Phaseolus vulgaris]
Length=432

 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 141/445 (32%), Positives = 221/445 (50%), Gaps = 29/445 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +KVE+ SKE V+ SSP P  LK++K S LDQLA    +P + FY +  A   T     
Sbjct  1     MEVKVEIVSKERVKASSPPPNKLKHFKLSLLDQLAPPFYVPVLLFYSASDATDITTISHN  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLS+ L+L YP  G  + D  TVECN EGV F  + +  ++S++L+N  + +I QL 
Sbjct  61    LKASLSQLLTLYYPFCGTLR-DNSTVECNHEGVLFTHSTLPIHLSTILKNPHLHRINQLF  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +   +      + VQ+N+FSCGG+A+    SH IADAS+ A F+  WA+ +R    
Sbjct  120   PLDPYNPARDTLLETMVVQLNQFSCGGVALAVCFSHKIADASSAASFLTAWAATSRK-EE  178

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             N       +  +++FPP      IE  +  G  G     KD++ KRF+     I++L+Q 
Sbjct  179   NILIAPQMEEGALVFPP----RKIEMDITRGMVG----HKDIVTKRFMFNRTNISRLKQK  230

Query  1028  LTITGGSVQ-RPSRVEALTALVWAAVINATPTQT-------ATLSCMVNLRRRMEPPLPP  873
             +    GS++  P+ VEA+TAL+W + + A    +       + +S  VN+R RM   L  
Sbjct  231   V----GSLEFFPTSVEAVTALIWKSSLEAAKASSEEGKFPASMVSHAVNIRSRMASTLGK  286

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW-LRAVI  696
             + +G L  +A+    E +     V   +L +R+R+  R V      K+ G+  + +   +
Sbjct  287   HSMGNLWQQAVSPLVEVEGE---VGLRDLGERVRETIRKVDGNYVSKLQGDEFYEVIEGL  343

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAV  525
                  +   +       SS  R   YE DFGWGKP  V  +   + N  +L    +   +
Sbjct  344   KEARRMASEKGVPCYSFSSWVRFGLYETDFGWGKPSYVRTIGVPIKNVVILMPTKVGDGI  403

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVS  450
             E W+ L    M    Q+   L ++S
Sbjct  404   EAWITLTTNDMLHFQQNPELLHFLS  428



>ref|XP_002314561.1| transferase family protein [Populus trichocarpa]
 gb|EEF00732.1| transferase family protein [Populus trichocarpa]
Length=445

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 223/449 (50%), Gaps = 36/449 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHTDTIDE  1569
             + VE+ ++E++ PSSPT   L+ +  S LDQLA     P V  Y     R   +  ++  
Sbjct  6     VNVEIVAREVIGPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQRLTGNHQSL-R  64

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK+SLS+TL+  YPLAGR K D  ++ECND G  F+ + V+  +S  LE  +   I++  
Sbjct  65    LKRSLSETLTRFYPLAGRIK-DGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKFI  123

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW--ASFNRGC  1215
             P  +   P+ +  +LV VQ N F+CGG+AIG  +SH  AD    + F++ W  A+F    
Sbjct  124   P-VETESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAAAAFR---  179

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
             + N+ +     ++S LFPP       + L       +E      + KR V  A+ IA L+
Sbjct  180   SVNDSTVLPLFNASSLFPP-------QNLPLTRPAAVELMNDKCVTKRLVFDASKIAALQ  232

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLPPN  870
                     SV  P+RVEA+TAL+W   +NA+ + +     + LS  VNLR+RM PPLP N
Sbjct  233   AK--AVSESVTCPTRVEAVTALIWKCAMNASRSNSEHLRYSILSQSVNLRKRMVPPLPEN  290

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              +G LV        E +     +    LV ++R   R   +    K+ GEG    AV   
Sbjct  291   TIGNLVGYFASCATECE-----IELQSLVGQLRKGLRDFGENYVEKL-GEGKAFMAVCES  344

Query  689   GYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING-A  528
               E   +++  +     ++  CR  +Y +DFGWGKP  V      + +    +D  +G  
Sbjct  345   FQEAGSMLQEGNVDFYASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMDTRDGEG  404

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             VE W+ L ++ M    +DR  LA  S  P
Sbjct  405   VEAWVTLTEEDMAFFERDRELLAAASLDP  433



>ref|XP_008226591.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=477

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 151/479 (32%), Positives = 225/479 (47%), Gaps = 53/479 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLP-FVFFYV-------SGRACHH  1587
             +KVE+  ++ V+PSSPTP  L+  + S  DQ+  +   P  +FFY        SG     
Sbjct  6     IKVEIIQRQTVKPSSPTPHPLRTLQLSVFDQMIPSEDYPPTLFFYTTNNNVSGSGGGAPS  65

Query  1586  TDTID----------ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENM  1437
             TD  D           L +SL+KTL+  YPLAGR  +    ++C D+G EF+ A V  ++
Sbjct  66    TDMADMRMKERDYCQHLIQSLAKTLTHFYPLAGRLSKGHDMIQCTDDGAEFVTARVKCSL  125

Query  1436  SSLLENFEIGKIKQLTPSAKFYEPQPVGKA----LVAVQVNRFSCGGIAIGFFVSHAIAD  1269
             S + E+ +   +  L P+    +P   G A    L+AVQ N F CGG+AIG  +SH I D
Sbjct  126   SQIFEHPDPEILTGLVPA--IGQPDGDGDATRLPLLAVQFNLFECGGMAIGLKMSHKIVD  183

Query  1268  ASALAKFMEIWA--SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQE  1095
              +    F+  WA  + + G      S      ++  FPPL D S   Q       GI + 
Sbjct  184   GTTCNAFISCWAKTALDDGDNDQVTSMIPKFDAASYFPPL-DFSNSSQPSSAKLVGISKH  242

Query  1094  EKDMIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP--------  939
             +   I +RFV  A+ IA L Q    +      P+RV A+ AL+W   + A+         
Sbjct  243   K--YITQRFVFDASKIATL-QSYLASPSPAHEPTRVLAVLALIWKCAMEASSKSSNIALG  299

Query  938   TQTATLSCMVNLRRRMEPPLPPNCLGTLVDEAIVLC-------QEAKDGGTVVTAVELVQ  780
             ++ ++L   ++LRRR EPPLP N  G +V   IV+        QE  D  T +   +LV 
Sbjct  300   SRPSSLRLTMDLRRRFEPPLPQNLAGNVVSNLIVIATASLLKRQEESDDET-IDLKDLVA  358

Query  779   RIRDAFRAVKDGEARK--VYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDF  606
              +R  F   K+  + K        W R    R  +L RN D      +S CR A+YE DF
Sbjct  359   TLRKGFEQQKETYSTKQPFDSNKAWQRVQEYR--KLTRNVDMDHFSCASWCRFAFYEADF  416

Query  605   GWGKPRLVV--NMLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             GWGKP  V   ++     V+ +D  +G  +E  + + +++M     +   L Y S  P+
Sbjct  417   GWGKPAWVSIPSIPLKDAVILIDKRDGKGIEALLTVSEEIMEHFESNPELLKYASVNPR  475



>ref|XP_010027285.1| PREDICTED: BAHD acyltransferase At5g47980-like [Eucalyptus grandis]
 gb|KCW62007.1| hypothetical protein EUGRSUZ_H04686 [Eucalyptus grandis]
Length=438

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 223/451 (49%), Gaps = 33/451 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR--ACHHTDTI  1575
             + +KVEV +KE +R SSPTP+ LKN+K S  DQLA  +    +FFY S    + HH  + 
Sbjct  1     MELKVEVVAKETIRLSSPTPDHLKNFKLSVFDQLAPILYTSVLFFYTSNTNASSHHRSSC  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
               LK SLS  L+  YPLAGR + D ++V+C D G EF+ A V   +S +L+      +++
Sbjct  61    --LKSSLSDVLTRFYPLAGRIR-DNLSVDCEDGGAEFVDAKVNCPLSHILDRPCPVSLRK  117

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P      P+     L+ VQ N F CGG+A+G  VSH IADAS L+ F++ W++     
Sbjct  118   LLP-IDTESPEASTGRLLLVQANAFGCGGLAVGVCVSHKIADASTLSTFIKAWSAAALLS  176

Query  1214  AANNGSGFVS-DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
               N G      D +S  FPPL + +AI   + +        +   + +R+V+    I  L
Sbjct  177   DVNVGIEIPPLDTASAWFPPLVELAAILPTVVL-------PKARCVTRRYVLDPAKITPL  229

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRMEPPLPPN  870
                      +V  P++VEA+ ALVW  V  A+    P + + LS  VNLR R+  PLP  
Sbjct  230   -----AASEAVPDPTQVEAVVALVWRCVARASRKNDPGRRSLLSQAVNLRGRLPEPLPET  284

Query  869   CLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI-  696
              +G  V    V +  +A++    +   +LV  +R+A R   D    ++ G      AV+ 
Sbjct  285   TIGNFVGGFTVEMPPQAEEREMELK--KLVSDMREAKREYFDNYTPRLSGLVVGCMAVVE  342

Query  695   --ARGYELVRNRDSSTLYTSSLCRMAYYE-VDFGWGKPRLVVNM---LDNSWVLFLDAIN  534
               A+   L+ + D      SS C    YE  DFGWG+P  +        NS VL      
Sbjct  343   AAAKFGALINSGDVDFYNCSSWCGFGLYEAADFGWGRPAWISFAGVEYKNSIVLVDARDG  402

Query  533   GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G +E W+ L ++ MH L  D   L + S  P
Sbjct  403   GTIEAWLTLSQEDMHVLDADEELLRFASVNP  433



>ref|XP_009361769.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=446

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 136/443 (31%), Positives = 230/443 (52%), Gaps = 31/443 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+ E+  +E ++PSSPTP+ L+N+K S L+QL+       V FY    +  +  ++  LK
Sbjct  1     MEFEMIKRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFYPGNDSTTNQSSLRILK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL   YPLAGR K D I+V+CND GV+++ A V   +S+ L   + G ++QL P 
Sbjct  61    KSLSETLVRFYPLAGRMK-DNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGTLRQLLPV  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
             A    P+    AL+ VQ N F C G+AIG  +SH +ADA++L+ F+  W++   G +   
Sbjct  120   AT-ESPEASKGALLLVQANVFGCSGLAIGMCMSHKLADAASLSTFIMSWSATALGFSQAL  178

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                F    +S  FPP+  +S+  Q  ++GA     + ++ + KRFV  A+ I+ LR    
Sbjct  179   LPDFT---ASFRFPPIDYSSSFHQSSQVGA-----KRENCVTKRFVFNASKISALRTKAA  230

Query  1022  ITGGSVQRPSRVEALTALVWAAVINAT--------PTQTATLSCMVNLRRRMEPPLPPNC  867
              T   V +P++ EA+TAL+W   + A+        P + + LS  V++R+ + PPL  + 
Sbjct  231   ST--IVDQPTQAEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVVPPLSDDS  288

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G L+        E +     +    LV ++R     + +  A++   +     +V    
Sbjct  289   IGNLMGYFAAQTDENE-----LELQGLVAQLRRGIEELSNNYAKRPGKDQAIRESVTEVH  343

Query  686   YELVRNRDSSTLYTSSLC--RMAYYEVDFGWGKPRLVVNM--LDNSWVLFLDAI--NGAV  525
                V+  D+   Y  +        YEV+FGWGKP  + N+    ++ V +L +   +  +
Sbjct  344   NNFVKRDDTINFYVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLVSTRKDDGI  403

Query  524   EVWMKLPKQVMHTLTQDRHFLAY  456
             E W+ L ++ M    +++  LA+
Sbjct  404   EAWVTLSEEDMAAFERNQELLAF  426



>ref|XP_004135298.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
 ref|XP_004164195.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
 gb|KGN51706.1| hypothetical protein Csa_5G590720 [Cucumis sativus]
Length=438

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 134/457 (29%), Positives = 224/457 (49%), Gaps = 51/457 (11%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++++ SKEI++PSSPTP+ L+ Y  SFLDQ+ ++V  P V+FYV+G A    +  D 
Sbjct  1     MAVQIDIVSKEIIKPSSPTPDHLRRYCLSFLDQVTVDVYNPMVYFYVAGSATTPVEIADR  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS  L+  YPLAGR   D + ++CND+GV FI   V   +S ++      ++ +L 
Sbjct  61    LKKSLSDFLTYYYPLAGRLNSDELFIDCNDDGVPFIETSVNCPLSDVMNTSFPSELNKLL  120

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    +E   +    + VQ+N F CGG+A+G  VSH I+DA +    +  WA++ RG   
Sbjct  121   P----FELDKLDDVSMGVQLNVFECGGVAVGICVSHKISDALSFFIVVNEWAAYCRG---  173

Query  1208  NNGSGFVSDHSSILFPPL------TDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
                +  V   S+ +FPP       T TS   Q  ++G             +R+ I A  +
Sbjct  174   EKEAVRVHLSSAEVFPPTKTKVHNTRTSIFRQ--RVG-------------RRYHIDAANV  218

Query  1046  AQLRQDLTITGG--SVQRPSRVEALTALVWAAVINATPT--------------QTATLSC  915
               +R          + +RPSRVEAL+  +++  I A                 +   L C
Sbjct  219   ETIRAKYADCPAMENQRRPSRVEALSTFIYSRFIAAIKAVSNDRMENGSSDSEKKIFLVC  278

Query  914   M-VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEA  738
               VN+R R++PP+P    G        +  E           +LV+++R+    +     
Sbjct  279   HSVNIRSRLDPPVPDYAFGNYYRTTFAVPSEEVLNDEY--CYDLVKQVREEIGKINKDYL  336

Query  737   RKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDN  564
             +++     ++ ++     +       S  +T SLCRM  Y++DFGWG+P  + +  ++  
Sbjct  337   KRLQDSSKFIESMKKTASQFATGELISCSFT-SLCRMPIYDIDFGWGQPDWISSPALIFK  395

Query  563   SWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAY  456
             +  +F+D  +G  VE+++ L ++ M     D  FL Y
Sbjct  396   NLFVFIDKKDGDGVEIYVHLTEEHMKKFEADEEFLKY  432



>gb|KEH20540.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=437

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 221/450 (49%), Gaps = 32/450 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+E ++PSSPTP  LK Y  SF+D + +   +P ++FY   +       I +L+
Sbjct  1     MEIELISRETIKPSSPTPSHLKIYPLSFIDNILMRNYVPLLYFYKPNKDSDQNVKISQLR  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+ LS  YP AGR K D+ITVECND+GV F+V +V   +S +L+N     +  L P 
Sbjct  61    KSLSQLLSKYYPFAGRLK-DKITVECNDQGVPFLVTNVKNKLSEVLQNPIEKLLNPLFPD  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++     + L+A+Q+N F+CGG+AI   +SH I D S L  FM  W+  N       
Sbjct  120   ELQWKEMDWSETLIAIQINCFACGGMAISVCMSHKIGDGSTLFNFMNDWSIINENLPKEK  179

Query  1202  --GSGFVS------DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
                 G +       D  + +FP        ++ + +  E + + E +++ KRFV   + I
Sbjct  180   EGEKGLLELPFHFLDGGASMFP--------QRDLPIFQELVLKRENNVVCKRFVFQPSMI  231

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT--QTATLSCMVNLRRRMEPPLPP  873
               L++    T  SV  P+RV+ +TA ++   ++ T    +T+  S  V+ R+RM PPL  
Sbjct  232   KSLKK--MATSSSVHSPTRVQVVTAWIYKCTVSITGLNFKTSLFSMAVDFRKRMVPPLSE  289

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
              C+G +   + +   + +     +   +LV +I++      D   +   G+       I+
Sbjct  290   KCVGNIFWFSSMFADKKE-----MELKDLVCKIKEGLSECCDVYPKIFGGKKNDNLLKIS  344

Query  692   RGYELVR---NRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-  531
                + V    + + + +  SS CR   YE DFGWGKP  V        + ++ +D  +G 
Sbjct  345   ECLKQVTESYSENGNLISFSSWCRFPMYEADFGWGKPIWVTTSACYVRNGIILMDTRDGD  404

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E  + + +  M     +   L Y S  P
Sbjct  405   GIEAVVNMEENDMTKFEHEVKLLQYASLNP  434



>gb|ACI45392.1| salutaridinol 7-O-acetyltransferase [Papaver bracteatum]
Length=477

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 147/452 (33%), Positives = 220/452 (49%), Gaps = 50/452 (11%)
 Frame = -3

Query  1736  VEVRSKEIVRPSSPTPESLKNYKFSFLDQ-LALNVRLPFVFFY------VSGRACHHTDT  1578
             VEV SKE ++P++PTP  LKN+  S LDQ   L   +P + FY       +G + HH D 
Sbjct  9     VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPDTVANSTGSSSHHDD-  67

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
             +D LK SLSKTL  +YP+AGR   D I V+C+D+G++F    +   M   +   ++  + 
Sbjct  68    LDLLKSSLSKTLVHLYPMAGRMI-DNILVDCHDQGIDFYKVKIRGKMCDFMSQPDV-PLS  125

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL PS       P  +ALV VQVN F CGG AI   +SH I+D + +  F+  WAS  + 
Sbjct  126   QLLPSEVVSANVP-KEALVIVQVNMFDCGGTAICSSISHKISDVATMGTFIRSWASTTKT  184

Query  1217  CAANNGSGFV--------SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKD--MIVKRF  1068
               + + +  V        S  S+ LFPP    ++   + ++    I ++ +D   + KRF
Sbjct  185   SRSGDATAAVITDQKLIPSFDSASLFPPSERLASPSGMAEIPFSSIPEDTEDDKTVSKRF  244

Query  1067  VIPANAIAQLRQDLTI---TGGSVQRPSRVEALTALVWAAVINATPTQ-TATLSCMVNLR  900
             V     I  + + L +        +RP+RVE +T+L+W +V+ +TP      +   VNLR
Sbjct  245   VFDFAKITSVSEKLQVLMHDNYKSRRPTRVEVVTSLIWKSVMKSTPAGFLPVVDHAVNLR  304

Query  899   RRMEPPLPPNCLGTL-------VDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVK  750
             ++M+PPL     G L       +         A +     T+ E   ++  + D F A  
Sbjct  305   KKMDPPLQDASFGNLSVTVSAFLPATTTTTTNAVNKTINSTSSESQVVLHELHD-FIAQL  363

Query  749   DGEARKVYGEGGWLRAVI---ARGYELVRNRDSS------TLYTSSLCRMAYYEVDFGWG  597
               E  KV G+ G L  VI     GY+    + +         + SS CRM  YE+DFGWG
Sbjct  364   RSEIDKVKGDKGSLEKVIQNFVSGYDASIKKINDVEDKVINFWISSWCRMGLYEIDFGWG  423

Query  596   KPRLVV---NMLDNSWVLFLDAIN--GAVEVW  516
             KP  V    N+  N   LF++       +EVW
Sbjct  424   KPIWVTIDPNIKPNKNCLFMNDTKCGQGIEVW  455



>ref|XP_007037901.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY22402.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=432

 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 221/446 (50%), Gaps = 35/446 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             + +++ SKE ++P+ PTP  L+N K SFLDQLA  + +P V FY + +     +    LK
Sbjct  4     IDIQIVSKETIKPAIPTPHHLRNLKLSFLDQLAPPIYIPIVLFYPAKQNVDLLERSLLLK  63

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLSKTL+  YPLAG  +ED  T ECNDEGVE+    V   +  + EN ++  +    P 
Sbjct  64    KSLSKTLTQFYPLAGTMRED-FTFECNDEGVEYFETKVPCKLVDVTENPDVNVLNLFLP-  121

Query  1382  AKFYEPQ-----PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
                +EPQ        +  +A+Q N F CGG+AIG  +SH IAD +++  F+  WA+ +R 
Sbjct  122   ---FEPQQNCIESKKQVPLAIQYNIFKCGGVAIGIRLSHLIADGTSVITFVNAWAAMSRE  178

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F    ++  FPP  D S     M   + GI +E+  ++ KRFV    +I  L
Sbjct  179   PGEVIIPIF---EAATHFPP-RDIS-----MFRPSIGITKEK--IVTKRFVFDKPSITVL  227

Query  1037  RQDLTITGGS-VQRPSRVEALTALVWA---AVINATPTQTATLSCM--VNLRRRMEPPLP  876
             R+  +   GS V+ P+RVEA+++ +W+   A+    P +    + +  VNLR RM P LP
Sbjct  228   REKASSRDGSQVKTPTRVEAISSFIWSRQMAIAKTKPERAKLYAAVHAVNLRERMVPSLP  287

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
              +  G     AI       +    V    LV  +R+A   + +   + +     +L+ + 
Sbjct  288   KHSFGNFWRMAIATFPAEMEQDYHV----LVSHMRNAISKIDNNYVKMLQDGDRYLKTMK  343

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLFLDAINGAV  525
                 +  ++      +T S CR   YEVDFGWGKP    +      N  +L  D     V
Sbjct  344   MVSEQFSKSEVEFCNFT-SWCRFPVYEVDFGWGKPAWACSPSRPYKNLVILMSDKGGEGV  402

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSA  447
             E W+ L ++ M    +D   L++ S+
Sbjct  403   EAWVNLLEEDMAIFERDPELLSFASS  428



>ref|XP_002515007.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47561.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 139/464 (30%), Positives = 228/464 (49%), Gaps = 56/464 (12%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA---CHHT  1584
             + +  KV++  +E ++PSSPTP  LK +K S LDQL     +P V FY +       HH 
Sbjct  1     MAMAAKVKIIQRETIKPSSPTPPELKIHKLSLLDQLIPTNYIPVVLFYPANDGDNLDHHA  60

Query  1583  DTIDElkkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFE  1413
             ++ +   K  +     +   YP AGR K D  +VEC+D+G +FI A +   +S +L++ +
Sbjct  61    NSTERSLKLKTSLSETLTHYYPFAGRIK-DSTSVECDDQGADFIQARINCLLSDVLKSPD  119

Query  1412  IGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                ++Q  P+A        G  L+ VQ   F CGG+A+G  +SH I+DA+ L  F++ W 
Sbjct  120   AVVLRQFLPAAITSTEAATGN-LLLVQATFFHCGGLAVGVCISHKISDATTLKAFIKCWV  178

Query  1232  SFNRGCAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             +     +  + +      S  +FPP  ++  +++ +LMK          K  I KRFV  
Sbjct  179   ATATSSSTESATPLFMGAS--IFPPVDISIPTSVVELMK----------KQCITKRFVFT  226

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQ-----TATLSCMVNLRRR  894
              + IA L+  +  T  +++ P+RVE ++ L+W   + AT ++      +  S  VN+R R
Sbjct  227   GSKIAALKAKVAST--TMRNPTRVETVSGLLWKTAMAATRSKLGYSRPSVWSMPVNMRTR  284

Query  893   MEPPLPP----NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
               PPLP     NCL   ++  I    E K         ELV RIR      ++   +K+ 
Sbjct  285   FLPPLPESYAGNCL-LHINPKIADESELK---------ELVGRIRKEIEGFRENYVKKLR  334

Query  725   GEGGWLRAVIAR-GY-----ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLD  567
             GE    RAV+A  G+      L  N D      +S C++  Y+ DFGWG+P  V ++ + 
Sbjct  335   GE----RAVLATFGFFQEYGNLAMNNDIDLYTCTSWCKLELYDADFGWGRPLWVGIDSIP  390

Query  566   NSWVL-FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              S V+  +D  +G  +E W+ L ++ M     ++  L + +  P
Sbjct  391   LSNVVCLMDTRDGDGIEAWLTLGEENMALFESNQELLQFAAVNP  434



>ref|XP_009773462.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   184 bits (468),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 139/423 (33%), Positives = 216/423 (51%), Gaps = 31/423 (7%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA-CHHTDTIDElk  1563
             KVE+ SKE+++PSSPT  +LK +K S LDQ++  V +P +FFY       + +  I  LK
Sbjct  4     KVEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDELGNINRSRNIQILK  63

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP-  1386
             KSLS  L+  YPLAGR  ++   ++CND G EFI A V   +S ++E  +  ++++  P 
Sbjct  64    KSLSDALTRFYPLAGRFNDNNF-IDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFLPR  122

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
              A   E   V   L+AVQVN F+CGGIAIG  +SH + D S++  F+  WA+  RG    
Sbjct  123   EACEVENNDV---LLAVQVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARG----  175

Query  1205  NGSGFVSD--HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             N +G      H S +FPPL     + +     + GI+ ++   + +RFV     +  +++
Sbjct  176   NHTGIAQPNFHLSSIFPPLD----LSKSSFKPSIGIKNDK--FLSRRFVFNKEKLDAIKK  229

Query  1031  DLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLPPNC  867
               + +G  V+ P+RVEAL+A +W  +     +N   T+      +VN+R RM P L  N 
Sbjct  230   --SASGSQVKDPTRVEALSAFLWKNLMKVSKLNKDSTKMFAAVHVVNIRSRMNPTLSDNS  287

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
              G L   A        +   +    +L+  +R A R + + +  ++   G      I++ 
Sbjct  288   FGNLWTTAPAFLSPKSE--EIFGIDDLLYHLRSAIRKI-NSDYTEILQNGEEFLKHISKF  344

Query  686   YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNML--DNSWVLFLDAING-AVEVW  516
              EL    +      SS CR   YEVDFGWGKP  V        + V+F+    G  +E W
Sbjct  345   AELFSKEEVEFYNFSSWCRFPVYEVDFGWGKPVWVCTTTFPFKNVVIFMGTKCGEGIETW  404

Query  515   MKL  507
             + +
Sbjct  405   VNM  407



>ref|XP_010100291.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
 gb|EXB82425.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
Length=434

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 143/451 (32%), Positives = 228/451 (51%), Gaps = 40/451 (9%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDEl  1566
             TMKV++  +EI++PSSPTP  LK +K SFLDQ+   V    V FY +        T + L
Sbjct  5     TMKVDIIGREIIKPSSPTPSHLKTFKLSFLDQIVPAVYTSLVLFYPNINVLTPDQTSNHL  64

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLL--ENFEIGKIKQL  1392
             KKSLS+ L+L YPLAGR K D   +EC+D+G +++ A     +S  L  ++ +   I++ 
Sbjct  65    KKSLSEALTLFYPLAGRVK-DNTVIECHDDGAQYVEAKFNCLLSIFLDQQHKDEALIRRF  123

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P+A    P+     L+ VQ   F CGG+A+G  VSH +ADA+ L+ F++ WA  N    
Sbjct  124   LPAA-MESPEAGTWPLLIVQATFFDCGGVAVGVCVSHKLADAATLSVFLKTWA--NTAVP  180

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                 + +     +  F P                 +E +  + + KR V   + IA L+ 
Sbjct  181   DFEAASYYLPRDTFSFAP--------------PAALELKRVEGVSKRCVFDKSTIAALKA  226

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLPPNC  867
              L     SV++P++VE +TAL+W  ++ A+ +   T     ++  V++R+R+EPP   N 
Sbjct  227   KL--VSDSVKQPTKVEVVTALLWRCLMAASSSAQVTPRYSLVTQSVDMRKRVEPPFSQNS  284

Query  866   LGTLVDE-AIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
              G LV   A+ +     +G T     +   LV ++R   +   + +A++  G+ G L+AV
Sbjct  285   AGNLVSYFALQVENNIYEGSTEPLECQLQGLVAKLRQGIKDFTERKAKRFRGDEG-LQAV  343

Query  698   IAR---GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---NMLDNSWVLFLDAI  537
             +     G +LV   D    + +S C   +YEVD G+GKP  V    N  +N  +LF+D  
Sbjct  344   VEHFMEGRKLVTRDDVCYFFCTSWCNFQFYEVDVGFGKPVYVTVPSNTYEN-MILFMDTR  402

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             +G  VEV   L K+ +         L+  S+
Sbjct  403   DGDGVEVIFTLSKENVALFENQLEILSLASS  433



>ref|XP_004240930.1| PREDICTED: vinorine synthase-like [Solanum lycopersicum]
Length=439

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 144/464 (31%), Positives = 225/464 (48%), Gaps = 48/464 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M V+V S+EI++P  PTP  L+NYK SF+DQ      +P + FY +     H   +  ++
Sbjct  1     MDVKVISEEIIKPCIPTPRHLRNYKISFIDQFTPCSYIPVILFYNANDDVDHE--LKPMQ  58

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP-  1386
              +L++TLS  YPLAGR K D  ++ECNDEGV ++ A    N+S  L+N +I  + +  P 
Sbjct  59    VALAETLSYYYPLAGRFK-DVYSIECNDEGVVYVEAQANFNLSKFLQNPDIPFLNKFLPF  117

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
                  EP    + LVA+Q   F CGG+AIG  + H + DAS ++ F++ WA  +RG    
Sbjct  118   KGNCLEPS-YNQPLVALQTTAFECGGMAIGVCMLHKVVDASTMSVFLKTWAKISRG---E  173

Query  1205  NGSGFVSDHSSI--LFPPLTD--TSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                    D +S   LFPP+    T  I        +G +       ++RF+  + +I  L
Sbjct  174   GDKTLHPDFTSAISLFPPIDSLPTKFITDFDNFYFQGSKSP-----MRRFLFDSKSIKAL  228

Query  1037  RQDLTITGGSVQRPSRVEALTALVW----AAVINATPTQTATLSCMVNLRRRMEPPLPPN  870
             + +   +  SV  PS++EALTA +     AA++     +T  ++   NLR R++PPLP  
Sbjct  229   KAN--TSSESVPFPSKIEALTAFICKRIGAALMANNVPKTLMITHAANLRPRVDPPLPQK  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAF-----RAVKDGEARKVYGEGGWLR  705
               G L+  A            +    +L   +R+ F       +KD ++  V+     L 
Sbjct  287   TFGNLLWLAFAFYDPLDTNNEL---PDLGIMLREVFAQLTAENIKDIDSECVFES---LS  340

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD---------NSWVL  552
              V+     L  N +  T   +S C M  Y+V+FGWGKP  V +M D           +V 
Sbjct  341   EVLE---SLSTNENIKTYRFTSWCNMGLYDVNFGWGKPVWVAHMGDLPAANVRSKQQFVF  397

Query  551   FLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL*IQ  420
                A    +E+W+   ++ +  L +D  FLAY +  P P + I 
Sbjct  398   IESASRQGIELWVASDEEEIRFLEKDAEFLAYAN--PNPSICIN  439



>gb|AFK43775.1| unknown [Medicago truncatula]
Length=416

 Score =   184 bits (467),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 144/442 (33%), Positives = 222/442 (50%), Gaps = 36/442 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + ++VE+ SKEI++PSSPTP  L++Y+ SFLDQ+A  V  P V FY    A +     + 
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFYSHNDALNTATISNT  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQL  1392
             LKKSLSK L+  YPLAGR       ++CNDEG+ +I   +   N+  +++N    ++ +L
Sbjct  61    LKKSLSKILTHFYPLAGRMNNKNF-IDCNDEGIPYIETKITNYNLKDIIQNPIPNELNRL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++   +      +Q+N FSCGGIAIG  +SH IAD  +   F+  WA+  R   
Sbjct  120   IP----FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANITRKLI  175

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                 S  + D SS LFPP  + S  +        GI +E  +++ K FV  A+ +  LR 
Sbjct  176   F---SKPIFD-SSKLFPP-KNISGFDP-----RSGIAKE--NIVCKIFVFNADVVENLRA  223

Query  1031  DLTITGGSVQRPSRVEALTALVWA----AVINATPTQTATLSCMVNLRRRMEPPLPPNCL  864
                        P+RVEAL+A +W+     + N    +   +   VNLR++MEPPLP    
Sbjct  224   KYINFN-----PTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHAVNLRQKMEPPLPLESF  278

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G  +   I + +   + G       L +++RD  + + D E  K   EG      +   +
Sbjct  279   GNYLRFTITIPK--MNSGE--ECYGLAKQVRDEIKKI-DKEYVKKVQEGKEHLEFLKESF  333

Query  683   ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN-GAVEVW  516
             + V  ++   ++  +SLCR   Y+ DFGWGKP  V +   N  + V+F D  + G +E +
Sbjct  334   DRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFFDCKDGGGIEAY  393

Query  515   MKLPKQVMHTLTQDRHFLAYVS  450
             + L    M     D   LA V+
Sbjct  394   VSLKVGDMVKFEADLELLACVN  415



>gb|AES72092.2| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=416

 Score =   184 bits (467),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 143/442 (32%), Positives = 223/442 (50%), Gaps = 36/442 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + ++VE+ SKEI++PSSPTP  L++Y+ SFLDQ+A  V  P V FY    A +     + 
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFYSHNDALNTATISNT  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQL  1392
             LKKSLSK L+  YPLAGR       ++CNDEG+ +I   +   N+  +++N    ++ +L
Sbjct  61    LKKSLSKILTHFYPLAGRMNNKNF-IDCNDEGIPYIETKITNYNLKDIIQNPIPNELNRL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++   +      +Q+N FSCGGIAIG  +SH IAD  +   F+  WA+  R   
Sbjct  120   IP----FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANITRKLI  175

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                    + D SS LFPP  + S  +        GI +E  +++ K FV  A+ +  LR 
Sbjct  176   FPKP---IFD-SSKLFPP-KNISGFDP-----RSGIAKE--NIVCKIFVFNADVVENLRA  223

Query  1031  DLTITGGSVQRPSRVEALTALVWA----AVINATPTQTATLSCMVNLRRRMEPPLPPNCL  864
                        P+RVEAL+A +W+     + N    +   +   VNLR++MEPPLP    
Sbjct  224   KYINFN-----PTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHAVNLRQKMEPPLPLESF  278

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G  +   I + +   + G       L +++RD  + + D E  K   EG      +   +
Sbjct  279   GNYLRFTITIPK--MNSGE--ECYGLAKQVRDEIKKI-DKEYVKKVQEGKEHLEFLKESF  333

Query  683   ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN-GAVEVW  516
             + V  ++   ++  +SLCR   Y+ DFGWGKP  V +   N  + V+F+D  + G +E +
Sbjct  334   DRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFVDCKDGGGIEAY  393

Query  515   MKLPKQVMHTLTQDRHFLAYVS  450
             + L  + M     D   LA V+
Sbjct  394   VSLKVEDMVKFEADLELLACVN  415



>ref|XP_003601841.1| Vinorine synthase [Medicago truncatula]
Length=496

 Score =   186 bits (471),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 143/440 (33%), Positives = 222/440 (50%), Gaps = 36/440 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + ++VE+ SKEI++PSSPTP  L++Y+ SFLDQ+A  V  P V FY    A +     + 
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFYSHNDALNTATISNT  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQL  1392
             LKKSLSK L+  YPLAGR       ++CNDEG+ +I   +   N+  +++N    ++ +L
Sbjct  61    LKKSLSKILTHFYPLAGRMNNKNF-IDCNDEGIPYIETKITNYNLKDIIQNPIPNELNRL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++   +      +Q+N FSCGGIAIG  +SH IAD  +   F+  WA+  R   
Sbjct  120   IP----FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANITRKLI  175

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                    + D SS LFPP  + S  +        GI +E  +++ K FV  A+ +  LR 
Sbjct  176   FPKP---IFD-SSKLFPP-KNISGFDP-----RSGIAKE--NIVCKIFVFNADVVENLRA  223

Query  1031  DLTITGGSVQRPSRVEALTALVWA----AVINATPTQTATLSCMVNLRRRMEPPLPPNCL  864
                        P+RVEAL+A +W+     + N    +   +   VNLR++MEPPLP    
Sbjct  224   KYINFN-----PTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHAVNLRQKMEPPLPLESF  278

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G  +   I + +   + G       L +++RD  + + D E  K   EG      +   +
Sbjct  279   GNYLRFTITIPK--MNSGE--ECYGLAKQVRDEIKKI-DKEYVKKVQEGKEHLEFLKESF  333

Query  683   ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN-GAVEVW  516
             + V  ++   ++  +SLCR   Y+ DFGWGKP  V +   N  + V+F+D  + G +E +
Sbjct  334   DRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFVDCKDGGGIEAY  393

Query  515   MKLPKQVMHTLTQDRHFLAY  456
             + L  + M     D   LAY
Sbjct  394   VSLKVEDMVKFEADLELLAY  413



>ref|XP_004140566.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 ref|XP_004157592.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 gb|AIT72029.1| acetyltransferase [Cucumis sativus]
 gb|KGN46392.1| hypothetical protein Csa_6G088700 [Cucumis sativus]
Length=433

 Score =   184 bits (468),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 138/451 (31%), Positives = 222/451 (49%), Gaps = 38/451 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +KV++ ++EI++PS  TP++  +  FSFLDQLAL V +P + FY      +   +I  
Sbjct  1     MALKVDIINEEIIKPSISTPKTHNHLNFSFLDQLALPVYVPLLLFY--SPKPNQIPSISH  58

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK SLS+TL+  YP AGR  +D +++ CNDEG  F+ A+   +++ +L +  +  + Q  
Sbjct  59    LKSSLSQTLTQFYPFAGRVNDDNLSISCNDEGAIFVEAEANYSLNDILTHLNVDSLNQFL  118

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   F+        +V +Q   F CGGI +G  +SH I+DAS+++ F++ W S N   + 
Sbjct  119   P---FHLAN--KGCIVLIQTTTFQCGGITVGLLMSHKISDASSISSFVKTWTSINVSGSD  173

Query  1208  N---NGSGFVSDHSSILFPP-LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             N   +   FVSD  S+L PP     S       + A+G        I KR V P + IA 
Sbjct  174   NPLFSKPEFVSD--SVLPPPNFPVASPTTPDSGIHAKG--------ITKRIVFPHSKIAS  223

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLP  876
             L+        +V+ P+RVEA+ AL+W + ++A+ + +     + L   VNLR+ ++P LP
Sbjct  224   LKA--KAASSTVKNPTRVEAIAALLWKSAVSASRSTSGVSRASVLGQAVNLRKILKPNLP  281

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV-  699
              N +G     AI         G  +    +V  +R+A    K    +K      +L    
Sbjct  282   ENSVGN----AIGFVTPETAVGAELELQSMVGLMREAIEEFKKNGYKKYQDTDAYLSYFK  337

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAING-  531
                  +   N + +    SS  R  +YE DFGWG P      ++M  N + L LD  +G 
Sbjct  338   TLMDPDGPYNGEKNFYLCSSWSRFEFYEADFGWGCPVWFIGGISMFSN-FFLLLDTKDGK  396

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
              +E  + L ++ M    +D   L + S  P 
Sbjct  397   GIETLVSLSEEDMSVFERDEDLLEFGSFNPN  427



>ref|XP_002271612.1| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=433

 Score =   184 bits (467),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 142/455 (31%), Positives = 234/455 (51%), Gaps = 51/455 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG----RACHHTDTI  1575
             MK+++ S + ++PSSPTP  L+++K S LDQLA    +P +  + +      A  H    
Sbjct  3     MKIDILSTQPIKPSSPTPNHLRSFKISLLDQLAPPFYVPVILLFSADDFDCEAVDHVTIC  62

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             D LK+SLS+TLS  YPLAG+ K +  +V+C+D+G  F+ A     +S +L + EI  +++
Sbjct  63    DLLKRSLSQTLSRFYPLAGKLKGND-SVDCSDDGAVFMEARANVELSEILRDPEIDLLQK  121

Query  1394  LTPSAKFYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
             L P     EP  VG     +A+ A+Q   F CGGI IG  +SH +AD + LA F+  W++
Sbjct  122   LLPC----EPYSVGSESSDRAITAIQATIFECGGIGIGVCMSHKVADGATLATFLTAWSA  177

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                G   ++G     D +S LFPP    + +       + G+    K  + +RF+  A +
Sbjct  178   TAMG--TDDGITPFLDSAS-LFPPRDINTVL-------SSGVISHGK-TLTRRFLFDAAS  226

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVIN------ATPTQTATLSCMVNLRRRME  888
             +A+L+             +RVEA+T+L+W + ++         T ++ ++ +VNLR + E
Sbjct  227   LARLQS-------KASNSTRVEAVTSLIWKSAMDVAREKSGKDTISSIVTHVVNLRGKTE  279

Query  887   PPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             PPL    LG L  +A+  V  QE K     V   +LV R+R A + V     +++ GE G
Sbjct  280   PPLSDRSLGNLWQQAVATVTEQEGK-----VELDDLVGRLRRAIKKVDKEYVKEIQGEEG  334

Query  713   WLRAVIARG--YELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVL  552
               +A  A     +++ ++    LY  SS  R  +YE DFG+G+P  V  +   + N  +L
Sbjct  335   LSKACGAMKEVQKMIMSKGEMELYRFSSWSRFPFYETDFGFGRPIWVCTITAPIKNVIIL  394

Query  551   FLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
                   G +E W+ + ++ M    +    L +VS+
Sbjct  395   MDTKSGGGIEAWVTMVEEDMTKFQRHYELLEFVSS  429



>ref|XP_009606783.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=414

 Score =   184 bits (466),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 133/435 (31%), Positives = 221/435 (51%), Gaps = 38/435 (9%)
 Frame = -3

Query  1712  VRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkkslsktlsLM  1533
             ++PSSPTP+ L +Y+ S+LDQ+A N+ +P VFFY +     +T   ++LKKSLS  L+  
Sbjct  3     IKPSSPTPDDLHHYQLSYLDQIAPNILMPLVFFYAADNNLTNTQRSNQLKKSLSHVLTRF  62

Query  1532  YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPSAKFYEPQPVG  1353
             YPL+GR  E    V CNDEG+ +I A    ++S  L +    ++ +  P  K ++   V 
Sbjct  63    YPLSGRL-EANSHVNCNDEGIPYIEAIAKCSLSDFLLDPVPKELNKFIP-CKLHD---VK  117

Query  1352  KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSDHSS  1173
                + VQ N F CGG+AIG  +SH +ADA +   F+  W +  RG        F   +SS
Sbjct  118   DFFLLVQANFFECGGMAIGIAISHKLADAMSTFMFINCWGAIARGNTNVPSPRF---NSS  174

Query  1172  ILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQRPS  993
             ILFP   DTS ++  + +G + I       + KRFV  A+ ++ L+   T    + + PS
Sbjct  175   ILFPQ-RDTSELKSSITIGKDTI-------VTKRFVFSASKVSALKDKYT---ENTRPPS  223

Query  992   RVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQ  828
             R+EAL+  +W  ++ +        +   +   +NLR R  PPLP +  G ++   + +  
Sbjct  224   RIEALSTFLWTRLMASIHRKRDENKNYGIVHTLNLRTRSNPPLPESLFGNVMQVVVTIPS  283

Query  827   EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG-----EGGWLRAVIARGYELVRNRD  663
                +        ELV+++R+    + +  +  V G     +   L  +  +  E  + + 
Sbjct  284   LDHNISDEEQGFELVKQVRE---GIHNANSEFVSGLQKINDDKHLSFIKEKANE--QRKG  338

Query  662   SSTLYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-AVEVWMKLPKQV  495
                L+  +SLCR   YE DFGWG+P  V   +++  + + FLD  +G  +E W+ L ++ 
Sbjct  339   GLVLFNFTSLCRFPLYEADFGWGQPIWVGSASLVLKNVIGFLDTKSGNGIEAWVNLKEED  398

Query  494   MHTLTQDRHFLAYVS  450
             M     D+  L++ S
Sbjct  399   MARFEADKELLSWCS  413



>ref|XP_008797275.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Phoenix 
dactylifera]
Length=422

 Score =   184 bits (466),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 221/446 (50%), Gaps = 42/446 (9%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkk  1560
             KV+V SKE ++PSSPTP++L + + S LDQ+A  +    + FY    + +    + +LK 
Sbjct  4     KVQVISKETIKPSSPTPQNLHSLQLSLLDQIAPQIYNHLLLFY----SKNPPQALTQLKS  59

Query  1559  slsktlsLMYPLAGRAKEDR----ITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             SLSKTL+  YPLAGR KE +    + VECNDEGVEFI A     + S+L    I +  +L
Sbjct  60    SLSKTLTCFYPLAGRIKESKDDNTLYVECNDEGVEFIQARAEAELHSVLLQPPIDQFSEL  119

Query  1391  TP--SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              P  ++ F      G  L+AVQ+  F   G A+G  +SH IAD +++A F+  WA   RG
Sbjct  120   LPIRASDFR----YGDPLLAVQLTWFERRGFALGLSMSHLIADGASMAMFLNRWADVARG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F    S   FPP      I+Q  K       Q      ++RFV+ + AIA+L
Sbjct  176   LDLRPAPRF---DSMATFPP--RPQFIDQAPKRAQPASGQPAA--AIRRFVMSSRAIARL  228

Query  1037  RQDLTITGGSVQR---PSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNC  867
             R      GGS  R   P+RVEA++ALV   ++ A   +       VNLRR++ PPL    
Sbjct  229   R------GGSYDRVHAPTRVEAVSALVLRCLVRARGKKRPVAKHSVNLRRKLSPPLSDES  282

Query  866   LGTL-VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              G + +  A V                L + +R+  R V D E  +   E  WL      
Sbjct  283   FGNMWISVAAVGKLVGDGCDDGGGQGFLEEALRNGVRKV-DEEYVRRKAEEKWLG---RD  338

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL----VVNMLDNSWVLFLDAING-AV  525
             G + V   +S T   SS CRM +Y  DFGWG+P      + +M D    + +D  +G  +
Sbjct  339   GMDGVVVGESETWIFSSWCRMPWYRTDFGWGEPEWLGCGIRDMKDV--CILVDTKDGDGM  396

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSA  447
             EVW+ L  + M  + +D  FL ++S+
Sbjct  397   EVWLWLRAEEMEKVARDPEFLDFISS  422



>ref|XP_006473916.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=472

 Score =   185 bits (469),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 148/483 (31%), Positives = 223/483 (46%), Gaps = 63/483 (13%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDEl-  1566
             M+VE+ SKE ++PSSPT   L+ +K S LD       +P V +Y   +     + ID+  
Sbjct  1     MEVEILSKECIKPSSPTAHHLETHKLSLLDLYLPPAYIPLVLYYPMNQQHSSANIIDDHI  60

Query  1565  --------kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEI  1410
                     K++LS+TLSL YPLAG+ K D  +++CNDEG+ FI A     +   L    I
Sbjct  61    ISTRLQLLKQALSETLSLFYPLAGKIK-DLHSIDCNDEGIYFIEARAKSPLDEFLNLPSI  119

Query  1409  GKIKQLTPS---AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
               IK+  P    AK+      G  + +VQV  FSCGG+ IG +VSH I D +A + F++ 
Sbjct  120   SLIKEFLPDPDDAKWRSIPTPGDYVASVQVTTFSCGGMTIGAYVSHMIGDGTAFSLFLKS  179

Query  1238  WASFNRGCAANNGSGFVSDHSSILFPPLTDTS-AIEQLMKMGAEGIEQEEKD--------  1086
             WA+     + N  S      +++L  P  D S +  Q      +      +         
Sbjct  180   WAAATARKSYNEES-----EAALLLSPKFDASLSFPQNDAYPRQACSTSIRSNLPIKFGR  234

Query  1085  MIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-------  927
              + +RF+  A+AIA L+      G +VQ P+RVEA+T L+   ++ A+ TQ         
Sbjct  235   CVCRRFLFDASAIANLKAK--AKGSTVQNPTRVEAVTTLLGKCIMAASKTQARSSSSDRD  292

Query  926   -----TLSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAF  762
                   L   VNLRRR  PP   N +G  +  A  LC+  ++         LV ++R+A 
Sbjct  293   SDKPFALIHAVNLRRRATPPFSENYMGNFIWMASALCKTEEEP----ELQGLVCQLREAI  348

Query  761   RAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSSTLYT-----SSLCRMAYYEVDFGWG  597
               +       + G+ G L  + A  YE    R++ TL       SS C   +YE+DFGWG
Sbjct  349   AKLNGDFVNSLQGDEGLLNFLEALKYE----RETYTLAADRIAYSSWCNFGFYEIDFGWG  404

Query  596   KPRLV---------VNMLDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAF  444
             KP               + N+ +L    +   +E W+ L +  M  L  D+  L Y +  
Sbjct  405   KPIWASVTGPPESPATAILNAILLMDTNMGNGIEAWVYLHEDTMAILQVDQQLLQYATVD  464

Query  443   PKP  435
             P P
Sbjct  465   PSP  467



>ref|XP_006441394.1| hypothetical protein CICLE_v10023627mg [Citrus clementina]
 gb|ESR54634.1| hypothetical protein CICLE_v10023627mg [Citrus clementina]
Length=407

 Score =   183 bits (464),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 147/458 (32%), Positives = 217/458 (47%), Gaps = 77/458 (17%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---  1578
             + + VE  SKE+++PS+PTP  L++Y+FS LDQ+   V +  ++FY       H D    
Sbjct  1     MKIDVETMSKEMIKPSTPTPSQLRHYQFSHLDQIGPPVYISLLYFY-------HLDDHKL  53

Query  1577  -------IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
                     + LK SLS  L+  YPLAGR K +   V+CNDEGV F  A V+ ++S     
Sbjct  54    VSNNHLFSNSLKSSLSNVLTKYYPLAGRIKNNY--VDCNDEGVVFSEAKVSCHLS-----  106

Query  1418  FEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
              EI K           +   V    +A+QVN F+CG +AI   +SH I D S+L  F + 
Sbjct  107   -EIEK-----------DVVSVDGLAIAIQVNIFNCGNVAIAVMISHRIEDGSSLITFTKT  154

Query  1238  WASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             WA+  RG + N    FV   ++ LFPP     +            +   K +++K+F+  
Sbjct  155   WAAVARGESENILPEFV---AAKLFPPKDAGGS-------SGTSFDPRPKKVVLKKFLFE  204

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRR  894
              + I  LR    +   ++  P+ VEAL+A +W+ +     I  +P +   L   VNLR+R
Sbjct  205   GSKITTLRDKYGL--DNLIYPTCVEALSAFLWSRLAASTRIKVSPEKPCMLVHAVNLRKR  262

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAV-KDGEARKVYGEG  717
             MEP LP +  G L   A+ + +E  D         +V + RDA   + KD    K     
Sbjct  263   MEPQLPADSFGNLFAFAVTILEENHDN-------RMVNKFRDAIGKIDKDYLKAKNVEHS  315

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSW-------  558
               +   I  G E     +      SSLC+   YE DFG GKP  V      +W       
Sbjct  316   ELIDLAITNG-ERFDKVELGYCIISSLCKFPVYEADFGLGKPISV------AWGCFPYKN  368

Query  557   -VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              + F+D  +G  +EVW+ L ++VM     D+  LAYVS
Sbjct  369   VIHFMDTKSGDGIEVWVHLEEEVMAIFENDQELLAYVS  406



>ref|XP_006345840.1| PREDICTED: BAHD acyltransferase At5g47980-like [Solanum tuberosum]
Length=447

 Score =   184 bits (467),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 139/461 (30%), Positives = 219/461 (48%), Gaps = 44/461 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++ + SKE V+PS+PTP  L+N+K    DQLAL + +  +FFY      ++ + +D   
Sbjct  1     MEIIILSKEKVKPSTPTPPHLRNHKLCLFDQLALGICITPIFFYK-----NNNNIVDNRL  55

Query  1562  kslsktlsLM-YPLAGR--AKEDRITVECNDEGVEFIVADVAEN--MSSLLENFEIGKIK  1398
             K        + YPLAG   +++D   V+CND GV ++ A V +N  M   + + ++ ++ 
Sbjct  56    KKSLSETLTLFYPLAGELSSEDDSTFVKCNDNGVLYMEACVKDNVCMDEFIRDLDLSQLI  115

Query  1397  QLTPS-----AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                P      +K    Q + + LV++Q  RF+CGG+AIG  + H + D   ++KF   WA
Sbjct  116   NFLPQHASMGSKMNYGQTL-ETLVSIQATRFNCGGVAIGGVLFHRLLDGDTMSKFFNTWA  174

Query  1232  SFNRGCAANNGSGFVS-DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                RG   N+    +    SS+LFPP        +  KM    I   E+  +V+RFV  A
Sbjct  175   KIARGDFHNDDIASLDFTSSSLLFPPQNLPQEFLETNKM----IFFYEEKSLVRRFVFNA  230

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSC------MVNLRRR  894
              AI  ++  + ++  +V  PSRVEALT  +W  +I AT T     S       +VNLR R
Sbjct  231   RAIEAIK--MKVSSENVPNPSRVEALTTFIWKHLILATRTTKGVSSSPIMVAHVVNLRSR  288

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             ++P L  N  G LV  A     +  D    +    L   +R+ F  +     + + G+  
Sbjct  289   IDPKL-LNAFGNLVFIATSEVIDMSDDDE-LDLPHLFGIVREMFENMNSENLKALQGDDA  346

Query  713   WLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-------N  564
              L  ++    +   L+   D  T   SS C    Y+VDFGWGKP  +   ++        
Sbjct  347   -LDCIVDMATQVGSLLPQLD--TYKFSSWCNFGLYDVDFGWGKPIFIAPFIEPISSLNKQ  403

Query  563   SWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +L  +  N  +E W+    + M  L +D  FL Y S+ P
Sbjct  404   QIILVENGRNDGIEAWILRNNEEMLELEKDEEFLTYASSNP  444



>ref|XP_002514983.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47537.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=442

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 141/465 (30%), Positives = 213/465 (46%), Gaps = 47/465 (10%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV----SGRACHH  1587
             + +  KVE+  K+ ++PSSPTP  LK  K S LDQ         + FY          HH
Sbjct  1     MAMATKVEIIQKDTIKPSSPTPHDLKILKLSLLDQFIPITYTSLLLFYPINYGDDNLDHH  60

Query  1586  TDTIDElkkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
               T ++  K        +   +PLAGR + D  +V C+D+G EFI A V   +S LL+N 
Sbjct  61    ASTSEKSLKLKKSLSETLTHFHPLAGRLR-DNTSVACDDQGAEFIEARVNCLLSELLKNP  119

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             +   + Q  P A    P+     L+ VQ   F CGG+A+G  +SH +ADA+ L  F+  W
Sbjct  120   DAQVLSQFLP-APIESPEAATGNLLLVQATFFDCGGLAVGICISHKMADAATLTTFIRCW  178

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQL-MKMGAEGIEQEEKDMIVKRFVIP  1059
                         S   +D S IL P     S    + + +    +E  ++  + +RFV  
Sbjct  179   ------------SATATDRSKILNPVFMGASIFPPIDISIPRTPVELMQQKCVTRRFVFA  226

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRR  894
             A  IA LR  +  T  +V  P+RVEA++ ++W + + A+      ++ +  S  VN+R R
Sbjct  227   APKIAALRAKVAST--TVPDPTRVEAVSGILWKSAVTASRIRFGYSRPSIWSISVNMRTR  284

Query  893   MEPPLPP----NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
               PP P     NCLG +   A +L     DG       ELV R+R   +   +   +K+ 
Sbjct  285   FVPPFPENYAGNCLGHI---APIL----MDGECEFELKELVGRVRKEIKGFGENYVKKLQ  337

Query  725   GEGGWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN--S  561
             GEG  L AV     E   L  + D+     +S C+   Y+ DFGWGKP  V N      +
Sbjct  338   GEGA-LLAVCGFAKEFGNLAMSNDNDFYICTSWCKYELYDADFGWGKPVWVGNASHKVRN  396

Query  560   WVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
               + +D  +G  +EVW+ L ++ M     +   L +    P   L
Sbjct  397   VAILMDTRDGDGIEVWLTLGEEDMAFFESNEELLEFADINPSVSL  441



>ref|XP_008372855.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=465

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 218/458 (48%), Gaps = 49/458 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-------VSGRACHHT  1584
             MK++V  K+ ++PS PTP  L+N   S  DQL  ++ +P + FY         G+     
Sbjct  30    MKIQVIYKDTIKPSLPTPHHLRNLSLSVFDQLFPDIYVPLLLFYPNDNNKYFEGKHSLVA  89

Query  1583  DTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGK  1404
             +    LKKSLS+ L+  YP AG  + +  ++ CND G  ++ A V   MS +L   E+  
Sbjct  90    ERSKLLKKSLSEALTRFYPYAGNFQHNA-SICCNDHGAAYVEARVNCPMSKILNKPELMI  148

Query  1403  IKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +KQL P+      +  G  L+ V+ N F CGG+AIG   SH +ADA  L+KF   WA+  
Sbjct  149   LKQLLPTVLDSSQEDTG-YLLLVKANFFECGGLAIGVGSSHKVADAYTLSKFTSCWAAIA  207

Query  1223  RGCAANNGSGFVSDH---------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKR  1071
             R      GS  ++DH         ++ LFP +   ++++         +E  ++  I KR
Sbjct  208   R------GSNTITDHIELPDKFGVAASLFPQVDFLNSLQP-------ALEFSQEKCITKR  254

Query  1070  FVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVN  906
             FV  A+ IA L+        +V+ P+RVE ++AL+W   + A+ +     + + LS  VN
Sbjct  255   FVFXASKIAALKS--KAGSATVENPTRVEVVSALIWKCAMEASRSNLGVVRPSELSQFVN  312

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
             +R+ +  PL  N LG LV     LC    +   V     LV + R      K    + + 
Sbjct  313   IRKILVSPLAENLLGNLVG----LCVAKTEASEVDDVQSLVTKFRKEMEEFKVXYGKGIS  368

Query  725   GEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVL  552
             GE         + Y  +  RD       S CR  +YE DFGWGKP  V  +  L N  +L
Sbjct  369   GEEA---CEFYKEYGHLMKRDVDNYNCXSWCRFPFYEADFGWGKPLWVPHIGGLKN-LIL  424

Query  551   FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +D  +G  +E  + L ++ M     ++  L+Y S  P
Sbjct  425   LMDTRDGEGIEASLTLKEEDMAKFESNKELLSYASVNP  462



>ref|XP_002311734.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
 gb|EEE89101.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
Length=439

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 138/452 (31%), Positives = 220/452 (49%), Gaps = 43/452 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR----ACHHTDTI  1575
             M VE+ ++E V+PSSPTP+ L+ +    LDQLA     P V FY + +      H ++ +
Sbjct  1     MAVEIITREAVKPSSPTPDHLREFNLRLLDQLAPVAYEPLVLFYSNFQQKFTVAHKSERL  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
                           YPLAGR K+D  ++ECND G  F+ A V+  +S LLE  +   I++
Sbjct  61    KRSLSETLSR---FYPLAGRIKDD-ASIECNDFGAVFVQARVSCLLSKLLEKPDAEVIRK  116

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P  +   P+ +  +LV VQ N F+CGG+AIG  +SH +AD    + F++ WA+     
Sbjct  117   FIP-IEIESPEELTGSLVLVQANFFACGGLAIGVCISHKVADPVTFSTFIKAWAA-----  170

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                  + F S  S++L  PL + S++   + +       +E      + KR V+ A+ +A
Sbjct  171   -----AAFRSGDSTVL--PLFNASSVFPPQNIPLARPAALEFIRDRCVTKRVVLDASKVA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPL  879
              L+  +     SV  P+RVEA+TAL+W   +NA  + +     + LS  VNLR++M  PL
Sbjct  224   ALQ--VKAVSESVTCPTRVEAVTALIWKCAMNAARSNSEHLRYSILSQSVNLRKKMVRPL  281

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P + +G L         E +     V    LV+++R   +   +   +K+ G+     A+
Sbjct  282   PEHTIGNLAGYFASCATECE-----VELQSLVRQLRKGLQDFGENYLKKL-GKDKASMAI  335

Query  698   IARGYELVRNRDSSTL---YTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAIN  534
                  E        T+    ++S CR+ +Y +DFGWGKP  V        +    +DA +
Sbjct  336   CESFQEAASMLPEGTVDFYVSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKD  395

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G  +E W+ L +  M    +DR  LA  S  P
Sbjct  396   GKGIEAWVTLTEDDMAFFERDRELLAAASFDP  427



>ref|XP_003616843.1| Salutaridinol 7-O-acetyltransferase [Medicago truncatula]
 gb|AES99801.1| transferase family protein [Medicago truncatula]
Length=439

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 131/442 (30%), Positives = 217/442 (49%), Gaps = 23/442 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+E ++PSSPTP  LK Y  SF+D +  +  LP ++FY             +L+
Sbjct  1     MEIELLSRETIKPSSPTPSHLKLYPLSFIDNIVCSNYLPLLYFYNPNGNRDQNSKTSQLR  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+ LS  Y  AGR K D+IT+ECND+GV F+V  V   +S +++N     +  L P 
Sbjct  61    KSLSQLLSKYYHFAGRIK-DKITIECNDQGVLFLVTKVKNKLSEIVQNPTEKLLNPLFPD  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++      + +A+QVN F+CGG+ I   +SH I DA+ +  FM  WA   +    + 
Sbjct  120   ELQWKEMDWRASFIAIQVNWFACGGMVISICISHKIGDAATIFNFMNDWAIIYQKFDEDE  179

Query  1202  GSGF-VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
                  + D    +FP        ++ + +  E + + E ++  KRFV     I  L+   
Sbjct  180   KDLLSLLDAGGTIFP--------QRDLPIFPENVLKRENNVEFKRFVFQPAMIKSLKA--  229

Query  1025  TITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGTLV  852
              +T  S+  P+RV+ + A ++  A  I     QTA+   +VNLR+RM PPL   C+G ++
Sbjct  230   MVTSSSMPSPTRVQVVIAWIYKHAVSIMGLNFQTASFYMVVNLRKRMVPPLSEKCVGNIL  289

Query  851   DEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR--KVYGEGGWLRAVIARGYEL  678
               + ++    K+    +   ELV +I++      D   +  +  G+   L +   +    
Sbjct  290   WFSSMMMTNKKE----MKLEELVCKIKEGLSECCDVYPKMFREIGKNNLLISECLKQATE  345

Query  677   VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSW--VLFLDAING-AVEVWMKL  507
              ++ + +    SS CR   YE DFGWGKP  +     +S   +L +D  +G  +E  + +
Sbjct  346   PQSENKNVFGFSSWCRFPMYEADFGWGKPIWITTTGCSSKNNILLMDTRDGDGIEAVVNM  405

Query  506   PKQVMHTLTQDRHFLAYVSAFP  441
              ++ M     D   L Y S  P
Sbjct  406   EEKYMAKFEHDFELLQYASLNP  427



>ref|XP_004310024.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=447

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 150/463 (32%), Positives = 218/463 (47%), Gaps = 48/463 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI--  1575
             +  +VEV S E ++PSSPTP+ L+++K S+LDQ+   + +P V FY      +  D I  
Sbjct  1     MKFQVEVLSTETIKPSSPTPDHLRHHKLSYLDQIQPPIFMPMVLFYPKEHDHNDLDLISI  60

Query  1574  -----DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEI  1410
                   ++KK+LS TL   YPLAGR    +  V+CNDEG  ++ A     +S ++EN   
Sbjct  61    HEQRCSKIKKALSDTLVKFYPLAGRVHGTQY-VDCNDEGAYYVEAKTDCKLSDIIENPNP  119

Query  1409  GKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
                 +  P    +E     +  V  QV  F+CGG++I   +SH + DA +   F+   A+
Sbjct  120   KDFNKFLP----FELDAAHELPVCFQVTFFACGGMSIAMGMSHKVGDALSYFTFLNGLAA  175

Query  1229  FNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
               RG   N+     FVSD     + P  D S   Q       GI ++  ++  KRFV   
Sbjct  176   EARG-EGNDVCAPVFVSDK----YFPQKDLSGFYQ----HRSGIIKQ--NISTKRFVFDG  224

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVI---------NATPTQTATLSCMVNL  903
               +  +R          +RP+RVEAL+A +W   I           T     T+S  VNL
Sbjct  225   PMVQAIRAKCVDMS---RRPTRVEALSAFIWCRYIASCTSIQQEGVTTDAMYTVSHAVNL  281

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQ---EAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             R RMEPPLP +  G +   AI +     + KDG    T   +V  +R+A + V     RK
Sbjct  282   RTRMEPPLPEHTFGNVTRTAIAVPPVPVDPKDG----TLHGVVNHVREAIKQVDKEYIRK  337

Query  731   VYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSW  558
             +      L  + +R  E+ R    S  +T SLCR   Y+ DFGWGKP  V   +    + 
Sbjct  338   LQEGDAHLNFLRSRTEEVKRGEVVSFSFT-SLCRFPIYDADFGWGKPVYVGSASFTFKNL  396

Query  557   VLFLDA-INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             V F D  +   VE W+ L ++ M    +D   L YVS  P  K
Sbjct  397   VSFFDTNVGDGVEAWINLLEEDMEKFEKDEELLKYVSLAPSYK  439



>ref|XP_006438135.1| hypothetical protein CICLE_v10031490mg [Citrus clementina]
 gb|ESR51375.1| hypothetical protein CICLE_v10031490mg [Citrus clementina]
Length=458

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 228/466 (49%), Gaps = 49/466 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV-----SGRACHHTDT  1578
             MKVE+ SKE ++PSSPTP  LK+YK S LDQ+A       + FY        +  HH   
Sbjct  9     MKVEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHDHHISV  68

Query  1577  ID------ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
                     +LK+SLS+TL+  YPLAGR K D IT++C+D G  ++ A V   +  LL+  
Sbjct  69    YKANKLSLQLKQSLSETLTRFYPLAGRVK-DNITIDCSDHGAVYVEAQVNCLLQDLLKQP  127

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
                 + QL P     E +P    L+ VQ + F+CGG+AIG  +SH IADA+ +  F+  W
Sbjct  128   NGDSVIQLVPIQLAEESKP--GLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSW  185

Query  1235  ASFNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A    G AA +     + S ++S LFPP  D +A   L       +  +EK    KRFV 
Sbjct  186   A----GAAAGDHRRVYYPSYNASSLFPP-RDVTATAMLFLNPPFNMAMKEK-CFTKRFVF  239

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
                 IA L   L+         +R EA+TAL+W   +NA+ + +     + LS  V++R+
Sbjct  240   YGPKIAALEAALSAPS------TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRK  293

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
                PPLP N +G LV        E+      +    LV+ +R   +       +K+  E 
Sbjct  294   ITVPPLPDNSVGNLVGYYASQKDESD-----IQLQGLVRELRKGIQDFSKSYLQKLQRED  348

Query  716   GWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS-----  561
               L A+     +   ++ + D      +SLC ++ Y++DFGWG P  V N+  N+     
Sbjct  349   A-LEAITESCKDAIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAANHKN  407

Query  560   WVLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              V  +D+   +G++E W+ L +  M    +D   L Y + F  P +
Sbjct  408   LVGLIDSSTGDGSIEAWVTLSEADMALFERDPDLLCYAATFDYPSV  453



>ref|XP_009780612.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 132/392 (34%), Positives = 204/392 (52%), Gaps = 28/392 (7%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA-CHHTDTIDElk  1563
             KVE+ SKE+++PSSPT  +LK +K S LDQ++  V +P +FFY       + +  I  LK
Sbjct  4     KVEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDELGNINRSRNIQILK  63

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP-  1386
             KSLS  L+  YPLAGR  ++   ++CND G EFI A V   +S ++E  +  ++++  P 
Sbjct  64    KSLSDALTRFYPLAGRFNDNNF-IDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFLPR  122

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
              A   E   V   L+AVQVN F+CGGIAIG  +SH + D S++  F+  WA+  RG    
Sbjct  123   EASEVENNDV---LLAVQVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARG----  175

Query  1205  NGSGFVSD--HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             N +G      + S +FPPL     + +     + GI+ ++   + +RFV     +  +++
Sbjct  176   NHTGIAQPNFNMSSIFPPLD----LSKSSFKPSIGIKNDK--FLSRRFVFNKEKLDAIKK  229

Query  1031  DLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLPPNC  867
               + +G  V+ P+RVEAL+A +W  +     +N   T+      +VN+R RM P L  N 
Sbjct  230   --SASGSQVKDPTRVEALSAFLWKNLMKVSKLNKDSTKMFAAVHVVNIRSRMNPTLSDNS  287

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
              G L   A        +   +    +L+  +R A R + + +  ++   G      I++ 
Sbjct  288   FGNLWTTAPAFLSPKSE--EIFGIDDLLYHLRSAIRKI-NSDYTEILQNGEEFLKHISKF  344

Query  686   YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
              EL    +      SS CR   YEVDFGWGKP
Sbjct  345   AELFSKEEVEFYNFSSWCRFPVYEVDFGWGKP  376



>ref|XP_011101100.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=462

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 144/472 (31%), Positives = 221/472 (47%), Gaps = 66/472 (14%)
 Frame = -3

Query  1733  EVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS-GRACHHTDTIDElkk-  1560
             E+ S+E ++PSSPTP   + YK S LDQ+   + +P V +Y +        D I +  + 
Sbjct  6     EIISREHIKPSSPTPLEQRTYKLSLLDQIVPPIYVPLVLYYPNLENTPKDPDFISQTTQI  65

Query  1559  ---slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
                SLS TL+  YPLAGR K D+++++CNDEGV F+V      +S  L+N +    +   
Sbjct  66    LRQSLSATLTRFYPLAGRIK-DKLSIDCNDEGVPFVVTKFNTRLSDFLKNPDSQVCRGHI  124

Query  1388  PSA-KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             PS   + EP P G  +  +QVN F CGGIA+G    H +AD   +  FM+ WA+  RG  
Sbjct  125   PSPLTWAEPGP-GSNVALIQVNFFDCGGIAVGSLFLHKVADGVTIGTFMKAWAAAARGSV  183

Query  1211  ANNGSGFVSDHSSILFPPLTDT--------SAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                      D+++  F P  +T        SA+ Q  K G           +++R+V  A
Sbjct  184   ET----VSPDYAAQSFFPQNETMKRESHLFSAMRQYFKFGK---------TVMRRYVFDA  230

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVI-------NATPTQTATLSCMVNLRR  897
              AI+ LR  L+ T G  QRPS+VE ++AL+W   I       N  PT T+ ++  VN+RR
Sbjct  231   LAISALRAKLSSTEGLKQRPSKVEVVSALLWKCFIIASNKSSNNHPT-TSLVTHGVNMRR  289

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             + EPP P +  G  V    ++   + +  T      L  ++R+    V     +++ GE 
Sbjct  290   KAEPPFPEHSFGNFV---WLVPASSTNDHTDADLENLFSKVRNTISTVDVEFVKRMQGES  346

Query  716   GWLRAVIARGYELVRNRDSS---------TLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN  564
             G+L      GY   +N + S          L  SS C    Y +DFG G+P  +      
Sbjct  347   GFL------GY--CKNLEESWKGFPENADYLAISSWCNFGLYSIDFGLGRPIWISKCDAG  398

Query  563   SWV--LFLDAI-------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             S V   F++ +        G +E W+ L +  +    + +      S  P P
Sbjct  399   SEVDWPFINVLWLMDTRQGGGIEAWLTLDEHYIEAFDKIQELRDLASVDPSP  450



>ref|XP_011083978.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=435

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/450 (30%), Positives = 220/450 (49%), Gaps = 34/450 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MK++  S +++RPSSPTP  L+++  SF+DQ      +P V +Y       + +   E+ 
Sbjct  1     MKIKTASTQLIRPSSPTPPQLRHFNLSFIDQRIPPSYVPLVLYYNVSTEERYINKQPEMS  60

Query  1562  ----kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
                  S+S  L L YPLAGR  E +  V+CNDEG+ +I A     +S ++ + +   +  
Sbjct  61    RRLKSSMSDALVLFYPLAGRILEGQPLVDCNDEGILYIEATADGKISDIVRSPDTRTLDN  120

Query  1394  LTPSAKFYEPQPVGKA--LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             L P   F     +  A  L+AVQ   F+CGGI+IG  +SH+IADA++L+ F+  WA+   
Sbjct  121   LIP---FKSNGSISNAEELLAVQATLFNCGGISIGICISHSIADAASLSSFINCWAAIAA  177

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G   N  S     +S+  FPPL           +    I+    +++++R +   +AI  
Sbjct  178   GEQPNVVSPVF--NSATFFPPLNTPDFRPNFRNL---AIQAPPVNLVMERLLFTPSAIDA  232

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCM---VNLRRRMEPPLPPN  870
             L+Q +     S+ +P+RVE +TA +W+  + A   + +  S     VNLR R+ P L   
Sbjct  233   LKQKVAENKSSIVKPTRVEVVTAFLWSRCLVAKGLELSHKSVAFHPVNLRGRV-PGLTER  291

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G +      +      G T  T   LV+++R AF  +     + + GE G    V   
Sbjct  292   SFGNIFQ----MTHAEVVGETNWTG--LVEKLRAAFGKIDSEYVKMLLGEKGC--EVAKE  343

Query  689   GYELVRN----RDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI--N  534
              ++ + +     + + L  SS CR   YEVDFGWGKP  V   +      ++  D++   
Sbjct  344   NFQGISSFLTLGNVAVLLFSSYCRFPIYEVDFGWGKPAWVSSASFSIKDMIMLFDSVVSR  403

Query  533   GAVEVWMKLPKQVMHTLTQDRHFLAYVSAF  444
             G +EVW+ + +Q M  L QD     + S+F
Sbjct  404   GGIEVWIVMAEQEMDRLRQDSDIQHFTSSF  433



>emb|CDP07885.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 142/458 (31%), Positives = 218/458 (48%), Gaps = 37/458 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRL-PFVFFYVSGRACHHTDTIDEl  1566
             +++E+ S+E ++P SPTP   K +K S LDQL  ++ + P V+F+ +      +   + L
Sbjct  4     LEIEIISREYIKPESPTPNDFKTFKISLLDQLLPHLYVVPLVYFFKNDGKSDISKRRELL  63

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K+SLSKTL   YPLAG+ K D + V+CND+G+ ++ A V   +S  L + +   I  L P
Sbjct  64    KQSLSKTLVHFYPLAGKVK-DNLHVDCNDDGMYYVEARVNAQLSDFLGHPQQELIHGLLP  122

Query  1385  SAKFYEPQPV---GKALVA-VQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
                 + P       K  VA VQVN F CGGIAIG + SH + D  +   FM  WA+   G
Sbjct  123   ----FHPSSTELFTKTYVAMVQVNIFECGGIAIGIYSSHKVMDGQSTVTFMNAWAATASG  178

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              +      F+S  SSI  P     +A   L+       + E+     +RFV  A+A+  L
Sbjct  179   SSEEIHPSFIS--SSIFHPNPKLPNATSILIPPP----QSEQSKSATRRFVFDASALNVL  232

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPPLPP  873
             + +      +V  PSRV A   L+W   I  +       + + L+ +VNLR R  PPLPP
Sbjct  233   KNNANCAESNVTNPSRVTAAMGLIWQCAIATSQARFGFRKPSILTFVVNLRSRNSPPLPP  292

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
               +G +       C    D    +    +V+R+R+    + +     + G+ G L  V+ 
Sbjct  293   YSMGNIFWVTYAKCLVNSD----LKLPSMVRRVRNGIDKLDNSFLEDIKGKDGSLVNVMK  348

Query  692   RGYEL----VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV------VNMLD-NSWVLFL  546
                EL      N D+  L  SS+C    Y  DFGWGKP         ++ L   + V+F+
Sbjct  349   HLKELEEVHTGNLDTEYLSLSSICNGGIYNADFGWGKPIWTCIGSAGIDALGLPNLVVFM  408

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             D  +G  +E W+ L +  M    +    L + +  P P
Sbjct  409   DTRSGDGIEAWVTLKENDMAIFEKIPELLNFATLDPSP  446



>ref|XP_010556178.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
Length=478

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/458 (32%), Positives = 233/458 (51%), Gaps = 36/458 (8%)
 Frame = -3

Query  1751  QITMKVEVRSKEIVRPSSPTPESLKN---YKFSFLDQLALNVRLPFVFFYVSGRACHHTD  1581
             ++  +V V S+E+++PSS T +   +   +  SFLDQLA  + +PFVFFY +G      +
Sbjct  29    EMEFQVSVISRELIKPSSATHDDDGDRLLHHLSFLDQLAPPIFMPFVFFYTNGENLTRQE  88

Query  1580  TIDElkkslsktlsLMYPLAGRAKEDRIT--VECNDEGVEFIVADVAENMSSLLENFEIG  1407
               D +K+SLS+TL+L YPLAGR +    +  VECN EGV FI A      S +LEN    
Sbjct  89    RTDRIKRSLSETLNLFYPLAGRVRNSNGSCYVECNGEGVPFIEAKAGIRASQILENPNPN  148

Query  1406  KIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
             ++ +  P    +E   V +  + VQV  F  GGIA+G    H + DA +  +F+  WA+ 
Sbjct  149   ELNKFLP----FEFHEVSEVALTVQVTSFESGGIALGIGFCHKLCDAFSGLEFVRNWAAI  204

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
              R  + N  +  + D S +   P  D S ++      + GI +E  +++ +RFV   +++
Sbjct  205   ARRDSENVDAPCL-DLSKMF--PQCDMSDLDM-----STGIMKE--NILTRRFVFLNSSV  254

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVI-----NATPTQTATLSCM---VNLRRRM  891
               LR+    +GG+V R +RVEAL+  +W+  +        P +   +  M   VNLR++ 
Sbjct  255   ESLRE--RFSGGNV-RATRVEALSVFIWSRFMASIGAEGNPDRNGKIYTMLHPVNLRKQA  311

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE-GG  714
             EP +P N  G L+  ++ + + ++D     T   +V+++R   + +  G  +K+  +   
Sbjct  312   EPAMPDNLFGNLMRFSVTVPKISRDIDD-ETGCSIVKQMRKEIKRIDAGYVKKLQEDRQE  370

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDA  540
              L  +  +    VR    S  +T SLC    YE DFGWGKP  V +  M   + V F D 
Sbjct  371   HLEFLKRQASGFVRGEIVSFSFT-SLCNFPLYESDFGWGKPSWVASARMSFKNLVAFFDT  429

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
               G  +E W+ L +  M     D+  L+YVS+ P   L
Sbjct  430   KQGDGIEAWINLDEVDMSRFESDQELLSYVSSDPSVNL  467



>ref|XP_011021361.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=445

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/449 (32%), Positives = 221/449 (49%), Gaps = 36/449 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS-GRACHHTDTIDEl  1566
             + VE+ ++E++RPSSPT   L+ +  S LDQLA     P V  Y +  +    T     L
Sbjct  6     VNVEIVAREVIRPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQQLAGTHESQRL  65

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K+SLS+TL+  YPLAGR K D  ++ECND G  F+ + V+  +S  LE  +   I++  P
Sbjct  66    KRSLSETLTRFYPLAGRIK-DGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKFIP  124

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               +   P+ +  +LV VQ N F+CGG+AIG  +SH  AD    + F++ WA+        
Sbjct  125   -VETESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAA--------  175

Query  1205  NGSGFVS-DHSSILFPPLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
               + F S D S++L  PL + S++   + L       +E      + KR V  A+ IA L
Sbjct  176   --AAFRSVDDSTVL--PLFNASSLFPPQNLPLTRPAAVELMNDKCVTKRLVFDASKIAAL  231

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLPP  873
             +        SV  P+RVEA+TAL+W   +NA+ + +     + LS  VNLR RM PPLP 
Sbjct  232   QAK--AVSESVTCPTRVEAVTALIWKCAMNASRSNSEHLRYSILSQSVNLRERMVPPLPE  289

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL--RAV  699
             N +G LV        E +     +    LV ++R       +    K+  +  ++  R  
Sbjct  290   NTIGNLVGYFASCATECE-----IELQSLVGQLRKGLLDFGENYVEKLGEDKAFMAVRES  344

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING-A  528
                   +++  +     ++  CR  +Y +DFGWGKP  V      + +    +D  +G  
Sbjct  345   FQEAGSMLQEGNVDFYASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMDTRDGEG  404

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             VE W+ L ++ M    +DR  LA  S  P
Sbjct  405   VEAWVTLTEEDMAFFERDRELLAAASLDP  433



>ref|XP_009602470.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=412

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 134/431 (31%), Positives = 224/431 (52%), Gaps = 35/431 (8%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRA-CHHTDTIDElk  1563
             KVE+ SKE+++PSSPT  +L+ +K S +DQ++  V +P +FFY       + +  +  LK
Sbjct  4     KVEIISKEMIKPSSPTTSTLRTHKLSLVDQISPPVFIPLIFFYQDELGNINRSRKLQLLK  63

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP-  1386
             KSLS  L   YPLAGR  ++   ++CND G EFI A V   +S ++E  ++  +++  P 
Sbjct  64    KSLSDALMRFYPLAGRFNDNNF-IDCNDAGAEFIEAQVHGYLSQVIETPKMEDLREFLPR  122

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
              A   E   V   L+AVQVN F CGGIAIG  +SH + D S++  F+  W++  RG    
Sbjct  123   EACVVENNDV---LLAVQVNLFDCGGIAIGICMSHKVGDGSSIVTFINAWSAIARG----  175

Query  1205  NGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
               +G V  + ++  +FPPL  +++  +     + GI+ ++  ++ +RFV     +  +++
Sbjct  176   -DTGIVQPNFNLSSIFPPLDLSNSSFK----PSIGIKNDK--LMTRRFVFDKEKLDAIKK  228

Query  1031  DLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLPPNC  867
               + +G  V+ P+RVEAL+A VW  +     +N   T+       VN+R RM P LP + 
Sbjct  229   --SASGSQVKDPTRVEALSAFVWKHLMEVSKLNRDSTKMFAAVHAVNIRSRMNPTLPDHS  286

Query  866   LGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              G L   A+  L  E+++    +   +L+  +R A R + + +  ++   G      +++
Sbjct  287   FGNLWTTALAFLSPESEE----IEIGDLLHHLRCAIRNI-NSDYIEILQNGQEFLKHMSK  341

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAVEV  519
               EL    +      SS CR   YEVDFGWGKP  V       +N+ +         +E 
Sbjct  342   LAELFSKEEVEFYNFSSWCRFPVYEVDFGWGKPVWVCTATFPYENTVIFVGTKCGEGIEA  401

Query  518   WMKLPKQVMHT  486
             W+ + +  + T
Sbjct  402   WVNMLEDEIST  412



>ref|XP_011101142.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=447

 Score =   182 bits (463),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 134/466 (29%), Positives = 223/466 (48%), Gaps = 55/466 (12%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + M VE+ S E ++PS PTP  L+N+K   LDQL      P V +Y +  A  H + ++ 
Sbjct  1     MIMDVEIISVERIKPSFPTPNHLRNFKLCVLDQLIPAAYGPVVVYYPNEGAASHFEVLER  60

Query  1568  lkkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
                        +   +PLAG  ++D ++++C+D G  F  A V   ++  LE+ ++  I 
Sbjct  61    FAVLKKSLSETLTGFFPLAGTIRDD-VSIDCDDHGACFTTAKVKCTLTEFLESPDLKMIA  119

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL P       +  G  +  VQ + F+CGGIA+G  +SH I D +AL+ F++ W +    
Sbjct  120   QLLPCGL----KSAGACVTNVQASEFACGGIAVGLCISHRILDGTALSTFLKSWGT----  171

Query  1217  CAANNGSGFVS-DHS-SILFPP----LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
              A+++    VS D S S LFP     L D S       M   G   ++   + +RF+   
Sbjct  172   AASSSVEKLVSPDFSASALFPAAGVWLKDAS-------MAMWGSLFKKGQFVTRRFMFDG  224

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRM  891
             +AIA L+ D+        +P+RVEA++  +W   + A+       + + L+ +VNLR+R 
Sbjct  225   SAIASLK-DMATGTSRTGKPTRVEAVSGFIWKCAMAASEERFGCKRPSLLTHIVNLRKRA  283

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTV-VTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
              P      LG L    I +      GGT  +   ELV  IR +   +     +K+ G+ G
Sbjct  284   APNFSEQSLGNL----IWMTSAKFTGGTENLEFPELVDEIRRSISKIDADYVKKLQGDEG  339

Query  713   ------WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVL  552
                   +L+ ++        ++D      +S C++ +Y+VDFGWGKP + V+ +D+S   
Sbjct  340   SNMMQKYLKEIVE-----FSSKDVDYFGFTSWCKLGFYDVDFGWGKP-VWVSSIDSSGPF  393

Query  551   FLDA-------INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             F++            +E W+ L +Q M  L  ++ F  + S  P P
Sbjct  394   FMNLSVLMDSRCGDGIEAWVTLDEQEMVILEGNQEFKIFASLNPSP  439



>gb|KDO48724.1| hypothetical protein CISIN_1g047399mg [Citrus sinensis]
Length=399

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 144/458 (31%), Positives = 212/458 (46%), Gaps = 85/458 (19%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---  1578
             + + VE  SKE+++PS+PTP  L++Y+FS LDQ+   V +  ++FY       H D    
Sbjct  1     MKIDVETMSKEMIKPSTPTPSQLRHYQFSHLDQIGPPVYISLLYFY-------HLDDHKL  53

Query  1577  -------IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
                     + LK SLS  L+  YPLAGR K +   V+CNDEGV F  A   + +S     
Sbjct  54    VSNNHLFSNSLKSSLSNVLTKYYPLAGRIKNNY--VDCNDEGVVFSEAKEKDVVS-----  106

Query  1418  FEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
                                 V    +A+QVN F+CG +AI   +SH I D S+L  F + 
Sbjct  107   --------------------VDGLAIAIQVNIFNCGNVAIAVMISHRIEDGSSLITFTKT  146

Query  1238  WASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             WA+  RG + N    FV   ++ LFPP     +            +   K +++K+F+  
Sbjct  147   WAAVARGESENILPEFV---AAKLFPPKDAGGS-------SGTSFDPRPKKVVLKKFLFE  196

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRR  894
              + I  LR    +   ++  P+RVEAL+A +W+ +     I  +P +   L   VNLR+R
Sbjct  197   GSKITTLRDKYGL--DNLIYPTRVEALSAFLWSRLAASTRIKVSPERPCMLVHAVNLRKR  254

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAV-KDGEARKVYGEG  717
             MEP LP +  G L   A+ + +E  D         +V + RDA   + KD    K     
Sbjct  255   MEPQLPADSFGNLFAFAVTILEENHDN-------RMVNKFRDAIGKIDKDYLKAKNVEHS  307

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSW-------  558
               +   I  G E     +      SSLC+   YE DFG GKP  V      +W       
Sbjct  308   ELIDLAITNG-ERFDKVELGYCIISSLCKFPVYEADFGLGKPISV------AWGCFPYKN  360

Query  557   -VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              + F+D  +G  +EVW+ L ++VM     D+  LAYVS
Sbjct  361   VIHFMDTKSGDGIEVWVHLEEEVMAIFENDQELLAYVS  398



>ref|XP_008372831.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
 ref|XP_008346322.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=446

 Score =   182 bits (463),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 134/443 (30%), Positives = 230/443 (52%), Gaps = 31/443 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+ E+  +E ++PSSPTP+ L+N+K S L+QL+       V FY          ++  LK
Sbjct  1     MEFEMIKRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFYPRNDXTTPQISLRILK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL   YPLAGR K D I+V+CND GV+++ A V   +S+ L   + G ++QL P 
Sbjct  61    KSLSETLVRFYPLAGRMK-DNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGTLRQLLP-  118

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                  P+    AL+ VQ N F CGG+AIG  +SH +ADA++L+ F+  W++   G +   
Sbjct  119   VXTESPEAGKGALLLVQANVFGCGGLAIGICMSHKLADAASLSTFIMSWSATALGFSQAL  178

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                F    +S  FPP+  +S+  Q     +  ++ + ++ + KRFV  A+ I+ LR    
Sbjct  179   LPDFT---ASFRFPPIDYSSSFHQ-----SSPVDAKRENCVTKRFVFNASKISALRTKAA  230

Query  1022  ITGGSVQRPSRVEALTALVWAAVINAT--------PTQTATLSCMVNLRRRMEPPLPPNC  867
              T   V +P++ EA+TAL+W   + A+        P + + LS  V++R+ + PPL  + 
Sbjct  231   ST--IVDQPTQAEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVVPPLSDDS  288

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G L+        E +     +    LV ++R   + + +  A++   +     +V    
Sbjct  289   IGNLMGYFAAQTDENE-----LELQGLVAQLRRGIKELSNNYAKRPGKDQAIRESVKEVH  343

Query  686   YELVRNRDSSTLYTSSLC--RMAYYEVDFGWGKPRLVVNM--LDNSWVLFLDAI--NGAV  525
                V+  D+++ Y  +        YEV+FGWGKP  + N+    ++ V +L +   +  +
Sbjct  344   NNFVKRDDTTSFYVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLVSTRKDDGI  403

Query  524   EVWMKLPKQVMHTLTQDRHFLAY  456
             E W+ L ++ M    +++  LA+
Sbjct  404   EAWVTLSEEDMAAFERNQELLAF  426



>ref|XP_007158727.1| hypothetical protein PHAVU_002G177000g [Phaseolus vulgaris]
 gb|ESW30721.1| hypothetical protein PHAVU_002G177000g [Phaseolus vulgaris]
Length=449

 Score =   182 bits (463),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 141/447 (32%), Positives = 210/447 (47%), Gaps = 26/447 (6%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRAC--HHTDTIDEl  1566
             K+E+ S+E ++PS  TP  LK Y   F+D +     +P + FY +      HH   I  L
Sbjct  12    KMELVSRETIKPSIATPPHLKIYPLCFIDNIVFRNYIPILLFYSANHHSKNHHESKISTL  71

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKSLS+ LS  YP AG  + D++++ECND+GV F+V   A N+SS+L N       +L P
Sbjct  72    KKSLSQVLSRYYPFAGMLR-DQLSIECNDQGVSFLVTSFACNLSSILHNPNHASFHRLFP  130

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
                 ++P      +VA+Q+N F+CGGI I   + H +ADA+ L  F+  WA F+R    +
Sbjct  131   DQLQWKPMEPTSTIVAIQINCFACGGIVISVCMCHKVADAATLCNFINDWAMFSRQ-NQD  189

Query  1205  NGSGFVSDHSSILFP-PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
                      SS+ FP P       E L         +   D + +RFV     I  L+  
Sbjct  190   QQEEQEKLLSSLPFPVPGASFLPQENLPVFPETAFVK--NDTVCRRFVFEGAKIDSLKA-  246

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINA--TPTQTATLSCMVNLRRRMEPPLPPNCLGTL  855
               ++   V  P+RVE ++AL++   +++     +T      VNLR R  PPLP   LG L
Sbjct  247   -MVSSRDVHNPTRVEVVSALIYNRAVSSLGLTFKTMPFRTAVNLRNRTVPPLPEKSLGNL  305

Query  854   VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELV  675
             V    V      + G      ELV +++   R  +D   +K  G+    R +     +  
Sbjct  306   VWFLFV-----SNLGEETELQELVVKMKQGLREFRDTFGKKFGGKNKDSRFITECLEQAT  360

Query  674   RNRD-----SSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING-AVE  522
             R  +      S +  +S CR   YE DFGWGKP         + NS VL +D  +G  +E
Sbjct  361   RVPEGGGCVESLVCCASWCRFPMYEADFGWGKPVWFSTSECPVKNSVVL-MDTRDGEGIE  419

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               + + +  M    +D H L Y S  P
Sbjct  420   ALVNMEEHDMAKFERDFHLLQYASLNP  446



>ref|XP_002315640.2| hypothetical protein POPTR_0010s06380g [Populus trichocarpa]
 gb|EEF01811.2| hypothetical protein POPTR_0010s06380g [Populus trichocarpa]
Length=394

 Score =   181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 141/442 (32%), Positives = 227/442 (51%), Gaps = 63/442 (14%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR--ACHHTDTI  1575
             + +++EV S EI++PSSPTP+ L++Y+ SFLDQ++     P + FY +      ++ +  
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPLLLFYPADGDVKINNIEKP  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             ++LK+SLS+ L+L YPLAGR K D + VECNDEG+ F  A+V   +  ++EN E  ++ +
Sbjct  61    NQLKQSLSEVLNLYYPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVENPEPSELNK  119

Query  1394  LTPSA-KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             L P A    E  P+G     +Q N F CGGI IG  +SH + DAS+L  F++ WA+  RG
Sbjct  120   LIPFALDDAEELPLG-----IQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATARG  174

Query  1217  CAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
              A + +   F+   S+ LFPP+ + S  +      A GI +E  D++ KRFV  +++I  
Sbjct  175   EADHISRPEFI---SATLFPPI-NISGFKP-----ATGITKE--DVVTKRFVFRSSSIEL  223

Query  1040  LRQDLTITGGSVQR---PSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPN  870
             L++  +   GS++    PSRVEAL+  +W     AT  ++                  P 
Sbjct  224   LKEKCSPASGSLENQRPPSRVEALSVFIWQRFTAATKVESR-----------------PE  266

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              + ++ +                    LV +IRD+   V     +K+      L  +  +
Sbjct  267   RIYSMEN------------------YNLVSQIRDSIGKVDKEYVKKLQKGSEHLGFMKEQ  308

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-AVEV  519
                 +R  +  TL  +SLCR   YE DFGW KP  V   ++   + V+F+D  +G  +E 
Sbjct  309   AARFLRG-EVVTLNFTSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDTASGDGIEA  367

Query  518   WMKLPKQVMHTLTQDRHFLAYV  453
              + L ++ M    +D   L Y+
Sbjct  368   LVHLKEEDMAKFEEDEELLQYI  389



>gb|KEH20539.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=453

 Score =   182 bits (463),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 133/446 (30%), Positives = 219/446 (49%), Gaps = 24/446 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++E+ S+E ++PSSPTP  L+ Y  SF+D +   + +P +FFY           +  L+
Sbjct  1     MEIELISRETIKPSSPTPTHLRIYPLSFIDNIFFRLYVPVIFFYNPNECSDQNSKVSLLR  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+ LS  YP AGR K D+IT+ECND+GV F+V  +   +S +L+N     +  L P 
Sbjct  61    KSLSQLLSKYYPFAGRLK-DKITIECNDQGVSFLVTKIKNKLSEILKNPTDKILNPLFPD  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++       L+AVQ+N F+CGG+AI   +SH I DAS +  FM  W+  N+      
Sbjct  120   KLQWKDMDWSDTLIAVQINCFACGGMAISICMSHKIGDASTIFNFMNDWSIINQKLQEEE  179

Query  1202  GSGFVSDHSSILFP-PLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                   D   ++ P PL D  A    ++ + +  E +   + +++ KRFV   + I  L+
Sbjct  180   -----EDKGLLVLPFPLLDGGASVFPQRDLTIFPELVLTRKNNVVCKRFVFQPSMIKSLK  234

Query  1034  QDLTITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPPNCLG  861
               +  +      PSRV+A+TA ++  A  +     QTA  S  V+LR+RM P L   C+G
Sbjct  235   A-MATSSSMHSPPSRVQAVTAWIYKRAVSLMGLNFQTALFSMGVDLRKRMVPALSEKCVG  293

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYE  681
              +V  + ++  + +     +   ELV +I++      D        +     ++I+   +
Sbjct  294   NIVWFSSMVADKKE-----MELHELVSKIKEGLSQFGDFIPETFGAKENENLSLISECLK  348

Query  680   LVR--NRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEV  519
              V   + ++  L+T SS CR   YE +FGWG P  V     +S   +  +D  +G  +E 
Sbjct  349   QVTEPHPENENLFTFSSWCRFPMYETNFGWGNPTWVTTFGCSSRNIIFLMDTKDGEGIEA  408

Query  518   WMKLPKQVMHTLTQDRHFLAYVSAFP  441
              + +    M     +   L + S  P
Sbjct  409   IVNMEDNYMTKFEHEVELLRHASLNP  434



>ref|XP_006432232.1| hypothetical protein CICLE_v10001086mg [Citrus clementina]
 gb|ESR45472.1| hypothetical protein CICLE_v10001086mg [Citrus clementina]
Length=460

 Score =   182 bits (463),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 143/468 (31%), Positives = 225/468 (48%), Gaps = 45/468 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTID--  1572
             M+VE+ S+E ++PSSPTP  LK++K   LDQ   N+ +P V +Y ++      T  ID  
Sbjct  1     MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  60

Query  1571  ------ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEI  1410
                   +LK+SLS+ L   YPLAG+   +  +V+CNDEGV F+ A    +++  L   + 
Sbjct  61    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  119

Query  1409  GKIKQLTP-SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               I +  P        Q  G  +  VQV  F+CGG+ I   +SHA  D ++ + FM+ WA
Sbjct  120   NLIYKFFPVDGNEQRGQIAGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMKAWA  179

Query  1232  SFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQ--EEKDMIVKRFV  1065
             +  R   +   + ++  +  +S LFPP  D     QL         +  E    +V+RFV
Sbjct  180   ATARNKTSEEEAIYICPNYDASSLFPP-NDGDLFHQLKATSRASFGRFFETGKFVVRRFV  238

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLR  900
               A A A+L+         VQ P+RVE ++A +  +V+ A  T++ +     LS  VNLR
Sbjct  239   FDAKATAELKA--KAKSSRVQNPTRVEVVSATLSKSVMTAFKTRSGSLKPTLLSHAVNLR  296

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              +  PPL  N +G +V +   LC E +     V    LV ++R+A         + + G 
Sbjct  297   SKARPPLSENLIGNIVWKTNALCTEEE-----VDLDVLVWQLREALSKFDGDFVKSLQGV  351

Query  719   GGWLR-----AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-------  576
             GG L+        A  Y   +N+    +  SS C   +Y +DFGWGKP  V         
Sbjct  352   GGLLKLSEDIKCEAEAYSDAKNK----IMFSSWCTFGFYGIDFGWGKPIWVSGACLGGSI  407

Query  575   MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +  +  ++ +D+ +G  +E W+ L ++ M  L  D   L   +  P P
Sbjct  408   VQSSPTIILMDSRSGNGIEAWVLLLEEDMALLEVDEKLLEVATIDPSP  455



>gb|KDO85073.1| hypothetical protein CISIN_1g044625mg [Citrus sinensis]
Length=472

 Score =   182 bits (463),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 220/479 (46%), Gaps = 55/479 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDEl-  1566
             M+VE+ SKE ++PSSPT   L+ +K S LD       +P V +Y   +     + ID+  
Sbjct  1     MEVEILSKECIKPSSPTAHHLETHKLSLLDLYLPPAYIPLVLYYPMNQQHSSANIIDDHI  60

Query  1565  --------kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEI  1410
                     K++LS+TLSL YPLAG+ K D  +++CNDEG+ FI A     +   L    I
Sbjct  61    ISTRLQLLKQALSETLSLFYPLAGKIK-DLHSIDCNDEGIYFIEARAKSPLDEFLNLPSI  119

Query  1409  GKIKQLTPS---AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
               IK+  P    AK+      G  + +VQV  FSCGG+ IG +VSH I D +A + F++ 
Sbjct  120   SLIKEFLPDPDDAKWRSIPTPGDYVASVQVTTFSCGGMTIGAYVSHMIGDGTAFSLFLKS  179

Query  1238  WASFNRGCAANNGSGFVSDHSSILFPPLTDTS-AIEQLMKMGAEGIEQEEKD--------  1086
             WA+     + N  S      +++L  P  D S +  Q      +      +         
Sbjct  180   WAAATARKSYNEES-----EAALLLSPKFDASLSFPQNDAYPRQACSTSIRSNLPIKFGR  234

Query  1085  MIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-------  927
              + +RF+  A+AIA L+      G +VQ P+RVEA+T L+   ++ A+ TQ         
Sbjct  235   CVCRRFLFDASAIANLKAK--AKGSTVQNPTRVEAVTTLLGKCIMAASKTQARSSSSDRD  292

Query  926   -----TLSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAF  762
                   L   VNLR R  PP   N +G  +  A  LC+  ++         LV ++R+A 
Sbjct  293   SDKPFALIHAVNLRGRATPPFSENYMGNFIWMASALCKTEEEP----ELQGLVCQLREAI  348

Query  761   RAVKDGEARKVYGEGGWLRAVIARGYEL-VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL  585
               +       + G+ G L  + A  YE     R +  +  SS C   +YE+DFGWGKP  
Sbjct  349   AKLNGDFVNSLQGDEGLLNFLEALKYERETYTRAADRIAYSSWCNFGFYEIDFGWGKPIW  408

Query  584   V---------VNMLDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
                          + N+ +L    +   +E W+ L +  M  L  D+  L Y +  P P
Sbjct  409   ASVTGPPESPATAILNAILLMDTNMGNGIEAWVYLHEDTMAILQVDQQLLQYATVDPSP  467



>ref|XP_008372858.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=440

 Score =   182 bits (461),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 133/454 (29%), Positives = 208/454 (46%), Gaps = 42/454 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV+V +KE ++PSSPTP  L+N + SF DQ    + +P + FY +       D  +   
Sbjct  5     MKVQVLNKETIKPSSPTPPDLRNLRLSFFDQFEPEIFIPLLLFYRNKPCAAVADDQERSX  64

Query  1562  kslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
                +     +   YP AG  + +  ++ CND GV F+ A V   MS + +  +   ++QL
Sbjct  65    FLKTSLSEALTXFYPFAGEFQRND-SIXCNDHGVAFLQAQVNCYMSMVFDKPDDXILEQL  123

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P+ K          L+ +Q N F CGG+AIG   +H ++DA  + KF+E WA+   G A
Sbjct  124   VPTDK-ESTLSNTDYLLLIQANFFECGGLAIGVSFAHKVSDAFTICKFIERWAAIALGSA  182

Query  1211  ANNGSGFVSDH----------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             +       +DH          S+ LFPPL   ++ +  + +  EG          +RFV 
Sbjct  183   ST-----TTDHHXVLXGEFGVSASLFPPLDIFNSPDFAVTLSTEG-------SXTRRFVF  230

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRR  897
              A+ IA L+        +   P+RVE ++AL+W   I A+ +     + + L  +VN+R+
Sbjct  231   DASKIATLKSK---AASTTPNPTRVEVVSALIWKCAIQASRSKLGIIKPSMLCPIVNMRK  287

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             R    L  N LG  V     +  E +     +    LV ++R       +     V G  
Sbjct  288   RSRQALAENILGNCVWSFAAMTVEXE-----IEHESLVAKLRKGIEEHXEKYPNGVSGND  342

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVLFLDA  540
                 A  + G +L+ + D      SS CR ++YE DFGWGKP  V V  L  + +L +D 
Sbjct  343   IIEAAKESGGSKLLDSDDIDIYTCSSWCRFSFYEADFGWGKPSWVSVRSLYKNTILLMDM  402

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E  + L +  M         LAY S  P
Sbjct  403   RDGDGIEASLTLKEDDMAXFENSEELLAYASPNP  436



>ref|XP_010528792.1| PREDICTED: BAHD acyltransferase At5g47980-like [Tarenaya hassleriana]
Length=447

 Score =   182 bits (461),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 226/463 (49%), Gaps = 43/463 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHT-------  1584
             MKVE   KE ++PSSPTP  L+  K S  DQ    V    V F+    +C H        
Sbjct  1     MKVEAIGKETIKPSSPTPNDLRTVKLSVYDQFLPPVYTVSVLFF--SNSCRHDQTQREGP  58

Query  1583  -----DTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN  1419
                  DT  +LK SLS+TL+  YPL+GR  +    ++CNDEG  F+ A     +   L++
Sbjct  59    MFSEHDTSLKLKSSLSETLTRFYPLSGRINDGGDAIDCNDEGAVFVDARSDSTLLDFLKS  118

Query  1418  FEIGKIKQLTPSAKFYEPQPVGKA--LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFM  1245
              +   +++  P      P        L+ V+   F CGG+AIG  +SH IADA++++ F+
Sbjct  119   PDFAALQRFLPLDTVENPYESAATWPLLLVKATYFKCGGLAIGICISHKIADAASISMFV  178

Query  1244  EIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
               WA+  RG   ++ + +    ++  FPP ++++         +  I  + K    KRFV
Sbjct  179   RGWAATARG--DSDSATYPEFTAAKFFPPASESTRF-------SGKITLDRKICATKRFV  229

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLR  900
                + IA+LR+   +  G V  P+RVE++T L+W  V+ A+ +      +  L+  VNLR
Sbjct  230   FDGSKIAELRR--KVASGDVAEPTRVESITGLLWKCVVTASNSVSEKLLSKVLNQPVNLR  287

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAF-RAVKDGEARKVYG  723
              ++   L  N +G ++  ++ L  + +    +  AV+ ++R  D   R ++D     + G
Sbjct  288   GKVPSLLSENVMGNVMYSSMPLMIDGQGEVEIQDAVKDLRRKADELKRFIRDDGGSSLIG  347

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN----MLDNSWV  555
                 +  +I      +          SS C++  YE DFGWG P  V       LDN  +
Sbjct  348   TK--MVDLILSNISGLSYETHEPYSVSSWCKLPLYEADFGWGSPAWVTGNVAPALDNLMI  405

Query  554   LFLDAINGA-VEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
             L +D+ +GA VE W+ LP+QVM +  Q+   LA+  A P P +
Sbjct  406   L-IDSKDGAGVEAWVTLPEQVMLSFEQNAELLAF--ACPNPTV  445



>ref|XP_006465504.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=470

 Score =   182 bits (462),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 148/470 (31%), Positives = 226/470 (48%), Gaps = 51/470 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYV----SGRACHHTDTI  1575
             M VE+ SKE ++PSSPTP  LK YK S LDQL  +   P   +Y     +  +   TD I
Sbjct  1     MDVEIISKEFIKPSSPTPLHLKTYKLSLLDQLHDHCYPPVSLYYPLKQDTDLSISSTD-I  59

Query  1574  DE--------lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE-  1422
             D+        LK+SLS+TLS  YPLAG+ K D+++V+CNDEG+ F  A     ++  L  
Sbjct  60    DQIVSKRLQLLKQSLSETLSSFYPLAGKMK-DKLSVDCNDEGIYFAEARAKCTLNEFLNR  118

Query  1421  ---NFEIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAK  1251
                +  I K   +  + +    +  G  +  +QV RFSCGG+ I   + H +AD   L  
Sbjct  119   PDLSLVIFKFHPVVGNEQRQSKEIAGAHVGKIQVTRFSCGGLVICACILHMVADGVTLGS  178

Query  1250  FMEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKR  1071
             F+  WA+        + S   +   S LFP   D +   +       G        +V+R
Sbjct  179   FLMSWAARAGKNIGEDTSICPNYEISSLFPQ-NDHTYPREATTFSKSG------KFVVRR  231

Query  1070  FVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVN  906
             FV  A AIA L+   T +  S+Q PSRVE +TAL+   ++ A   ++ +     L+ ++N
Sbjct  232   FVFDAQAIANLKAKATTSSTSLQNPSRVEVVTALISKRIMAAFKAKSGSYKPTLLTRVLN  291

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
             LR  + PPL  N  G  V  A  LC++  D    V    LV ++R++F  V     +++ 
Sbjct  292   LRPLVRPPLSENSFGNFVWNADALCKDHDDE---VELDGLVWKLRESFTKV----VKRLQ  344

Query  725   GEGGWLRAVIARGYELVRNRD-----SSTLYTSSLCRMAYYEVDFGWGKP-RLVVNMLDN  564
             G+G      +  G +   N++        +  SS+C+  +Y++DFGWGKP  +     D 
Sbjct  345   GDGEGSLISLCEGIK-DENKEVFADAKDRISFSSVCKFPFYDIDFGWGKPIWMNFTSFDG  403

Query  563   SWVLFLDAI-------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             S V F + +          +E W+ L ++ M  L  DR  L + S  P P
Sbjct  404   SIVQFANFVILSDTRSGDGIEAWLHLLEEDMALLELDRELLGFASLDPSP  453



>ref|XP_008226064.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   182 bits (461),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 141/457 (31%), Positives = 226/457 (49%), Gaps = 42/457 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+ E+  +E ++PSSPTP  L+N+K S LDQL      P V FY          +I  +K
Sbjct  1     MEFEIIKRETIKPSSPTPHYLRNFKLSLLDQLGPVAYEPLVLFYPKNGIATPQKSIWIIK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSLS+TL+  YPLAGR K + I+++CND GV+++ A V   +S+ L   +   +++L P 
Sbjct  61    KSLSETLTRFYPLAGRIKGN-ISIDCNDHGVDYVEARVNGLLSTFLSKPDAQTLRKLLP-  118

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                  P+     L+ VQ N F CGG+AIG  +SH +ADA++L+ F+  W++   G +   
Sbjct  119   VDAESPEAGRGPLLLVQANVFDCGGLAIGVCMSHKLADAASLSTFILAWSATALGFS---  175

Query  1202  GSGFVSDHS-SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDL  1026
                 + D S S  FPP    S+ +Q        ++ +  + + KRFV  A+ IA LR   
Sbjct  176   -QALLPDFSASFRFPPTDHASSFQQ------SSVDVKRVNCVTKRFVFYASKIAGLRT--  226

Query  1025  TITGGSVQRPSRVEALTALVWAAVINATPT--------QTATLSCMVNLRRRMEPPLPPN  870
                   V +P+R EA+TAL+W  V+ A           + + LS  V++R+R+ PPL  +
Sbjct  227   KAASAIVDQPTRAEAVTALIWRCVVAAASRSSSSLQSPKLSVLSQSVDIRKRVVPPLSDD  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              +G LV        E K     +    LV ++R   + + +   +++  +      V+ +
Sbjct  287   SIGNLVGYFAAHTDETK-----LELQGLVVKLRKGIKELSNSYTKRLQKDQAL--QVVCK  339

Query  689   GY----ELVRNRDSSTLYT-SSLCRMA-YYEVDFGWGKPRLVVNML----DNSWVLFLDA  540
              +    E ++  D    Y  + LC     Y V FGWG P  + N+     +N   L    
Sbjct  340   SFKEADEFIKRDDIINFYVGTDLCNYKLLYGVSFGWGNPIWLSNVPAASNNNVASLVSTR  399

Query  539   INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              +G +E W+ L ++ M    QD+  LA+  AF  P +
Sbjct  400   EDGGIEAWVTLSEEDMAAFEQDQELLAF--AFMNPSV  434



>ref|XP_006464646.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=476

 Score =   182 bits (462),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 143/468 (31%), Positives = 225/468 (48%), Gaps = 45/468 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTID--  1572
             M+VE+ S+E ++PSSPTP  LK++K   LDQ   N+ +P V +Y ++      T  ID  
Sbjct  17    MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  76

Query  1571  ------ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEI  1410
                   +LK+SLS+ L   YPLAG+   +  +V+CNDEGV F+ A    +++  L   + 
Sbjct  77    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  135

Query  1409  GKIKQLTP-SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               I +  P        Q  G  +  VQV  F+CGG+ I   +SHA  D ++ + FM+ WA
Sbjct  136   NLIYKFFPVDGNEQRGQIAGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMKAWA  195

Query  1232  SFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQ--EEKDMIVKRFV  1065
             +  R   +   + ++  +  +S LFPP  D     QL         +  E    +V+RFV
Sbjct  196   ATARNKTSEEEAIYICPNYDASSLFPP-NDGDLFHQLKATSRASFGRFFETGKFVVRRFV  254

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLR  900
               A A A+L+         VQ P+RVE ++A +  +V+ A  T++ +     LS  VNLR
Sbjct  255   FDAKATAELKA--KAKSSRVQNPTRVEVVSATLSKSVMTAFKTRSGSLKPTLLSHAVNLR  312

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              +  PPL  N +G +V +   LC E +     V    LV ++R+A         + + G 
Sbjct  313   SKARPPLSENLIGNIVWKTNALCTEEE-----VDLDVLVWQLREALSKFDGDFVKSLQGV  367

Query  719   GGWLR-----AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-------  576
             GG L+        A  Y   +N+    +  SS C   +Y +DFGWGKP  V         
Sbjct  368   GGLLKLSEDIKCEAEAYSDAKNK----IMFSSWCTFGFYGIDFGWGKPIWVSGACLGGSI  423

Query  575   MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +  +  ++ +D+ +G  +E W+ L ++ M  L  D   L   +  P P
Sbjct  424   VQSSPTIILMDSRSGNGIEAWVLLLEEDMALLEVDEKLLEVATIDPSP  471



>ref|XP_006415694.1| hypothetical protein EUTSA_v10007649mg [Eutrema salsugineum]
 gb|ESQ34047.1| hypothetical protein EUTSA_v10007649mg [Eutrema salsugineum]
Length=441

 Score =   181 bits (460),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 139/454 (31%), Positives = 221/454 (49%), Gaps = 44/454 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             +  ++ V S+E+++PSS     L  +  SFLDQ+A +  +PF+FFY S R     +  D 
Sbjct  1     MEFEITVTSEELIKPSSLNINHLPYHYLSFLDQIAPSSFMPFLFFYHSKRNLSDRERADH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             +K SLS+ L+L YPLAGR K     V CND GV F+ A    +MS +LEN    ++    
Sbjct  61    IKSSLSEILNLFYPLAGRIKNSGDVVLCNDVGVSFVEAKAGCDMSQILENPNPYELDMFL  120

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P  KF E   VG   + +Q+  F CGG+A+G  + H + DA +   F+  WA+F RG   
Sbjct  121   P-FKFDE---VGDVPLKIQLTFFECGGLALGIGLCHKLCDAMSGLIFIRSWAAFARG---  173

Query  1208  NNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              +    V+    I  +FPP  D         +  E       +++ +RFV   +++  LR
Sbjct  174   -DTDKIVTPSFDIAKMFPP-RDMEDFNMATSITNE-------NLVTRRFVFSKSSVESLR  224

Query  1034  QDLTITGGSVQRPSRVEALTALVWA---AVIN--ATPTQTATLSCMVNLRRRMEPPLPPN  870
             +    +G    R +RVEAL+A +W+   A IN      +  TL  +VNLRR+ +P +P +
Sbjct  225   E--RFSGNKKFRATRVEALSAFLWSRFVATINRDDKTQKIYTLKHLVNLRRKADPFIPEH  282

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G ++  ++ + +   +         LV++IR+  R +      K+  +        +R
Sbjct  283   MFGNILSFSVTVPKMIINEDDDEAKPSLVEQIREEIRKIDALYVNKIQED--------SR  334

Query  689   GYELVRNRDSS--------TLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA  540
              +   RN+  S        +L  +SLC+   Y+ DFGWGKP      +M+D +   F+D 
Sbjct  335   AHLEFRNKHFSGFFKGEIVSLTLTSLCKFPVYDADFGWGKPLWFASTSMIDENQGAFIDT  394

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               G  +E  + L +  M     D   L YVS+ P
Sbjct  395   KEGDGIEALINLDQNHMSRFESDGELLRYVSSNP  428



>ref|XP_004295709.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=423

 Score =   181 bits (458),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 142/446 (32%), Positives = 213/446 (48%), Gaps = 39/446 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV++  KE + PSSPTP  LK    SF+DQL   V +P + FY      H   +I  LK
Sbjct  1     MKVKIIHKETITPSSPTPSHLKTLHLSFMDQLVPEVYVPLLLFY-PNPTTHEKSSI--LK  57

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
              SLS+TL+  YPLAG+ + +  ++ C+D G  F+ A V   +S +LEN +   +K L P+
Sbjct  58    TSLSETLTHFYPLAGKFQYND-SICCDDHGAAFVEARVNCRVSKILENPDAEMLKHLFPA  116

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
             A F   Q +   L+ VQVN F CGG+AI   +SH +ADA  L+ F +IWA   +G     
Sbjct  117   A-FESTQALTGHLLLVQVNFFECGGMAIAINISHKVADAFTLSTFTKIWARVAQG-----  170

Query  1202  GSGFVSDHSSIL----FPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    H  +L    F  LT     +  +       E  ++  +++RFV  A+ IA L+
Sbjct  171   -------HPVLLPADSFGALTYLYPPQDFLNASKPLAEYTQEQCMIRRFVFDASRIAALQ  223

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-----SCMVNLRRRMEPPLPPN  870
                     SV  P+R+E ++AL+W   + A+ + + ++     S  VN+R+R   P   N
Sbjct  224   --FKAASASVTNPTRIEVVSALIWKCAMEASRSNSGSIRPSVCSQPVNMRKRSGKPFVEN  281

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              LG  V     +  E +     V    LV   R      K      V  E  +    I  
Sbjct  282   VLGNFVWFFKAITVEGE-----VDLQSLVATFRKCMEDFKVNYRNGVSAEQAY--QTIKE  334

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVEV  519
               +L+      +   +S CR  +YE +FGWGKP  V     L N + L +DA +G  +E 
Sbjct  335   SAKLLEKEGMDSYTCTSWCRFPFYETNFGWGKPSWVSTPYALKNKFYL-MDANDGNGIEA  393

Query  518   WMKLPKQVMHTLTQDRHFLAYVSAFP  441
             ++ L ++ M     ++  LAY S  P
Sbjct  394   YVTLLEEDMAIFGSNQELLAYASLNP  419



>ref|XP_007029093.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY09595.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=546

 Score =   183 bits (465),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 212/451 (47%), Gaps = 25/451 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTIDE  1569
             M V + S+E V+PSS     LK +K SFLDQL     +P +FFY      H      +  
Sbjct  1     MDVRITSRETVQPSSQEVHLLKPFKLSFLDQLIPAFYVPLIFFYTQSSNSHFDSAQILAR  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LK+SLSKTL+  YPL+GR   D   ++   EGV +I A V   +S  L++ E+ K+  L 
Sbjct  61    LKESLSKTLNQFYPLSGRTI-DNFCIDYYREGVPYIEARVNGCLSDYLQSTELEKLNHLI  119

Query  1388  PSAKF-YEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             P   F Y   P     +AVQVN F CGGIA+    SH I DAS ++ F+  WA+F+RG  
Sbjct  120   PCEPFCYFSDPAVIPQLAVQVNIFDCGGIALAMCCSHKIIDASTISAFLRSWAAFSRGSN  179

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                    + + SS LFPP+    +I          +  +E+    +RFV  ANAIA L  
Sbjct  180   GEIPHPDLLEASSRLFPPM---DSIPPNFLSSTRTLWFKEERYKTRRFVFDANAIATLM-  235

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS----CM-VNLRRRMEPPLPPNC  867
                    S++ PSRVEALTA +W   + A  + +  L     C  VNLR +M+P LP   
Sbjct  236   -FKAKSKSLEHPSRVEALTAFIWKYAMLACASASGILKPSVLCQAVNLRHKMKPRLPDYS  294

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAVIA  693
             +G L+  A       K     +    L   +R+A         + + G+ G+  +     
Sbjct  295   VGNLIRFA---ASAYKPADKDIELHHLAYLLREAMENYNTDYLQSLQGDEGFKVISEKAN  351

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV----VNMLDNSWVLFLDAI--NG  531
             +  E     ++     SS      ++VDFGWGKP  +    V     + + FL  I    
Sbjct  352   QVAEFAAKGNAQVYGFSSWLNSGMHQVDFGWGKPSWIGIPGVVSPAFTSLTFLKEIGQEK  411

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             AVE W+ L ++ M     D  FLA+ S  P 
Sbjct  412   AVEAWVTLDEKKMTIFEHDHEFLAFASPNPH  442



>ref|XP_008446186.1| PREDICTED: vinorine synthase-like [Cucumis melo]
 gb|ADN33961.1| anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]
Length=430

 Score =   181 bits (459),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 220/454 (48%), Gaps = 41/454 (9%)
 Frame = -3

Query  1760  LSLQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTD  1581
             + ++ ++K+E+ S EI++PSSPTP + +++K SFLDQ A     P +FFY  G A  H D
Sbjct  1     MEMKNSLKIEITSTEIIKPSSPTPSTHQHHKLSFLDQFAPGSYTPLLFFY-PGHA-DHRD  58

Query  1580  TIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLEN-FEIGK  1404
                +LK+SL++TLS  Y LAG   E  + VECNDEGV F    V+  +S ++EN  ++  
Sbjct  59    RCRKLKESLAETLSRFYLLAGTLVEAYL-VECNDEGVAFSEVRVSGRLSEVMENPNDLVS  117

Query  1403  IKQLTPSAKFYEPQPV--GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
             + +L P    + P  V   + ++ VQ N F CGG  IG  V+H I D ++   F + WAS
Sbjct  118   LHRLLP----FHPDAVLERECILGVQYNVFECGGAVIGLCVTHKIVDGTSATMFTKAWAS  173

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
               RG           D    + P    T     +   G    +   + ++ +RF+   + 
Sbjct  174   TCRG-----------DSQCSIVPTFDATELFPAMEIRGGNRRQSRMQKVVTRRFIFNKSN  222

Query  1049  IAQLRQDLTITGGSVQR--PSRVEALTALVWAAVI----NATPTQTATLSCM--VNLRRR  894
             IA L++        + +  PSRVE+++  +W   I       PT+      +  VNLR R
Sbjct  223   IAALKKQANSAALFLNQRPPSRVESVSGFLWNRFIALSHQKPPTKAKRFVAIQTVNLRSR  282

Query  893   MEPPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             M PPLPP+  G +   A   V   E +          LV +IR+A + + D   + +   
Sbjct  283   MNPPLPPHSFGNICWSATAEVPIDEKQHFPF------LVGKIREAIKEIDDEYTKTLQDT  336

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFL  546
                +RA +  G E V + +   +  +S C    YE DFGWGKP  V        + VLF+
Sbjct  337   EKSMRAKMKMG-ERVYSGEVEMVCFTSWCNFPVYETDFGWGKPTWVCTPGRPYKNVVLFV  395

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             +  +G  +E W+ L +  M     D   L++ S+
Sbjct  396   NTSDGEGIEAWVNLEENDMALFENDSELLSFTSS  429



>ref|XP_008446094.1| PREDICTED: vinorine synthase-like [Cucumis melo]
Length=440

 Score =   181 bits (459),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 139/462 (30%), Positives = 219/462 (47%), Gaps = 59/462 (13%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++E+ SK I++PSSPTPE L+ Y  SFLDQ+ ++V  P V+FY +G +    +  D 
Sbjct  1     MAVQIEIVSKAIIKPSSPTPEHLRRYSLSFLDQVTVDVYNPMVYFYPAGGSATPAEISDH  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS  L+  YPLAG+   D   V+CND+GV FI   +   MS ++      ++ +  
Sbjct  61    LKKSLSHVLTHYYPLAGKVNYDEFFVDCNDDGVPFIETKINCRMSGVMNTPFPSELNKFL  120

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    +E   + +  + VQ+N F CGG+A+G  VSH I+DA +L   +  WA++ RG   
Sbjct  121   P----FELDQLDEVSMGVQLNVFECGGVAVGICVSHKISDALSLFIVVNEWAAYCRG---  173

Query  1208  NNGSGFVSDH--SSILFPPL------TDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
                   V  H  S+ LFPP       T TS   Q                + +R+ I   
Sbjct  174   --EKEVVRAHLSSAELFPPTKTGLYNTRTSIFRQ---------------RVARRYEIDGG  216

Query  1052  AIAQLRQDLTITGG--SVQRPSRVEALTALVWAAVINATPTQTAT---------------  924
              +  +R          S +RP+RVEAL+A ++   I A     ++               
Sbjct  217   NVESIRAKYAECSAMESQRRPTRVEALSAFIYGRFIAAIKAVVSSSELENGRSTELEKNI  276

Query  923   -LSCM-VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVK  750
              L C  VN+R R++PP+     G        +  E     T     +LV++ RD    + 
Sbjct  277   FLVCHSVNIRSRLDPPVVDYAFGNYYRTTFAVPAENILNDTY--CYDLVKQARDEIGKID  334

Query  749   DGEARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--  576
                 +++     +L ++     +       S  +T SLCRM  Y+ DFGWGKP  + +  
Sbjct  335   KEYLKRLQQGSKFLDSMKKTAAQFSTGELISCSFT-SLCRMPIYDADFGWGKPAWIGSPA  393

Query  575   -MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAY  456
              M  N +V F+D  +G  V++++ L ++ M+    D  FL Y
Sbjct  394   LMFKNLFV-FIDKKDGDGVDIYVHLKQEHMNKFEMDEEFLKY  434



>ref|NP_173852.4| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAF97979.1|AC000103_29 F21J9.9 [Arabidopsis thaliana]
 gb|AEE30529.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=435

 Score =   181 bits (459),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 144/447 (32%), Positives = 223/447 (50%), Gaps = 34/447 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKN----YKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI  1575
             +++ V S+E+V+PS   P +L +    +  SFLDQLA  + +PF+FFY +       +  
Sbjct  3     LEITVTSQELVKPS---PRNLNHPPCHHHLSFLDQLAPPIFMPFLFFYHNKTNLSDKERS  59

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             D +K SLS+ L+L YPLAGR K     V CND GV F+ A    NMS +LEN    ++ +
Sbjct  60    DHIKSSLSEILNLYYPLAGRIKNSGDVVVCNDVGVSFVEAKADCNMSQILENPNPNELNK  119

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P    +E   V    + VQ+  F CGG+A+G  +SH + DA +   F+  WA+F RG 
Sbjct  120   LHP----FEFHEVSDVPLTVQLTFFECGGLALGIGLSHKLCDALSGLIFVNSWAAFARGQ  175

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                  +   S   + +FPP      IE L    A GI +E  +++ +RFV   +++  LR
Sbjct  176   TDEIITP--SFDLAKMFPPCD----IENLNM--ATGITKE--NIVTRRFVFLRSSVESLR  225

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
             +    +G    R +RVE L+  +W+  + +T       +  TL   VNLRR+ +P +P N
Sbjct  226   E--RFSGNKKIRATRVEVLSVFIWSRFMASTNHDDKTGKIYTLIHPVNLRRQADPDIPDN  283

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG-GWLRAVIA  693
               G ++  ++ +     +      A  LV ++R+  R +     +K+  +  G L  +  
Sbjct  284   MFGNIMRFSVTVPMMIINENDEEKA-SLVDQMREEIRKIDAVYVKKLQEDNRGHLEFLNK  342

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVE  522
             +    V     S  +T SLC+   YE DFGWGKP  V +  M   + V F+D   G  +E
Sbjct  343   QASGFVNGEIVSFSFT-SLCKFPVYEADFGWGKPLWVASARMSYKNLVAFIDTKEGDGIE  401

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              W+ L +  M     D   L YVS+ P
Sbjct  402   AWINLDQNDMSRFEADEELLRYVSSNP  428



>ref|XP_008459937.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis melo]
 gb|ADN33685.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase [Cucumis melo 
subsp. melo]
Length=435

 Score =   181 bits (459),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 139/450 (31%), Positives = 218/450 (48%), Gaps = 40/450 (9%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkk  1560
             KV++ ++EI++PS PTP++L +  FSFLDQLAL V +P + FY      +   +I  LK 
Sbjct  4     KVDIINEEIIKPSIPTPKTLNHLNFSFLDQLALPVYVPLLLFYSPKN--NQIPSISHLKS  61

Query  1559  slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPSA  1380
             SLSKTL+  YP AGR  +D +++ C DEG  F+ A+   +++ +L    +  + Q  P  
Sbjct  62    SLSKTLTQFYPFAGRVNDDNLSISCTDEGAIFVEAETNYSLNDILTQLNVDSLNQFLP--  119

Query  1379  KFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN--  1206
              F+        +V +Q   F CGGI +G  +SH I+DAS+++ F++ W S +     N  
Sbjct  120   -FHLAN--KGCIVLIQTTTFQCGGITVGLLMSHKISDASSISSFVKTWTSVHVSGNDNPL  176

Query  1205  --NGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
               +   F+SD  S+L PP     T+       + A+G        I KR V   + I  L
Sbjct  177   SVSKPEFISD--SVLPPPKNFPVTTPTTPDSGIHAKG--------ITKRIVFSHSKITSL  226

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRMEPPLPP  873
             +        +V+ P+RVEA+  L+W + I+A+      ++ + L   VNLR+R+EP LP 
Sbjct  227   KAK--AASSTVKNPTRVEAVAGLLWKSAISASRSTSGLSKASVLGQAVNLRKRLEPNLPD  284

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N +G     AI         G  +    +V  +R+A    K    +K      +L    A
Sbjct  285   NSVGN----AIGFVTPETAVGAELELQSMVGLMREAIEEFKKNGYKKYQDTEAYLSYFKA  340

Query  692   -RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAING-A  528
                 +   N + +    SS  R  +YE DFGWG P      ++M  N + L LD  +G  
Sbjct  341   LMDPDGPYNGEKNFYLCSSWSRFEFYEADFGWGCPVWFIGGISMFSN-FFLLLDTRDGKG  399

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             +E  + L ++ M     D   L + S  P 
Sbjct  400   IEALVSLSEEDMRLFECDEDLLEFGSFNPN  429



>ref|XP_008346587.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=445

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 145/457 (32%), Positives = 221/457 (48%), Gaps = 42/457 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKVEV  KE ++PSSPTP  LK  + S  DQLA +V  P + FY S       D+ID   
Sbjct  5     MKVEVIYKETIKPSSPTPSHLKTTQLSVFDQLAPDVFXPLLLFYPSNINSDAVDSIDHHS  64

Query  1562  k----------slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFE  1413
                        SLS+ L+  YP AG  + + +++ C+D GV F+ A V   MS +LE  +
Sbjct  65    SVXERSNILKASLSEALTHFYPFAGTFQYN-VSISCDDHGVAFLQAHVNCPMSKILEKPD  123

Query  1412  IGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                ++QL P+++       G  L+ +Q N F CGG+AI    SH I D   L+ F++ WA
Sbjct  124   FEILRQLLPASQGSSQAETGH-LLLIQANFFECGGLAIAVSSSHIIIDGYTLSTFIQSWA  182

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTD--TSAIEQL--MKMGAEGIEQEEKDMIVKRFV  1065
             +      A   S   +DH  +L  P  D   S   QL  +      +E  E+  I KRFV
Sbjct  183   A-----VALASSTVSTDH--VLLTPKFDVAVSLFPQLDFLNSPPPAMELVEEKCISKRFV  235

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-----SCMVNLR  900
               A+  A L+     T  SV  P+R+E+++AL+W     A+ + +  +     S   +LR
Sbjct  236   FEASKAAALKSKAVST--SVPNPTRIESVSALIWKCATAASRSXSGVVRQSVWSTNASLR  293

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             + ++ PL  N +G LV   +V  + ++       +V  V ++R      K+  A  V GE
Sbjct  294   KIVQRPLAENLMGNLVGMIVVKIEASEVVDIDFPSV--VAKLRKGMEEFKEKYANGVSGE  351

Query  719   --GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LF  549
                G+++    R    ++  D+   + SS CR  +YE +FGWGKP  V   +    V +F
Sbjct  352   EACGFMKDFXDR----IKRVDN--YHCSSWCRFPFYEANFGWGKPLWVCQTITMKNVAMF  405

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              D  +G  +E  + L ++ M     D+  LAY S  P
Sbjct  406   TDTRDGEGIEALVTLSEEDMAKFECDKELLAYASVNP  442



>gb|KDO85081.1| hypothetical protein CISIN_1g015400mg [Citrus sinensis]
Length=407

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 141/409 (34%), Positives = 204/409 (50%), Gaps = 48/409 (12%)
 Frame = -3

Query  1742  MKVEVR--SKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             MK+EV+  SKE ++PSSPTP  LK +KFS LDQ   +   P + FY +   C     I +
Sbjct  1     MKIEVQIISKEDIKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFYPND--CMTLAEIPK  58

Query  1568  lkk----slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKI  1401
                    SLS+TL+  YPLAG+ K+D +++ECND+G  F+ A V   +   L   ++  +
Sbjct  59    RLALLKRSLSETLTRFYPLAGKIKDD-LSIECNDDGAYFVEAQVNCRLDEFLTKPDLLLL  117

Query  1400  KQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +  P     E   V   L  +QVN F CGGIAIG  +SH + D +AL+ F+  W++  R
Sbjct  118   HRFLPCELMKELTAV-TYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSATAR  176

Query  1220  GCAANNGSGFVSDHSSILFPP----LTDTSAIE--QLMKMGAEGIEQEEKDMIVKRFVIP  1059
             GC       F +     LFP     L DTS +    L K G           I KRFV  
Sbjct  177   GCEEVIYPNFAAPS---LFPANDLWLRDTSMVMWGSLFKKGK---------CITKRFVFD  224

Query  1058  ANAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ-------TATLSCMV  909
             A+AIA L+  +  T   ++    P+RVEA++A +W  ++ A+  +          L+ +V
Sbjct  225   ASAIAALK--VVATSSKIKCPTPPTRVEAVSAFIWKCIMAASKEKHGYQTRRPCVLTHLV  282

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARK  732
             NLRRRM PPL  NC G L+  A   C             +LV  ++DA   + DGE  +K
Sbjct  283   NLRRRMTPPLSDNCTGNLLWMAAAKCMTPDKP----ELHDLVGELKDAISKL-DGEFVKK  337

Query  731   VYGEGG--WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
             +  + G   +   + +  EL    +   +  SS C   +YE+DFG GKP
Sbjct  338   LSSDEGNSLMCESLKQIGELCSKDEVDHVGFSSWCNFGFYEIDFGRGKP  386



>ref|XP_010094574.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
 gb|EXB56328.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
Length=456

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 228/458 (50%), Gaps = 25/458 (5%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V++ S + ++PSSPTP  L+ +K S LDQL  +   P + FY       +++ ++ LK
Sbjct  1     MEVKIVSIDHIKPSSPTPSHLRTFKLSLLDQLIPSPYAPIILFYPPNDDVSNSNKLESLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE--NFEIGKIKQLT  1389
             KSLS+TL+ +YPLAG+ K+D ++++C+D G  F  A V  ++   L   ++ +   K L 
Sbjct  61    KSLSETLTDLYPLAGKIKDD-LSIDCDDGGAYFAEAKVDSSLRDFLNQPDYLLLLQKLLP  119

Query  1388  PSAKFYEPQPVGKALVA-VQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG--  1218
                 F          VA +Q+N F CGG+A+G  +SH I D +AL+ F+  WA+  RG  
Sbjct  120   CDLNFAASNRNDNNHVANIQINVFGCGGLAVGLCISHKILDGAALSSFLRSWATTARGDR  179

Query  1217  -CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI--  1047
              C A     F + +S  LFP         +   M   G    +   + KRFV  A+AI  
Sbjct  180   TCKAARPPSFEAANS--LFPANDAGDLWLRDTSMVMFGSFFTKGKCVTKRFVFDASAILS  237

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS------CMVNLRRRMEP  885
              +     + +  +VQ P+RVEA++A +W  VI+A   +   +S       +VNLRRR  P
Sbjct  238   LRSEASRSSSSAAVQNPTRVEAVSAFIWRCVISAAKDRNGGVSRPSLSTHLVNLRRRTTP  297

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
              L  +CLG L+  A    + A+    V    ELV  +R++F        +++ GE    R
Sbjct  298   FLSEHCLGNLLWIASAQSRPARGDHAVAGVSELVGLLRESFSKTDGDFVKRLRGEKRRFR  357

Query  704   AV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM-LDNS----WVLFL  546
              +  + R  +++ + +   +  SS C+  +YE DFGWG+P  V +  L  S     V+  
Sbjct  358   MLESLNRIIQVMGDGEMDQIGFSSWCKFGFYEADFGWGRPAWVSSFGLSGSVFMKLVILA  417

Query  545   DA-INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             D  +   +E W+ L ++ M  +  +   L      P P
Sbjct  418   DTRLGDGIEAWVTLDERDMAIMESNTELLQLAQVDPTP  455



>ref|XP_009780317.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=445

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/461 (28%), Positives = 227/461 (49%), Gaps = 44/461 (10%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY--VSGRACHHTDTI  1575
             + +KV++ S E+++PSSPTP  LKN+    LDQL      P + FY  +     H    +
Sbjct  1     MNIKVKLISTEMIQPSSPTPNHLKNFNLCLLDQLIPAPYAPILLFYPNLGDIKVHEKSAL  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
               LKKSL  TL   YPLAGR K D ++++CND+GV ++  +V  ++   L    +  I Q
Sbjct  61    --LKKSLVDTLYRFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCHLIEFLNEPNLESISQ  117

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P    ++    G  +  +Q+N F CGGIAIG  ++H I D   L+ F++ WA     C
Sbjct  118   FLPCQPPFKVLAAGDYVTNIQINVFKCGGIAIGLCIAHKILDGVGLSTFLKYWAGL--AC  175

Query  1214  AANNGSGFVSDHSSILFPP----LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             ++N    + +  ++  FP     L DTS     M M +   ++   + + +RFV  A+AI
Sbjct  176   SSNEVQ-YPNLMANYFFPAEDLWLRDTS-----MTMWSSMFKK--GNFVTRRFVFNASAI  227

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--------LSCMVNLRRRM  891
               L+     T   ++ P++VE +++ +W   I A+  +  +        L+ +VNLR+R 
Sbjct  228   NNLKT--MSTSSHIKHPTKVEVVSSFIWKCSIAASKQKNCSNKRHSNSILTHIVNLRKRA  285

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
              P LP N LG L    + L          +   +LV ++R +   + D   +++  + G+
Sbjct  286   APSLPENILGNL----LWLSSAKNTAKHEMELPDLVNQVRKSISTIDDRYIKRLRSDEGF  341

Query  710   --LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI  537
               +R  +    E+         +T S C+  +Y++DFG+GKP + ++ + +  + F++ I
Sbjct  342   NLMRKSLKEIGEVCSKGADHYGFT-SWCKFGFYDIDFGFGKP-IWISSISSRCLFFMNLI  399

Query  536   -------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
                       +E W+ L ++ M+ +  ++  L + S  P P
Sbjct  400   ILMETKCVDGIEAWVTLDEEEMNMIVGNQELLVFASIDPSP  440



>ref|XP_002308878.2| hypothetical protein POPTR_0006s03450g [Populus trichocarpa]
 gb|EEE92401.2| hypothetical protein POPTR_0006s03450g [Populus trichocarpa]
Length=439

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/422 (30%), Positives = 206/422 (49%), Gaps = 47/422 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             MKV++ S++++ PSSPTP +LKN K S  DQLA    +P VF+Y +    H  + ++  K
Sbjct  1     MKVQILSRKLIAPSSPTPPNLKNLKISCFDQLAPPTYVPCVFYYPANGEDHGGNNVERSK  60

Query  1562  kslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLL--ENFEIGKIK  1398
             K        +   YPL GR  E+ +++EC+DEG E++ A V+ ++S LL  E F+     
Sbjct  61    KIEKSLAETLALFYPLGGRYTEENLSIECSDEGAEYLEARVSGSLSQLLEREEFKTEMWS  120

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L P       QP    LV +Q+N F CGG+AIG  V+H IADA  +  F+  WA+    
Sbjct  121   RLVPRVL----QPENSPLVTIQINMFECGGLAIGTCVAHRIADAYTVGTFINTWAT----  172

Query  1217  CAANNGSGFVSDHSSI----LFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
              A   G   V    S     LFPP  +   ++++ ++ + A       K ++ K FV   
Sbjct  173   -ACRIGIEKVHCRPSFPFGSLFPPKNIPAITSVDDVISVRA------VKKVVRKSFVFKG  225

Query  1055  NAIAQLRQDLTITGGS---VQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLR  900
               I++L++  T    +     +P+RVE +T L+W  +I          + +     VN+R
Sbjct  226   ETISRLKEIATAFDSNQLLKYQPTRVEVVTGLIWMVLIRVARAIHGHLRPSVFGLTVNMR  285

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              +    +P    G  ++  +V+ Q   D  + +   + V R+ DA R+  +  A+   G+
Sbjct  286   GKTTLTMPEYACGNFIN--LVIAQFVPDDESKIELHDCVNRVHDAIRSAVEDCAKASSGD  343

Query  719   GGWLRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFL  546
               +   +  +  G E  R  +      +S CR+ +YE DFGWGKP         SWV  +
Sbjct  344   ELFSLMIKKMREGDEAWRKSEIDAYIVNSWCRLPWYETDFGWGKP---------SWVHGV  394

Query  545   DA  540
             DA
Sbjct  395   DA  396



>ref|XP_010025917.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=432

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 129/449 (29%), Positives = 217/449 (48%), Gaps = 44/449 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             +++EV SKE ++PSSPTP  LK +    LDQ+ L    P VFFY + + C  +  I+   
Sbjct  2     VEIEVTSKEAIKPSSPTPHHLKTFDLCLLDQMTLMYYAPVVFFYPTDQFCTPSLPIERAP  61

Query  1562  kslskt----lsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
              +L ++    L+  YPLAGR   + + V+CND G+ ++ A    ++   +E+ +IG + +
Sbjct  62    STLKESLPEALARFYPLAGRLNRNNLCVDCNDAGILYVEARACGSLLEFIESPDIGLLDE  121

Query  1394  LTPSAKFYEPQPVGKA-LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
               P      P+P  +A L+ +QV+ F CGGI IG   SH + D + L+ F+  WA+   G
Sbjct  122   FLPLHGL-APEPHEEAFLLGIQVSVFPCGGIVIGTSSSHKVIDGTTLSAFLRTWAAIAAG  180

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                +         ++ LFP                     E      +RF+    A++ L
Sbjct  181   -RPDQAMRAECTAAATLFP-------------------RSEPGKSSARRFLFDTKALSTL  220

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPPLPP  873
             ++       +V  P++VEALT  +W   + A+         + L+  +NLRRR++PPLP 
Sbjct  221   KE--LARSKNVPNPTQVEALTGFLWKHAMRASGAVGGIGSQSALAHSINLRRRLKPPLPE  278

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV--  699
               +G +  +A  +C        +   VELV+R   +  +V      K+ G+  +LR    
Sbjct  279   YAIGNIDWKAFAVCDSPGLETELPCLVELVRR---SMASVNSDYVEKIRGDRAFLRISKW  335

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSW---VLFLDAIN  534
             +    E+ R   +      S C M + EVDFG G+PR +   N+ D+++   V+ ++  +
Sbjct  336   LEEVNEIYRKARNDCYTFVSWCGMGFNEVDFGLGRPRWISAGNVGDDAFKNVVILVETWS  395

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +EVW+ L ++ M  L  D  F  + S
Sbjct  396   GDGIEVWIVLEEREMGLLENDGEFREFAS  424



>ref|XP_008377211.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=501

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 148/498 (30%), Positives = 231/498 (46%), Gaps = 72/498 (14%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT-----  1578
             M+V++ S E ++PSSPTP+ L+ +K S LDQ   ++ +P + F+    + H  +      
Sbjct  6     MQVKIISDECIKPSSPTPQHLRTHKLSLLDQFIPSIYVPMILFFNPSSSIHPININITTP  65

Query  1577  --IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGK  1404
                  LK+SLS+TL+  +PLAGR + D ++++CNDE   +I A+V  N+S  L + ++  
Sbjct  66    MRSQLLKQSLSETLTHFHPLAGRIR-DSLSIDCNDERARYIEAEVDSNLSQFLNHPDLSF  124

Query  1403  IKQLTPS-AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
             I Q  P  A ++E  P G  +  +Q+  F+CGG  +G FVSH + D +AL+ F + WA+ 
Sbjct  125   ISQFLPGEASWHEAAP-GAHVAMMQITNFACGGFVLGAFVSHMVVDGTALSAFFKAWAAA  183

Query  1226  N-RGCAANNGSGFVSDHSSILFP---PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
               R  A  N   ++        P   P  D    E  M M       +  + + +R V  
Sbjct  184   TFRYIATPNTPHYIYTKGKFDAPSLFPQNDAYPREATM-MALYYRFLKVGNCVTRRIVFD  242

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVI---------NATPTQTATL-SCMV  909
             A A+A L++       +V  P+RVE +TAL+W  ++         N    ++ TL +  V
Sbjct  243   APALATLKR--KAASSTVPNPTRVEVVTALIWKHIMAAFNLKTERNIVQNRSTTLITHAV  300

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQ-------EAKDGGTVVT------AVELVQRIRD  768
             NLRRR  PP     +G  +  A  L Q       + +D    V          L + +R+
Sbjct  301   NLRRRAVPPFSEYTMGNFLSMAAALSQCSTEDNYQKEDNLAHVDDDRDHELGRLAKHVRE  360

Query  767   AFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSST------------LYTSSLCRMA  624
             A   +     + + G+G          ++ +R   S T            +  SS C   
Sbjct  361   AISKLDGDFVQSLQGDGTRGLTKFCEPFKEIRETLSRTSADAADGQSLDCIGFSSWCNFG  420

Query  623   YYEVDFGWGKPRLV--------------VNMLDNSWVLFLDAING-AVEVWMKLPKQVMH  489
              YEVDFGWGKP  V              +NM     V+ +D  +G  VE W+ L +Q + 
Sbjct  421   LYEVDFGWGKPSWVSCVGGKRGADEPVYMNM-----VVLMDTRSGDGVEAWIYLDEQDIA  475

Query  488   TLTQDRHFLAYVSAFPKP  435
              L  D HFLA+VS  P P
Sbjct  476   ILEHDPHFLAFVSLNPSP  493



>ref|XP_004310183.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=435

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 160/459 (35%), Positives = 223/459 (49%), Gaps = 54/459 (12%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRAC--HHTDTI  1575
             + + VEV SKEI+ PSSPTP  L++Y+ S LDQLA  V  P V FY S      + T+  
Sbjct  1     MKVDVEVTSKEIITPSSPTPAHLRHYQLSSLDQLAPLVYNPLVLFYESNDKTVPNITEIS  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
               LKKSL++ L+L YPLAGR K D   V+CNDEG+ ++ A V   +S  L+N       Q
Sbjct  61    SHLKKSLAEVLTLFYPLAGRIKHD-WCVDCNDEGIPYLEAQVNCKLSDFLKN---PIPDQ  116

Query  1394  LTPSAKFYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             LT    F     + K L + VQ++ F CGG AIG  VSH +ADAS+   F + WA+  RG
Sbjct  117   LTKFVPFELGDHIDKELALGVQLSVFDCGGFAIGQCVSHRLADASSYFMFSKTWAATARG  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              A           S   FPP  D  A +    +         K+ + KRF+  A  +  L
Sbjct  177   EANIEHPDLF---SGTRFPP-KDVLAYDPSFNIS--------KNKVTKRFLFNATMLEAL  224

Query  1037  RQDLTITGG-----SVQRPSRVEALTALVW----AAVINATPTQTATLSCM---VNLRRR  894
             R+   + G      + +RPSRV+ALT+ VW    A  I  T      L  M   VNLR R
Sbjct  225   REKY-VEGAFGSKENQKRPSRVDALTSFVWSRYLANSIKITGADDEKLYIMIHAVNLRPR  283

Query  893   MEPPLPPNCLGTLVDEAIV--LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY--  726
               PPLP N  G +   A+   L ++A +     T    ++ +R   + + D   + +   
Sbjct  284   FVPPLPQNSFGNIYRVAMTGPLLRDACN-----TYGRAMEEVRAEIKKIDDECVKGLQQG  338

Query  725   GEGGWLRAVIARG----YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDN  564
              E  W+      G     ELV      +L  +S CR   Y+ DFGWG+P  V +  +   
Sbjct  339   AEQSWIPVNENTGRLTELELV------SLGFTSYCRFPAYDNDFGWGRPAWVFSAPLTFK  392

Query  563   SWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +   F+D   G  +E ++ L +Q+M     D  FLAYVS
Sbjct  393   NLTAFMDTKEGDGIEAYIGLEEQLMAEFETDAEFLAYVS  431



>emb|CDP14000.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 148/463 (32%), Positives = 230/463 (50%), Gaps = 38/463 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKN-YKFSFLDQLALNVRLPFVFFYVS-GRACHHTD---T  1578
             M V++ S+EI++PSSPTP    N YK S LDQ + +  +PF+ FY +   +  H D   T
Sbjct  1     MNVKILSEEIIKPSSPTPHHHPNTYKVSLLDQFSPSSYMPFILFYKNKNNSLDHQDSAQT  60

Query  1577  IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIK  1398
             +  LK+S SKTL++ YPLAGR + D  T+ECNDEG  ++ A V   +   L+  ++  + 
Sbjct  61    LSHLKESFSKTLAIYYPLAGRFR-DAATIECNDEGGLYVEAQVNGTLPEFLKQPDVQFLN  119

Query  1397  QLTP-SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
                P  A   E   +    VAV++ +F CGG+ +G  + H + DA+A A F+  WA   R
Sbjct  120   NFLPCKANGLEKDRIPP--VAVKITQFQCGGLVVGACLFHKVVDAAASAAFLNSWARVAR  177

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G        F S  +S LFPP    S  +  ++       Q +K  + +R+V  A A+  
Sbjct  178   GEKVVE-PDFSS--ASALFPPKDPLS--DDFVRYFDNFFFQGKKSYM-RRYVFDATALTT  231

Query  1040  LRQDLTITGGSVQRPSRVEALTALV-----WAAVINATPT-QTATLSCMVNLRRRMEPPL  879
             LR +       V  PSRVEAL+A V     WA+    +    T  ++  VNLR+R+EPPL
Sbjct  232   LRAN--AASEKVPNPSRVEALSAFVAERLTWASTAAKSEIFSTLMITHPVNLRQRIEPPL  289

Query  878   PPNCLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--L  708
             P N  G ++  A    + +  +    +   +LV+ +R+AF  +      ++  +  +  L
Sbjct  290   PDNTFGNIIWLAFAFYEIDPSNTEKKIDHADLVKILREAFAGLNKDSIAELDADEAFNAL  349

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD------NSWVLFL  546
               V+   Y    N +      +S   M  Y+VDFGWG P  V +M D          +FL
Sbjct  350   NEVLESVY---TNENIKIFRFTSANNMGLYDVDFGWGTPSWVAHMGDMVGYRSKQQFVFL  406

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL*IQ  420
             +A  G  +E+W+   +  +  L +D  FL Y +  P P + I+
Sbjct  407   EATTGKGLELWLASDEAELSILEKDPEFLEYAT--PNPSICIE  447



>gb|KCW86588.1| hypothetical protein EUGRSUZ_B03220 [Eucalyptus grandis]
Length=409

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 144/447 (32%), Positives = 217/447 (49%), Gaps = 62/447 (14%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG---RACHHTDTID  1572
             MK++V SKE + PSS TP  ++ Y+FS LDQLA    +P V FY +    +   H +  +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFYVPVVLFYSAPDPEQDFDHVNIYE  60

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
             +LK SLS+ LS  YPLAGR+K D   V+   +G  F+   V   ++ LL N E+  ++QL
Sbjct  61    KLKTSLSECLSCFYPLAGRSKGDEHAVDLG-QGAVFVRTRVNARLAKLLANPELKLVQQL  119

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    Y  Q     + A+Q+N F CGGI IG  +SH IAD + L+ F+  W + +RG  
Sbjct  120   LPLDP-YNIQCQNALVTAIQLNLFDCGGIGIGVCISHKIADGATLSTFLSSWGAISRG--  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAI----EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                        +S L  P  DT+ I    E  + +    I++E+  ++ KRF   + ++A
Sbjct  177   -----------ASKLVAPYQDTTTIFPPREFRVPLPNNLIKKEK--IVTKRFEFDSASLA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA------TPTQTATLSCMVNLRRRMEPP  882
              LR      G + + P  VEA+TAL+  A +NA          +  +S +VNLR RM PP
Sbjct  224   ALRTKAG-DGSTSKSPILVEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPP  282

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP +  G +   A    +E +D        EL  R  ++ R V                 
Sbjct  283   LPDHSFGNIWRFATATIKEEEDDA------ELHVRACESMREV-----------------  319

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLFLDAING-  531
                  +EL+   D  +   SS  R  +YE DFGWGKP    + ++   + V+ + + +G 
Sbjct  320   -----HELMYKGDVESYRFSSWVRFPFYETDFGWGKPVWACISSVPIKNVVILMSSWSGN  374

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +E W+ L +Q M     D   L +VS
Sbjct  375   GLEAWVTLDEQEMAKFQSDPLLLQFVS  401



>ref|XP_011071305.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=412

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 135/389 (35%), Positives = 204/389 (52%), Gaps = 29/389 (7%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDE  1569
             + +++E+ S+EI++PSSPTPESL+ Y+ SFLDQ+A  + +P V+FY +     +    + 
Sbjct  1     MEIEIEMISQEIIKPSSPTPESLRKYQLSFLDQIAPPIFMPVVYFYQADAKFSNHGKSNN  60

Query  1568  lkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLT  1389
             LKKSLS+ LS  YPLAGR   D + V+CNDEG  ++ A    ++S +L N  +  + +  
Sbjct  61    LKKSLSQVLSRFYPLAGRLV-DNLYVDCNDEGSPYVEAVANCSLSQVLTNPVVKNMDKFL  119

Query  1388  PSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P   +     V    VAVQV  F CGG A+G  +SH IADA +       WA+  R    
Sbjct  120   P---YKVDDDVQNLCVAVQVTFFQCGGTAVGLVISHKIADALSSFLVANTWAAVARHGNY  176

Query  1208  NN--GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
             ++  G  F  D    +FPP  DT+  +      + GI +EE  ++ K F  P + I+ L 
Sbjct  177   DDVPGPKFEGDK---IFPP-RDTAGFKP-----STGILKEE--LVTKIFTFPNSKISAL-  224

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
             Q+    G + +RPSRVEAL+A +W   I+A      P +  T+   VNLR R++PPL   
Sbjct  225   QERYYGGAAQRRPSRVEALSAFIWTRFISAMEMKAHPNKIYTVLHAVNLRPRLDPPLSEY  284

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G +   AI       D G+     EL+Q++R+A RAV      ++      L  +  R
Sbjct  285   HFGNIFRLAIARPTVGADSGS-----ELLQKVREAIRAVNREYVAQLQQGDKHLNFLKER  339

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFG  603
               + ++  +  T   +SLC    Y+ DFG
Sbjct  340   MAQAIKG-ELVTFNFTSLCGYPLYKADFG  367



>ref|XP_002514982.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47536.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 142/437 (32%), Positives = 226/437 (52%), Gaps = 37/437 (8%)
 Frame = -3

Query  1706  PSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkkslsktlsLMYP  1527
             PSSPTP  L+ +K S LDQL+       +  Y   +     D    LK+SLS+TL+  YP
Sbjct  15    PSSPTPNHLRIFKLSLLDQLSPAAYGSMLLVYSINKPSTAIDKSQLLKRSLSETLTRFYP  74

Query  1526  LAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGK-IKQLTPSAKFYE-PQPVG  1353
             LAG+ K D   VECND+G  ++ A V   +S LLE  +  + I+ L P+       +   
Sbjct  75    LAGKIK-DNSAVECNDDGAVYLEAQVDCLLSKLLEKPDDHQVIRNLIPAEHIQSLSETQA  133

Query  1352  KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSDHSS  1173
               L+ VQ   F+CGG+AIG  +SH +ADA  +  F++ WA+   G          +DH +
Sbjct  134   GCLLLVQATFFACGGLAIGVCISHKLADARTVCTFIQGWAAAALG----------TDHEA  183

Query  1172  ILFPPLTDTSAIEQLMKMGAE-GIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQRP  996
             +   P  + S+I     + +E  ++  E+  + KR+V  A+ IA L+        SV+ P
Sbjct  184   VR--PKFNVSSIFPPQNLPSELAVKLNEEKCVTKRYVFHASGIATLKDK--AASESVRHP  239

Query  995   SRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLPPNCLGTLVDE-AIVL  834
             +RVEA+TAL+W   + A+ + +     + L+  VN+R+++ PPL    +G L+   A+  
Sbjct  240   TRVEAVTALIWKCAMKASRSNSKQPKMSVLAQSVNIRKKLVPPLSEYSIGNLMGHFALRA  299

Query  833   CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL--VRNRDS  660
              +   + GT+VT      ++R   +   +   +K+  EG  L+AV     E+  + +  S
Sbjct  300   TENEVELGTLVT------KMRKGIQEFGENYVKKLQ-EGNALKAVFEALKEMGSLLHGGS  352

Query  659   STLY-TSSLCRMAYYEVDFGWGKPRLVVNMLD--NSWVLFLDAING-AVEVWMKLPKQVM  492
             +  Y TSSLCR  +Y +DFGWGKP  VV   D   + +  +DA +G  +E W+ L ++ M
Sbjct  353   TEFYITSSLCRFPFYGIDFGWGKPAWVVPPRDPIKNIISLIDARDGNGIEAWVTLKEEDM  412

Query  491   HTLTQDRHFLAYVSAFP  441
                 +D+  LA  S  P
Sbjct  413   AIFERDQELLAVASLNP  429



>ref|XP_011040773.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like [Populus 
euphratica]
Length=439

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/418 (32%), Positives = 215/418 (51%), Gaps = 39/418 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSG---RACHHTDTID  1572
             MKV++ S++++ PSSPTP +LKN K S  DQLA    +P VF+Y +    R  ++ +   
Sbjct  1     MKVQILSRKLIAPSSPTPPNLKNLKISCFDQLAPPTYVPCVFYYPANGEDRGGNNVERSK  60

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE--NFEIGKIK  1398
             +++KSL++TL+L +PL GR  E+ +++EC+DEG E++ A V+ ++S LLE   F+     
Sbjct  61    KIEKSLAETLALFHPLGGRYIEENLSIECSDEGAEYLEAGVSGSLSQLLEREEFKTEMWS  120

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L P       QP    LV +Q+N F CGG+AIG  V+H IADA  +  F+  WA+  R 
Sbjct  121   RLVPRVL----QPENSPLVTIQINMFECGGLAIGTCVAHRIADAYTVGTFINTWATACR-  175

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                 N     S     LFPP  +   ++++ L+ + A       K ++ K FV     I+
Sbjct  176   IGIENVQCRPSFPFGSLFPPKNIPAITSVDDLISVRA------VKKVVRKSFVFKGETIS  229

Query  1043  QLRQDLTITGGS---VQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRME  888
             +L++  T    +     +P+RVE +T L+W  +I          + +     VN+R +  
Sbjct  230   RLKEIATAFDSNQLLKYQPTRVEVVTGLIWMVLIRVARAIHGHLRPSVFGLTVNMRGKTT  289

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
               +P    G L++  +V+ Q   D  + +   + V R+ DA R+  +  A+   G+  + 
Sbjct  290   LTMPVYACGNLIN--LVIAQFVPDDESKIKLHDCVNRVHDAIRSTVEDCAKASSGDELFS  347

Query  707   RAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDA  540
               +  +  G E  R  +      +S CR+ +YE DFGWGKP         SWV  +DA
Sbjct  348   LMIKKMREGDEAWRKSEIDAYIVNSWCRLPWYETDFGWGKP---------SWVHGVDA  396



>gb|KDO46444.1| hypothetical protein CISIN_1g037811mg [Citrus sinensis]
Length=435

 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 148/468 (32%), Positives = 222/468 (47%), Gaps = 67/468 (14%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVS-GRACHHTD--TID  1572
             M++++ SK I++PSSPTP  LK +K S LDQLA N     + FY    R    T   TI+
Sbjct  1     MQLDIISKNIIKPSSPTPLHLKTHKLSLLDQLAPNNYTSLLLFYDGPSRFDDKTSASTIN  60

Query  1571  ElkkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAEN--MSSLLENFEIG  1407
             +     S     +   YP AG+  +D   V+C+D GV F+ A V  +  MS +L+N E+ 
Sbjct  61    DYHHLKSSLSKTLTLYYPFAGKVLKDNYVVDCDDSGVPFVEARVPSSISMSEVLKNPEMN  120

Query  1406  KIKQL---TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              ++QL    P+ K+          +A+Q+N F+CGG+AIGF   H +ADA+A   F++ W
Sbjct  121   TLQQLLPFNPNKKYL--SSTDDVNMAIQINHFACGGVAIGFNFRHIVADATASIGFIKNW  178

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIE--QEEKDMIVKRFVI  1062
             A  N   ++++ S     H  +     TDT    + +   A  I   Q   + + KRFV 
Sbjct  179   AKLN---SSDDNSIINYKHVVV---DCTDTFPRNKEIPSYARRINEWQRAPECVTKRFVF  232

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-SCMVNLRRRMEP  885
                 +A L++++ +                     +I      T+T+ S  VNLR RM  
Sbjct  233   DGCKVAALKREMIL---------------------LIERNIDSTSTIESIPVNLRNRMNQ  271

Query  884   PLPPNCLGTLVDEAIVLC---QEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             PLP +C+G L     V C    EA DG    +   L + + ++ + V     RKVY +GG
Sbjct  272   PLPEDCIGNLFHS--VTCAANNEAGDGHCDKST--LARNVHESKKMVGGDFVRKVYQDGG  327

Query  713   WLRAVIARGY-----ELVR---NRDSST----LYTSSLCRMAYYEVDFGWGKPRLVVN-M  573
                 V    Y     EL++   N D++        S    + +YE+DFGWGKP  V + M
Sbjct  328   ---VVFVNQYKEAVEELLKDGTNNDTTNSVRLFGFSGPMGLQFYEIDFGWGKPVWVTSAM  384

Query  572   LDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
               ++  + LD  +G  VE W+ LP   M  L QD   L Y S  P P+
Sbjct  385   RMHNTAMLLDTRDGKGVEAWVGLPINDMPKLEQDPGILTYASFTPSPR  432



>gb|KHN36442.1| Vinorine synthase [Glycine soja]
Length=466

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 146/476 (31%), Positives = 233/476 (49%), Gaps = 53/476 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACH-HTDT----  1578
             M+VE+ S + ++PS  TP     Y  S LDQ   ++ +P V FY   ++   + D+    
Sbjct  1     MEVEIISTQCIKPSCTTPNHPNTYNLSILDQFMPSIYIPMVLFYSFAQSSQANIDSTITQ  60

Query  1577  --IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE--NFEI  1410
               + +LK+SLS+ L+  YP AGR K D+ T++CNDEGV +  A V+  ++      NF  
Sbjct  61    QRLKQLKESLSQVLTHFYPFAGRVK-DKFTIDCNDEGVHYTEAKVSCTLAEFFNQPNFS-  118

Query  1409  GKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
               I +L P+    E    G   + VQVN F+CGG+ IG  +SH IAD +  + F+  W S
Sbjct  119   SLIHKLVPNQPIMELATEGYTAM-VQVNCFACGGMVIGTLISHMIADGAGASFFLNSWGS  177

Query  1229  ---FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMK-MGAEGIEQEEKDMIVKRFVI  1062
                F+   A +    F +      FP   +  A       M   G    E  + ++RF+ 
Sbjct  178   NSNFSHQDAFDQFPNFDTP-----FPQNNNNYACPHDTNVMNLCGQFLNEGRVAMRRFLF  232

Query  1061  PANAIAQLR-QDLTITGGSVQRPSRVEALTALVW---AAVINAT-----PTQTATLSCMV  909
              A AI++LR Q  ++T   VQ P+RVE +T+L+    A V NA      PT    ++  V
Sbjct  233   DAEAISRLRAQGSSLT---VQNPTRVEVVTSLLCKCTAKVFNANFGLERPT---LITHAV  286

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARK  732
             N+RRR  P  P +C+G     A+ L   +KD   ++  + +LV ++R+A  ++     + 
Sbjct  287   NMRRRASPMFPKSCMGNFAWLALALIMSSKDNKVIMELLPDLVVKLREAVSSINSDFVKG  346

Query  731   VYGEGGWL------RAVIARGYELVRNRDSSTLYT--SSLCRMAYYEVDFGWGKP---RL  585
               G+ G+       + +I +         S   Y   +S C    Y+VD+GWGKP     
Sbjct  347   FEGDEGYAKYCEVSKELIEKASSFAATTTSGVNYVHFTSWCNFGLYDVDYGWGKPIWVSC  406

Query  584   VVNMLDNSW----VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             V + +D+S     V+ +D  +G  +E W+ L +  M  L QD+  LA+ +  P P+
Sbjct  407   VADSVDDSMFFNAVILMDTPSGNGIECWVYLNEDEMAILQQDKELLAFSTLDPNPQ  462



>ref|XP_007044970.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00802.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=436

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 138/459 (30%), Positives = 211/459 (46%), Gaps = 41/459 (9%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH------  1587
             I MKVE+ S++ ++PSSPTP  LKN++ S LDQL  +     VFFY S  + HH      
Sbjct  2     IKMKVEITSRQTIKPSSPTPYHLKNFRLSLLDQLLPSFYGLIVFFYASTPSTHHQNEDCR  61

Query  1586  TDTIDElkkslsktlsLM---YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
             + + D      S    ++   YP+AGR K D  +++CNDEG  F+ A +   +S  L+  
Sbjct  62    SKSCDRSHILKSSLSKVLTHFYPMAGRLK-DATSIDCNDEGAYFVEARIDCQLSDFLKQP  120

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             ++  +    P+      +      + VQ+  F CGG AI   + H   D S+LA F++ W
Sbjct  121   DMEALNGFLPTTDPETSKAASGCNLLVQLTTFECGGTAISICLLHKNTDVSSLATFLQSW  180

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
              +  R         FV    + L PP  D S +          +     + + KRF   A
Sbjct  181   TAIARDSGEAVSPEFV---GASLLPP-GDLSFMPP--------VNNPSGNFVTKRFKFEA  228

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-----TLSCMVNLRRRM  891
             + IA L+      G  V  PSRVE + AL+    + A+  ++       L   VNLR+R+
Sbjct  229   SKIASLKAK--AAGQFV--PSRVEVVLALILKCSVAASRAKSGLARPIALFQAVNLRKRI  284

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
              PPLP N +G L+    V       G   +   ELV  +R       + +A K  G+ G+
Sbjct  285   VPPLPENSIGNLIWTVPVFL-----GDGEMELNELVTVMRREMTQFCNEKANKFKGDDGF  339

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI  537
             L    +        +D++    +S CR   YE+D+GWGKP  V   ++   + V+ +D  
Sbjct  340   LLITESLKERRELCKDAAVYRCTSWCRFPLYEMDYGWGKPVWVSSASLSFRNIVVLIDTK  399

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL*I  423
             NG  +E W+ L +Q M     D+  L   SA   P + I
Sbjct  400   NGDGIEAWVTLEEQEMSIFECDKELLG--SALLNPSIFI  436



>ref|XP_009763180.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=433

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 141/450 (31%), Positives = 223/450 (50%), Gaps = 40/450 (9%)
 Frame = -3

Query  1739  KVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElkk  1560
             K+E+ S E+++P SPTP  L+ Y+FS LDQ+A+++ +P   FY        +  +  LKK
Sbjct  4     KIEIVSVELIKPLSPTPNHLRCYEFSLLDQMAVDMSVPLALFYPPPLDGGESSRLLLLKK  63

Query  1559  slsktlsLMYPLAGRAKEDRITVECNDEGVEFIVA--------DVAENMSSLLENFEIGK  1404
             SLS+ L+  YP AGR K++  +VECND+GV F  A        DV    + + E F    
Sbjct  64    SLSEILARFYPFAGRIKDN--SVECNDDGVPFYEAFAHNYQLEDVLRKPAYVNERFLPTT  121

Query  1403  IKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +++      F     +   L  VQV  F+CGG+AIG   SH +AD + L   +  W++  
Sbjct  122   VEE----GSFMSDSALYPLL--VQVTLFNCGGMAIGIRASHKVADCATLCTLINAWSTIA  175

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             RG        FV+  +  L PP+           +  + +   +K ++ K     A+ I 
Sbjct  176   RGTIEGVVPEFVA-AAKFLPPPIPHVQPKPMNFDVPKDLV---DKKLVAKFIAFDASTIT  231

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPPN  870
              L+        SVQ PSRVE ++A++W  A V +   T+ + L   VN+R+R+ PPLP +
Sbjct  232   SLKA--KAVSDSVQMPSRVEVVSAVIWKCAMVASGNETRLSKLVHNVNIRKRLVPPLPNH  289

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             C+G +V  A   C+   DG  + T V  ++      +A+ +  ++ V  +     A+ A 
Sbjct  290   CVGNVVTPATA-CKGENDGSDLPTLVTCIR------KALSELSSKYVDFKQNRDEAIFAI  342

Query  689   GYE-----LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN-  534
              Y+       R R    ++ SSLC   +Y+VDFGWGKP  V  +       V+ +D+ + 
Sbjct  343   PYDAAEIFAARFRGEIEIHISSLCTYPFYDVDFGWGKPSWVSLIRSFGVGTVILMDSRDS  402

Query  533   GAVEVWMKLP-KQVMHTLTQDRHFLAYVSA  447
             G V+ W+ L  K  M    Q+   LA+ SA
Sbjct  403   GGVDAWVYLKDKDNMLVFEQELQLLAFGSA  432



>gb|KDP45585.1| hypothetical protein JCGZ_17192 [Jatropha curcas]
Length=447

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 221/457 (48%), Gaps = 41/457 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTIDEl  1566
             M+VE+ SKE ++PSS   +  K YK +F DQL   V  P +FF+ ++    H   T+  L
Sbjct  1     MEVEIISKEFIKPSSSATQHQKPYKLTFFDQLQPAVYFPVIFFFPMNDSKSHINQTLTHL  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             KKSLS+TL+L YPL+GR  +D I +    EG+ FI A  + +MS  L+  E   +    P
Sbjct  61    KKSLSETLNLYYPLSGRPNDDNIFISRFQEGLPFIEAKASCSMSDFLKLHETESLNSFLP  120

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
              + +++   V   L+AVQV++F+CGGIA+G   SH + DA+  + F+  W+S +RG    
Sbjct  121   CSPYHKELAVEIPLLAVQVSKFTCGGIALGCCFSHKLLDAATASNFIASWSSLHRG----  176

Query  1205  NGSGFVS---DHSSILFP-----PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
             + +G +    +  S+ FP     P T  S ++ L    A+G      D I +RFV  A A
Sbjct  177   DPNGVIMPDFEEPSLFFPPKIPIPRTQISLMDTL--CFAKG------DYITRRFVFNAEA  228

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----------PTQTATLSCMVNLR  900
             I  L+            P+R++ L+  +W   + AT           + T+ L   VNLR
Sbjct  229   IDTLKAKAKGNEVDQTEPTRIQTLSCFIWKHCMEATRMLAQSSSSSASNTSVLIESVNLR  288

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +R  P +     G L+  A+ +   A    T     ELV+ + +A    K        G+
Sbjct  289   KRTTPEMKDGSSGNLIWGAVAI---ADPNDTNQELHELVKMLSEAIALFKPDYTESFQGD  345

Query  719   GGW-LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-----VNMLDNSW  558
              G+   +      EL+   +      +S  RM+    DFGWG+P  V     V  L  + 
Sbjct  346   NGFETLSQYFETIELLSMENPEVFVFTSWSRMSLTRPDFGWGEPYWVGVMGKVGDLSRNM  405

Query  557   VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +F+DA +G  +E W+ L  + M  L Q+  FL + S
Sbjct  406   TIFVDAKDGKGIEAWITLDDKRMEILQQNPEFLEFAS  442



>ref|XP_010061156.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW68074.1| hypothetical protein EUGRSUZ_F01758 [Eucalyptus grandis]
Length=449

 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 146/457 (32%), Positives = 223/457 (49%), Gaps = 38/457 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT----I  1575
             M+V V SKE V+P SPTP  LK +K S LDQ      +P V FY    A     T    +
Sbjct  1     MEVVVVSKEFVKPYSPTPNHLKIHKLSLLDQFMPTAYVPLVLFYTIEEADRAATTPLRMV  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
               LK+SLS+TL L YPLAG+   D +++EC+DEGV F+ A     +S LL   +   +++
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLFVEARAEFALSRLLHQPDFKTVRK  120

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P A  +    VG  +  VQV  F CGG+ +G  +SH  AD ++ A F++ WA+  R  
Sbjct  121   FLPCAAAWRRTEVGDRVAMVQVTAFPCGGVVVGVLISHTAADGASFATFLKGWAAAARKT  180

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    F    +  LF  + + +  E+    G   + +       +R V  A+A+A+L+
Sbjct  181   GEAPHPSF---DAPTLF--IQNKAFSEEDTFFGMCPVNRGRYG--TRRLVFDASAMARLK  233

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS------CMVNLRRRMEPPLPP  873
                   G  VQ P+R E +TAL+  + + AT T+ + L         VNLRRR  P    
Sbjct  234   AKTANVG--VQNPTRTEVVTALMCKS-LTATMTKVSGLDKPVVFPNAVNLRRRAVPNFHD  290

Query  872   NCLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARKVYGEGGW--LR  705
             + +G  V    +LCQ E KD   + +   L+  +R+A ++  DGE  + + G+GG+  L+
Sbjct  291   DSMGNYVWLPTILCQLEEKDYDGLPS---LIGWLREA-KSKIDGEFVKSLEGDGGFNALQ  346

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---------NMLDNSWVL  552
               +    E +   D    + SS C   +YE+DFGWG+P  V          N++ N+ +L
Sbjct  347   DALRETRESLARTDRLVSF-SSWCNFGHYEIDFGWGRPAWVSPVGFPEESENLIGNTVLL  405

Query  551   FLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                     VE W+ + ++ +  L QD     Y S  P
Sbjct  406   MDTRCRKGVEAWVFMDERELEVLEQDEELTEYASINP  442



>gb|KCW68080.1| hypothetical protein EUGRSUZ_F01765 [Eucalyptus grandis]
Length=448

 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 145/455 (32%), Positives = 218/455 (48%), Gaps = 35/455 (8%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT----I  1575
             M+V V S+E V+P SPTP  LK +K S LDQ    + +P V FY    A     T    I
Sbjct  1     MEVVVVSREFVKPYSPTPNHLKIHKLSLLDQFVPTLYVPLVLFYTIEEADRAATTPSRMI  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
               LK+SLS+TL L YPLAG+   D +++EC+DEGV  + A     +S LL   +   I++
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLLVEARAEFALSRLLHRPDFETIRK  120

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P A  +    VG  +  VQV  F CGG+ +G  +SHA AD ++ A F++ WA+  R  
Sbjct  121   FLPCAAPWRRVEVGDRVAMVQVTAFPCGGVVVGVLISHAAADGASFATFLKGWAATARKT  180

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    F    +  LF  + + +  E+    G   + +       +R V  A+ +A+L+
Sbjct  181   GEAPRPSF---DAPTLF--IQNKAFSEEDTYFGVCPVNRGRYG--TRRLVFDASTMARLK  233

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-----SCMVNLRRRMEPPLPPN  870
              +    G  VQ P+R E +TAL+  + + AT T+ + L     +  VNLRRR  P    +
Sbjct  234   AETANVG--VQNPTRAEVVTALICKS-LTATMTKVSGLDKVVFTNAVNLRRRAVPNFHDD  290

Query  869   CLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAV  699
              +G  V    +LC  E KD   + +   L+  +R A   +  G  R + G+GG   L+  
Sbjct  291   SMGNYVWLPTILCPLEEKDYDGLPS---LIGWLRQAKSKIDGGFVRGLEGDGGLNALQDA  347

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---------NMLDNSWVLFL  546
             +    E +   D    + SS C   +YE+DFGWG+P  V          N++ N  +L  
Sbjct  348   LGEMRESLARTDRLVTF-SSWCNFGHYEIDFGWGRPAWVSPVGFPEESGNLIMNVVLLLD  406

Query  545   DAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                   VE W+ + +Q +  L QD     Y S  P
Sbjct  407   TRCRKGVEAWVFMDEQELEVLEQDEELTEYASINP  441



>ref|XP_009588476.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=443

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 127/452 (28%), Positives = 218/452 (48%), Gaps = 30/452 (7%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+V++ S E+++PSSPTP  LKN+    LDQL      P + FY +       +    LK
Sbjct  1     MEVKLISTEMIQPSSPTPNHLKNFSLCLLDQLIPASYAPIILFYTNLGDIKVHEKSALLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTPS  1383
             KSL+ TLS  YPLAGR K D ++++CND+GV ++  +V   +   L    +  I Q  P 
Sbjct  61    KSLADTLSRFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCLLIEFLNEPNLESIGQFLPC  119

Query  1382  AKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANN  1203
                ++    G  +  +Q+N F CGGIAIG  ++H I D   L+ F++ WA     C++N 
Sbjct  120   QPPFKELVGGDCVTNIQINVFECGGIAIGLCIAHKILDGVGLSTFLKYWAGL--ACSSNE  177

Query  1202  GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLT  1023
                   +  +  F P  D    +  M M +   ++   + I +RFV  A+AI  L+    
Sbjct  178   VQ--CPNLMANYFFPADDLWLRDTSMTMWSSLFKK--GNFITRRFVFNASAIDNLKT--M  231

Query  1022  ITGGSVQRPSRVEALTALVWAAVINATPTQTAT--------LSCMVNLRRRMEPPLPPNC  867
              T   ++ P++VE +++ +W   I A+  ++ +        L+ +VNLR+R  P LP N 
Sbjct  232   STSSHIKHPTKVEVVSSFIWKCSIAASKEKSCSNKRPSNSLLTHIVNLRKRAAPALPENI  291

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAVIA  693
             LG L    + L          +   +LV ++R + R + D   +++  + G+  +R  + 
Sbjct  292   LGNL----LWLSSAKNTAKHEMGLPDLVNQVRKSIRRIDDHYVKRLRSDEGFNLMRKSLN  347

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV------VNMLDNSWVLFLDAING  531
                +          +T S C+  +Y++DFG+GKP  +       +   N  +L       
Sbjct  348   EIGDFCTKGADHYGFT-SWCKFGFYDIDFGFGKPIWISSISSRCSFFMNLIILMETKCVD  406

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
              +E W+ L ++ M+ L  ++  + + S  P P
Sbjct  407   GIEAWVTLDEEEMNMLVGNQELVVFASIDPSP  438



>ref|XP_004310026.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=429

 Score =   179 bits (453),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 140/444 (32%), Positives = 216/444 (49%), Gaps = 36/444 (8%)
 Frame = -3

Query  1748  ITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH--TDTI  1575
             +  + EV SK I++P+SPTP+ L++Y+FSFLDQ++  V  P + FY          T+  
Sbjct  4     MKFEAEVISKHIIKPASPTPDHLRHYQFSFLDQISPPVYNPLLLFYEFNAKTQPNITEIS  63

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             + LK SL+K LSL YPLAGR K+++  V+CND GV ++ A V   +S +L N   G++ +
Sbjct  64    NHLKTSLAKVLSLYYPLAGRFKDNQ-HVDCNDNGVPYLEAQVNCKLSDVLNNPIPGELNK  122

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P   F       K  + VQ+N F CGG AI   ++H +AD  +   F + WA+   G 
Sbjct  123   LMP---FELDDVASKYPLGVQLNVFQCGGFAIAQCLTHKLADGLSYFTFSKTWAATAGGE  179

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    F+   S+ LFPP   +         G +      ++ + KRFV  A  I +LR
Sbjct  180   PKIAQPQFI---SATLFPPKNLS---------GYDARTGITRNKVTKRFVFSAINIEELR  227

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRMEPPLPPN  870
             +       +   PSRVEAL++ + +  + AT       +   +   VNLR R EPPLP +
Sbjct  228   K--VQANKASAHPSRVEALSSFILSRFVEATKDIGSAEKFYRVVHAVNLRPRFEPPLPHH  285

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G L   A+    +   G       E    IR+    + +   RK+      L ++   
Sbjct  286   SFGNLYRVAMTAPLQISSG-------EPYHGIREEISKIDNAYVRKLQKGDEHLSSIKTY  338

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAI-NGAVEV  519
                  +  +  T+  SS CR   Y+ DFGWG+P  V +  +   + V F+D    G +E 
Sbjct  339   AKSFAKG-EQVTISFSSYCRFPLYDNDFGWGRPTWVGSPALTFKNLVNFMDTREGGGIEA  397

Query  518   WMKLPKQVMHTLTQDRHFLAYVSA  447
             ++ L ++VM     D   LAY+S+
Sbjct  398   YISLEEEVMTKFESDVELLAYMSS  421



>ref|XP_002314550.2| hypothetical protein POPTR_0010s06640g [Populus trichocarpa]
 gb|EEF00721.2| hypothetical protein POPTR_0010s06640g [Populus trichocarpa]
Length=441

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 130/458 (28%), Positives = 221/458 (48%), Gaps = 41/458 (9%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTI  1575
             + + M++E+  +E ++PSSPTP  L++ K S LDQ      +P   FY   R  + TD +
Sbjct  1     MSVPMRIEIMQRETIKPSSPTPLHLRSLKLSLLDQFMPVGHIPLQLFY--PRNGNDTDHL  58

Query  1574  DElkkslsktlsLM-------YPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
              +  +      + +       YP AGR K D  ++EC+D G E+I A +   +S +L+  
Sbjct  59    AKATERSLLLKTSLSEALTHFYPFAGRLK-DNSSIECDDHGAEYIEARIHCILSDILKKP  117

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             +   +KQL P+A   EP     + + VQ + F CGG+AIG  +SH +ADA+ L  F++ W
Sbjct  118   DTEVLKQLMPAA-VSEPATARDSQLIVQASFFDCGGLAIGVNLSHKVADAATLTSFIKCW  176

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQL-MKMGAEGIEQEEKDMIVKRFVIP  1059
             A+  R           S    ++ P     S   Q+ + +    ++  + + ++KRFV  
Sbjct  177   AATARR----------SSTEVVISPVFMGASIFPQMDLPISMLPVDLIQGESVMKRFVFE  226

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRR  894
             A  I  L+        SV  P+RVE++TAL+W   ++A+ +     + A LS  VN+R+R
Sbjct  227   APKITALKA--KAISASVPDPTRVESVTALIWKCAMSASRSNLGVPRKAVLSLGVNIRKR  284

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             + P LP N  G  V       ++  D    +    +V RIR       +  A+   G+  
Sbjct  285   LVPTLPDNYGGNYVGSISARIEDHDD----LELQGIVSRIRKDLIEFGENYAKITQGDDT  340

Query  713   WL---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD---NSWVL  552
              L   +AV   G ++  ++D  +   +S CR   Y+ DFGWGKP  + N+      + + 
Sbjct  341   SLAICKAVEEFG-KMAMSKDIDSYNGTSWCRFELYDADFGWGKPTWLSNVFTIELKNIMC  399

Query  551   FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +D  +G  +E  + L ++ M     ++  L + +A P
Sbjct  400   LMDTRDGDGIEACISLSREDMALFESNKELLEFAAANP  437



>ref|XP_011029622.1| PREDICTED: BAHD acyltransferase At5g47980 [Populus euphratica]
Length=439

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 132/451 (29%), Positives = 212/451 (47%), Gaps = 41/451 (9%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGR----ACHHTDTI  1575
             M VE+ ++E V+PSSPTP+ L+ +   FLDQL      P +  Y S +      H ++ +
Sbjct  1     MAVEIITREAVKPSSPTPDHLREFNLCFLDQLPPVANEPLLLVYSSFQQKFTVAHKSERL  60

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
                           YPLAGR K+D  ++ECND G  F+ A V   +S  LE  +   I++
Sbjct  61    KRSLSETLSR---FYPLAGRIKDD-ASIECNDFGAVFVEARVNCLLSKFLEKPDAEVIRK  116

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P+     P+ +  +LV VQ N F+CGG+AIG  +SH +AD    + F++ WA+     
Sbjct  117   FIPTG-IESPEELTGSLVLVQANFFACGGLAIGVCISHMVADPVTFSTFVKAWAA-----  170

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                  + F S  S+IL  PL +  ++   + +       +E      + KR V  A+ +A
Sbjct  171   -----AAFHSGDSTIL--PLFNAPSVFPPQNISLSKPAALEVMRDRCVTKRVVFDASKVA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPL  879
              L+  +     SV  P+RVEA+TAL+W   +NA  + +     + LS  VNLR +M PPL
Sbjct  224   ALQ--VKAVCESVTCPTRVEAVTALIWKCAMNAARSNSEHLRYSILSQSVNLRNKMVPPL  281

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P + +G L         E +     V    L +++R   +   +   +K+  +   +   
Sbjct  282   PEHTIGNLAGYFASCATECE-----VELQSLARQLRKGLQDFGENYLKKLGKDKASMAIC  336

Query  698   --IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING  531
                     ++   +     ++S CR+ +Y +DFGWGKP  V        +    +DA +G
Sbjct  337   EPFQEAASMLPEGNVDFYVSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKDG  396

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L +  M    +DR  LA  S  P
Sbjct  397   KGIEAWVTLTEDDMAFFERDRELLAAASFDP  427



>gb|KDO53587.1| hypothetical protein CISIN_1g040754mg, partial [Citrus sinensis]
Length=420

 Score =   179 bits (453),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 141/446 (32%), Positives = 211/446 (47%), Gaps = 55/446 (12%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M++   S E ++PSSPTP+  + +K SF+DQL        + FY +G +       + LK
Sbjct  1     MELRFSSIENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASS------ERLK  54

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAE-NMSSLLENFEIGKIKQLTP  1386
             KSLS+TL+  YP AG+ K++   V+C+D GV FI A     +MS +++  +   ++QL P
Sbjct  55    KSLSETLTHFYPFAGQFKDNHF-VDCDDHGVTFIEAHFDRGDMSEVIQQAKTNILEQLIP  113

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
               K +E   V   L+ VQVN F CGG+AIG    H +ADA+  A F++ W    RG  A 
Sbjct  114   -CKPHESTRVEHNLI-VQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARGAGAG  171

Query  1205  NGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
             + + F   + D +SI   P  D   +   + +G          +++ RF       A LR
Sbjct  172   DTNDFKHAIYDSNSIF--PAQDLPDMSVNLGLG----------IVLVRFC------ASLR  213

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVNLRRR  894
             + +      + RPSRVE +++++  A++ A              P    T    VNLR+R
Sbjct  214   EKIVQAEPGLGRPSRVEVVSSVILGALLAAYRGSRDGDEEFTTAPLTHVTAIIAVNLRKR  273

Query  893   MEPPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             M PPLP    G +   A   +      D    +    L  ++  + R V D   RK+Y E
Sbjct  274   MNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRKLYVE  333

Query  719   GGWL---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDNSWV  555
             G  L   +AV A+G      + +     SS C+M +YE DFGWGKP    V      + V
Sbjct  334   GEILNIRKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTEAAV  389

Query  554   LFLDAINGAVEVWMKLPKQVMHTLTQ  477
             L        +E W+ L KQ M    Q
Sbjct  390   LVDGCQTDGIEAWVGLSKQDMARFEQ  415



>ref|XP_004301008.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=439

 Score =   179 bits (454),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 144/454 (32%), Positives = 223/454 (49%), Gaps = 51/454 (11%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             M+VEV S E V PS+PTP  L  ++ SFLDQ A +V + F++FY       H+     LK
Sbjct  1     MEVEVISLETVTPSAPTPHHLPRHQLSFLDQFAPHVYIGFLYFYSLPNTHSHSQISTHLK  60

Query  1562  kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADV-AENMSSLLENFEIGKIKQLTP  1386
             +SLSKTL+  YPLAGR + + + V+CND G+ F  A V + ++S  + N  + ++  L P
Sbjct  61    RSLSKTLTHYYPLAGRVRFN-LFVDCNDHGIPFHQARVKSHSLSDAITNPSLSELNSLLP  119

Query  1385  SAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN  1206
                 ++   + +  + VQ+N F CGG+A+G  VSH +ADA +   F+  WA+     A  
Sbjct  120   ----FKLDELTEIPLGVQLNLFPCGGVAVGVCVSHRLADALSYFTFVRNWAA----TACG  171

Query  1205  NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIE-QEEKDMIVKRFVIPANAIAQLR--  1035
             +    V   ++ +FPP             G  G+   +  D++ KRFV     I  LR  
Sbjct  172   DADVDVDFSAASIFPPKN---------MEGYNGVPIPKRNDVVSKRFVFDGLKIEALRAT  222

Query  1034  --QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA--------TLSCMVNLRRRMEP  885
               + + +     +RPSRVEAL+A +W     A   +          T+  +++LR R EP
Sbjct  223   YEESIRLKMEMKRRPSRVEALSAFLWNRFKAAAAKEEEQSSLRRLYTVVYIMDLRSRFEP  282

Query  884   PLPPNCLGTLVDEAI---VLCQEAKDGGTVVTAVELVQRIRDAF-RAVKDGEARKVYGEG  717
             PL  N  G     A     L    + GG V   +E + +I + + R  +DG    +    
Sbjct  283   PLQQNSFGNYYRAATATPTLVDGEESGGLVREVIEEIDKIDNKYMRKFQDGYKEHL----  338

Query  716   GWLRAVIARGY--ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
              ++R  + R    EL+      TL  SS+CR   YE DFGWGKP  V   +M  ++ ++F
Sbjct  339   DFMRRRMERAAKGELI------TLTFSSVCRFPIYEADFGWGKPVWVNMASMKISNQIIF  392

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +D   G  +E +    ++ M    +D  FL  +S
Sbjct  393   MDTKTGDGIESYFNFKEEDMAKFERDSEFLQLLS  426



>ref|XP_003537018.2| PREDICTED: vinorine synthase-like [Glycine max]
Length=530

 Score =   181 bits (458),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 146/477 (31%), Positives = 233/477 (49%), Gaps = 53/477 (11%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACH-HTDT---  1578
              M+VE+ S + ++PS  TP     Y  S LDQ   ++ +P V FY   ++   + D+   
Sbjct  64    NMEVEIISTQCIKPSCTTPNHPNTYNLSILDQFMPSIYIPMVLFYSFAQSSQANIDSTIT  123

Query  1577  ---IDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLE--NFE  1413
                + +LK+SLS+ L+  YP AGR K D+ T++CNDEGV +  A V+  ++      NF 
Sbjct  124   QQRLKQLKESLSQVLTHFYPFAGRVK-DKFTIDCNDEGVHYTEAKVSCTLAEFFNQPNFS  182

Query  1412  IGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                I +L P+    E    G   + VQVN F+CGG+ IG  +SH IAD +  + F+  W 
Sbjct  183   -SLIHKLVPNQPIMELATEGYTAM-VQVNCFACGGMVIGTLISHMIADGAGASFFLNSWG  240

Query  1232  S---FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMK-MGAEGIEQEEKDMIVKRFV  1065
             S   F+   A +    F +      FP   +  A       M   G    E  + ++RF+
Sbjct  241   SNSNFSHQDAFDQFPNFDTP-----FPQNNNNYACPHDTNVMNLCGQFLNEGRVAMRRFL  295

Query  1064  IPANAIAQLR-QDLTITGGSVQRPSRVEALTALVW---AAVINAT-----PTQTATLSCM  912
               A AI++LR Q  ++T   VQ P+RVE +T+L+    A V NA      PT    ++  
Sbjct  296   FDAEAISRLRAQGSSLT---VQNPTRVEVVTSLLCKCTAKVFNANFGLERPT---LITHA  349

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDGEAR  735
             VN+RRR  P  P +C+G     A+ L   +KD   ++  + +LV ++R+A  ++     +
Sbjct  350   VNMRRRASPMFPKSCMGNFAWLALALIMSSKDNKVIMELLPDLVVKLREAVSSINSDFVK  409

Query  734   KVYGEGGWL------RAVIARGYELVRNRDSSTLYT--SSLCRMAYYEVDFGWGKP---R  588
                G+ G+       + +I +         S   Y   +S C    Y+VD+GWGKP    
Sbjct  410   GFEGDEGYAKYCEVSKELIEKASSFAATTTSGVNYVHFTSWCNFGLYDVDYGWGKPIWVS  469

Query  587   LVVNMLDNSW----VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
              V + +D+S     V+ +D  +G  +E W+ L +  M  L QD+  LA+ +  P P+
Sbjct  470   CVADSVDDSMFFNAVILMDTPSGNGIECWVYLNEDEMAILQQDKELLAFSTLDPNPQ  526



>ref|XP_004310177.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=494

 Score =   180 bits (456),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 146/446 (33%), Positives = 226/446 (51%), Gaps = 39/446 (9%)
 Frame = -3

Query  1745  TMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALN--VRLPFVFFYVSGRACHH-TDTI  1575
             T++VEV SKEI++PSSPTP+ L++Y++SFLDQ +L        +FF  +G+   + T+  
Sbjct  3     TLEVEVISKEIIKPSSPTPDHLRHYRYSFLDQTSLPQIYSSMVLFFQFNGQTQPNITEIS  62

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQ  1395
             + LK SL++ L+L YPLAGRA  D + ++CND+GV F+VA V  N   L +        +
Sbjct  63    NHLKTSLAEVLTLYYPLAGRA-HDNLYIDCNDKGVPFLVAHV--NNCKLSDMLRDPIPDE  119

Query  1394  LTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             LT    F       K    VQ+N F CGG AIG  +SH IAD  ++  F   WA+  R  
Sbjct  120   LTKLVAFELDDVDNKIPFGVQLNVFECGGFAIGQCISHKIADGLSMLMFSRAWAATARRA  179

Query  1214  AANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
               +  +  +     S+ LFP         +L      G+ + +  ++ KRFV  A+ I  
Sbjct  180   HGDQEAEILRPEFISATLFP--------TKLFTQTCIGVAKNK--LVTKRFVFDASNIEY  229

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVI-----NATPTQTATLSCMVNLRRRMEPPLP  876
             LR      G +++RPSRVEAL+A +W+  +     +    +  ++  +VNLR R +PPLP
Sbjct  230   LRA--RYVGTTMKRPSRVEALSAFIWSRFVAISKDDGIHEKFHSVIHVVNLRPRFDPPLP  287

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
              +  G L+  A   C       T      L +++R+A   +  G  +K+ G         
Sbjct  288   LHSFGNLISFA---CSTPSLLNTREECYGLARQVREAICKIDKGYIKKLQGGADHDNMTS  344

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD----NSWVLFLDAI-NG  531
             + G E V      T + + LC+   Y+ DFGWGKP  V   L     N+ V+F++   N 
Sbjct  345   SDGGEKV------TSFFTGLCKFPLYDNDFGWGKPSWVYVRLPGLNFNNLVIFIETKDNN  398

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYV  453
              +E ++   ++V+  L +D  FL  V
Sbjct  399   GIEAYITSAEEVLTKLQRDTEFLQRV  424



>ref|XP_006429944.1| hypothetical protein CICLE_v10011699mg [Citrus clementina]
 gb|ESR43184.1| hypothetical protein CICLE_v10011699mg [Citrus clementina]
Length=453

 Score =   179 bits (454),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 146/451 (32%), Positives = 217/451 (48%), Gaps = 25/451 (6%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-VSGRACHHTDTIDEl  1566
             M++ + S+E+VRPSS     LK ++ S LDQL      P V FY +       T    +L
Sbjct  1     MEIGIVSREVVRPSSLNVHLLKPFRISLLDQLTPTTFAPLVLFYPMKSTHLKGTQISTQL  60

Query  1565  kkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQLTP  1386
             K+SLSKTL   YPLAGR + D + +   DEGV +I   V  ++   L+N  +  + Q  P
Sbjct  61    KESLSKTLEHFYPLAGRVR-DNLIINDYDEGVPYIETRVNTHLFEFLQNPPMELLNQCLP  119

Query  1385  SAKF-YEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
                F Y+P P     VAVQ+N F CGGIA+G   SH I D +  + F+  WA+ +RG   
Sbjct  120   YPPFRYQPNPDRVPQVAVQLNTFDCGGIALGLSFSHKINDGATTSAFLRSWAANSRGACH  179

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
                       +S++FPP  + S    L  M  E I   E     +RFV  A AIA LR +
Sbjct  180   KAVKYKNLSEASMIFPP-QNPSPNHHLSVM--EKIWFREAKYKTRRFVFDAKAIATLRSE  236

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINATPTQTAT---LSCMVNLRRRMEPPLPPNCLGT  858
                 G  V  P+R+EAL+A +  + + A+ +  ++   L   VNLRR  EP L P  +G 
Sbjct  237   --CKGERVPNPTRIEALSAFILKSAMLASRSTASSRFVLHQAVNLRRLTEPRLSPCSVGN  294

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV--IARGY  684
             L   A        +    +    LV R++ A   +     + ++G+ G+ +    I R  
Sbjct  295   LFLWATAAYN--MEHAAEMELHGLVARMKQAVGKINSEYLKTLHGDEGFPKVCEYIKRIE  352

Query  683   ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSW---VLFLDA----IN  534
             E+  +++      SS  +  + EVDFGWG P    +   +  NS+     F +      +
Sbjct  353   EVSAHKNLEAFTFSSWVKFGFNEVDFGWGNPIWSGIFGEVGSNSFRNLTFFKETRSANYD  412

Query  533   GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              AVE W+ L +++M  L  D  FLA+ S  P
Sbjct  413   NAVEAWVTLDEKIMSLLEHDPQFLAFASPNP  443



>ref|XP_006443317.1| hypothetical protein CICLE_v10020331mg [Citrus clementina]
 gb|ESR56557.1| hypothetical protein CICLE_v10020331mg [Citrus clementina]
Length=418

 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 214/449 (48%), Gaps = 55/449 (12%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHH----TDTI  1575
             M++   S EI++PSSPTP+ LK +K S LDQ+A +   P + FY   + C +      T 
Sbjct  1     MEINNVSSEIIKPSSPTPQHLKTHKLSVLDQVAGDSLFPIILFY--PQTCSNNTSLNKTT  58

Query  1574  DElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVAD-VAENMSSLLENFEIGKIK  1398
             D LK+SLS+TL+L +P AGR K D  +++C+D G  FI A   A +MS +++   +  ++
Sbjct  59    DLLKRSLSRTLTLYHPFAGRLK-DEFSIDCDDTGATFIEARAAASDMSEIVKQPTVDMLE  117

Query  1397  QLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL P  K  E   V   L A       CGG+A+    SH IAD +  A F++ W +F  G
Sbjct  118   QLMP-YKLNEKPSVAVNLAAKVTYFEHCGGMALCVCFSHVIADITTAANFIKTWVTFASG  176

Query  1217  CAANNGSGFVSDHS----SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                ++    V  H+    S +FPP   +S    ++   AE + +   +++ KRF+   + 
Sbjct  177   SDTSSEDDDVIKHAVFGCSSIFPPQKFSSFSRNVI---AENLSK-SAEILTKRFIFEGDK  232

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT------QTATLSCMVNLRRRME  888
             IA L++ +     S   P+RVEA++A++   +++               S  VNLR R+ 
Sbjct  233   IAALKEKMGSESSSGYHPTRVEAVSAIILGGIMSVEKEADDFNHSHLVASIAVNLRNRVN  292

Query  887   PPLPPNCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             PP+P   +G +V   I  L  E K     +    L + +  +   + D   RK +    W
Sbjct  293   PPIPEQSIGNIVQAGIAKLPIEKK----TIDYRNLAETLHKSIEKINDEYLRKWFTISAW  348

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAIN  534
                                      CR   YE DFGWGKP  V  ++ +  V + LD+ +
Sbjct  349   -------------------------CRRPLYEADFGWGKPVWVSTVMKHKDVAVLLDSSD  383

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +E W+ LPK+ M    QD   L Y S
Sbjct  384   GKGIEAWVALPKKDMAKFEQDSGILRYAS  412



>ref|XP_008226087.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=455

 Score =   179 bits (454),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 143/465 (31%), Positives = 228/465 (49%), Gaps = 57/465 (12%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDTIDElk  1563
             +KVEV  KE ++PSSPTP  L++   S  DQL   + +P + FY +  +    + ID   
Sbjct  14    IKVEVIRKETIKPSSPTPHHLRSSSLSVFDQLQPEMYIPLLLFYPNNISDDVVNNIDHNS  73

Query  1562  ----------kslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFE  1413
                        SLS+ L+  YP AG   E  +++ CND G  FI + V   +S +LEN +
Sbjct  74    LFAERSKLLKTSLSEALTQFYPFAGEF-EYNVSISCNDHGAGFIESQVNCPISKILENPD  132

Query  1412  IGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                +KQL P+A   +    G  L+ VQVN F CGG+ IG  +SH +ADA  L+ F++ WA
Sbjct  133   FEILKQLLPTAVKSKQSEAGHLLL-VQVNLFECGGLTIGVNISHKVADAFTLSTFIKSWA  191

Query  1232  SFNRGCAANNGSGFVSDH---------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMI  1080
             +   G A+       SD          ++ LFPP    +A + +       +E  + + I
Sbjct  192   TIALGSAST-----ASDQVLLPVEFGVAATLFPPQDVFNAPQPI-------VESIKNNCI  239

Query  1079  VKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSC  915
              KRFV  A+ IA L+        SV  P+RVE ++AL+W   + A+ +     + +  + 
Sbjct  240   TKRFVFDASKIAALKSKAASA--SVPNPTRVEVVSALIWKCALQASKSNLGFRKPSAWNQ  297

Query  914   MVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
             +VN+R+     +  N LG+LV    V+  E+ +    V    LV ++R      K+  A+
Sbjct  298   LVNMRKISGLAMTENILGSLVSLFTVMTVESDE----VKLESLVHKLRKGIEKYKEKYAK  353

Query  734   KVYGEGGWLRAVIARGYELVRN---RDSSTLY-TSSLCRMAYYEVDFGWGKPRL--VVNM  573
                GE       + +  E ++N   +DS   Y  +S CR ++YE DFGWGKP    + ++
Sbjct  354   GFSGED------LIQTMEGLKNLIMKDSIETYGCTSWCRFSFYEADFGWGKPSWMSLCHI  407

Query  572   LDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                +  L +D  +G  +E  + L ++ M  + ++   LAY S  P
Sbjct  408   ESMNTTLLMDTSDGVGIEALLCLEEEHMAIIERNEDLLAYASLNP  452



>ref|XP_007018014.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY15239.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=648

 Score =   182 bits (462),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 146/459 (32%), Positives = 230/459 (50%), Gaps = 44/459 (10%)
 Frame = -3

Query  1742  MKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFYVSGRACHHTDT---ID  1572
             M+VE+ S + ++PSS TP+ LK +K S LDQ   +   P + FY +  +  H +    ++
Sbjct  202   MEVEIISTQHIKPSSLTPQHLKIFKLSLLDQFIPSPYAPIILFYPTDESTSHLEIPRRLE  261

Query  1571  ElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENFEIGKIKQL  1392
              LKKSLS TL+  YPLAG+ + D +++EC+D+G  ++ A V   ++  L   ++  + + 
Sbjct  262   LLKKSLSNTLTSFYPLAGKIRND-LSIECSDQGAYYVEAGVNCRLNEFLNQPDLLFLPRF  320

Query  1391  TPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P     +    G  +  +QVN F CGGIAIG  +SH I D +AL+ F++ W +  RGC 
Sbjct  321   LPREFILDEPTAGTYVTNIQVNMFECGGIAIGICISHKILDGAALSTFLKAWTATARGCK  380

Query  1211  ANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                   F+   ++ LFP     L D+S +    L + G           I +R +   ++
Sbjct  381   EAIYPNFI---ATSLFPTDDLWLRDSSLVMWGSLFRKGKS---------ITRRMIFGTSS  428

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEP  885
             IA L+   TI G   Q P+RVEA++A +W   ++A+  +      + L+ +VNLRRRM  
Sbjct  429   IAALKAQATIPGR--QCPTRVEAVSAFLWKCTMDASKGKNGFQRPSLLTHLVNLRRRMVQ  486

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE--GGW  711
             P   N  G L+   I   +   +  + +   +LV R+R+A   V DG+  K  G+  G  
Sbjct  487   P-TENSTGNLL--WIASAKSKVENKSDLP--DLVGRVREAISRV-DGDFLKKLGDDKGKS  540

Query  710   LRAVIARGY-ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM-LDNS----WVLF  549
             L     R   +LV          SS C+  +YE DFGWGKP  V +  ++NS     ++ 
Sbjct  541   LMCETLREIGDLVSKEGLDHFGFSSWCKFGFYEADFGWGKPAWVSSFGMENSVYMNLIIL  600

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +D   G  +E W+ L +Q M  L +D   L      P P
Sbjct  601   VDTRFGDGIEAWVTLDEQDMAILERDEELLRLAMFDPSP  639



>ref|XP_010092011.1| BAHD acyltransferase [Morus notabilis]
 gb|EXB49715.1| BAHD acyltransferase [Morus notabilis]
Length=439

 Score =   179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 131/457 (29%), Positives = 218/457 (48%), Gaps = 41/457 (9%)
 Frame = -3

Query  1754  LQITMKVEVRSKEIVRPSSPTPESLKNYKFSFLDQLALNVRLPFVFFY-------VSGRA  1596
             ++   K+E+ S++ + P SPT    +N KFS LDQ+        + FY       +   +
Sbjct  1     METKAKIEIISRKAINPFSPTSPQCRNLKFSLLDQIVPPRYTSIILFYTANTNQNIDSSS  60

Query  1595  CHHTDTIDElkkslsktlsLMYPLAGRAKEDRITVECNDEGVEFIVADVAENMSSLLENF  1416
               H++  + L+KSLSKTL   YP AGR K D   +EC+DEG  FI A +   +S  ++  
Sbjct  61    TAHSEISNSLQKSLSKTLVHFYPFAGRLK-DNTCIECSDEGAYFIEARINCQLSEFIKEP  119

Query  1415  EIGKIKQLTPSAKFYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             +   +  L P++     + VG+ ++ +Q+  F CGG A+    SH IADAS++ +F++ W
Sbjct  120   DPNFLSHLLPTSDPKGAELVGRVVLLIQLTVFKCGGTAVSVCASHKIADASSMCEFIKSW  179

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG-IEQEEKDMIVKRFVIP  1059
             A+  R            DH  ++ P     S +        EG +E   +  + KRFV  
Sbjct  180   AAMAR------------DHDEVVHPEFIGASMMRPTTDPSIEGRLEAPGESFVTKRFVFD  227

Query  1058  ANAIAQLRQDLTITGGSVQR--PSRVEALTALVWAAVINATPTQTATLSC-----MVNLR  900
              + +A L+  +   G  V +  P+ VE ++A+     I A  + T  L        VNLR
Sbjct  228   VSKLANLKAKI---GSGVPQLVPTNVELVSAIFLRCAIAACQSTTGCLKPSLLYQTVNLR  284

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              RM PP+P   +G L+    V+ +EA      +   ++V ++R       + +A +  GE
Sbjct  285   TRMVPPVPEAAIGNLIWGFPVVVEEASK----MEVGDIVVKMRKGLIDFCNEKANRFKGE  340

Query  719   GGWLRAVIARGYELVRN--RDSSTLYTSSLCRMAYYEVDFGWGKPR-LVVNMLDNSWVLF  549
              G+  + +   +++  +     +  + SS C+  +YEVDFGWGKP  +   M   + +  
Sbjct  341   DGY--SFVFESFKVGESLKMGMNMYFCSSWCKFPFYEVDFGWGKPTWITCPMYSMNAITL  398

Query  548   LDAINGA-VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +D   G  +E W+ L KQ M     +   LA+ S  P
Sbjct  399   MDTKRGERIEAWVTLEKQEMAMFETNEELLAFASINP  435



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5506453176389